3G71S

Co-crystal structure of bruceantin bound to the large ribosomal subunit
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 19
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3g71S00
1URNA 1WF1A 1D9AA 2FC8A 1H6KX 2OSQA 2MKKA 2DB1A 2LEBA 1U1MA 1WEXA 1N52B 1VQOS 3UCGA 2VONA 2MQQA 2L9WA 2KXFA 4CQ1A 1X5TA 5GADU 2DHAA 3OW2R 3D2WA 1F9FA 1CVJA 1X4CA 2HGLA 4M5DB 2YH0A 1B7FA 3CCMS 3CTRA 2I38A 2PEHA 3CCVS 3ZZZA 2J8AA 2OIHA 2K3KA 2AD9A 1O0PA 4UQTA 3P3DA 4QPTA 2DHSA 5DM7Q 3IRWP 2L41A 5ITHA 4UY8T 1XN9A 3VAMA 4IO9Q 3VAKA 2JWNA 2SXLA 3BO4A 2DH8A 1JJHA 5DETA 3J7YU 2RVJA 1VQPS 3U1MA 1VBXA 2KXNB 4IOAQ 2F9DA 3CXCR 1K73T 1JJ4A 2Q79A 2ERRA 3CMAS 2J76E 2XSFA 3UE2A 3S6EA 2MYFA 4F26A 2G1DA 4BS2A 4W90B 2MSTA 2CQ0A 5D78A 2XS2A 1M5PC 2DNRA 5BJRA 3UD4P 2MGZA 1VC6A 1Q7YT 1OO0B 2MGZB 1KQSR 2DGQA 3MOJB 2WBRA 2E44A 3US5A 1H2UX 3EX7B 3CC2S 2RNEA 2OJ3A 2XS5A 5GMKa 1H2TZ 4WKRA 1YWXA 2LEAA 3U1LA 2FHOB 2MHNA 2DNGA 3NMRA 1HL6A 3CCES 2MJNA 3CCRS 2M2BA 1VQ6S 3NS6A 1FT8A 2ZJPQ 2ZJQQ 3MUTP 4OZ1A 5IM0A 1M5KC 3S01A 1Q82T 1WELA 3CPWR 1VBZA 2M0GB 3HI9A 1Q86T 1N54B 2YH1A 1K9MT 5JVGQ 1VQMS 3CC7S 2CQ1A 3HHNB 2O3DA 2AYMA 1SJRA 2I2YA 5GAEU 2U2FA 1X4AA 3H2UB 3Q2SC 2DHXA 2XNRA 4YUDA 3J7ZT 1M5OC 2DO0A 3CMES 2PE8A 2DNLA 5LJ3Y 3K0JA 5HL7Q 3SDEB 4IOCQ 1SJ3P 5LSOA 2BZ2A 2MQPA 2B0GA 2FY1A 1AUDA 4QU6A 3SMZA 1DBDA 1A9NB 1FJ7A 2HZCA 5DDQC 1M90T 2KH9A 2MZJA 2DNOA 3CCJS 1P27B 3LQVA 2KU7A 3MD3A 2MKSA 3R1LA 2DIUA 1WHYA 3BO3A 5LXYA 2X1FA 1WHXA 3NNCA 1IQTA 2RUGA 2DNKA 1VQ5S 1KOOA 4C4WA 2MXYA 1FNXH 3FEYB 1U1RA 1WF2A 2OTLS 5D77A 1X5OA 2D3OR 5GVQA 1WHVA 2BOPA 2CPHA 2QEXS 1U6FA 3NNAA 1D8ZA 2CQGA 3PIOQ 1X5PA 2FC9A 4EGLA 2LQ5A 2MZ1A 2M9KA 2MQOA 2D9PA 2CPIA 2CQ2A 1OWXA 1X4DA 2F3JA 1JJ2R 1WEZA 4PR6A 2MKJA 2E5HA 2F9JA 1FO1A 2DGTA 2CPDA 1SJFA 1QVFR 5DDOC 4U67Q 3VAJA 2CQBA 1HD0A 1ZZNA 4OZ0A 1M5VC 4CH0S 1UFWA 1QM9A 2KT5A 1KD1T 1BY9A 1DHMA 1FJEB 1L3KA 3L3CA 2X1BA 2DGUA 2FPHX 4TU8A 1WG1A 3G4SS 1R8HA 3PIPQ 1X0FA 4A8XA 3CCSS 2OTJS 1P1TA 4C0OC 2JVRA 2DNQA 2DGWA 3B4MA 2VOPA 2MZQA 3THPA 1A7GE 1YIJS 2VODA 1U1LA 1YHQS 2CPZA 1H2VZ 5H1SV 4CIOA 2M70A 4F25A 2DH9A 3VAFA 2XS7A 5LJ5Y 5IQQA 2M8HA 2LA6A 1PO6A 3NNHA 2MQLA 2DH7A 1R8PA 2G0CA 2DGOA 5CA5A 5HO4A 2QFJA 4WIIA 2DNPA 2NLWA 2LCWA 3VAIA 3V4MA 2KG0A 3RW7A 4TU9A 4IUFA 4LMZA 4CH1A 3IWNC 2RRAA 2XB2D 2CQCA 2DO4A 1G2EA 2EK1A 3VF0B 2LXIA 2N82B 2M52A 3G6ES 1HA1A 5CYJA 2MPUA 2DNMA 3VALA 2D9OA 2HYIB 3TYTA 1Q81T 1U6BA 1SJ4P 4FXVA 4PKDB 3NS5A 2AYBA 1N8RT 2RU3A 2RS2A 2VOOA 4Z2XA 2GHPA 1VQ7S 2LECA 3MUVP 1WI6A 2LKZA 1KOHA 1U1KA 2KRRA 1WEYA 1DRZA 1ZZFA 2N7CA 2QA4S 2XNQA 2AYEA 2M7SA 1U1PA 2RS8A 3I56S 2CPEA 2RQCA 3RW6A 2M4MA 1FXLA 2E5GA 3ULHA 1VC0A 1X4GA 2DGVA 2ZJRQ 2OSRA 1WG5A 2KVIA 1WHWA 2MQMA 2NZ4A 3TO8A 1UAWA 4C7QA 2CPYA 2DNHA 2YTCA 1X4BA 1DZ5A 2CQIA 4W92B 2DK2A 3UCUP 4J5OA 1X5SA 1WI8A 2CQPA 1WG4A 2V94A 4YB1P 4ZKAA 1UW4A 1WTBA 1U1QA 3UD3P 3BO2A 1SXLA 1VQ4S 2KM8C 4FXWA 1JMTA 2G4BA 4PRFA 2MJUA 4QU7A 3N9UC 3CCQS 1NU4A 5IFMA 5DDRC 2HVZA 3G96A 3EGZA 2DIVA 5FJ4A 4WFNQ 2DISA 5EN1A 2CQHA 1YJWS 5MLCV 2KN4A 3VAGA 2EK6A 2RQ4A 4RU2A 2MKIA 2J0QD 2MKHA 5DDPC 2U1AA 3P5TL 1RKJA 2MKCA 3R27A 1FJCA 2JX2A 2CPJA 5IM0B 3CULA 2KFYA 4Y0FA 2M88A 2CJKA 2YKAA 2ADBA 4YOEA 2MZTA 3P6YC 2RRBA 2KRBA 4WCEQ 3MURP 1W2BR 3CCUS 2DNYA 2KXHA 1NO8A 2LYVA 4V19X 2M8DB 3ZZYA 5GAHU 5CXTA 2DHGA 3H2VE 5LXRA 1NJIT 3G8TA 2DNZA 2E5JA 2KYXA 2KHCA 4WFAQ 2CPFA 3MI7X 2X1AA 1OPIA 1X4EA 1U2FA 3CD6S 2MMYA 4ED5A 2CPXA 1S72S 2YWKA 2N3OA 3G9CA 3B4DA 3LPYA 1SJQA 1YJ9S 2LA4A 3SDEA 5LSLA 2E5IA 2KI2A 1X4HA 3BEGB 3R1HA 3CF5Q 3UCZP 2GO9A 2MZSA 1U1NA 2AYGA 2J0SD 4WF9Q 1WF0A 2MSSA 2HGNA 2KG1A 2DNNA 1VC5A 3THTA 3MXHP 3G8SA 3TP2A 2CQ4A 1PGZA 2MY7A 1VQLS 4ERDA 4TU7A 2RT3A 3EGNA 2DITA 3DXBA 2LXUA 1YJNS 1RK8A 5GAGU 3MUMP 4TLQA 1N88A 3CC4S 3FEXB 1YI2S 2LMIA 1M1KT 2DGSA 3G71S 3S7RA 1YITS 1VQKS 3P49B 1K8AT 1FHTA 2KM8B 1ZH5A 2CQDA 2A3JA 2K8GA 4F02A 3MD1A 3UWTA 5JVHQ 1X4FA 1OIAA 2DGXA 2UP1A 1WWHA 2HGMA 2MZRA 3I55S 2EVZA 4P6QA 1VQ9S 3BS9A 1HD1A 1UP1A 1VBYA 3DLLQ 1VQNS 3SXLA 2CQ3A 1KC8T 4LJMA 5DM6Q 2L08A 2JRSA 2MQNA 3S8SA 1VQ8S 2MY8A 3CCLS 4LIRA 4WFBQ 1S79A 3JB9k 4QQBA 1YTYA 2N3LA 1QVGR 3CUNA 3VAHA 2MB0B 2ADCA 2JVOA 2X1GA 3MDFA 4Y00A 1U1OA 3Q2TC
