3G71S

Co-crystal structure of bruceantin bound to the large ribosomal subunit
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 19
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3g71S00
2DH9A 5DDRC 2I38A 1YJNS 2LKZA 2GO9A 4WKRA 3NS6A 1X5TA 2KT5A 2MQPA 2BOPA 2DNRA 3CD6S 3BS9A 1X4GA 3V4MA 1ZH5A 3S6EA 2MQMA 2X1AA 1YJWS 1WTBA 4QQBA 2CPZA 4P6QA 3H2UB 2KH9A 2N82B 2YKAA 3FEYB 2CPDA 4PR6A 1YI2S 1U1LA 2ADCA 1N88A 2KXHA 4W92B 2KM8C 4QU7A 1U1RA 4PKDB 4LIRA 2XS5A 2DNOA 1VQLS 2M4MA 2HZCA 2XNRA 1X5OA 1X4BA 2CPIA 2K3KA 3EX7B 1QM9A 2CQ4A 5HL7Q 3L3CA 5DM7Q 3THTA 3P5TL 2AD9A 4V19X 1IQTA 4FXWA 1WI8A 3UCZP 3ZZYA 2J0QD 2CPFA 4A8XA 1X4HA 5LJ5Y 2KU7A 1D9AA 1JJ4A 2D9PA 2OJ3A 1H2TZ 2NZ4A 4BS2A 1SJQA 2X1FA 2K8GA 2L41A 2AYMA 1UW4A 3J7YU 2HGLA 2PEHA 1FT8A 2CQGA 3U1MA 1D8ZA 3U1LA 1QVGR 2RNEA 2U1AA 1VQ8S 1M5PC 2KHCA 5GAHU 2F9DA 2XSFA 2M8DB 2M70A 3CCLS 2D3OR 1KC8T 5GMKa 3VALA 2KVIA 1ZZFA 2N7CA 2HYIB 3SXLA 1JMTA 2X1BA 3CC2S 1UP1A 3G4SS 2MQOA 2OTJS 5LSLA 2DIUA 1SJRA 3EGNA 3CCUS 4WCEQ 3UD4P 1M5VC 2LA6A 3CF5Q 5DETA 3G9CA 4ERDA 2DO0A 4ED5A 2MSTA 1NU4A 3CCSS 2YH0A 1WG5A 2M0GB 3CCJS 2DHGA 5JVHQ 2KYXA 2B0GA 2MQQA 3VF0B 2RT3A 3I55S 3NNCA 2CQPA 3ULHA 1VQMS 2MQNA 2JX2A 2DIVA 1BY9A 1VC0A 3RW7A 3MUVP 3MD3A 2MZTA 2XS7A 1HL6A 2AYEA 1Q7YT 2MZJA 3H2VE 1PGZA 4W90B 1X5PA 5CXTA 2LXUA 5EN1A 2QFJA 2DISA 1KQSR 1WELA 2CQ3A 3CCRS 2G1DA 2XNQA 4UY8T 2ZJRQ 4F25A 4C7QA 1WEZA 5DDQC 2VOOA 2F9JA 4EGLA 2RUGA 5HO4A 2DNHA 3BO4A 2LA4A 3CULA 1U1OA 2DNQA 1M5KC 1N54B 2DGXA 2MQLA 1K8AT 1YIJS 1OIAA 5LJ3Y 3NNHA 1VQKS 2HVZA 1YTYA 2E5JA 1G2EA 3NS5A 4F02A 2JVRA 1VQPS 2DNPA 3RW6A 1FO1A 3BO3A 1VBYA 2MPUA 1PO6A 2LECA 2RQCA 2CPYA 2MYFA 2CPXA 3VAIA 1WF1A 3DLLQ 1VC6A 2FC9A 3CMAS 2YWKA 1DZ5A 2LYVA 1A9NB 2CPEA 1AUDA 2JWNA 2DNGA 3R27A 1X4AA 3IRWP 5MLCV 2MKKA 2YTCA 1U1MA 4OZ1A 1WG1A 2AYBA 1WF0A 1HD1A 3G6ES 2E5GA 2EVZA 2DGOA 2MKHA 3CC4S 1N8RT 2MSSA 1WI6A 2MZSA 3NMRA 2E5IA 1WWHA 1NO8A 2Q79A 2J8AA 1P1TA 3BO2A 2DNZA 1X4DA 3TP2A 2RRBA 3PIPQ 2JVOA 2CQBA 2CQ1A 4TU9A 3G71S 4C4WA 2MGZB 2M7SA 3VAFA 3MUMP 5IM0A 3CPWR 2G0CA 4RU2A 2CQ2A 3CCVS 2J76E 3Q2TC 3MD1A 1R8HA 2OSRA 3G8SA 1VC5A 1A7GE 1WEXA 1VBZA 3MUTP 2OSQA 2DITA 3TYTA 1WHXA 3G96A 2UP1A 1OO0B 1JJHA 1RK8A 1N52B 1U1PA 3SDEA 1WHYA 4LJMA 1P27B 2MKJA 1K9MT 2LMIA 1FJEB 2RS2A 3THPA 1X0FA 1WHWA 3CTRA 5D78A 2J0SD 3J7ZT 1VQ9S 2CQCA 2MZQA 3OW2R 1B7FA 2KG0A 3DXBA 2MMYA 1U2FA 1F9FA 1VQ4S 3VAKA 5DDOC 1FJCA 3CXCR 1VQ5S 1Q86T 3MOJB 4OZ0A 1VQNS 3IWNC 3UWTA 4IOCQ 2DK2A 4YUDA 2D9OA 3B4MA 4CQ1A 5IFMA 2ZJQQ 1K73T 3HI9A 5BJRA 1FJ7A 5LXRA 2DNLA 2MJNA 1S72S 2EK1A 2CQHA 4CH1A 5LSOA 1XN9A 4C0OC 4WFNQ 2DNKA 1M1KT 2MZ1A 4TU8A 1URNA 2XB2D 3SDEB 2KRBA 1WF2A 2KXFA 2SXLA 5LXYA 2MY8A 2DHXA 2KM8B 1YJ9S 2MB0B 1KOHA 1OWXA 1UFWA 2DH7A 1DHMA 4LMZA 3R1HA 1VQOS 1VQ7S 3UD3P 2AYGA 2ADBA 3BEGB 3VAMA 1OPIA 2CPJA 2V94A 4Y00A 1YITS 2VOPA 2MHNA 2VODA 4ZKAA 1HA1A 2DNYA 1YWXA 2KN4A 4TLQA 5IM0B 2L08A 3I56S 1M5OC 3N9UC 2N3LA 4IO9Q 4F26A 2DO4A 3TO8A 5JVGQ 2LQ5A 2WBRA 3S8SA 2DGWA 2O3DA 1U1NA 1SJFA 2FY1A 2DGSA 3FEXB 3VAGA 1X4CA 1DBDA 4CH0S 3VAHA 5FJ4A 2G4BA 1QVFR 1RKJA 2OTLS 2E5HA 5IQQA 4WFAQ 2EK6A 3MDFA 1X5SA 2CJKA 5D77A 3CCMS 1FNXH 4WF9Q 2M52A 3HHNB 3R1LA 2X1GA 5DM6Q 1YHQS 3ZZZA 2OIHA 2QA4S 3LPYA 2MJUA 2RQ4A 1FHTA 2DHSA 3CCES 2KFYA 2KG1A 3JB9k 3LQVA 2GHPA 3EGZA 2MKIA 2DGTA 2LXIA 3VAJA 2A3JA 4WFBQ 2ERRA 2KI2A 3MURP 1VQ6S 1SXLA 1Q82T 3CC7S 1WEYA 2M88A 1HD0A 2BZ2A 2CQ0A 1WG4A 3UE2A 1VBXA 1S79A 2MKCA 4J5OA 4WIIA 1KD1T 2MZRA 3P3DA 3G8TA 1U1KA 1NJIT 3NNAA 2CQIA 4UQTA 3CCQS 2MGZA 3UCUP 5DDPC 2YH1A 5GAEU 1CVJA 3S01A 3US5A 2FC8A 5H1SV 2DNMA 3P6YC 2DGUA 1ZZNA 4PRFA 4YB1P 4QPTA 1JJ2R 4YOEA 3D2WA 4Z2XA 2DGVA 1X4FA 2M9KA 2I2YA 3MXHP 3B4DA 5GVQA 1X4EA 2QEXS 3P49B 1FXLA 1W2BR 4FXVA 1H6KX 4IUFA 3K0JA 2M2BA 2JRSA 1O0PA 2RVJA 2MXYA 2L9WA 2RRAA 3CMES 2RS8A 1WHVA 2MKSA 2NLWA 2FPHX 4M5DB 3MI7X 2U2FA 2M8HA 5CYJA 3PIOQ 5CA5A 3SMZA 5GAGU 2VONA 4CIOA 1SJ3P 2XS2A 4TU7A 2KXNB 3S7RA 2HGNA 1R8PA 1SJ4P 2HGMA 3UCGA 1DRZA 2E44A 2PE8A 2LEAA 2KRRA 1H2UX 2DNNA 2ZJPQ 4QU6A 1M90T 5ITHA 1U6FA 1U6BA 2DHAA 2LEBA 1Q81T 2F3JA 1KOOA 1H2VZ 4IOAQ 4Y0FA 1U1QA 2DH8A 4U67Q 2MY7A 3Q2SC 2CQDA 2FHOB 2DGQA 2CPHA 2DB1A 2RU3A 3CUNA 1L3KA 1UAWA 5GADU 2LCWA 2N3OA
chains in the Genus database with same CATH superfamily
2N4DA 3CJ4A 5DDRC 1YJNS 5HI7A 3KXDA 5KT5A 2IPOB 4DR2J 1R0AB 1IKXA 2WVCA 1QE1B 2YX4A 2DNRA 2GJ2A 1RTHB 1I3OB 1OSCA 1RABB 1RZMA 1VFJA 3I32A 1ZH5A 2XY6A 2MQMA 1U1RA 2Z58B 4NCGB 4M5HA 3NRBA 3RBZA 2R8HA 5E3CA 1AFJA 4QQBA 3ZXWA 2CPZA 3PR5B 3D6TB 1MMDA 1IBLF 3H2UB 2NUUG 4JP8A 3FCVA 4B9LA 2V68A 1HWKA 2E1PA 2JL9A 2YKAA 4RBUA 2NXJA 2RAQA 3R7BB 1V3SA 2IMOA 4PR6A 3DXSX 3M8PA 2XMTA 3OR2A 2W1BA 4CLUA 3OHBA 2AGOA 2R7SA 2ADCA 2OEJA 3FFIA 5ETLA 2EXUA 2KXHA 3Q8SB 3IR5B 4B3MJ 1FE4A 4W92B 4TY8A 1G4CA 1HLWA 1SJ1A 2FB0A 4QU7A 1RWNB 2VBZA 3KG1A 4CM0A 4N8NA 3JYTA 1RHUB 3FMBA 4PPZA 1VQLS 5E0OA 2C3MA 2IVFB 2HZCA 3W61A 3MTJA 2BMBA 5KG4A 4DG1B 1CLFA 4WKYA 2K3KA 1CSJA 2BM1A 5T41A 3JSMB 4NLTA 5E3QA 1QM9A 2CQ4A 4Q43A 2G2OA 3ILOA 3M30B 4IO1A 2YNIA 5DM7Q 1PILA 3RG6A 3D6FB 4TY8B 3M8ZA 2QYCA 3THTA 2VICA 4V19X 2V8DA 1IQTA 4FXWA 4PEOA 1LFWA 4ITSA 4DLEA 4RUBA 4RLEA 4EI2A 1NDPA 2JC1A 1NAQA 3ZZYA 4NMLA 1J27A 2ALYB 2I9SA 2EFPA 3TVZA 5AE3A 4J9LA 3CW2C 5F8MA 2EPIA 2M3DA 1LKZA 1CS4A 1PBAA 1OY6A 2KU7A 4C3LA 1X7VA 2C2DA 1JJ4A 2QLXA 3GPAA 1HWIA 2VBWA 5EGYA 2NZ4A 1AXQA 2ZH1A 2CKWA 2DD8S 4BS2A 1SJQA 2G2ZA 4LRCA 4KJIA 5F8JA 3MPWA 3KNAA 4DR4J 2AYMA 2DCUB 5DO2A 5L38A 2FVRA 5L9NA 2HWHA 2KFZA 3J7YU 2HGLA 1HR0J 2PEHA 2R8GA 1FT8A 2CQGA 2BOAA 1WNEA 1UL3A 3U7JA 1D8ZA 4PXBA 3U1LA 3FSIA 2I5JB 1MMNA 2HAIA 2ZH2A 4DV2F 1JLAB 4FF4A 1HQEB 2ABYA 1TKTA 2GMLA 5JUMA 1M5PC 2KHCA 3RU0A 1U6ZA 2XSFA 2M8DB 2CJYB 2M70A 2XI3A 1XK8A 1ZM9A 5H9EJ 2V34A 4E2FB 4X4NA 4IH6A 2KVIA 4JUZA 1ZZFA 3KK2B 3PEHA 2HK2A 1IKWA 1NPKA 2FHJA 2X1BA 3HXMA 5B0FA 2Y0BB 1V5IB 4YY3F 2MQOA 1CJKA 1FRJA 1R43A 4MJKA 4LR8A 3TJ8A 2XLJA 2C28A 3EXYA 2HQ3A 4WCEQ 2HFZA 5IC4B 2LA6A 5DETA 2XULA 2AMCB 2XGQA 2HEKA 4USVA 5F41A 2GJIA 2DEIA 4I2PA 3GYGA 5I4MA 4ERDA 1B0TA 2WRMA 2DO0A 2HPUA 2FDNA 3TAPA 1U0HA 4V19J 4LBIA 2FIUA 3CEDA 2YH0A 1KBRA 3CCJS 1N36J 3PJ9A 3PTWA 4NI2B 4WIQA 1NSQA 4OL8A 5H9FK 2HQGA 3ENAA 4QIVA 3KK1B 3J7AN 1TVRB 2QMXA 4M5IA 4ZVSB 5A8RB 2QA1A 3IG1B 4JI3F 2KYXA 1NZ8A 3HT0A 4U7CA 4W4MA 4UZBA 1HHTP 4FXDA 1P8GA 1URRA 1ICEB 4WU3A 1YZ7A 3RBXA 4ALZA 2JHEA 4DV0J 4N7TA 3IMQJ 4ZN1A 3MMCB 1XNRF 4OZ5A 1BY9A 2H5EA 3ZTPA 4EO8A 3KK1A 1BQMA 4TVAB 3DYAA 2BKOA 4IG0A 3PZPA 3PW0A 3IS9A 1PAUB 3GSDA 1B3TA 2AYEA 3IC1A 3DRPA 2RF2B 5AJ3F 3V4IB 2CNKB 2Z2LA 3BN4A 3F41A 3ILIA 2HNDB 5T7LA 5F3ZA 5CXTA 4B3RF 2RRNA 2LXUA 3PJXA 4OZ2A 2RDDA 2DISA 2QLFB 1HI0P 4KHPJ 3W9JA 2VD3A 2W01A 2E5LJ 2WONB 3CDBA 3UO0A 1JNZB 4NLDA 3H5UA 2W24A 2WB1D 1JLQB 1FNMA 1VLOA 3T19A 4F25A 3OL9A 5J2NA 4C7QA 3NCQA 4FDFA 2IM2A 4DN0A 2F9JA 3NEKA 3J81U 1EB0A 2MLXA 3I9V9 4EGLA 2RF2A 1TTHB 3HSGA 4UUXA 2AZ1A 1RWUA 3LP0A 2K3IA 3ONQA 3BSCA 5JXSA 1LV5A 2ZM6J 1AZSA 4RWXA 1XBWA 1UTAA 5E3AA 2AGQA 2HQCA 4NXMJ 2ILZA 5CH7B 1AYEA 5KT4A 1M5KC 2DGXA 2MQLA 3B6BA 4W98A 2J6TA 4JI7F 4RKUC 1EQ0A 1FDNA 1TMMA 4R8UA 3RZAA 5LJ3Y 2GQCA 2FJWA 3NNHA 3SZ2A 2J5AA 3BREA 4M94A 2E5JA 1G2EA 3NS5A 2X7IA 4X64F 2OD4A 2JVRA 3H42A 3POTB 4G1QB 5E3PA 1FO1A 3J7YI 4CT9A 3FZ2A 4C11B 3TX8A 5J2PA 2V67A 3M32A 2YNHA 3PR4A 2K2PA 4DFPA 1VBYA 1HNIA 3U1NA 4EMDA 2MYFA 3QO9A 1KDNA 1RKIA 2W4DA 4ZPWR 3CJ3A 3V4IA 2CPXA 4MKAA 2V69A 3M8PB 1H7XA 1WF1A 2QIFA 3OR2B 4DX8H 4R8UB 5ETTA 3VAIA 2EFOA 4U7UD 4HACA 2FC9A 4ZK7M 1NUEA 4NLVA 3HP6A 1KP6A 3NGSA 3W8PA 4RNNA 2QA4G 4J9MA 3NAIA 2R7OA 5DLFA 4B9TA 4Q7AA 1S6UA 2IAJB 2CPEA 2W8LA 5GMDA 1RU1A 3R27A 3M2VA 2AHOB 1OYDA 1WC1A 2OELA 2V9KA 3BN7A 4KQZA 4PG8A 4R5PA 4IOBA 2VU5A 2ZH7A 1U1MA 1IR2A 4OZ1A 3KKFA 2ZZTA 5FIIA 1T7PA 4NE9C 3MAQA 1HI8A 1MG7A 3TOQA 1UVNA 1HD1A 2BACA 2YNIB 2BW7A 2E7WA 4FVMA 4X62F 4Q5VA 1RAFB 1YLXA 2ZH3A 3HHLB 1RT6B 4K4WA 1FX2A 1WDTA 4I6AA 5KFDA 3C8YA 2XWYA 2DVIA 1WWHA 2Q79A 4WFAQ 4XDCA 4I1TA 3BO2A 2E9TA 3NMAA 1X4DA 4NPOA 4OHVA 4PXCA 2JVOA 2CQBA 3SQOP 3T9NA 2P9EA 4TU9A 4DL4A 4USKA 3HMJG 1KSPA 1SQEA 2QTWA 4UF4A 4EWTA 3D54A 2KFNA 1TKXB 1Q4RA 1VK8A 4RU2A 2CQ2A 5IV4A 3CCVS 2J76E 3KHLA 4A8WA 5DG9A 4OZ3A 2R3VA 2V4QA 4HACB 2NXNA 4P2SA 5DJBA 1VR6A 3AH6A 2ZWPA 1UKUA 2MDAA 4GO5X 4HDHA 1VBZA 4WE1A 1VLYA 4RZRA 2FJXA 3G96A 3KHRA 5A8KA 2GCFA 1XMOJ 3G2XA 2Q3PA 4ED7A 1UPPA 3H20A 1N52B 1U1PA 1S49A 1X0PA 2HMIA 1HQUA 1P27B 3I0SA 4LJMA 2JFDA 2MLZA 4M5DA 1U0SA 2P5VA 2B9YA 3THPA 3OQ2A 4KC5A 2RU9A 5D0EA 3CTRA 4KPCA 2V8HA 2IFXA 1IBMF 3KUHA 1F0XA 4ZN3A 2BDPA 2ZKTA 2J0SD 3EGWB 2CQCA 3OW2R 3W60A 3NGUA 3BB5A 1IN0A 3C14B 2UVWA 3T3FA 2QSFA 1NDKA 4NEYA 1VQSA 3IBFB 1NPRA 1F9FA 1TL7A 2Z57B 4JI6F 1HBMB 4KGXB 3VR1A 3CJTA 3ZTRA 4Z7CA 5DDOC 4ZPCA 4DU7A 2OMLA 3W63A 1R8AA 2J9EA 2UV8A 2D3UA 2WVDA 4GO7X 1TVRA 4CLPA 1SL2A 3R97A 1UCNA 2AJQA 4LFBJ 2VV5A 3W65A 1VQ5S 4X84A 4OZ0A 3SV4A 3NL0A 4ZPBA 5I3QA 1CG2A 2BJ1A 1VQNS 4DUTA 3IWNC 4X2BA 2V5HG 3EDQB 4WTOB 5KAKA 3EPIA 1F9EB 2DEJA 3M8YA 4ZP9A 3GJRB 2P6TA 4OYXA 1PIEA 1FE0A 5IFMA 1FDBA 5I42B 2VFVA 1YJRA 3TZZA 4ER8A 1Y3JA 2QMWA 2HVHA 3KFWX 1FJ7A 2GW8A 3ISND 1X8DA 3G6XA 4ZOSA 5AXLA 3CE8A 1S72S 1TFWA 3KLHA 2CQHA 2YWWA 2KO1A 1GFWB 2D3O1 2H5IB 5J1PA 4JI5F 5L8RC 3H0PA 3GE9A 1YX2A 2OLWA 3OTCA 1XR6A 5K8PA 5DLGA 1WKLA 1MU2A 2KRBA 4KHRA 1ZAWA 4NZ6A 4Z7YA 1TR0A 2KXFA 5IOLA 4DDFA 4RL1A 4PG7A 2DHXA 4XK8C 2QG9B 3MMAB 3L7UA 4KBIA 1OWXA 3T41A 3TANA 1FRKA 2KT2A 3AD8C 4WFXA 3R1HA 5HROA 1RYSA 4R25A 1N33J 4JI6J 3RR7A 2DBBA 2CJBA 3MMBB 2XYPB 1YJTA 4DV6J 2KZMA 3UD3P 1FDDA 2VQEF 3L09A 3PX0A 2ADBA 1KTQA 1NK8A 3Q24A 1OPIA 4QJVA 4D3HA 4YR2A 1N34J 4F3OA 2HS0A 1YITS 2BKPA 1FTCA 5D8HB 1RAOA 1T94A 2MHNA 2ASYA 2BUNA 2XM3A 4CWBA 4EBCA 1XMQF 1HA1A 1SH3A 3N28A 3PFEA 3T5HA 4ECXA 3K5PA 2MKYA 2L08A 4K4ZA 4YMEA 1F5AA 3I56S 3PRBA 4IO9Q 3SSRA 1Y10A 2UUAJ 2JSXA 3QLHA 3TO8A 5EWFA 3S8SA 5JVGQ 1LQ9A 4C0BA 2B5JA 2HNDA 5T7LB 3RBDA 1ZTWA 1H3DA 3M6VA 1RJJA 2DGSA 4Z37A 1J5EF 1XQIA 4KE5A 1D1UA 2H51B 2ZH4A 4ZDNA 2HQFA 1U2RA 1FFSB 1ZS6A 2I1RA 5KFRA 5KTQA 4CH0S 1SH0A 2G4BA 2ZOFA 3THVA 1JLBB 1N4LA 3D4JA 2RHQB 2XLIA 5AXNA 4OI2A 3D3BJ 