chains in the Genus database with same CATH superfamily
1VHFA 5H9FJ 1WF1A 2ACYA 2RHSB 4H4OA 1UVKA 1XR6A 3PEJA 1JJCB 4HDHA 3CO0P 2OPPA 4OLOA 2COLA 3AB4B 3NBPB 5D0GA 3LWMA 3T9ZA 1WEXA 1YBUA 3G2XA 2BR0A 4DS5A 3HSJA 2JFKA 5G0RB 2ZD1B 2MQQA 2VQFJ 5KG3A 2VQEJ 3C15A 1TKTB 2KXFA 4KR0B 2R2UA 1ZTTA 1Y0HA 3PRDA 3EYZA 3C15B 3PKMA 2WB1D 3HFVA 4M5DB 5CAAA 5L46A 4F0KA 1KBRA 2F65A 1FA0A 2I38A 3DM2A 4I7FB 2XQCA 2GVZB 4X65J 2HYIB 1X31C 1HNVB 4USWA 4WYWA 3OUYB 1G1XA 6FDRA 1O0PA 3KLGA 4LF9F 4UQTA 2GGPA 3RBXA 5F8IA 2WBMA 4LF2A 3DMJA 4WPAA 3QWUA 4P75A 1CJUB 2FZGB 1K47A 4HHHA 1HPZB 3CT9A 4M5IA 2GMJA 5ETNA 1UEVA 2KJWA 3BGFA 3ZTOA 1E6VB 3TAQA 4UY8T 2VFUA 1AA1B 2ALYB 2O01C 3CJQA 3MMBB 4BDPA 2JWNA 3BO4A 4FYYB 3FMBA 1JJHA 3J7YU 1TK5A 3LW5C 3DLBA 2CG8A 4IOAQ 1GQEA 3DRSA 4ZPCA 3NAHA 2N82B 4JYAJ 2UXDJ 3CNQP 2ZD1A 1OQ3A 2J76E 2QO3A 1HQUA 2RH3A 5T41A 2CAJA 2OPQA 1QY7A 3MEEA 3S6EA 3WDOA 5KFOA 2OELA 3W8PA 3JAMU 4HT5A 4LF4F 1S9EA 3BGUA 4ILLA 1JLFB 2G1DA 5LT5A 3HFKA 3TAPA 3Q8YA 1RUSA 2QLXA 3DOMA 3M05A 4UOFA 1ZPVA 2YKOA 4RUBA 4LVNP 4WP9A 3QT8A 5A2QU 5CD4H 4DV1J 1RWPB 1KNZA 3CDWA 3LALA 3TEHB 3DM2B 4I7FA 3M8WA 1HWJA 4QWDA 4RW4A 4YR0A 1DJ0A 5E7OB 2WBRA 3DLKB 1R0BG 3UQSA 1H2UX 1Z2LA 5HROB 2PIIA 4PG7A 3H40A 2OJ3A 1XR7A 4OX7A 4U8VA 4DSKA 3PV8A 1FESA 2QC3A 2R7OA 4CLWA 3AQOA 4PPDA 4BWJA 4ES1A 5DLGA 1HQEB 3H4DA 1EKSA 1QAJA 2BJ9A 4HEA9 3JYTB 1HHTP 4DV5F 1MW7A 3EMTA 3G86A 3IS9B 2HFNA 2OPPB 3NMRA 1DTTB 3K5PA 3CCES 3GTYX 2XYPB 3AQPA 2V2ZA 3D1OA 2MJNA 3PW0A 4B3MJ 1C0TB 1NKCA 1FT8A 2BXJA 2GS8A 3DMJB 2R4FA 3GMGA 3PYFA 4NCBA 4WIQA 1AFIA 3RTVA 4OZ1A 1KVKA 2XGQA 4NI2A 4JOUA 1LWCA 1ZYQA 1Q82T 1S9GA 3NOGA 2XI3A 4GO7X 1RTHA 4ZVRB 1Q86T 1K9MT 2G2YA 2ZITA 1VQMS 2V4JB 1VQSA 1RHQB 4IG0A 1SJRA 1FDAA 3GFHA 3ISND 2W9BB 3QBCA 2I2YA 5KFRA 1IN0A 1YGYA 3Q2SC 2YWEA 4NA3A 2AGPA 1RT3B 3R8YA 4LFBF 3I0SA 2DNLA 2ABYA 5HL7Q 3EJMA 1QUVA 3W7BA 1NK0A 1BWEA 4HLBA 2D7SA 2Z2YB 5K5MA 4DSIA 1HYSA 4LF5F 4DLGA 3TUIC 3CJ4A 4PAAA 3V81A 1N4LA 3BBBA 3QWPA 4OL8A 2FY1A 1TFYA 4AT1B 1FRJA 1HQEA 2C3YA 4XPEA 1A9NB 4IFVB 4NZ7A 2I9SA 2ZDPA 4O4GB 3D5MA 2ZWOA 2DNOA 2X7IA 3PRVA 4J9MA 2XZDB 1NK4A 4B9NA 1N33J 4WK1A 2ZNZA 2VB6A 3T1YF 4UOCA 3UFCX 3G6YA 1SB6A 3R1LA 4ID5B 1X9MA 3MM6A 3TRGA 4ITSA 3V4IA 4EK2A 3BO3A 1PJ7A 1XTZA 3IA0A 1HI8A 5LXYA 1NK8A 2V4RA 1RTHB 2X1FA 3NNCA 2Q1LA 4J91A 3SCIE 3SQOP 3AD9C 1T03B 1VQ5S 2F40A 4WZMA 1RHKB 4DFKA 3W2WA 1RT7B 4OYOA 1P8GA 1LWFA 5HMYA 3MAHA 1LWEB 4L72B 1JLBB 3FEYB 3VGVA 3QJLA 3FCVA 4LRDA 3TJ9A 2AJ1A 3QJJA 2OTLS 4YDXA 3E01A 1S7HA 1LW0B 3ZC4A 1S0NA 4N76A 2XMKA 3AH6A 3CCJS 2HW3A 2HVIA 3EDRB 1IM4A 2CPHA 2KO1A 4OI1A 3SQGB 4QWAA 3KK3A 2R8IA 2QEXS 1NZAA 3RB6A 4G1QA 1D8ZA 2HQGA 1F60B 3BSCA 3FFIA 3FSYA 1X5PA 2AF6A 2HRYA 2AKWB 1RWXB 2I8EA 3OT9A 2YWWA 2LQ5A 4AQYJ 1PJ5A 1RCOB 4DR4J 2APOA 3PYEA 1MWQA 1WKKA 1WORA 2CXEA 2JC1A 2M9KA 3AHPA 1LFWA 4Y2MA 2HNZB 2BKNA 2CQ2A 4K2XA 2V4QA 4KFBB 5HP1B 1T9TA 4F2RA 4OQJA 3CO9A 4JV2A 4PUOA 1TL7B 2AX1A 1RWVB 4C2MA 2K1RA 5LMNJ 4LF8F 3HD1A 4RW9A 2CPDA 5DDOC 4CH7A 3IRXB 3RJMB 3VAJA 3BN7A 1HD0A 1NK5A 1CJVB 1VJQA 2VG5A 3EVMA 1UMJA 1R8CA 3R97A 4O44A 4DPYA 1BY9A 2HS4A 1EP4A 1LW2B 1RE1B 3QGIA 4RZRA 4DX7A 4R5PA 5DZ7A 1FNMA 1VS3A 2DGUA 1JNZB 3TZWA 3QT6A 4TU8A 1WG1A 3DRSB 3G4SS 3T5LA 2DVIA 4ELVA 1R8HA 2GQ2A 1MROA 3PIPQ 1X0FA 3HULA 2V9WA 2UUTA 3NY0A 4L75A 4OX6A 2Y1IA 4C0OC 1S6UA 2NXUA 2DGWA 1V3ZA 1PKUA 1N36J 2CVIA 4J37A 3BQ0A 5B0EA 2EKYA 4KO0B 4ZPBA 2VODA 3I32A 1S1XA 1N0UA 1H2VZ 1YZ7A 2CPZA 3QNWB 4RNOA 2YNGA 4QW9A 1AFJA 4CIOA 4M63A 4FDFA 4EBCA 