4I7FA 4AD6A 5AT1B 1UJ5A 1Y5IB 2E5HA 1HWLA 3IM8A 4B17A 4LBHA 4A46A 2BR0A 3M1VA 2AEFA 1N32F 2CVEA 2OGUA 4RPFA 5IQQA 3VWSA 2EK6A 5A8WB 2KTQA 1I51B 3OL8A 1CJVA 3CJKB 4DU8A 1X5SA 2DR8A 5LL6d 4P7TA 3BBCA 4WF9Q 2M52A 3BDPA 4CNZA 3LA0A 2E1AA 3PACA 2OIHA 4KFBA 1VIOA 3QRPA 2VG7A 2CA9A 2MJUA 3I96A 3OR1A 3OFHA 4QR0A 1GQEA 3FBCA 2PA8D 2H4YB 1LW2B 2YVSA 4BC7A 4DR1J 4UOCA 1NM2A 4X4QA 2W9BB 4JI4J 1T95A 3R6LB 4JI0F 2KG1A 3MR3A 3QSYB 4LSZB 1U09A 1GX5A 2RKIA 4ZIVA 3DCAA 2VIHA 2QFIA 3MM9A 2CWXA 1KVIA 3DHWC 4O3OA 2YPZA 2RIJA 3DOLA 5KG2A 5C24B 2OPQA 3I4PA 3VAJA 2XQCA 3ZTSA 4NLUA 1Z2ZA 4U8VA 3TUZC 2YPYA 4DSLA 2B5JB 2L9DA 1YDLA 4N8OA 1HD0A 2CQ0A 1L3SA 1MSWD 2B7CB 4FZVA 1S79A 3NGTA 3G8TA 4IRKA 3OSNA 1RWVB 4U96A 1J2VA 2MGZA 3UCUP 3D66A 2PEBA 3WHIA 3WDOA 4XPCA 2IVYA 2V4RA 2R9LA 1S77D 2Z56B 5THWA 3JSYA 4C9DA 4QYZJ 3WIUA 1JJ2R 1EP4A 4YOEA 4EU0A 4Z2XA 1Q1KA 1E6VA 3I9ZA 4OHWA 2LEPA 3N5BA 2PDAA 3B4DA 4Y65A 4B3OB 4IR1A 3R2DJ 1RTJA 3BGRB 3ELHA 2BYCA 1SIWB 1RE1B 5GVQA 5L39A 3IO1A 4RWWA 2B4OA 1OQ6A 3O3LA 3WIVA 1H6KX 3GU0A 2ZKUA 4F4AA 2WAQD 4HHJA 4JI7J 2F4FA 4LRFA 4NLOA 3DNCA 2NXCA 3GWCA 3PO4A 1CJTB 1Q95G 2L9WA 2RRAA 4J9VA 3DRSA 3ETOA 2GVDB 1MWZA 1PAEX 2IY5B 2OEKA 1Q5YA 3ISNC 4OYMA 2EFVA 4F4KA 4M5DB 4FYDA 2U2FA 3O2IA 4A8QA 2M8HA 5CYJA 1VRUA 1HBOB 5CA5A 4ZVUB 2L3MA 5MAOA 3SMZA 1JLAA 1GMUA 5LXYA 2VG5A 2HWTA 3NKYA 3BPDA 3SIPB 3PDNA 1RA7A 4TU7A 1CC7A 3M4XA 1R8PA 2HGMA 1K1QA 2KB2A 2GNKA 2OPSA 1NPPA 1VRQC 4DJBA 4QWDA 1KRPA 1TL7B 1HW9A 1Q8BA 2NQPA 2MLYA 4WU2A 2EBEA 2LEAA 2PE8A 3CD5A 3F56A 4USHA 6FD1A 2V0NA 2DNNA 3GQCA 4K2JA 2ZJPQ 2H48B 4AQYF 4PQAA 4NLYA 2K1RB 4DUZF 3W3SA 4IFVA 1TAUA 2WVEA 3Q8VA 1NSPA 2LEBA 3HHLC 2GVZA 5C7PA 4C48A 1HBUA 2BJEA 4DS4A 2B9EA 2BA9A 2JJ4D 1XNRJ 3DGVA 2ZFHA 2DH8A 2ZUAA 3DLJA 5K5MA 3OJUA 2IRXA 4N77A 1KQGB 1F3VA 2MY7A 2XYHB 3NGRA 3QFWA 5A0YB 3Q2SC 1NKEA 4OX6A 1KQFB 1DLOA 3CB4A 4IQMA 3PEJA 4Y2IA 4DSEA 1L3VA 3D7SB 1F5BA 2VG6B 2F8MA 3HSJA 1HPZB 4M63A 4RJVA 2ZBPA 1PYTA 2DB1A 3K7RA 3JAMY 4JI3J 1L3KA 5KFYA 3IG1A 2ZH9A 2J7WA 2CNLB 1WDDA 3BJYA 2CJ9A 2BQ3A 2HHXA 1TK0A 3VQSA 4XDDA 2ZNYA 4L3NA 4C8OA 2BBEA 1X5TA 3C6TB 3K5MA 3R7NB 4OX9F 1X4GA 3V4MA 3OFFA 2B51A 2Z2YB 1Y00A 3CVKA 4WK1A 4GC6A 4ZJLA 1YJWS 4DR6J 4OJ1A 2LECA 1FXDA 1NCLA 3S1TA 2JEGA 2AX1A 5E5NA 1WTBA 4DX6A 2G0IA 4LF9J 2UXBJ 1RHKB 1UPMB 2LFVA 3RTVA 4GVLA 4LREA 5B0GA 1S1XA 2KH9A 1NDLA 1F3FA 3IR7B 5D15A 2I6WA 1OSDA 3ADAC 1BD6A 4U7UK 1TKDA 4O3QA 5KG5A 3JSBA 4IFVB 2CPDA 4HHUA 1YI2S 1H7WA 1PC4A 2VFRA 1JLCB 3DRYA 3JSRA 2VB6A 1WOSA 4H54A 3T6JA 3GZ7A 3RAXA 1ZPWX 2QT7A 3SQGB 3WBZA 1NK5A 1R3NA 1RT3A 1SCJB 2Y0SD 2RDIA 2VF3A 3TA1A 2HSEB 2KM8C 4O44A 4DV5F 3D67A 3W2WA 1S0NA 1DLOB 3FEZA 3NLCA 2XS5A 2DNOA 4OI0A 1C4AA 3ZZOA 4DPWA 1KHWA 3DYAB 3CJ5A 1X4BA 2CDRB 4PG6A 3M1VB 2NCKL 5M2RA 1EX8A 3TEGA 1B64A 3QIPB 1AW0A 4QWAA 1UWBA 3KLFA 1AB8A 2GHVC 2UUTA 4I2QB 3EX7B 2CVIA 4Y2AA 4YP3A 3VVTA 1NK7A 1KR4A 2HHUA 3WZ0A 2W2QP 3OUYA 3U02A 1FRXA 3OL6A 2AIRB 3K17A 2AD9A 4B3TF 5K8NA 2R8IA 1WI8A 1YKWA 3UCZP 4IRCA 1FVQA 2VFSA 1OYEA 2HWIA 1GNKA 1BHNA 1O51A 3NCRA 4EZ6A 4Q0BB 1DJ0A 5FLXY 2EG1A 2J9DE 2JZ5A 3BSOA 1T0TV 1RU2A 4HHHA 5C2GA 3W2VA 1IUJA 3MWBA 2K8GA 1NNDA 1RWPB 2P6SA 1RWXB 4LF2A 3PYFA 1UW4A 1S48A 5FD1A 4P52A 4FS2A 3E8OA 3MECA 4LF6F 2J9CA 2YX7A 3BV8A 4JBCA 4KAIA 2PFFB 3D1OA 2AGPA 2YXLA 2U1AA 3TVKA 4X4UA 4I2PB 2F9DA 5B09A 1F5CA 4K8RA 2ASLA 2D3OR 2VA3A 3IWLA 4KHPF 4GKKF 3VALA 4RW6A 2BJ3A 2FY8A 4B9UA 4DWIA 2LQ9A 3D1QA 3RGIA 2N7CA 3SXLA 1JMTA 2YNHB 3I31A 3SCKE 3G4SS 2C2EA 4LF5J 2OTJS 3CIMA 2DIUA 4MIWA 1UWBB 3KLFB 3ZC4A 3QWPA 4ED2A 4NX9A 1HYSB 4NLPA 2I5JA 1U7LA 3NWGA 4NZ7A 1TELA 1YRXA 3D9BA 3BYPA 3FZBA 3KG0A 4DPXA 3G9CA 1EETA 4DQSA 4F50A 2IAJA 1HNWF 4LRBA 2KHDA 4ZCKA 2RE1A 3D68A 4C98A 2ZH8A 1NJZA 1WG5A 3CDAA 2M0GB 2HFNA 2QN6B 4IG0B 2DHGA 3I5BA 1UEVA 4IYQA 5FLXU 3RB3A 1HNVB 3MFIA 3UDLA 3Q89A 2XMJA 3FKBA 5A8WA 4DR7J 2VL1A 4JI2J 4NXMF 2B9XA 2F65A 2PMHA 3PFOA 4G65A 4HTIA 4DF4A 5BR8J 4YB6A 1S1TB 3O6QA 3PRDA 3C46A 3HVRA 2B0GA 2NREA 1YRTA 3VF0B 2XC9A 3MEGB 1Y5NB 2D7SA 1LWCB 2Q43A 2CQPA 1EKRA 3GONA 4TYBA 2ZITA 4FPRA 1HWUA 4HVZA 3ULHA 5DGAA 2JX2A 2DIVA 4KT0C 5D0HA 5F8LA 1FNOA 4B3TJ 4OX8A 1QAXA 2O1PA 3TUJC 3RW7A 3MD3A 1QAYA 4NI2A 2MZTA 2XS7A 3I0SB 4DV3F 4MK7A 1UVKA 2CZVC 3MR5A 1HL6A 2WOMA 3CJ8A 4OMFG 3K2YA 4TXSA 4G6VB 3DKDA 1Q7YT 4W90B 4QYRA 2CUYA 1RT2A 1A0OB 2PMWA 4X66F 3DRRB 2GGPA 1QLNA 1C2PA 3AQPA 4CM2A 1F6TA 3TNVA 2XMWA 5EN1A 5KT7A 1WELA 2OD6A 3LAMA 1ZAXA 1IR1A 2M5YA 3BZQA 2G13A 2G1DA 3CCRS 4WP8A 4R0EA 4QR1A 4J9KA 2IC3A 4ED4A 1SC3B 3C16A 3DI6B 3D6MB 2A2DA 4ILMA 3ENVA 1W2IA 3PJWA 2GAHC 4ZVEA 4CRJA 1Q0NA 2E7XA 1N5YA 2AZ3A 1GH8A 3A4TA 4FPIA 5CQGA 3ZTQA 2KYZA 5J2QB 3CCWA 5D3GA 3AD9C 2HURA 1KVJA 4USWA 3VZIA 5HVHA 2GGPB 2LA4A 4CDIA 3BO4A 4LFCF 1UVJA 3FBEA 1U1OA 9RUBA 3SSQA 2DNQA 1VHFA 2NYIA 2BJ9A 3MEKA 2GIFA 2QL7B 4ZVOB 1K8AT 1XEZA 2JEIA 2Z2ZA 1FWLA 5H9FJ 4LF9F 1BC6A 3ITHA 1NK9A 1VQKS 4J9RA 2HVZA 2JLEA 1YTYA 1NH7A 1NSKL 3M2RB 1LXJA 2DR6A 2IM3A 3IRXB 1N0UA 1QY7A 1WC5A 2DNPA 3HKWA 3N0VA 4LSLA 4O23A 3M8SA 3BQ2A 1UFLA 2CJAA 2HHTA 1S0OA 1RDRA 2MPUA 4GVBB 2C2NA 3MCSA 4DXLA 4ENOA 5EX0A 1MROB 4MYUA 4JV0A 4DUYF 1E6YA 4KV8B 4Q8FA 5A6WA 2BJ7A 3OTOJ 4K4UA 6AT1B 2UVUA 2FZKB 3Q8QB 3GFXA 2HFOA 4ZA1A 1VC6A 4NA3A 2DRAA 1M1HA 3CMAS 3IM9A 3MPYA 2BE9B 2X51A 3QAEA 4MK8A 4F67A 5A76A 1PYOB 1DZ5A 5HJXA 5CD4A 1A9NB 1FEHA 3DMJA 1B4SA 1RQ0A 4FYWB 1T3NA 5SZTA 1X4AA 5L1JA 4PQUB 3E51A 3ICLA 1QD1A 4C11A 4I68A 5J2PB 1BQNA 2YTCA 4DZ6A 1NB2A 2Z8QA 3OJSA 1R0BG 2YWGA 2W4PA 2HS4A 4E98A 1QJHA 2W7AA 4F0KA 1C0TA 1WF0A 1J5OB 4AQYJ 2AYBA 2C1EB 3VGTA 4OI3A 1V5VA 3R5JB 4NMXA 3KUGA 4NCAA 1JWWA 1U4BA 3DLBA 5CCLA 2EVZA 2DGOA 3CMQA 4PWUA 3BSAA 3BKUA 3OLAA 2HNZB 3CC4S 1N8RT 3HDSA 3IGNA 1NKCA 4LFAF 1WI6A 4F4ZA 1RBLA 3V81B 4ZLJA 1C1CA 2HRTA 3MMCA 5ADZA 3GIJA 3BKFA 2IVMA 1NO8A 1RWOB 1WSRA 1LW0A 2Y1JA 1P1TA 1SKSA 1LXNA 1S9EB 2YQ0A 3N4WA 3TP2A 5IQ6A 3I0RB 2XSJA 4RW4B 2CQ1A 3MPVA 4BCAA 3PIPQ 4G1PA 4DR5F 2DR9A 2M7SA 3Q8UA 1IM6A 1JLGA 2QSWA 3C6UB 4F8RA 5HQLA 4RR5A 3K58A 3MUMP 2HQDA 4U9RA 2G0CA 3J80U 1Y5LB 2D74B 2DKOB 2J7KA 1MMLA 1IKXB 1D8YA 3Q2TC 2VUGA 3KUEA 5AE1A 3QZ7A 2OI2A 2IMWP 1DAXA 1NJXA 3G8SA 1C1CB 1YJUA 5KFQA 4DSFA 1TK5A 1K0TA 4ECRA 2ZC4A 4K4TA 2VJUA 2ROPA 2UVVA 3I5CA 3BBFA 2MEWA 2X3DA 3DMJB 3FQKA 4X4VA 3TYTA 2JFKA 3NAHA 4PQUA 1N48A 2ZDPA 2IIHA 4B9SA 3R5AA 2R2RA 2DR7A 1JJHA 4ZLLA 1RT7B 1RK8A 3D0HE 3QGIA 1SC1B 1WJ9A 4BWJA 4DPUA 4QPXA 1D9DA 1S1WA 1Q7LB 3AD7C 1RGVA 2MKJA 1TL3A 2LQJA 1TV6B 3GG0A 3OFEA 4ED0A 2YKPA 5DG7A 2RS2A 1S97A 1X0FA 3NP5A 4ID8A 2NSCA 4K5RA 4PYAA 5ETKA 4ZCLA 3T1YJ 5KFZA 5HQ8A 1H73A 2VFTA 1M0SA 4KGZB 4ZP7A 3ILJA 5SUHA 1LWFA 3KLIA 3IBWA 4M5GA 5HVGA 1B7FA 3ZTOA 1F9HA 3DXBA 2MMYA 4URSA 5I3PA 1U2FA 3G82B 1BWEA 4FBUA 2ATCB 3M8QB 1VQ4S 4EBDA 3TARA 3K5LA 5LMUF 4M8LA 3A1YG 2POKA 4S0MA 5L1IA 1UZDA 2J0XA 4H4KA 1XWLA 4DG1A 4DV1J 1VHIA 5D4LA 4BC9A 1XTZA 2E9RX 1IJEB 4ECSA 3OUYB 3CDEA 3O5TB 1WACA 2C3PA 4H4MA 1AZSB 3N5FA 2D9OA 3GCXP 3P45B 4L72B 3FUYA 5I3UB 3AJDA 3LP2A 4JI4F 4CT8A 2ACYA 1LWFB 2D69A 2Y1RI 3B4MA 3KLIB 3BR9A 3OTDA 1RUSA 4HH1A 4HYKA 5KFJA 1K73T 4DQIA 1WOPA 2JC0A 2B9WA 4Q0BA 2E9ZA 3C14A 4RX6A 3SFUA 5KFCA 2MHEA 3UW1A 4AL7A 2R2TA 2ZWOA 3MM5A 1H74A 3H5SA 4X66J 7FD1A 2HIYA 3LUYA 4YS2A 5LSOA 4CH1A 1XN9A 4DL6A 5CCMA 4WFNQ 4ANEA 4OV1A 4M5KA 1JJCB 5C2CA 4FN5A 1F1BB 3MEEB 4FYVB 2XG8A 3PYEA 2R8KA 3TW0A 2SXLA 2B8PA 1TL3B 3RB0A 1G1XA 2KM8B 4Y34A 1YJ9S 3DLKA 2FLPA 2DH7A 3N79A 3FDSA 1ZYQA 3T5LA 2H9ZA 1TMJA 5LMNF 4Q45A 1HQEA 1RHJB 3BEGB 3MCNA 1NEEA 2AW0A 2ZBQA 3LOUA 2V94A 3TA2A 3TZYA 4CO5A 5GAGI 4RNOA 2BQUA 2VOPA 5K14B 3G6YA 2HFUA 2VODA 3P96A 4ZKAA 4XPEA 2AJ1A 1S12A 5C42A 4OX7A 2KN4A 1FFGB 1VRTA 2CWKA 4AXJA 5IM0B 3DRSB 4ZPDA 2GVZB 3NBPA 2QL9B 2EW9A 1CJVB 4LF4F 1NHKL 4PG4A 1QUPA 3PW4A 3H4BA 1HNWJ 4YR0A 2LQ5A 3L7OA 2WSEC 1HBOA 4NOHA 2DGWA 4DCOB 2O3DA 2W25A 4I6WA 5F9NA 1U1NA 3HFKA 1SJFA 4ED3A 3W5ZA 3BH6B 3FEXB 4PG5A 3VAGA 2QLWA 2C3YA 3AOBA 2ZD1A 3P8BB 1YVFA 5J1EB 3EZ5A 2VQEJ 1JXEA 4CYUA 1EKSA 2VG6A 3R9LA 2QE5A 3MCOA 2IC3B 1G6BA 2VH7A 4CLLA 1U0HB 1UVIA 1B99A 1RKJA 1FEEA 2NR0A 2OTLS 2FJDB 1HNZF 4F0MA 3QQCD 5A2QY 1CJUB 4JV5F 2EC2A 2IRYA 1Z2LA 2LQBA 3MR7A 5D3GB 2HZVA 2PI5A 1SC4B 5L1KA 4GKKJ 2R7TA 3AT1B 1H98A 2W4CA 4RW7B 5EDWA 3HHNB 3QAUA 3TJAA 3R1LA 3H90A 5DS7A 5DM6Q 1FI4A 1GTHA 3C15A 4YEAA 3M7VA 5J1EA 2QA4S 3LPYA 1RBAA 4KRWA 2Z2MA 3CDWA 2EC0A 1FHTA 3CDUA 3QFHA 3HVTA 2VC1A 3RAMA 4RU9A 2DHSA 3MAAB 4LF6J 2OEMA 5KFMA 1NZAA 2Y1LB 6FDRA 1FKPB 4CLTA 1MWYA 3PX4A 4P7VA 2GHPA 1WORA 1RHMB 4ECWA 2HBYB 5F8HA 2A3JA 4DX7A 3M2UA 2YX1A 3GV5B 2LQ8A 3MURP 3E01B 2FZCB 1P6TA 4TQRA 2HHHF 2WBMA 4P2XA 1DQAA 2C3OA 2VPWB 3QSIA 5KFIA 1Q82T 3P4UB 1FRIA 3CC7S 2E1CA 2M88A 4ZHRB 3MF5A 3PYDA 3PM9A 2DY9A 1EHWA 3HCXA 2FLNA 2Y1IA 1SV5A 2MKCA 2YQ3A 3GG1A 1VBKA 4CZCA 2C2ZB 3KJVB 3JQJA 1R8BA 2CQIA 2DXEA 5EX3A 4B02A 2W9BA 3UDCA 3SSSA 2YH1A 4PYDA 1HNXJ 1T9XA 5GAEU 4KPYA 5L46A 3US5A 2FC8A 4ZS6A 4RNHA 1IM4A 3P6YC 1Y4ZB 2GIQA 4X4SA 2GS8A 2RQKA 3ZZRA 1ZZNA 3CWJA 4Y2CA 1VISA 4YB1P 4PRFA 3UN2A 8AT1B 3V6KA 3R5BA 4DV5J 3A3NB 2HVDA 4WJBA 4C8LA 3EPGA 3MXHP 4C3MA 1RAEB 3MM6A 4AL5A 2JNJA 1MLAA 1M5HA 4QWCA 1X4EA 5J1NA 3W8GA 2QEXS 3WC2A 3P49B 1FXLA 4FXVA 2HNZA 3UDEA 1S10A 1XNQF 4C97A 2AKWB 2C2KB 1N36F 1FD2A 3HF5A 3QMQA 5KG6A 5K8MA 4N41A 2V4JA 5AE2A 2A0FB 1S1WB 1WHVA 2MKSA 2XMAA 3X1LB 2P8IA 3BGOP 1V9OA 1RT5A 3RAQA 3PIOQ 1S6PA 3WC0A 3OVAA 5HLFB 3HFVA 4MAKA 4DN9A 2HNYA 2VBXA 4YDXA 3SCLE 3GR1A 3PV8A 4DR6F 2FVCA 4J9UE 3HHEA 4FNHA 4N5SA 2ZBRA 1TUWA 4MT1A 5EUHA 3S7RA 1MWQA 2KXNB 1S57A 4KB7A 1NLKL 1PKUA 2QL5B 2QX0A 4PAAA 1DRZA 2NXEA 1I6JA 4X62J 1H2UX 2F7VA 4ES1A 3MZIA 4IQXA 4QU6A 2XMKA 2A18A 2IJNA 5ITHA 2DTJA 3W2VB 1LFPA 3OPKA 5B0DA 3W9HA 2EG2A 1RT4B 4PZVA 1Q81T 4CO4A 2A10A 3QGGA 5BYRA 4PXDA 1KOOA 2Z30B 2H65B 4IOAQ 5D0GA 3MECB 1JKHA 3MEDA 3LO3A 5I3UA 1FA0A 4MYTA 1QAIA 4U67Q 2BRLA 1W7WA 3H98A 1VQPS 1RAAB 4AFFA 4IH5A 2GO8A 3CO0P 2CAJA 3UR3C 2CQDA 4OV6A 3K57A 1DTQB 1DURA 4PUOA 2FHOB 3NGKA 2DGQA 2XYGB 2FZGB 3HVWA 4ZLPA 5GADU 3M8QA 2LCWA 2YWHA 3CJQA 3PW2A 2DH9A 1U49A 4TQSA 3FVYA 2ZUGA 4P9SA 4M5MA 1S4FA 3UR0A 3D0IE 3K0JA 4WKRA 1XMBA 