1B0PA 5LJ5Y 4JV5F 2W2PP 4KIAA 2ZC4A 2OEJA 4I56A 5IV4A 2MQLA 2VDHA 3PFEA 2FJEB 2RF2A 3OFEA 4OHWA 3ZFVA 1FCAA 6FD1A 1IBLJ 2W8LA 4DU7A 3E01B 5HO4A 4DWIA 4K4SA 2LCWA 3K8VA 2HNYB 4DV0J 4PG4A 5ETPA 4RW6A 2KG0A 4TU9A 4KHMA 1DARA 2IIHA 3HJVA 4CLLA 1EETB 1FKOA 1H38A 1U0HB 2KJVA 3GPAA 2OPSA 2W4DA 3TX0A 2ZBQA 2WTFA 2UVUA 4DCPB 1HMVA 1S57A 1W2IA 2W4PA 4O3PA 3OL9A 2CUYA 3MGJA 2VQEF 4WTYA 3CJ3A 3GE9A 4OMFG 2EK1A 4OX9F 1BQMA 1RTIA 2MLZA 3VF0B 1IJFB 1HNIA 3QLHA 4LBHA 4DUYF 4K7QA 2ZOGA 1YDLA 3DOKA 2EI5A 4J9LA 2FLOA 5DQHA 4GKKJ 2DT9A 2ZBIA 3PJWA 4O4RA 1U6BA 5KFZA 3T1YJ 1BQNB 1UWBB 3K2YA 3IR6B 3MM9A 2HFVA 2YKMB 3R5CA 2RS2A 4IQXA 4W98A 3H5YA 1BQNA 3MPWA 2QA4G 5D0RA 1VQ7S 1TKXA 4KH0B 3A8KA 3SFUA 5DGAA 1X9SA 2C2KB 2RDDA 3M32A 3BYRA 2HFOA 3CDEA 3DNCA 1MN7A 4IFYB 3TVZA 1WI6A 2LKZA 1WEYA 3DDNA 1ZZFA 2VD3A 3KMQA 1RBOB 3DDKA 1BQMB 3M6XA 4YR2A 1BGXT 4NLWA 1SKWA 1JB0C 4P9SA 5KFBA 3LAKA 3ULHA 2J9EA 4MIWA 4ZHRB 1PAUB 1X4GA 2AX0A 1Q5YA 4RBVA 4ZS6A 2LQ8A 5HK4A 3OL6A 2KVIA 2KFNA 3L7UA 4NYOA 1C1CB 3TO8A 2GJFA 4JI8F 2N4CA 1UAWA 3MMBA 3RU0A 4AUKA 2CPYA 2DNHA 2RKIA 1E6VA 3FRZA 2YTCA 2WOMB 3CDUA 3JXOA 3OFFA 4KYZA 4YB5A 5ETMA 3KLVA 2CQIA 2DPJA 1D1UA 2WVFA 4J5OA 4Q2MA 1IBCB 1RSCA 2B51A 5F3ZA 1X60A 2VFSA 2HFZA 1EAYC 3D67A 1QUPA 2CQPA 2C42A 3OTCA 2FTRA 2NSCA 4ZP9A 3TEGA 4BBYA 5C2GA 1SUQB 3AXKA 1FTRA 5GADI 4HACA 1I3OB 4AFFA 4YB1P 4OJHA 1FXDA 1UZDA 2AMCB 4TNOA 5EX0A 2V63A 3IS9A 3O6QA 1UVIA 1LEOA 4FYVB 3UD3P 2MQ8A 1S0VA 3BO2A 1RTIB 3HP6A 1SXLA 5L8RC 4KGMA 1XBWA 2ZVSA 4MAKA 4OZ2A 3OL7A 2XO7A 3UNGC 1D8YA 5KFLA 3BKUA 3IMQJ 1CS4B 4JI6J 2WVCA 2YX7A 4PRFA 2MJUA 5C24B 3GV7B 2HHSA 4ZIVA 4XDDA 3MR2A 4NLTA 4JI5J 2LQJA 1IR2A 4B3RF 2KL8A 4PZVA 1HBUB 1RT2B 3V6JA 2FJAB 2R7TA 4D3GA 2R7QA 3BN4A 4RW4B 3ZZUA 4F2SA 3HHEA 4DEZA 2HEKA 2YNFA 2VPYB 4GO5X 4AYBD 4DV7J 4JI2F 4C8KA 2DIVA 2P6TA 3TJ8A 5FJ4A 1RXOB 1XR5A 2FDNA 3BREA 3D1HA 1PIEA 2BDPA 2CQHA 2QZ8A 3CJRA 1YJWS 5EN1A 4ALZA 4NLQA 1JK9B 1S6OA 2RKIB 4N8NA 5ADZA 4A8KA 2XMUA 7AT1B 3G8QA 4FF2A 3R5BA 4RU2A 1EHWA 3FQLA 2EBGA 3MWBA 2MKHA 2YY3A 1U2CA 3P5TL 2HLTA 4FVMA 1HQUB 2JX2A 1X0PA 1RWNB 1FK9B 2V2QA 3DLJA 4MKVA 3SCLE 3HVTA 5KFGA 2LU2A 4CYUA 5IT4A 2XCAA 3IR5B 5L1JA 3P45B 1XNQJ 4B02A 3OVBA 2YKAA 3M9NB 4U9RA 3LGHA 3SCJE 3PHEA 3ENWA 1MSWD 2RMLA 4EYIB 3PO5A 2AIRB 2YQ3A 3N79A 5I42B 1ICEB 4B3OA 4LREA 3OQ2A 2A18A 2IM1A 1RA7A 5F8NA 4Y2KA 4QYRA 4JV0A 2LYVA 1KFDA 3N01A 2RIJA 2Z2LA 2DYAA 3RBEA 3P96A 1VBYA 2BE2A 3ZZYA 2V0NA 2UV8A 4ZN3A 3M32B 4IFYA 2DHGA 5D15A 4ZCMA 2V8HA 5H9EK 3H5UA 4J9OA 5L1LA 1OSCA 1S12A 4RW9B 1ZAVA 4FS1A 4UOHA 4FF4A 3I6PA 1XC9A 4ZVTB 3DYAB 3IG1B 4DOZA 5KFHA 3GFXA 5K8PA 1IBKJ 4JI2J 4ILMA 4HTJA 1RHMB 4HKQA 2OPQB 1YVFA 3FBCA 2KT2A 3R7NB 1O51A 2ASJA 1K1QA 2X1AA 4LRCA 1UWAA 4F3QA 2B4VA 4AD6A 1KHWA 3CD6S 1JIHA 4JI6F 3NGRA 4HHJA 2P9EA 5KFDA 1KS2A 3KK3B 2UXBF 2AEJA 3KNAA 2CJ9A 3TA2A 5AJ3J 4F4YA 2HSEB 3B4DA 5KFYA 2RD5C 3HCXA 4I69A 4B3TF 1U09A 1TFWA 4HDGA 2R8GA 4O23A 1U0HA 4NRUA 1SI9A 1HPZA 2HZAA 3MM7B 3Q8QB 4H4MB 4KHPJ 3LTOA 2E5IA 3TW0A 2ZZMA 1HKAA 2IC3A 3GIKA 2QFIA 3CJKB 1SC4B 1D09B 1R31A 2MZSA 2J0SD 3AB2B 1NK7A 3CCTA 2ACMA 4O3NA 4ED7A 4NZ0A 4OZNA 1IM6A 5DQGA 5KFTA 4DMZA 3BKTA 3HHKA 3MEDB 3UR3C 3AODA 1S1XB 3MR5A 3GIMA 3O1LA 3DN9A 3PJXA 3G8SA 2FGCA 4KAIA 4ER8A 1HWLA 4ZVUB 1L3VA 2G13A 2PO4A 4PYDA 1GTHA 1VQLS 3EZOA 4ERDA 3D3BJ 3UN3A 2Z56B 4IFVA 3VHQA 2RT3A 3SYZA 4QYZJ 1VK3A 3EGNA 4QJVA 4USKA 2NXNA 2DITA 3EVOA 4O44B 1JLBA 1T95A 2BJ3A 2GW8A 2OHDA 2JFDA 3DRRB 3GG0A 3HDSA 5GAGU 4MKAA 1SVDA 1VQYA 2NZCA 3CC4S 3DLHA 4M94A 3K58A 2ZHAA 1YX2A 1CQMA 5AJ3F 2R42A 4K59A 2IVFB 5E3AA 2DGSA 4X62F 2K1RB 2UXBJ 4X66F 4U7UK 1LNQA 4LSLA 1VR6A 1VQKS 2GIFA 1K8AT 3GJQB 4AXIA 4GRSA 4M5KA 1N5TA 2JEGA 3KLHB 1VRTA 1OY6A 2K8GA 3MEGA 4IH5A 1TZ0A 4L3NA 4YHHJ 4NLGA 3G6XA 1K44A 4K50A 4GKKF 2ATCB 4ZP7A 2JJ4D 1FVQA 2DR6A 4ANEA 2AGOA 2W2OP 3CJ5A 1RAIB 2IM3A 5KFAA 2ASYA 2JLEA 2ZKUA 1FE4A 5EWGA 2DKOB 2Z0GA 1SL1A 3I55S 1N5QA 4A46A 5L9NA 2KB2A 1M1GA 3ONQA 1VQ9S 2E1MC 3BGRB 4ED0A 5HMXA 1PC4A 5D4PA 3ETMA 3RB0A 4OI4A 1RHRB 4KV8B 1CJTB 4BWMA 4ECQA 1V3SA 4UZCA 1JLAB 2WVBA 1NHUA 2HWIA 2P9GA 5HMWA 3BH6B 4DR5F 2B8PA 2CQ3A 1S49A 3QIPB 4OX8A 1RT5A 1I6JA 4V19J 1S0MA 4C8YA 3GJRB 3KFWX 3T5JA 1RJJA 3BKFA 4NLRA 3ZTSA 1FK9A 2GMLA 4Y2AA 5IWAJ 4X64F 1VQ8S 3RB4A 3GCWP 3CCLS 1WOSA 4LIRA 4WFBQ 4DR2J 2FVQA 2FLNA 1S1VA 4ZPVR 3KLEA 2HG4A 4RW8B 2KTQA 2J0WA 4Y00A 1PSDA 1ZPWX 2X1GA 3NCPA 5EWEA 4J9KA 1B0TA 4CWBA 2H3EB 3KJNB 2RE1A 1C2PA 1D9AA 2FC8A 2FJDB 5T7LA 4E98A 2OSQA 4YFUA 3CGIA 3JSMB 1HBMA 1U1MA 2DB1A 2VASA 4IR1A 3NP5A 2WW8A 5DG8A 3IWLA 2A1BA 3K8WA 5ETLA 4DL2A 2V8DA 3NXZA 1VQOS 3H8YA 4L74A 2ROEA 3ELHA 3QJPA 3M30B 4CQ1A 1YK9A 3F41A 1ZM9A 3GFZA 1Y11A 3MM8A 3SCKE 2EWHA 4P7TA 1CC7A 5E0OA 1CVJA 1Y5NB 2B43A 3BV8A 3M8QA 2R3VA 1B7FA 1U6ZA 2QMUB 4LF8J 3NBPA 2PEHA 3GSIA 2LVWA 4C97A 3MAAA 2V6AA 2J8AA 5E41A 4RJVA 3OSNA 2K3KA 3PFOA 2CDRB 1REGX 5K14B 4LIWA 2ASDA 5KFCA 2IPOB 2OEMA 4X4QA 3PW5A 4KY3A 2XWYA 2DCUB 1WC3A 3OHAA 2ZH6A 1T3NA 3IRWP 3CCZA 2VH7A 1RAFB 5D4NA 1UVJA 4M1KA 1PC5A 5DQIA 5ITHA 4GKJF 3ZTQA 1IWAA 4M5NA 5M2PA 2V8VA 1R6YA 2QGFB 2SXLA 3EICA 1BC6A 1AROP 2MLYA 1U26A 4IH6A 5HBMA 1C0TA 1CJKB 1RKIA 2RVJA 5KFSA 3U1MA 3EDQB 4UUXA 1LWFB 2K3IA 1LXJA 2F9DA 4USUA 1K73T 2FLLA 2NQPA 1JJ4A 2Q79A 4CLYA 2PD1A 2XZWA 1O6XA 3CMAS 2HK2A 4ZIWA 4X4TA 2ZH2A 3DLKA 4ZOSA 5L1IA 1TK8A 3WX8A 3HM9A 4OYZA 4YY3F 4K4WA 3HZEA 2Y1JA 2HQCA 2Z57B 4LF6J 4OJ3A 4BS2A 2BVZA 4KPCA 5GAGI 2CQ0A 3QQCD 4C8OA 2XS2A 3TUPA 2OEKA 5KFWA 1OSDA 5IOLA 3OV7A 1H73A 1HWIA 3MF5A 1QE1A 4CO4A 2ZBPA 5FD1A 2O1PA 4J9UE 4OHXA 2MGZA 2VBZA 3T3FA 4DL3A 1BQXA 3GYNA 5HN0A 1VC6A 3M1VA 1QE1B 2XCPA 4DV4F 4NLPA 1TMJA 3AD8C 2DXFA 4ZPTR 2IJFA 2L3MA 4Y6IA 4CLTA 1LK5A 2IRUA 5I3QA 3TQ1A 1S99A 2IYGA 2RNEA 3CMQA 3LP1B 3NGUA 3Q89A 4I0WA 4QIVA 3WIVA 4F0HA 2AJ2A 4PWDA 1XMQF 4WKRA 2UXCF 3J81j 1S4FA 1EZZB 2H48B 2LEAA 2ZNYA 3LF0A 3R7SB 2FHOB 3TOQA 3DGPA 3TI0A 1J5EJ 3W9IA 2F4VF 2BM1A 4JP8A 5F8JA 3IC1A 3CDBA 2PN6A 4C8ZA 1WDDA 3R2CJ 1VQ6S 1V5IB 3D9BA 4MK7A 2ROGA 5D4LA 4ZVHA 3PZPA 4DQPA 3B82A 3SI8A 1S48A 3TAMB 3OVAA 3GILA 1VYAA 4UZBA 4NEZA 3T1HJ 1M5KC 4ZP6A 3S01A 2UUAJ 4X4PA 1RA6A 1WELA 3Q22A 1WC4A 2ZFHA 1VBZA 4USVA 5JVGQ 1WC5A 3D66A 4AXJA 3CC7S 2HRUA 5E2QA 4CLZA 4OJ1A 2KDOA 3PX0A 3HF5A 2XZTB 1LV5A 1VLYA 2GQCA 1FRHA 4EWTA 4ZVQB 2IDLA 4YUDA 4RUCA 3H59A 3QRPA 3J7ZT 1NJZA 3AA8A 2DO0A 2QRRA 3CMES 1I1GA 1ZM2A 2PE8A 4FKYA 4KB7A 5M2UA 1HNZF 5G0RA 3NAIA 3SDEB 5LSRA 3S1TA 4IOCQ 3J7A1 2GJIA 1SJ3P 1NMEB 3LP1A 4L6V3 1IQZA 3MOZA 3PRBA 3SSSA 2HBQB 4G6VB 2MQPA 5D3GB 2B0GA 2NYIA 3IFEA 3ISNC 3N0VA 3SMZA 4CCHA 1SPBP 1TKXB 2HS3A 2UVRA 2V9KA 2ZDOA 5D0EA 2HZCA 5DDQC 2HHVA 1M90T 1KVIA 4IO1A 2KH9A 4JI1F 3GIIA 4QWEA 1TMMA 3O8WA 4DI6A 3PXGa 3THVA 1D9DA 4DX6A 3UI3A 2FGOA 3JSMA 4QR1A 4MT1A 3MD3A 2KU7A 1GNKA 2MKSA 2DEJA 1GAOA 4V1Ak 3KLIA 2ZH8A 2ZVIA 4G1IA 1WHYA 1Q8BA 1TL1A 1NNDA 1P9QC 3KK2A 2ZWPA 1S1VB 2IVYA 4PG5A 2GFFA 4KGVB 2DNKA 4RW8A 2RB7A 3ZZPA 5AE3A 4DG1B 1KOOA 3KLEB 3K5NA 4C4WA 4WKYA 4A8QA 4JI0F 1HBOA 5AE2A 4EYHB 3K5MA 2LP4A 1OQ6A 1GX5A 1RABB 1T9WA 3Q8SB 1FEHA 4NLOA 4DR7J 2WSCC 2F8HA 1U1RA 1WF2A 2HQIA 1QJHA 4HVZA 4ETXA 4U6PA 3POTB 2QA2A 3V6KA 4BC9A 4DV5J 3KHRA 1U47A 3K89A 3JQJA 4XPCA 5HLFA 1DLOB 2D74B 2Q66A 3OVSA 1YBAA 3P8BB 4DR7F 3HKZD 4IRDA 2CQGA 3PIOQ 3FZBA 3W2WB 3PR5B 3F44A 2MZ1A 3QZ8A 2V67A 3KDNA 3TJAA 5J2QB 2EC0A 2CDQA 4NLVA 2HPUA 4JUZA 3CSKA 4O3SA 4DQSA 1HI0P 2DY1A 2V2VA 1WEZA 2J6TA 2YPYA 2RHQB 1UFLA 1HI1A 2MKJA 2XULA 2F9JA 4MFBB 4Q0BA 5F0WA 1HMVB 1SBRA 1Y3JA 1R0CB 2DCLA 2CQBA 5K8NA 2YKNA 3PHTA 5EDWA 2FVPA 1A0OB 4Y3CA 5THWA 4YEAA 1EETA 1FKOB 1UFWA 2KT5A 4ID8A 3IBWA 4Y2CA 1KTQA 4IQMA 2RQKA 3KXDA 2L48A 3CJ2A 3WIUA 1FJEB 1C0UA 2HHHF 2X1BA 3V81B 4CTAA 4IOBA 2DR9A 5KAKA 3I5AA 3OLAA 3GV5B 2RJZA 1CSJA 