3NS6A 3OT9A 4BBYA 2FJBB 2KT5A 1SB6A 3UN3A 2MQPA 5CYMA 2BOPA 3BS9A 5BYSA 1OY9A 2XO6A 3DDKA 1Q5VA 3S6EA 1DARA 2ZBIA 2X1AA 3RB4A 2W8KA 4M5LA 1D09B 2YKMB 2YNFA 4XTTA 3BPSP 4ZVFA 3HHDA 3R8YA 4ES3A 4P6QA 4YFUA 3ENWA 1S0MA 4OI6A 2HRUA 4HKQA 3G8QA 3H2LA 1PC5A 1LW2A 3MM7A 1RT7A 2AEMA 1JLFA 4PWWA 2AWZA 4YB7A 3QZ8A 2NYHA 1T05B 1KVKA 2B3TB 4P72A 3TA0A 4DL5A 5DZ7A 4A8YA 4OZJA 1F2GA 3KLGB 1RAHB 1RTHA 2P2CB 2BJDA 3GIRA 3BBBA 2ZVSA 4PPDA 4UUWA 2FVQA 2KL8A 2ZDOA 4H4OB 4OYPA 1IKVB 2BEFA 3CCTA 4RUHA 1UA0A 5HMYA 2CJQA 2BX6A 3WQPA 1NHUA 4USIA 3H8YA 1U48A 1OMSA 1U26A 3N6LA 2XTJP 4Y3CA 4EK2A 3MCMA 5KT2A 1S1XB 1LK7A 2B4VA 2XNRA 2QYGA 5K14A 2CPIA 2XMVA 4OJHA 4OX9J 3BKTA 3GCWP 4IFYB 2WTFA 1EQMA 1U47A 3JQKA 4LR9A 4KY3A 1WC0A 4H4MB 3LTOA 4TNOA 3L3CA 4ZPTR 1IKVA 2BABA 2VG5B 3P5TL 5E33A 1BXNA 2CDQA 3DOKA 3HJVA 4DHVA 4UOGA 3KJQB 4WTYA 5HMZA 2OFHX 2VA2A 4O44B 2CPFA 1FJGJ 2EI5A 4A8XA 2RSQA 3MPUB 4WZQA 1D9AA 2D9PA 1FF2A 1H2TZ 2DRBA 1JLFB 1T05A 3CSKA 1R6VA 2OH2A 2X1FA 5DQIA 3K5OA 3OL7A 4JI0J 3DN9A 5GMEA 4BLGA 4ECZA 4R0JA 2NPFA 2BANA 4OHXA 4DR1F 2IYGA 4WP3A 1CQMA 2NSBA 3GYNA 2P9CA 3BGUA 1VRUB 1TQLA 3ILLA 1IWGA 3KHHA 3T1HF 2XY5A 2AU0A 3AA8A 4OI1A 1QVGR 4ILLA 1VQ8S 3UVJA 2ZVIA 4MKYA 1LWEA 1ZM2A 3M05A 5DQHA 2AJ2A 4B9NA 4Q2MA 3TQ1A 1KC8T 1G3OA 5H9EK 4A8SA 1PJ7A 2PMZD 3FMWA 4WK3A 1LK5A 2HYIB 3C2PA 4DL7A 3R5GA 1U24A 4Y6IA 4YY3J 2B7BB 5KFLA 3P5BP 5B0EA 4CO3A 2ZZMA 5F0UA 8RUCA 3GJTB 4BHQA 3JSMA 1GT8A 1S1TA 3EGNA 3W62A 3Q8PB 3HT3A 3CCUS 4FKYA 3T5JA 4PXEA 1B0PA 3HKZD 5CHCB 3UD4P 3FCWA 1XNQJ 1VJQA 5J2MB 3K89A 1FCAA 1Z1ZA 3E01A 3PYGA 5EWGA 3M6WA 1J5EJ 1FXRA 3DRXA 5KFWA 1LW0B 4I64A 2E29A 4CYUB 7FDRA 5KFNA 3HPOA 4A8KA 2BM0A 1HHSA 3I0RA 4DV2J 2L48A 1R27B 2BW2A 1V3ZA 3MAHA 1Q8KA 4QIFA 4E8UA 1HR0F 1HIYA 4CTAB 3NOCA 4KGKA 3OV7A 5CABA 3CO9A 1I5OB 5JVHQ 1PJ5A 1C0UB 1BMQB 1RTZA 1ELOA 1TUVA 2BV3A 4NLWA 4ZLNA 4Y2MA 1QAJA 3LGMA 2MQQA 1HFEL 1BUXA 2W2NP 1RT3B 2RT3A 2OPPA 4U8YA 3I55S 4F3MA 2JLGA 5I42A 1TKTB 3NNCA 2RD5C 3AOCA 4DPYA 3MAAA 1Y3KA 2MQNA 2CXEA 1XC9A 1N33F 2B56A 3AAWB 3EXCX 3QBCA 4JB8B 1SIZA 1VC0A 3MR6A 2FGCA 2OO4A 5LM7E 2LP4A 3MUVP 4I67A 4EFAC 1PYSB 5G0RB 2UV8G 4JI5J 1BQXA 3H2VE 1PGZA 1UA1A 3KOAA 4AE5A 1XJWB 1X5PA 2IYIA 2YWEA 4ZCIA 2RILA 2D41A 2CIMA 3M9NB 2QFJA 1VJWA 1KQSR 3PO5A 2GX8A 2CQ3A 4TN2A 1MNEA 2AF6A 4FF3A 4ECYA 1SPBP 1X9WA 2MQ8A 2KKHA 5ETVA 3GP9A 4USMA 1P1LA 1BQMB 3ZO7A 3IRXA 3VVUA 1DTQA 5DDQC 3M6XA 3D5MA 2JEJA 5G0RA 3IFEA 2L9NA 1VS3A 4L6V3 4DV4J 4JI1J 2UXDF 1YK9A 4LFBF 2R7VA 1RAJA 2DNHA 1HNZJ 3RW6A 3M32B 1RWWB 5DQGA 3ZZTA 1JLEB 3DLGB 2CNNB 3A8EA 1T9YA 3T1AA 3JS9A 4MFBB 1QE1A 5IC6B 1RADB 5KFGA 4F4XA 1IBLJ 2DR5A 3TUIC 4M1KA 1OIAA 4QWEA 3M6UA 2ASJA 5HATA 5HP1B 4ECVA 3KLVA 3JXOA 4LVOP 3N01A 1RSCA 4WYWA 2XZTB 1TU0B 1SL1A 4F02A 3V5RA 4NRUA 3AFGA 3M2VB 2XO7A 5ETRA 3R2CJ 4R5PB 2XEXA 3SCJE 2Q6BA 1WD6A 3W5XA 3DGPA 2RQCA 4QW9A 4DR2F 2CPYA 1XMOF 1WKKA 1Q16B 1FK9A 3HD2A 5B7WA 5K20B 3DLLQ 3RB6A 4I69A 1CULB 2V8GA 4FP9A 2UVRA 3FNNA 5JMNA 4GC7A 1CBKA 2EKNA 1NXIA 3TZXA 5IT9Y 2YWKA 4OYWA 1WTFA 2WONA 1MW7A 4WE1B 4F36A 1FDAA 2ZHOA 3CD0A 4IG3A 1HHQA 3PCOB 4LSLB 1RA6A 5KFOA 5MLCV 1X9MA 4F4YA 4ZP6A 3QGPA 2APOA 1R8CA 1FESA 1RLDA 1XERA 2KT3A 3AODA 4JI8F 3JAMU 2C22A 1IR0A 5FDLA 1WG1A 4USTA 4ZVTB 1QTNB 4P2MA 3M9OB 2UUBF 2G1HA 2RH3A 3VV2B 2W2MP 2FLLA 1RTJB 3BGRA 1TAQA 2E5GA 2W9AA 2MKHA 3OFGA 5CYQB 2IM1A 4DFJA 4NLGA 2ZD1B 4O0NA 1UMJA 2MSSA 2DYAA 2J7UA 4P75A 1IBKF 5HP1A 3H5XA 3TUPA 4WZMA 2E5IA 2ROEA 2ZBCA 2QLBB 1KEKA 3PW7A 1RHQB 2F1FA 1KONA 2J8AA 3R6GB 1CS4B 2YQ1A 2RRBA 4C4WA 5KFEA 2D3ZA 2MGZB 2R42A 5DGBA 4DV1F 5A8KB 2FJAB 2WVFA 2HW3A 3VAFA 2E1MC 2OFGX 2UXCJ 4X4PA 1VRTB 5IM0A 3WX4A 5LMUJ 1HNVA 3DRRA 3SEOA 2WB4A 4FYYB 3L4BC 4OYBA 1PBUA 3HZEA 3NGDA 2ZHBA 4EZ9A 5KFBA 3GIIA 3V6JA 4FVCA 3O8WA 3GV7B 4ED6A 3IAM9 4EO6A 1IXKA 1CULA 2OSRA 1UETA 2BRKA 2CJXB 2HS3A 2ZE2B 3AA9A 1RCOB 4QWBA 3W7BA 3Q0AA 4ZMMA 4DV7J 2FHJD 3QGHA 2OSQA 1S6OA 3OSPA 4KHMA 3MM7B 1T9UA 1WHXA 3AXMA 1S59A 4NYZA 4ELTA 4OYIA 4NXNJ 5J2QA 2K06A 1CJTA 3GSIA 2V50A 4K4SA 1YZ6A 3RRGA 2RB7A 1RTIA 3MTKA 2MB0B 1RTDB 1CJKB 1VQYA 3GJQB 3OXLA 4K4XA 1GAOA 2R7UA 5D78A 3D28A 3QRRA 4H4OA 4OYOA 2AT1B 3LP2B 4MK9A 4A47A 2FUG9 2GQQA 3J7ZT 1KLMA 4UZCA 2MZQA 3SQGA 2W9CA 2KG0A 3B8HA 4CLYA 2G0JA 2R4FA 3QIDA 3UQSA 4AYBD 5D0RA 4HLBA 2QGFB 1YBAA 4LVNP 2QA2A 4C0HA 2UU9J 3RUBL 2XZDB 1EZZB 3D6HB 1L3TA 3DOMA 2OKQA 2VPXB 3GILA 2W7PA 2LXFA 3EGVA 1N5TA 2ALZA 1SL0A 1Q86T 4DR5J 4QIGA 1XR7A 2CZ4A 4QBUA 3UWTA 2R2SA 4DEZA 2DK2A 4IOCQ 5HJYA 4JYAJ 2EFNA 5HVFA 2OUGA 2E5LF 3J81j 2ZJQQ 2HHQA 3QNWB 4Q2LA 2ZE2A 3NXZA 3EWGA 1R0CB 1CPZA 3HI9A 4OYAA 3W1YC 2GMJA 5BJRA 1QSYA 1A6LA 2CNOB 2DNLA 3RJMB 3MM8B 4B3RJ 5AJ3J 1BQNB 1REVA 1NBEB 1RI7A 2PT0A 1M1KT 4TU8A 2W2PP 1UJ6A 2CFXA 5CZVA 4ZPAA 1JXLA 1O6XA 3KDNA 3CJKA 2UU9F 1CEZA 1WF2A 1X9SA 2ZOGA 2IDEA 2MY8A 1GXUA 2C3UA 3CT9A 2OP5A 3JQMA 1KOHA 4TY9A 1UFWA 3OVBA 1DHMA 4LMZA 1RAGB 1TP7A 3B54A 2G2YA 5HBMB 3JTPA 9ATCB 4DV0F 3EVOA 1CQNA 1AA1B 2GAGC 1K47A 2AYGA 4ZVRB 1KLMB 1S7HA 2O5DA 5LOQA 3QJPA 1ZAVA 3FC9A 2CPJA 1BE4A 