1OJ4A 1I5OB 1IVZA 5IXUA 2FLPA 4A8XA 2BYCA 1GMVA 4P71A 1P1TA 5IC6B 5A8RB 4F36A 4DX8H 1WSVA 2YX1A 4P74A 2CG4A 3QMQA 4PYAA 1U1LA 1YJVA 4DR2F 2AZ3A 1QAXA 1HIYA 4LQ9A 4WTOB 5H1SV 3LWLA 1Q1KA 2M70A 4F25A 4KPYA 1LK7A 1C1BB 2HS0A 1BXNA 2QL5B 3DLEB 3IGNA 4ZCKA 3HVWA 1R8PA 2G0CA 1S9FA 1ZETA 2XG8A 2CJAA 4Q2LA 2EEYA 2C3PA 2QFJA 4WIIA 2NLWA 3QT5A 5B0AA 1C4AA 3VAIA 4N77A 2FVRA 2D1CA 3CIZA 2DXEA 4ZLNA 3V6DB 3RAXA 3KUGA 2XLIA 2EXUA 1FDNA 3IRXA 3K59A 2CQCA 2ZZTA 1FFGB 2IYIA 4N56A 2HK3A 4DUTA 3D0GE 2ZOFA 2C2OB 3FCWA 3LH2S 5J1NA 3ETOA 2BJ8A 1TKDA 5CYJA 5HROA 5ETOA 1SV5A 2AGQA 1DTQA 1VCTA 1DAXA 2BANB 3TYTA 4A8WA 4MFBA 4E8UA 2BRLA 4IYQA 3B6BA 1SV5B 4LBPA 4RX6A 3WX4A 5C25B 2R2RA 2Q43A 2HQ3A 1OPZA 1L3SA 2XO6A 3CB4A 2AYBA 4LF6F 4Q8FA 2Y0SD 3AY0A 4Z2XA 5HVFA 1V9OA 2I1RA 1VIXA 4X66J 4ZLLA 2BKOA 3VR1A 3A4TA 4CM0A 3DLGA 5JUMA 4X62J 2LECA 1H7WA 2Y8YA 5KFNA 4DR6J 1KOHA 3OFGA 3W65A 2VICA 3EXYA 1DRZA 3OBIA 1OY9A 2BE2B 2AYEA 2HNYA 2CIMA 2NUHA 1VBKA 2YKPA 1FRKA 1VRUB 2E5GA 2UUBF 4KGXB 3EPGA 4B3OB 2A10A 1IKWA 4ZCIA 2UXCJ 3MPYA 1GTEA 1J5OB 2VJVA 2DGVA 2XHWA 5J2MA 1F5BA 3I5CA 3KTQA 2MQMA 1REVA 4FBTA 5CCMA 4A47A 4C7QA 3IO1A 2OP5A 2WAQD 2Z8QA 4ID5A 1S7IA 1X4BA 2JDJA 1Y10A 2B6AA 4RNMA 1DZ5A 1RU1A 3ENVA 3MECB 4O0NA 2R2SA 5C5JA 1HHSA 2KT3A 4ECUA 4NCAA 1S6QA 3ZNJ1 2B8QA 4KQZA 3MFHA 4I6WA 2Y8WA 3OR2A 1JLCA 3KLIB 4DR5J 1WG4A 1WUUA 4FPIA 3D6FB 3T1AA 4DV6J 2V94A 3TR5A 1F3VA 2YNFB 4URQU 2BJDA 2HMIA 2ZM6J 4DQRA 4RBTA 4ED2A 4J9QA 1HLWA 2QLWA 3AXMA 1YZ6A 3C6TB 4R8UB 4TVAB 4DS4A 3PVXA 1R8BA 2W25A 3ITHB 1VQ4S 2DPIA 4OLPA 3N6MA 3OFHA 1QD1A 3UPFA 2G4BA 3IGVA 6AT1B 3OTOJ 4FZVA 4EEYA 4ZJOA 1UPPA 1CS4A 4OHZA 1Q4RA 3CCQS 4L3KA 4M5MA 4PQUB 4AE5A 1NU4A 2GO8A 1JXVA 3IN5A 4DUZJ 2VG6B 2AP6A 2ZOMA 3M2UB 3H7HB 3M2VA 3FQKA 3CW2C 2HVZA 4RW7B 4DPUA 3I82A 3J81U 4M95A 4RLEA 4ECSA 3EGZA 1S9GB 4XO0A 4I64A 2C3UA 2Z58B 3ZTPA 1R0AB 2OUGA 1MNEA 2GC8A 5MLCV 2GX8A 4B9VA 3VAGA 3RAMA 1RLCL 3M9OB 3PCOB 1FDDA 2GNKA 2HWTA 2NUUG 3HHLA 2RQ4A 4I2PA 3FNNA 4TN2A 3MCSA 3ZZ0A 4XIUA 3KLFB 2DY9A 5DDPC 1D3WA 2U1AA 2WSEC 3R27A 4X4NA 1EX8A 1NJYA 5IM0B 4B9SA 1FJCA 2KFYA 2HKEA 2ZHBA 4ECTA 2M88A 3CCWA 4OFZA 2ADBA 4KH1B 4WZQA 4MJKA 5J2MB 2MZTA 3MM5B 2R8JA 4NA1A 1CEZA 4FYWB 1R3NA 2KRBA 3LO3A 3LP2B 2E7VA 2V50A 4QIGA 4WCEQ 4B08A 4QYZK 2WSFC 1SIWB 1NO8A 4V19X 1NK6A 1Y3KA 2HLUA 4R0JA 2EFVA 4NLDA 3OR1B 5CXTA 3LUYA 1OY8A 1WC6A 2GGPB 2Q3PA 3OPKA 5E3PA 1KFSA 1DFDA 3KNGA 3KLGB 5CYQB 2KHDA 4EO8A 4ENOA 5IS2A 5CZXA 4OYMA 3HHDA 3MM9B 3VZIA 2E5JA 2QMWA 2C2EA 2KHCA 1HW9A 1AYEA 4YHHF 1NB7A 4I1TA 4WFAQ 2C28A 1EIYB 2EFNA 1H72C 2RQMA 4X64J 4YR3A 3E2EA 2IRXA 3I4PA 2BW7A 1Y5IB 4JI3F 4PUOB 2HIQA 2VV5A 2UV8G 4MIBA 4OYIA 1VMBA 4YY3J 3C16B 4X4RA 4GC6A 3K7RA 4ED5A 3R9LA 3U02A 2EFQA 1L3TA 4DQQA 4B9LA 1S72S 5KT3A 5FIIA 3G9CA 5KFXA 1IKVB 1WSRA 3W63A 3BPDA 5KG4A 2W9CA 2BUNA 3G6VA 3GLJA 2XMTA 5CH7B 5D0HA 4BC7A 4MH8A 1GMUA 4MK9A 2K7JA 2KI2A 3C6TA 4R8UA 1FWKA 4CO1A 3OXFA 1T7PA 5HBMB 3CF5Q 3GP9A 5AE1A 2HMIB 5K20B 2HFUA 3V6HA 5F0UA 3HJFA 2GVDB 1MMLA 1IWGA 1Q53A 2C1EB 4D3HA 2JEJA 1TP7A 2W2NP 1RTJB 4RPFA 4ZVGA 2MSSA 2KG1A 5J2PA 4LFCF 2KZMA 3BDPA 2DNNA 2QYCA 3NCRA 1RT6A 3MTKA 3ZZRA 2AQ4A 1RWWB 1V5VA 1S10A 4YB6A 1MU2A 2UU9F 2CQ4A 4J9NA 1PGZA 3PW7A 1OS5A 4KO0A 2PMWA 2QL7B 2W9CB 3PJ9A 1RCXB 3NGKA 2X3DA 5FDLA 2HHWA 1H3DA 2CYYA 3QT7A 2LXUA 1YG0A 3CD5A 2B5JB 2ZH3A 2CFXA 1YJNS 1R0AA 2LDIA 4ED8A 4QBUA 4MMOA 3E51A 3FEXB 1JLEB 4WP8A 2LMIA 1YI2S 5IT0A 1PILA 4P10A 4CNZA 3G71S 2VG5B 3BPSP 1S76D 1KKHA 2E9TA 3ILIA 2N4DA 2OAUA 3RZAA 4C0BA 2EC2A 3FUYA 3PEHA 2DRAA 2PI5A 4ZJLA 2EW9A 4I6YA 2Z30B 1FHTA 2KM8B 3NS7B 4XDCA 2CQDA 2Y1RI 3JTOA 4K4VA 1BMQB 1X8DA 1RT4A 2NXEA 4IG3B 3PACA 4O3OA 2ALZA 4C3LA 1IBKF 3QSIA 4DUYJ 2E1RA 5C25A 4DQIA 1OIAA 2V2KA 3FVYA 3V5RA 5I3UB 2J9CA 2OGUA 3RB3A 1D0EA 2R9LA 3DU6A 2E5LJ 2R7UA 4Q7AA 4LR9A 4QIEA 3TZZA 2YX4A 3FSIA 4JI5F 1PAEX 5B0GA 