3PVXA 1T9WA 1FWKA 1FWPA 3FBFA 5D6GA 3OTOF 1MU2B 3I5AA 4DUYJ 4NLRA 1YWXA 2PIIA 4TLQA 5IV3A 2E7VA 3GIMA 4USUA 2R7WA 1NMEB 5GAEI 1M5OC 2LU1A 4JOUA 4F26A 3OD2A 4UOFA 2RDJA 1L3UA 3D3CJ 4DOZA 4LUBA 1PCAA 4QOTA 2DPIA 2FY1A 1FVSA 5IZHA 4NYPA 3CCZA 1X4CA 3C19A 4ANDA 4EBEA 1DY3A 2GQ2A 3ISZA 1RCXB 2YKNB 4XAKA 1DBDA 2IA6A 1UVMA 2PD1A 3GIKA 3ZFVA 3VAHA 5FJ4A 1D0EA 4CP5A 2H4WB 2AV5A 4KH1B 1JLQA 1FKPA 3TRGA 4IDKB 1REVB 1SUQB 4O4GA 3SBMA 3V6DB 3AJ1A 3FSXA 2KVQE 5A8RA 3DGPB 5L9XA 2ZEJA 3VQTA 1TK8A 2UXCF 4OQJA 2Y9HA 2O01C 2Y8WA 4ID5B 2ZH5A 3MDFA 3TI0A 4GMKA 4DCJB 5F9LA 5D77A 3IR6B 2CJKA 1FNXH 3AB2B 5LT5A 2R2UA 4X65J 1U02A 3MOZA 1YHQS 2VQFF 3ZZZA 2XBPA 4DFMA 2IDLA 3E2EA 2RQ4A 1IBKJ 1NB7A 3J7Z5 3A13A 2HHVA 5CAAA 3CCES 4IG3B 2YNGB 1U45A 2C2MB 3PW5A 1ZETA 3DM2A 4KSEB 5HMWA 2N4CA 3U27A 5M2PA 3LQVA 4BDPA 2QRRA 5HN0A 4KYZA 2C42A 2UUCJ 1LNQA 2DGTA 2UUBJ 2LXIA 4YB5A 4DV3J 4P71A 4ZJOA 2VKZG 4JI8J 2VC0A 4WFBQ 1HYSA 2ERRA 3ZNUA 5KFKA 2VJVA 2KI2A 3EDRB 5KFFA 4F2SA 2V8VA 1F60B 4KFBB 5E41A 1FK9B 1SXLA 3UNYA 5CYQA 3EJMA 3MPDA 2HQIA 2BVZA 1WEYA 1K1SA 1TL1B 1E6VB 2DHHA 2WZ1A 1I1GA 2XMUA 3DLEA 3EVMA 4NLSA 5CZXA 2ZH6A 4P2FA 1WG4A 4C8MA 3GV8B 3UE2A 1GXLA 2A2CA 3BSNA 3DI6A 4DS5A 2YKNA 3PX6A 1VBXA 3P3DA 1NJIT 1JXVA 4RW6B 3NNAA 2XLKA 4UQTA 3CCQS 3D1HA 1VOMA 2CRLA 4I7FB 2F40A 1PJ6A 2FTRA 5DDPC 1CVJA 2J8SA 3MEEA 3S01A 5H1SV 1UFKA 2UUWA 3MGJA 2AJ4A 5KFUA 4J9OA 2KDOA 7AT1B 4F4WA 4UY85 4QW8A 1S6PB 2LDIA 2XY7A 5A6PA 2DGVA 3UPFA 2AQ4A 3ET6A 2M9KA 3T9ZA 5B0BA 3QT6A 4NEZA 4NA1A 1HKAA 2CYYA 1Q8LA 2VG7B 4KO0A 3I6PA 4P10A 4B3MF 1HWJA 2PN6A 4DPOA 1SV5B 2GFFA 5EHHA 2HLUA 2ASDA 4IUFA 3PG9A 2CG8A 3POTA 4G1QA 2M2BA 2JRSA 3FRYA 1O0PA 2RVJA 1FRMA 4NLQA 4B08A 2OPSB 1D9FA 1KNZA 4LF5F 2ZZNA 4CO1A 2RS8A 2HMIB 2OPRA 2LVWA 1FTRA 3A12A 3GFZA 2NLWA 2JOQA 1RTDA 2UXDJ 2B6AB 3DOLB 3MI7X 4DV4F 4JI1F 4AXIA 2WW4A 4ED1A 2HAFA 4TKTA 5GAGU 4Q8EA 2ZNZA 4CLZA 3DDNA 4B3OA 1TZ0A 4OJ3A 3QJJA 3K5NA 1SJ3P 4ZVGA 2KZZA 3IGVA 1NRKA 2V2KA 2XS2A 1LWCA 1WOOA 1C1BA 3AJ2A 2HGNA 3ZZPA 1M1GA 5KFSA 1SJ4P 1Q79A 3OXFA 3UCGA 3KK2A 2C2OB 5ETQA 5C25B 1UW9A 1Y0HA 3NCPA 4ZPVR 3T6BA 2NUHA 2KRRA 4ICLA 1IWAA 4RW8B 1ROFA 3C3LA 2HVEA 2UZAA 2F63A 3QYYA 3HD1A 1LWXA 4A48A 2PO4A 4K5SA 5F0WA 4DR3F 3PHTA 1M90T 2Y8YA 5C42B 2V8PA 1U6FA 1U6BA 3RR8A 1RT2B 3IN5A 1C0TB 4IR9A 1HQUB 1UJ4A 2F3JA 1H2VZ 1YJVA 3I87A 1YQHA 3LH2S 4MIAA 2H3EB 5JJBA 4Y0FA 1U1QA 1U2CA 1VGYA 3ET6B 4OZLA 5IWAF 3TAQA 4J9NA 1FX4A 3FBBA 3A8JA 2HFSA 3UVJB 4HR2A 1WUUA 4X4TA 1UEUA 1TKZA 3AOAA 3FSYA 3KYLA 4FS1A 2YKMA 2YNFB 1AROP 1FD8A 3DU6A 5DRKA 2W9CB 1N5YB 3K59A 1U8WA 1R0AA 5IT9U 4ECTA 2CPHA 1E6YB 4RBTA 2IJFA 3CUNA 1HBMA 1VQ9S 4BWMA 3OXGA 3TQEA 2N3OA 1IKWB 3HHLD 1C0UA 3IWXA 4FYXB 4NL5A 2I38A 1YRUA 5KOXA 3KG4A 2LKZA 2GO9A 2V6AA 2J6UA 3VGSA 1SBRA 2IHR1 1RHRB 3BDEA 1NJWA 4O0IA 3CD6S 3O1LA 1RBOB 3KHGA 3RRKA 3MMBA 4LF8J 4RW7A 1TKZB 4KH0B 2FHKA 4DL3A 3CGIA 1QSSA 3TZWA 5KFHA 2RQMA 3R5DA 4ANCA 4WYLA 3CJRA 3CNQP 1ZA2B 2GZOA 5KG3A 3M8RA 1B0VA 3DRPB 1KFDA 2N82B 4FBTA 2Q66A 3FEYB 1P9QC 3HULA 1Z4UA 1UVLA 1YGYA 4FF1A 4A8OA 4ILRA 3EM1A 3QIPA 1V3RA 3B78A 3BQ0A 1U1LA 1FRHA 1HBUB 2UXBF 4B9VA 4MKBA 1N88A 3GLJA 4UOHA 4C8ZA 1H72C 4DQRA 2WSCC 4YHHJ 1X60A 2COLA 3UI3A 3I4HX 4A8MP 4FNIA 2FGOA 4DZDA 4K50A 1S1VA 1JLBA 3T1HJ 1IKYB 4I4BA 3OLBA 3AQOA 4LIRA 4PKDB 3BQ1A 4DF8A 1EJ7L 4DCPB 5KFPA 1HPZA 2BXJA 2M4MA 1X5OA 1S9FA 4J7CA 3ZZUA 4KR0B 3DU5A 5KOWA 4Q44A 2O67A 3KNGA 3LAKA 2YKOA 5HL7Q 5HLFA 4O3NA 1Y9OA 3A3OB 4EYIB 1HBNB 5EWEA 1FJGF 1BGXT 1S99A 3BH7B 2YY3A 2FHMA 3TVYA 4HI1A 4WXWA 5E3RA 1S1VB 3DFEA 2J0QD 4TYAA 4URQU 3DHXA 3OHAA 1X4HA 5LJ5Y 2QJ3A 1EARA 3QT8A 2DY1A 4WFYA 1KLNA 1VIXA 2VDHA 2OJ3A 4RO0A 1RWKB 2ATLA 4K0KF 4DUZJ 1WKJA 4K7QA 4GKJJ 1KD1T 3QJLA 4C3KA 4G3IA 1APSA 1HQ2A 2L41A 4IDKA 1AUSL 2DT9A 3V6DA 2F4VJ 1KHVA 3KMSA 3J80Y 4LSNA 3TX0A 5HROB 4RUAA 3SCIE 3G87A 3U1MA 3LW5C 3KLEB 2RNEA 4RNFA 3KK3B 1WC6A 1N56A 5GAHU 2EFQA 4YDDB 4DI6A 5HK4A 4N56A 5B0CA 5ETNA 3CCLS 4CNYA 3LANA 4CO0A 3HSZA 1U8SA 4KIAA 5GMKa 5T14A 4NRTA 4DMZA 1FFWB 4JV1A 5ETMA 4DL0C 2H1YA 4ZP8A 1PSDA 4OLOA 2B8QA 3UNGC 3HFZB 2QMUB 2JH3A 3CC2S 5ETSA 2VBYA 1UP1A 3FK4A 2E66A 3SYZA 3PXGa 1T03B 3L7PA 2JLFA 3NBPB 2BKNA 3EMTA 5LSLA 1NKBA 4CCHA 3FQLA 4UQGA 1SJRA 4PCQA 3R7SB 2Q1LA 3KK3A 1RT6A 3HX9A 2OPQB 3VHQA 3CF5Q 1M5VC 3O44A 1NH8A 4QZVB 2GV1A 1JKHB 1YJ7A 3K8WA 1OJ4A 3MEDB 1LWEB 4C6AA 1MN9A 3MEGA 2J0WA 4ED5A 2B43A 4CH7A 1KQKA 4ZJQA 2MSTA 1NU4A 3BM7A 3ETMA 2Z4PA 3A3PB 5E2QA 1VCTA 3CCSS 1HMVB 2XGPA 2IA0A 1RT1B 1N5QA 1ZM3A 1R7IA 1SKUB 1DQ8A 1HW8A 1K44A 3GFHA 3H5YA 3M9MB 3DLKB 3SV3A 1ZBTA 3N6NA 1VMBA 2AJ0A 2VPYB 3ZZ0A 4OFZA 4K0KJ 5DZ6A 3SI8A 3Q8RB 1X31C 2HBZB 4ZIWA 3H4DA 2AEJA 1S5ZA 4CO2A 3L95X 5CYMB 1EAYC 1UZHA 2A1BA 3VGUA 1S0VA 4LQ9A 1T02A 2XMMA 4HEA9 3KWMA 5D4PA 4YQWA 1VQMS 4O3SA 4CI0B 3LPEA 4F04B 2PFDA 4U95A 1HMVA 4DX5A 1KKHA 3VZHA 5C25A 1W25A 1N6QA 2F8HA 1OQ3A 4G1IA 1GX6A 2RKIB 1GMWA 4B3SF 3IP0A 4EYHB 1Q8IA 1RTIB 5LSRA 2J6SA 1QTMA 2AX0A 2MZJA 1RB0A 4KGVB 1DFDA 4UT4A 3NY0A 3B82A 3BR8A 1RXOB 2B6AA 4LF1A 5G4DA 5GAHI 2DRDA 2FVSA 