2EVZA 1T05B 1CULA 1RACB 4A8YA 5KFEA 3BS9A 1S6PB 1HD1A 2H5JB 1NSPA 1H74A 1YJRA 2Z2ZA 2OPRA 4ANCA 1UP1A 4DF4A 4B3TJ 4HYKA 2OLWA 4P73A 1DURA 8AT1B 3GSDA 3ISZA 3FBFA 4KV8A 1GMWA 1F0XA 3BB5A 4W4MA 2OPRB 2V8GA 1F6TA 4QZVB 3W61A 3RUBL 1VQNS 2PFDA 4LSNB 3RRHA 4DL0C 2HVEA 4PCQA 3OTBA 5GMEA 2W2MP 2L08A 1AT1B 1Y00A 2DTJA 3UDLA 1P9YA 5K14A 2E5LF 4DCJB 4G65A 3VWSA 3S8SA 2MY8A 4U95A 1I94F 1ZA1B 2BEFA 1S79A 5GAHI 2FIUA 4ANDA 4CO2A 1T03A 1GH8A 3IWXA 3CUNA 2CNOB 3FMWA 2ADCA 5A0YB 3H98A 1EB0A 2YPZA 1TL4A 4ZCLA 4JI8J 1R89A 2QYGA 3UDEA 1RADB 3CJSA 1URNA 1TAUA 3M8QB 3UVJA 4DU8A 4URSA 3TQEA 1NCLA 5CABA 1T94A 2HIYA 2LEBA 2X3GA 2DR8A 4DV7F 2V5HG 5C42B 3NOCA 1SQGA 7FD1A 3UCGA 1YRTA 5HATA 4ZA1A 2FD2A 3U27A 2RDIA 4HTIA 2DHAA 2GV1A 4C6AA 4F67A 5GADU 3OW2R 2ZH4A 3SZ2A 1TU0B 5IV3A 3QAUA 4X4UA 2ILZA 1Q79A 5T7LB 4DPTA 2YH0A 3JSRA 3N5BA 3CCMS 4TY8B 2E7WA 4KFBA 1YRXA 3R5DA 5HJXA 1NRKA 4YDDB 3OLBA 5LMUF 1ULRA 4UW2A 2UU9J 2OIHA 1KDNA 1QSYA 4UF4A 3UVJB 4EUVA 2Y3YA 4MKBA 2AD9A 2XGPA 4OZLA 2WVDA 2IA0A 5B08A 3T6BA 2R2TA 3A3PB 4HI1A 4E2FB 4NXMJ 1B70B 1LWCB 1S59A 3D0HE 2VFRA 3DRXA 3M6UA 4NI2B 4CO3A 4K5RA 1SQEA 3VAMA 4WWSA 1SL0A 1HR0J 3VAKA 3MCNA 1GX6A 2UUBJ 2DH8A 1U2RA 1NJWA 3SSRA 4PQAA 2OI2A 1L3UA 3A3NB 1T9YA 4LSNA 1K1SA 1VBXA 2J8SA 4LBIA 3BR9A 3GIRA 3M8PB 4NWBA 3FK4A 2DRBA 1RWUA 4JV1A 4TXSA 4DPOA 2B4PA 1IBLF 3KG4A 4PXBA 4NMLA 5B0DA 2W9AA 5T14A 1JNRB 1H7XA 4J7CA 2MYFA 1IKXB 4U8YA 2VBYA 3BSOA 4K4TA 3RR7A 1KWMA 4PABA 1IJEB 1TKZA 1X7VA 4H4KA 3MCMA 1HBOB 3W8GA 5D78A 1EJ7L 3T9NA 3ADAC 4CNYA 4DN0A 4EI2A 1VRTB 5BJRA 2XLJA 2FZKB 3ILLA 3KJFB 3DOLA 1RYSA 1TKZB 2XHCA 1G2EA 3T5KA 1NH8A 3W64A 4CDIA 1T11A 2BJ7A 1OO0B 3UO0A 4XK8C 2JSXA 3W66A 2MGZB 3KK2B 4A8SA 2FJWA 3HXMA 2AU0A 3H5SA 3ET6A 3US5A 1ZS6A 4CP5A 3TANA 1NK9A 5CZVA 3CC2S 3OTOF 5ETTA 3DDIA 2G0IA 3E3XA 1HR0F 1T9VA 5GMKa 3GFYA 3X3UA 2CJYB 5B09A 1Q16B 2XM3A 4ILRA 3F0NA 3J7YI 2B9YA 5FDLB 2MHNA 4MYTA 1GT8A 3W3SA 3POTA 3A8EA 3HZGA 2BA9A 3MPUB 3NKYA 1BE4A 5KOXA 4TYBA 3CCRS 3UN5A 4WYLA 1QLNA 1XWLA 3NS6A 5CYMB 3NGDA 2ZJQQ 1KQFB 4ZVPB 4GC7A 1RGVA 1SQFA 4O3QA 5IM0A 3CD7A 4MKYA 2HHQA 1JLQA 1XNRF 1MU2B 1CPZA 3CPWR 2WVEA 2M0GB 3H2LA 1N54B 5B0CA 4CLUA 2YH1A 1N36F 2A2DA 3KHGA 3HHLB 4ES2A 1Z1ZA 2O3DA 4H4MA 3CJKA 4ZVOB 5J2PB 2ZEJA 1F5AA 2C22A 3GWCA 2U2FA 1X4AA 2H1YA 3H2UB 1AB8A 4QW8A 2PT0A 1HNVA 2DHXA 3VV2B 5A8WB 5JMNA 4UUWA 1N5VA 4NLXA 4WP3A 1M5OC 2HVHA 3OSPA 2CKWA 3UD5A 5LJ3Y 1FRLA 2VG6A 3K0JA 2BQ3A 2GA7A 4B3RJ 1BWVA 3DI6A 3VGSA 2HZVA 5F8LA 1VFJA 4K2JA 2VC1A 2I6WA 4NPOA 1LKZA 2F5GA 1FJGF 5D3GA 1AXQA 4I68A 4C8MA 5E3RA 5LSOA 1T05A 3MM8B 5FLXU 2FVSA 3Q23A 1AUDA 4QU6A 3A13A 3HHLD 1DBDA 4NE9C 1KRPA 2VKZG 2I5JB 3TNVA 3EM1A 3TUJC 4IDKB 1NDKA 1S1TA 2EFOA 1ZM3A 2GIRA 1ZAXA 2MZJA 4ZMMA 1NLKL 2ZM6F 1Y9OA 2MEWA 4TLRA 2GJ2A 3B54A 3MPDA 3H25A 2R7SA 2JEFA 3MFIA 1P27B 2ZBCA 3DKDA 5HJYA 2IA6A 4K4YA 2CNNB 1SUQA 2B9WA 4O3RA 2DIUA 4HR2A 5LMNF 4TQRA 1NKEA 3LAMA 2L9DA 5K9FA 2BM0A 1IR0A 3EGVA 2UVVA 3RAQA 2BQUA 3MHYA 3SFGA 2YNIA 2RUGA 2CNLB 2V8PA 4UQGA 1VJWA 1XNRJ 3VTIA 1UCNA 3EE3A 4N5SA 5AT1B 4DXLA 4XTTA 4DFPA 3HO1A 4IKAA 3HKWA 3CD0A 3C2PA 2UXDF 3OJSA 1IKXA 5J1EA 2YBVA 5D8HB 2J7UA 3LOUA 2B9XA 3B78A 4ED3A 4DN9A 2EFGA 1HNZJ 4LR8A 3QO9B 5J1EB 5KG5A 3G87A 5D77A 3UN2A 1IKVA 2VIHA 3EGWB 2D3OR 4UTGA 2NREA 4JI0J 3HK2A 1PG5B 1WHVA 2VBWA 4ZJQA 2R8HA 2UZAA 3NG8A 1NAQA 4CZCA 2B56A 1CJUA 3BZQA 4LUBA 2V68A 2XMWA 1U6FA 3NNAA 1N34F 2ZUGA 3VGUA 1LFPA 1JX4A 3TA1A 4F50A 1RU2A 4UY85 1JXEA 2GVDA 2XMJA 4BLGA 3HMJG 1U45A 4ELUA 1OWXA 1X4DA 3M9MB 1N33F 4ICLB 1R6VA 1YJTA 4EBDA 4PR6A 2E5HA 2JH3A 3FKBA 3QAEA 3RBDA 4KKOB 1UL3A 1Q78A 2DGTA 1KVJA 3H20A 1QVFR 1JLEA 3LPEA 1M5HA 3WZ0A 1NZ8A 3AFGA 3OR1A 1UVLA 2AJ4A 5IC4B 4OIXA 2C2ZB 2HHHJ 2KYZA 3ZNUA 5A8KB 2VG7B 3VQTA 1QM9A 1KD1T 2RILA 4ECRA 2W24A 4DZDA 3L3CA 4P7VA 3C16A 1RT1A 2FJBB 2ASLA 2FZCB 4OYPA 1TUVA 2GQQA 3I96A 3LA0A 