4DBQA 2XCPA 3GB0A 1VDHA 1JB0C 4OI4A 2XNQA 4ZHRA 1SVDA 5B0AA 4YHHF 4LF7F 4ELUA 1EETB 2ZJRQ 4UY8T 1JQGA 3GYXB 5K8OA 3TR5A 5IT0A 3OBIA 1WEZA 4J90A 4MMOA 4AUKA 1RLCL 4RNMA 1NK4A 1I94F 2V9WA 2VOOA 4U6PA 2B4PA 3I82A 4TLRA 3BGFA 3J7A1 2RUGA 2R7XA 5HO4A 1N32J 2QZ8A 1HNIB 2VPZB 3FGVA 3QWUA 2WVBA 3IAS9 4DL2A 3OTEA 2EBGA 4LT6A 3CULA 4LIWA 2FQQB 1IJFB 4IFYA 4XIUA 2ACMA 4K4YA 5F8NA 3VCDA 1N54B 2GIRA 4Y28C 5D4OA 1YIJS 2HHSA 1P9YA 3C16B 2ILYA 3GR0A 1SC6A 3NOGA 4KO0B 2GMHA 3IA0A 2NPIA 1SQFA 4F7VA 3W9IA 2Z0GA 3QPIA 1R6YA 2GHWA 4J37A 1JIHA 3CIZA 3G86A 4LF8F 1IVZA 2UUAF 2HHPA 3MFHA 3EZOA 1YG0A 1ZOTA 3LP1B 5IXUA 3BO3A 1ZTTA 4ZVHA 4KTQA 1PO6A 2NS1B 5FDLB 5K9FA 4XO0A 4ECUA 1SI9A 1GMVA 3RBEA 3MMAA 3KDOA 1XMQJ 1BLUA 4N76A 2R8JA 1JLEA 1RAIB 3ZNJ1 2YWFA 1HNXF 1T8EA 1JLCA 3TJ9A 2HIQA 5RUBA 3KTQA 3KJNB 4CLWA 4ATNA 1CC8A 4D3GA 5J2MA 3C15B 1N34F 1DTTB 3Q86A 4AL6A 1C1BB 4LRDA 3C6TA 3HHKA 1S6QB 4OLPA 3LALA 5DG8A 2LYVA 1OY8A 5B08A 4DV6F 2D1CA 1AUDA 4NLXA 2JWNA 2DNGA 1HI1A 3AY0A 3LP1A 4HT7A 5IWAJ 3F73A 3V81A 3IRWP 2HHHJ 4C8NA 3MM8A 4J9SA 4P74A 3DLHA 2MKKA 1MROA 2WK4A 1K0VA 2I8EA 2K1RA 4DFKA 4ECQA 1JNRB 1JLGB 3C6UA 3UD5A 4DR3J 2K7KA 2X3GA 4Y2KA 2GA7A 1VK3A 2HHWA 4NASA 3C66A 1TFYA 3MHYA 3HM9A 3G6ES 2YBVA 3K8VA 1T11A 4QR2A 2MZSA 3NMRA 2RHSB 2QC3A 3LF0A 5F3TA 4DQPA 3OVSA 1UEKA 4I0WA 3H59A 4KKOB 4ZCMA 1V6HA 2VHGA 4USJC 2DNZA 1AFIA 2I0XA 2B4UA 2V4JB 1VYAA 3IS9B 1RP5A 3H25A 5U47A 4M95A 4V1Ak 2QV6A 1IKYA 3FCHA 1FRLA 1S4EA 3PKMA 1XIQA 4KGMA 4JV5J 5F8GA 3HLUA 3CPWR 1REGX 4OHYA 4MTPA 2XHCA 4ELVA 1KN6A 3D0GE 4HH0A 4URGA 3NS7B 3Q22A 1VI7A 3MD1A 3KLEA 1R8HA 4RW9B 5KG0A 4DSIA 5HMXA 1VC5A 4NWBA 1A7GE 1F2HA 1WEXA 2FJEB 2NZCA 2PA3A 2F8EX 4K59A 2FLOA 2HG4A 4F0HA 5HQMA 4A8FA 1ULRA 1ACMB 2EFGA 3MUTP 2DITA 1IBMJ 4K4VA 2XSJB 4RW4A 1U25A 3PNIA 1IQZA 2UP1A 1OO0B 1GTEA 2DXFA 2HBQB 2GJFA 4NYOA 3TAMA 4LF4J 1IBCB 4DLGA 2R7RA 3SDEA 2QO3A 1WHYA 4ZVPB 3DLGA 1K9MT 2LMIA 4CLFA 3V6HA 1TKXA 2VFUA 1T03A 5KG7A 3HSDA 2V2QA 1FJEB 4C8YA 4PABA 1WHWA 2FD2A 2W2OP 1N0VC 1TL1A 4OZNA 3LWLA 5L1LA 4IRDA 3G71S 3CJ0A 4E0DA 4O3PA 4YR3A 2PI4A 5KFVA 3N6MA 2LU2A 1NK0A 4C8KA 2FJVA 1B70B 3JTOA 5LMNJ 3KJFB 3QATA 3RYLA 4LRAA 3PY8A 3A8IA 4UTGA 2DXDA 4JV2A 3VAKA 4EEYA 1O8BA 1SKRA 3DM2B 4O4RA 1Y11A 1B7YB 1FJCA 3CXCR 2GC8A 5CD4H 1YSJA 3MM9B 4WP9A 5IS2A 2C2RA 4I2QA 3MOJB 1I94J 1RT4A 2UUCF 3LP0B 5KFXA 3HJFA 3M30A 4LF7J 1GXTA 4YUDA 4L74A 1NHVA 4FKXA 2IBKA 3PHEA 4X4OA 4CLKA 3G6VA 4CQ1A 2W7OA 2R7QA 1JX4A 2V2ZA 2HBRB 1HARA 3DC2A 3R3TA 2DCLA 1FKAF 3X3UA 5LXRA 2ROGA 3L9ZA 1KWMA 2MJNA 2BE2A 2VQFJ 4PUOB 2EK1A 2A6MA 4X65F 4HL9A 3Q8YA 1OPZA 3VTIA 4C0OC 2DNKA 3JTNA 2MZ1A 2ZHAA 1NSAA 1CJUA 4LBPA 1URNA 2XB2D 2WOMB 4B3SJ 3SDEB 3QT7A 4ES2A 1SKWA 1RT1A 2MTLA 1OS5A 1S7IA 2HLTA 4L76A 1JK9B 2LLZA 3QO9B 4QIWD 4GRSA 3UDVA 4RUCA 3H7HB 1YBUA 1VQOS 1VQ7S 2LDYA 3F44A 3LGNA 3H40A 3VGVA 2ZOMA 1LEOA 4QYZK 2HZAA 3VAMA 1N5VA 3DDIA 5KFTA 2FVPA 3HO1A 3T1YF 3QT5A 4Y00A 1W26A 5E7OB 3R5CA 1H38A 4PWDA 4MH8A 3KMQA 4DSKA 1Q78A 1TL5A 3GTYX 4DQQA 3W66A 2HKEA 2RJZA 4LQ3A 4RBVA 2DNYA 1Q53A 4MKVA 4HDGA 1SH2A 4QIEA 4F2RA 1LOUA 4ID5A 1T9TA 3KLGA 4MIBA 3N9UC 2N3LA 1GK8A 1C4CA 2DO4A 1ZM4A 3E3XA 2XHWA 4X64J 2WBRA 3DOKB 3UN5A 1T3OA 3GFYA 3W5YA 4EUVA 1D3WA 3FFIB 4WWSA 5HBMA 2J9DA 4J91A 3OR1B 3LWMA 2QLJB 4I6YA 2F5GA 3HHLA 4J9PA 5KT3A 2CZ9A 5HSPA 1S9GA 3AXKA 1QVFR 2BE2B 2DJWA 4ETXA 1WSVA 2ZM6F 3BYRA 3TWZA 4ICLB 4RW8A 3MR2A 3GMGA 4GVBA 4IH7A 2BANB 5HANA 5ETPA 4WBFA 4OHZA 4HT5A 3SFGA 4L75A 3WX8A 4CTAA 4KV8A 3NG8A 5C24A 3BGLA 4NCBA 5C5JA 2FYXA 3HVAA 2N7YA 1RISA 2H54B 1RWMB 1GEHA 3QLHB 4WFZA 5GADI 3CCMS 3HK2A 4O3RA 5D4NA 2X1GA 3MM6B 1RACB 1QSLA 5AXMA 3DLEB 5KG1A 1SQGA 1ZA1B 5IT4A 2DPJA 2XCAA 3Q83A 4LFAJ 2EKYA 3PKYA 1T9VA 1QDUB 4FF2A 3ITHB 1N6QB 4JYAF 2F4VF 2KFYA 3AHPA 4PWDB 5KFAA 1KFSA 3JB9k 2YKQA 2V2VA 1AT1B 4GKJF 8ATCB 3CJSA 3EGZA 5AXKA 2MKIA 4A4JA 1XR5A 2IM0A 2KJWA 3EZUA 4OIXA 2O66A 4WXOA 3V2UC 4M5NA 1VQ6S 2OMOA 1UWAA 5KT6A 4C2MA 3PRVA 2Q6CA 1FERA 2BJ8A 4ZITA 2XZWA 2BZ2A 3W2WB 4DPTA 4H4KC 3EYZA 1NK6A 3HZGA 4J5OA 1N5SA 4WIIA 1FKOB 2E1RA 3KLHB 2MZRA 2HFVA 2RMLA 1U1KA 1S9EA 2YNGA 1S9GB 2PC6A 3ENQA 2HK3A 4ZVQB 2VASA 3RRHA 3EVWA 2OPRB 4ETZA 3F0NA 3J81Y 2DNMA 3M2UB 2DGUA 3A8KA 4QPTA 3DOMB 1L5UA 3OTBA 2VKRA 4NZ0A 4L73A 2P9GA 3IXQA 1R31A 2IBOA 2OPPB 5BYQA 1TUGB 1RT5B 1X4FA 3D2WA 4NXNF 2I2YA 1NDCA 2H5JB 3T5KA 3QRQA 3EE3A 4LR7A 3AB4B 5ETOA 5A2QU 4X4RA 3LGHA 1FKOA 3BF4A 1W2BR 1DQ9A 3M2RA 2ZC3A 2BE7D 4DV7F 1ITPA 2JDJA 3HVTB 1G7CB 2V63A 3FRZA 4I56A 4DSJA 2VDIA 3TEHB 5F8IA 1TL4A 1M5SA 4KKOA 1KTVA 2MXYA 1WC4A 3TAMB 3UFCX 3IBCB 1R89A 3CMES 4LFCJ 2OAUA 1H0HB 4L3KA 1PG5B 2FPHX 2XWXA 4K2XA 4LSNB 3W64A 2A6OA 1Y7PA 2AP6A 2VZ9A 1EP4B 1YBTA 2WW8A 2VONA 4CIOA 1DTTA 2AJFE 1QUVA 2IJRA 1HBNA 4IKAA 4YN3B 2G9OA 1S6QA 2RUSA 4NCGA 2Y3YA 4J9QA 2WCXA 5J2NB 1S76D 2CG4A 4RW9A 5A0YA 1KS2A 4OJGA 4QCLA 1ZPVA 3G82A 2E44A 3KJVA 5BXIA 3EUNA 4HI2A 2EEYA 4WPAA 2NXUA 1SUQA 3EICA 4NA2A 4O4GB 4DR4F 3Q23A 1J5OA 2GVDA 3CD7A 4P73A 4MFBA 4M5JA 4B9MA 1O5JA 2HRYA 4HTJA 1NJYA 2DHAA 3NWRA 1S1UB 2HNYB 2XI2A 4AT1B 2KJVA 4CLSA 3M8WA 2IRUA 1TV6A 3MMJA 5HAOA 1RYRA 2PGCA 3GJSB 2CADA 2OHDA 2WHOA 1BWVA 4OYZA 2K7JA 1EIYB 3FJ2A 4N47A 4ED8A 3JYTB 2PSZA 3CJ2A 2HVIA 4F3QA 2JEFA 1GMWD 1MN7A 3MM5B 2WSFC 1WC3A 5BR8F 4UW2A 2EWHA 5M2UA 2RU3A 2BQRA 1UAWA 4JI2F 4DR7F 1S1UA
chains in the Genus database with same CATH topology
2N4DA 3CJ4A 5DDRC 1YJNS 5HI7A 5KT5A 1IKXA 1QE1B 2YX4A 2DNRA 2GJ2A 1RTHB 1OSCA 1VFJA 3I32A 1ZH5A 2XY6A 2MQMA 4NCGB 3NRBA 2R8HA 5E3CA 1AFJA 4QQBA 2CPZA 3PR5B 1MMDA 1IBLF 3H2UB 2NUUG 4B9LA 1HWKA 2JL9A 2YKAA 4RBUA 1V3SA 2IMOA 4PR6A 3DXSX 3M8PA 2XMTA 3OR2A 3OHBA 2AGOA 2R7SA 2ADCA 3FFIA 2KXHA 3Q8SB 3IR5B 4W92B 1FE4A 4TY8A 1SJ1A 2FB0A 4QU7A 2VBZA 3KG1A 4N8NA 3JYTA 3FMBA 4PPZA 1VQLS 5E0OA 2C3MA 2IVFB 2HZCA 3MTJA 5KG4A 4DG1B 1CLFA 4WKYA 2K3KA 1CSJA 2BM1A 5T41A 3JSMB 4NLTA 5E3QA 1QM9A 2CQ4A 4Q43A 3M30B 4IO1A 2YNIA 5DM7Q 1PILA 3THTA 4TY8B 2QYCA 4V19X 1IQTA 2V8DA 4FXWA 4DLEA 1LFWA 4ITSA 4RLEA 2JC1A 1NAQA 3ZZYA 4NMLA 2I9SA 2EFPA 3TVZA 5AE3A 4J9LA 5F8MA 2EPIA 2M3DA 1LKZA 2C2DA 4C3LA 2KU7A 1X7VA 1JJ4A 2QLXA 1HWIA 2VBWA 5EGYA 2NZ4A 1AXQA 2ZH1A 2CKWA 2DD8S 4BS2A 1SJQA 5F8JA 4KJIA 3MPWA 3KNAA 2KFZA 2AYMA 2DCUB 5DO2A 5L38A 2FVRA 5L9NA 2HWHA 3J7YU 2HGLA 2R8GA 2PEHA 1FT8A 2CQGA 1WNEA 1UL3A 3U7JA 1D8ZA 4PXBA 3U1LA 3FSIA 2I5JB 1MMNA 2HAIA 2ZH2A 4DV2F 1JLAB 4FF4A 1HQEB 2ABYA 1TKTA 2GMLA 5JUMA 1M5PC 2KHCA 3RU0A 1U6ZA 2XSFA 2M8DB 2M70A 2XI3A 1XK8A 1ZM9A 5H9EJ 4X4NA 4IH6A 2KVIA 4JUZA 1ZZFA 3KK2B 3PEHA 1IKWA 2FHJA 2X1BA 3HXMA 5B0FA 2XLJA 4YY3F 2MQOA 1R43A 1FRJA 2C28A 4MJKA 3EXYA 2HQ3A 4WCEQ 2HFZA 2LA6A 5DETA 2XULA 2XGQA 5F41A 2GJIA 4I2PA 5I4MA 4ERDA 1B0TA 2WRMA 2DO0A 2HPUA 2FDNA 3TAPA 4V19J 2FIUA 3CEDA 2YH0A 3CCJS 4OL8A 3KK1B 4QIVA 1TVRB 2QMXA 5A8RB 2QA1A 3IG1B 4JI3F 2KYXA 4U7CA 1HHTP 4FXDA 1P8GA 1URRA 4WU3A 4ALZA 2JHEA 3MMCB 1XNRF 4OZ5A 1BY9A 2H5EA 4EO8A 3KK1A 1BQMA 3DYAA 3PW0A 4IG0A 3PZPA 3IS9A 3GSDA 2AYEA 3IC1A 3DRPA 2RF2B 5AJ3F 3V4IB 2Z2LA 3BN4A 3F41A 2HNDB 5T7LA 5F3ZA 5CXTA 4B3RF 2RRNA 2LXUA 3PJXA 2DISA 1HI0P 2VD3A 2WONB 3CDBA 1JNZB 4NLDA 3H5UA 2W24A 2WB1D 1JLQB 1FNMA 3T19A 4F25A 3OL9A 5J2NA 4C7QA 3NCQA 4DN0A 2IM2A 2F9JA 4EGLA 3I9V9 2RF2A 4UUXA 1RWUA 3LP0A 2K3IA 3ONQA 3BSCA 5JXSA 1LV5A 4RWXA 2AGQA 1XBWA 5E3AA 1M5KC 2ILZA 5CH7B 5KT4A 2DGXA 2MQLA 2J6TA 4JI7F 4RKUC 1FDNA 4R8UA 3RZAA 5LJ3Y 2GQCA 2FJWA 3NNHA 3SZ2A 2J5AA 3BREA 4M94A 2E5JA 1G2EA 3NS5A 4X64F 2OD4A 2JVRA 3POTB 4G1QB 5E3PA 1FO1A 3J7YI 4CT9A 3FZ2A 4C11B 3TX8A 5J2PA 3PR4A 3M32A 2YNHA 4DFPA 2K2PA 1VBYA 1HNIA 3U1NA 2MYFA 3QO9A 4ZPWR 1RKIA 2W4DA 3CJ3A 3V4IA 2CPXA 4MKAA 3M8PB 3OR2B 1H7XA 1WF1A 2QIFA 3VAIA 4DX8H 4R8UB 2EFOA 2FC9A 4ZK7M 4NLVA 2QA4G 3HP6A 4RNNA 4J9MA 4B9TA 3NAIA 2R7OA 5DLFA 4Q7AA 1S6UA 2IAJB 2CPEA 2W8LA 3R27A 3M2VA 2V9KA 3BN7A 4KQZA 4PG8A 4R5PA 4IOBA 2ZH7A 1U1MA 4OZ1A 3KKFA 5FIIA 1T7PA 3MAQA 1HI8A 3TOQA 1UVNA 1HD1A 2BACA 2YNIB 2E7WA 4FVMA 4X62F 4Q5VA 2ZH3A 3HHLB 1RT6B 4K4WA 4I6AA 5KFDA 3C8YA 2XWYA 2DVIA 1WWHA 2Q79A 3NMAA 4XDCA 4I1TA 3BO2A 2E9TA 1X4DA 4NPOA 4OHVA 4PXCA 2JVOA 2CQBA 3T9NA 4TU9A 2P9EA 3G71S 4DL4A 3HMJG 1KSPA 1SQEA 4EWTA 3D54A 2KFNA 1TKXB 1Q4RA 1VK8A 4RU2A 2CQ2A 3CCVS 2J76E 3KHLA 4A8WA 5DG9A 2V4QA 4P2SA 5DJBA 3AH6A 1UKUA 2MDAA 4GO5X 4HDHA 1VBZA 4WE1A 1VLYA 4RZRA 2FJXA 3G96A 3KHRA 5A8KA 2GCFA 2Q3PA 4ED7A 3H20A 1N52B 1U1PA 1S49A 1X0PA 2HMIA 1HQUA 1P27B 3I0SA 4LJMA 2JFDA 4M5DA 2P5VA 2B9YA 3THPA 3OQ2A 4KC5A 2RU9A 3CTRA 2V8HA 2IFXA 1IBMF 1F0XA 2J0SD 2BDPA 2ZKTA 3EGWB 2CQCA 3OW2R 3BB5A 1IN0A 2UVWA 3T3FA 2QSFA 4JI6F 1VQSA 4RNOA 1F9FA 3VR1A 1HBMB 5DDOC 4ZPCA 2OMLA 1R8AA 2J9EA 2UV8A 2D3UA 4GO7X 1SL2A 1TVRA 2AJQA 2VV5A 1VQ5S 4X84A 4OZ0A 3SV4A 3NL0A 4ZPBA 5I3QA 1CG2A 4X2BA 1VQNS 3IWNC 2V5HG 3EPIA 5KAKA 4ZP9A 2P6TA 1FE0A 5IFMA 1FDBA 5I42B 2VFVA 1YJRA 2HVHA 1Y3JA 2QMWA 3KFWX 1FJ7A 2GW8A 3ISND 1X8DA 3G6XA 4ZOSA 5AXLA 3CE8A 1S72S 1TFWA 3KLHA 2CQHA 2KO1A 4JI5F 5J1PA 5L8RC 3GE9A 2OLWA 5K8PA 3OTCA 1XR6A 5DLGA 4J9RA 2KRBA 1MU2A 4KHRA 4NZ6A 1ZAWA 4DDFA 5DGAA 1TR0A 2KXFA 5LXYA 2AGPA 3PX4A 4PG7A 2DHXA 4XK8C 2MB0B 3MMAB 4KBIA 1OWXA 3TANA 1RYSA 1FRKA 2KT2A 4WFXA 3R1HA 5HROA 4R25A 3RR7A 2DBBA 2CJBA 3MMBB 2KZMA 1YJTA 3UD3P 1FDDA 2VQEF 3L09A 3PX0A 2ADBA 1KTQA 1NK8A 3Q24A 1OPIA 4D3HA 4YR2A 4F3OA 2HS0A 1YITS 1FTCA 1T94A 2MHNA 2ASYA 2BUNA 4EBCA 1XMQF 1HA1A 1SH3A 3N28A 3PFEA 3T5HA 4ECXA 3K5PA 2L08A 4K4ZA 4YMEA 1F5AA 3I56S 3PRBA 4IO9Q 3SSRA 2JSXA 3QLHA 3TO8A 5EWFA 3S8SA 5JVGQ 1LQ9A 4C0BA 2B5JA 2HNDA 5T7LB 3RBDA 1ZTWA 1H3DA 3M6VA 1RJJA 2DGSA 4Z37A 1J5EF 4KE5A 1D1UA 2ZH4A 4ZDNA 1U2RA 2I1RA 5KFRA 5KTQA 4CH0S 1SH0A 2G4BA 2ZOFA 3THVA 1JLBB 1N4LA 2XLIA 5AXNA 4OI2A 4I7FA 1UJ5A 1Y5IB 2E5HA 1HWLA 4B17A 2BR0A 2KTQA 4A46A 3M1VA 1N32F 2CVEA 5IQQA 5A8WB 3VWSA 2EK6A 3OL8A 3CJKB 1X5SA 2DR8A 5LL6d 4P7TA 4WF9Q 2M52A 3BDPA 4CNZA 2E1AA 3PACA 2OIHA 4KFBA 1VIOA 2VG7A 3I96A 2MJUA 3OR1A 3OFHA 4QR0A 1GQEA 2PA8D 1LW2B 2YVSA 4BC7A 4UOCA 4X4QA 2W9BB 1T95A 3MR3A 4JI0F 2KG1A 1U09A 1GX5A 2RKIA 3DCAA 3MM9A 1KVIA 3DHWC 4O3OA 2RIJA 3DOLA 5KG2A 5C24B 2OPQA 3I4PA 3VAJA 4NLUA 1Z2ZA 3TUZC 4DSLA 2B5JB