4HACB 2VUGA 5I3PA 4ZLJA 2XY5A 4HH1A 4DFMA 1Y7PA 3PTWA 5JJBA 2VA3A 2DEIA 2XWXA 3QFWA 4OJGA 4FYDA 2JVRA 3OR2B 1U0SA 2DNQA 3B4MA 3VCDA 1UVMA 2VOPA 3AOAA 3JSBA 4OI6A 4RBUA 1A7GE 4JV5J 1N6QA 1N5YB 5IT9Y 2EBEA 3N5FA 5CYQA 2ZHOA 1B7YB 3GB0A 1C1CA 1C1BA 4ZITA 1G4CA 3BSNA 2D3ZA 4YMEA 3FBBA 2XS7A 3CJ8A 2HNDA 2ILYA 3GYXB 1KQKA 3TX8A 2ZH9A 3R5GA 3NNHA 1B4SA 2K7KA 2DH7A 4P2XA 1FEEA 1WD6A 1XK8A 1B0VA 2MTLA 1S1WB 4CLPA 2FB0A 2B4UA 1U25A 2DNPA 3A3OB 5CYMA 3DRPB 2VA2A 4OYBA 3RW7A 3EPIA 4GMKA 1NSAA 1ROFA 2WW4A 5J2NB 3MM7A 2CA9A 1FRIA 2IMOA 3VVTA 1CC8A 1JLAA 1QDUB 1HHQA 3MEKA 4CH1A 4LMZA 2RRAA 3MR7A 2AJ0A 4P72A 2XB2D 3U1NA 5HVGA 1BD6A 3DLGB 1T9UA 2LXIA 3QSYB 3DHXA 1RTDB 2YNIB 3BGLA 2Q6CA 1SH2A 2M52A 5DRKA 3TWZA 1S5ZA 4HI2A 3DC2A 4ZVFA 1RI7A 1BHNA 1HA1A 3RRGA 2MPUA 2HWHA 5ETKA 1SKSA 3KJVA 5KFMA 1VOMA 2WONA 2BE9B 2BJEA 2GMHA 3AD7C 4PPZA 3LP0B 1PCAA 3AJ1A 3HT0A 1WOPA 4FXVA 4X65F 3AT1B 5HI7A 1CG2A 3NS5A 4C3MA 3KYLA 1YJUA 2VPWB 4BCAA 3D0IE 2RU3A 1KR4A 4LF4J 4I67A 2GHPA 2HAFA 3ZZTA 4P2MA 2R7VA 3M7VA 2JOQA 5E3CA 4EZ9A 3HT3A 1VI7A 4N8OA 3C14B 4RUHA 4I2QB 4YP3A 1M0SA 4B17A 3P5BP 1REVB 4DR1F 1UVNA 3RG6A 3FFIB 2YWHA 4X4OA 4OYXA 1TL3A 3IXQA 1NUEA 1U1PA 2M7SA 2RS8A 2CPEA 2PDAA 2RQCA 3RW6A 2M4MA 1QSLA 2A6MA 3LGNA 2J0XA 2QG9B 4OZ5A 5KG1A 4C3KA 4ZK7M 5KT4A 4KTQA 1ACMB 4RO0A 2B3TB 2XI2A 4EFAC 1L5UA 3BGRA 3IAS9 3C46A 1WG5A 5ETRA 3A1YG 4QPXA 4K4ZA 3VZHA 2NZ4A 1YSJA 3SSQA 1XJWB 2CZ4A 1RAGB 2NCKL 3CDAA 3W5ZA 5IZHA 2WZ1A 3J81Y 2DR7A 2W4CA 1SCJB 3T1HF 1FKPA 1RAEB 2DK2A 3KHLA 5KG2A 3C6UB 5HAOA 1X5SA 3QFHA 2BKPA 2PA8D 2RU9A 4DV1F 4GVBB 2IY5B 4FNHA 4NLYA 2HQFA 4NYZA 1NEEA 4HT7A 2BANA 4LVOP 4DBQA 5F8GA 1MROB 1J5OA 2ROPA 3I0RA 4ZKAA 4EZ6A 4FN5A 1HBNA 1PBAA 3GQCA 2I0XA 3CJTA 1VISA 1WTBA 4F4KA 2E9ZA 3R6GB 2Y0BB 4DL4A 1J2VA 3FJ2A 4PXCA 2R7RA 2IAJB 1FRXA 1UJ5A 2E1AA 3I9ZA 2AJQA 5C42A 2YQ1A 4CTAB 4F4XA 4QU7A 1SC6A 3D3CJ 3N9UC 5M2RA 4Q5VA 2IBOA 2D69A 1TL5A 2NYHA 1JLCB 1FFWB 2LXFA 5IFMA 5DDRC 1GXTA 2F4VJ 3GJTB 5HQMA 3W2VB 1QVGR 2J7KA 2D41A 3ICLA 1TVRA 2FQQB 4WJBA 4OHYA 2DISA 4NYPA 2UUCF 1N0VC 5KG7A 4WFYA 1XEZA 4FP9A 2V4JA 1T0TV 2LEPA 3ZXWA 4CLSA 2LQBA 2BX6A 3D7SB 3QIPA 2J0QD 4Z7CA 4DJBA 1IUJA 1MMDA 1XERA 1BUXA 1RLDA 2CPJA 1RAJA 1S4EA 2MKCA 1IR1A 4DPXA 3KDOA 3I87A 4HH0A 3CULA 1FX4A 2M3DA 2ZKTA 4OV1A 3KG0A 1TK0A 4OV6A 4YOEA 2H51B 5SZTA 1HW8A 3DFEA 3N4WA 2HBZB 4DR3J 1S6PA 1KTVA 5L39A 3NEKA 1FJGJ 2JEIA 4YS2A 3P6YC 2RRBA 1NPRA 1J5EF 4M5GA 4FBUA 2Y1LB 3OXLA 3CCUS 4USJC 2P9CA 3JYTA 2VQFF 2DNYA 4QCLA 4L76A 2NXCA 5KFPA 2W8KA 4CRJA 1MN9A 1OMSA 4J90A 3EVWA 1B64A 1F5CA 3UR0A 3V4IB 2G1HA 3W62A 5GAHU 3C14A 3H2VE 2ZBRA 4QIFA 4X84A 4JI3J 4RKUC 5LXRA 5H9FK 1EQMA 1ITPA 3R3TA 1K0TA 2BW2A 2G2OA 1MG7A 3SV3A 1FDBA 3CE8A 2KYXA 1S77D 4IG3A 2PMHA 4DL5A 4F4ZA 3GR1A 3ENAA 3Q8UA 2CPFA 3GU0A 4Y65A 4A4JA 4IR9A 5BXIA 3D6MB 2XYGB 1Q95G 4LFAF 1OPIA 1X4EA 3J80U 3OJUA 3W9HA 1ZOTA 4OYWA 4U7CA 1S1TB 2B5JA 2MMYA 5AXMA 3UNYA 3WC0A 1XQIA 3J7AN 2YWKA 3DRPA 2ZE2A 4WU2A 2FJXA 3CIMA 1IKYB 2FJVA 2PFFB 3I0RB 3LPYA 3GONA 3LP2A 1YJ9S 2OPSB 3IBCB 5G4DA 1PJ6A 4YQWA 3SDEA 4JB8B 4IG0B 3Q86A 3N28A 5HQ8A 2W9BA 3R1HA 4TQSA 3M2RB 3WC2A 2GO9A 2PGCA 1HNWF 3ILOA 2CJBA 1U1NA 3JAMY 3O2IA 3N6LA 2HNDB 3MPVA 1UKUA 1WF0A 1ZA2B 3PM9A 4QIWD 2VDIA 4LF9J 3UDCA 3ZTRA 3BBFA 5F8HA 2UUCJ 1HFEL 2DHHA 3HSDA 1SKUB 3MXHP 3RBZA 3TP2A 2H65B 4J9SA 2QLJB 3JQKA 3DHWC 1FI4A 3WHIA 4ZPAA 5DO2A 2QLBB 1RT1B 1IBMF 5F3TA 4N47A 2ZH7A 1NDCA 2W7AA 4TU7A 4DUZF 1A6LA 4E0DA 2AWZA 4TKTA 2NXJA 4KJIA 2HURA 2WRMA 3M8ZA 4CT9A 3X1LB 1RK8A 1UW9A 3D54A 4TLQA 1Q8KA 2DXDA 2UUWA 1N88A 4DR1J 4NZ6A 2IFXA 4UOGA 3EUNA 4Q0BB 4G1PA 5BYSA 3KUEA 2XY6A 2F8EX 3NL0A 4F3OA 1RYRA 2BJ1A 3S7RA 3LANA 1YITS 4NCGB 1FNOA 4NA2A 3ENQA 3MTJA 5K8OA 3FEZA 3DYAA 3IG1A 4MYUA 3HFZB 3P49B 2XLKA 1TL1B 1LWXA 3O44A 3K57A 3DOMB 4K4UA 2JNJA 5AXNA 1ZH5A 2A3JA 4KSEB 3KJVB 4F02A 1SJ1A 2NSBA 3R5JB 4B3SJ 5JVHQ 2J6SA 2DBBA 1GFWB 1RAAB 3RGIA 2UP1A 3VGTA 2VC0A 1WWHA 4M5LA 5IWAF 2VFTA 5ETSA 2V69A 4ECVA 1UA1A 4M5HA 5CD4A 2CWKA 3PYGA 2MZRA 3KOAA 3W60A 4RWWA 4DV2J 2ZUAA 1KLNA 1U8WA 4J9VA 2GZOA 4WBFA 1Q5VA 1QAYA 3SEOA 4F3MA 2XBPA 4OYAA 2HFSA 4FVCA 3PDNA 1X9WA 2H4YB 3M6VA 1KC8T 4LJMA 5DM6Q 1U24A 1JKHB 2JRSA 2OFHX 4QR2A 2MQNA 3QGHA 2VZ9A 2RF2B 1E6YB 1R27B 1D9FA 4B9TA 3JB9k 3HVAA 2UVWA 4QQBA 2KKHA 2N3LA 3C8YA 3VAHA 4I2PB 4AL5A 2JVOA 1U1OA 2EFPA 2JZ5A 3MAAB 1FF2A 4K5SA 2QX0A 4ELTA 3Q2TC 4A8OA 5BYQA 4LT6A 2BE7D 1ZAWA 2CNKB 3CEDA 4M5DA 5HQLA 1H6KX 3IP0A 4MK8A 1N56A 1EARA 2MKKA 2KFZA 4TY9A 3JQMA 3TUZC 7FDRA 4USHA 2A2CA 1N52B 3KKFA 1WC1A 1DQ8A 1SKRA 4P2SA 1VIOA 1YQHA 5KFKA 3DI6B 2IHR1 5K8MA 2VFVA 2VONA 2K2PA 3K17A 2J5AA 2PSZA 3M8SA 2L9WA 2D3UA 3SIPB 1X5TA 2HQDA 9ATCB 4DSJA 2W2QP 3D2WA 4RUAA 3BF4A 1F9FA 2IAJA 4HL9A 3R5AA 4JI7J 4ETZA 1ZM4A 1X4CA 2HGLA 4H4OB 3KHHA 9RUBA 3CTRA 2OO4A 2FHJA 2WCXA 4NASA 3Q0AA 2NS1B 3CCVS 3ZZZA 1RBLA 2HAIA 4Y34A 1RT3A 4EO6A 4LF7J 1VRQC 3TVYA 4USMA 1JLQB 1RBAA 4NLUA 4CM2A 4ECYA 2HHTA 1S1UB 1AUSL 3CJ0A 4LRBA 4F0MA 2HHUA 2H4WB 2XEXA 3P3DA 4QPTA 3C6UA 3MMAB 2DHSA 3HHLC 5DM7Q 1KQGB 5JXSA 1N32F 1GMWD 2BRKA 2VKRA 1N34J 2L41A 3OHBA 2PI4A 3I31A 4FXDA 4DHVA 1XN9A 4RNNA 3HVRA 2FY8A 2ZH1A 4IO9Q 4YB7A 4KGKA 2H5EA 4ZHRA 2IVMA 5BR8J 4IRKA 1M5VC 2BABA 1QSSA 5DETA 4KHPF 2O67A 1FXRA 3D6TB 3M8PA 1VQPS 4F7VA 2KXNB 2N7YA 3CXCR 1QAIA 2H9ZA 1WOOA 3UDVA 1XNQF 1DTTA 2ERRA 3RRKA 1U8SA 5DGBA 2IJNA 2GHWA 3PX4A 3NRBA 2XSFA 1XMOF 3UE2A 1UA0A 4OZ3A 3D1QA 3A8JA 4F26A 1CJVA 1PYTA 2HBRB 2QSFA 3B8HA 4K0KF 4I2QA 5BYRA 4OI2A 4JI4F 2YWGA 4NL5A 2MSTA 4W90B 1JLGA 1PYSB 3FC9A 1WACA 1M5PC 2DNRA 5DJBA 2FUG9 3JTNA 1AZSB 3UD4P 5A0YA 3DOKB 4WU3A 1Q7YT 3BQ2A 5F9LA 3KUHA 1R43A 2LDYA 1FD8A 4DL6A 1FVSA 1P6TA 1AZSA 1FWLA 2DGQA 3IM8A 3LP0A 4FS2A 1KQSR 4ED6A 4OX9J 3MOJB 2VF3A 1I51B 2E44A 3Q8VA 1GXUA 1RTZA 1B3TA 3C66A 3EX7B 1YLXA 3ZZOA 1JLFA 4DCOB 2XS5A 1S9EB 4OHVA 3OL8A 3MM5A 1H2TZ 4JYAF 1W25A 1YWXA 1KSPA 3FRYA 3BGOP 3RYLA 1KEKA 1W7WA 2LLZA 3U1LA 2DNGA 3H4BA 3QYYA 4DV3F 1HNXJ 1RB0A 2AEFA 3GR0A 5FLXY 3I5BA 1HL6A 1U48A 1VHIA 4OI0A 2M2BA 5KT7A 5HVHA 5HP1A 4MTPA 2XMMA 1S1WA 1WKJA 2ZJPQ 3MAQA 3GG1A 1GK8A 3MUTP 3HVTB 3MR6A 4Q8EA 5A2QY 1OYEA 4ECWA 3AAWB 5ETVA 4FYXB 4CYUB 4IRCA 3PNIA 1M5SA 1TVRB 4DSFA 4BHQA 3HI9A 3L4BC 3M8YA 2NPFA 3T41A 3M2VB 4MIAA 1URRA 1RP5A 2CQ1A 3KK1B 3HHNB 2CVEA 2AYMA 3VVUA 2EPIA 3KLHA 1GXLA 5GAEU 1FD2A 4Q44A 1MLAA 4ZP8A 2XNRA 2GVZA 2F1FA 1IKYA 3PR4A 4JI1J 4LR7A 4ED4A 3BDEA 1KONA 3M6WA 1F9HA 1W26A 1WJ9A 2QLFB 3BR8A 4A48A 4IH7A 3MZIA 5D4OA 5CCLA 4AL6A 1QTMA 1KN6A 4WK3A 5EUHA 3BYPA 1UFKA 2BZ2A 3QATA 4ECZA 2XSJB 2YKNB 2W7OA 3TA0A 1FJ7A 1QTNB 1YBTA 2DD8S 5I3UA 1NJXA 1TL7A 5B0FA 3SV4A 1WKLA 4ATNA 2B9EA 2AV5A 1HARA 4KHRA 3F56A 3V2UC 3LQVA 2B7BB 3H42A 1NM2A 2VPZB 2L9NA 3QGPA 4RNFA 2WONB 8ATCB 4QWCA 2VPXB 4F4WA 4DSEA 1RHJB 4CLKA 2AT1B 2C2NA 3MR3A 1VDHA 3EZ5A 2P8IA 1WHXA 2GAHC 3L95X 3K5LA 2IMWP 1IQTA 5J2QA 3JSYA 4AL7A 2UUAF 2OH2A 4RL1A 3D28A 2MXYA 2CZVC 2BACA 3BM7A 3Q8PB 1FNXH 1EQ0A 4ZDNA 2IC3B 1KLMB 3OD2A 5CQGA 4RWXA 4KE5A 1ZTWA 5AXKA 2CRLA 1LWEA 2DJWA 2YXLA 1XMBA 5EWFA 4DV0F 3KWMA 1X5OA 5GVQA 2BOPA 3EZUA 3L7OA 2E29A 1U02A 3QPIA 2G2ZA 1CULB 4PWDB 3FCHA 3RR8A 1RHUB 3FDSA 3PYDA 2CZ9A 5EHHA 1Q8IA 4ZPDA 2FC9A 5LOQA 2E7XA 5KT2A 4Z37A 4EGLA 1N32J 4ZPWR 3Q24A 1LOUA 3AOCA 2P2CB 4DV4J 1NH7A 2VU5A 2D9PA 3D6HB 2CPIA 3HSGA 2BBEA 2F3JA 5B0BA 2A6OA 2G0JA 1JJ2R 2O66A 2ATLA 1OYDA 3HX9A 2MDAA 1FO1A 5KFJA 1HBUA 1RT2A 4LF1A 1SJFA 2OD6A 4KC5A 4U67Q 3KG1A 4NMXA 4EMDA 3MMCB 1ZZNA 4JI7F 4LRFA 4OZ0A 5U47A 5LL6d 4CH0S 2JLFA 1RWOB 2RUSA 3DXSX 2BOAA 3BH7B 2CWXA 4H4KC 4NCGA 4LF5J 4NXNJ 1DHMA 5KT5A 5KTQA 1V6HA 1L3KA 1NHKL 3D4JA 1F3FA 2IRYA 2QA1A 4KBIA 2C2DA 2BQRA 2R8KA 1CLFA 2FPHX 5I42A 1DY3A 3ZO7A 4NLSA 3NLCA 3M30A 3TARA 3GIJA 1SH3A 1ELOA 3AJ2A 1JXLA 2VBXA 2HRTA 2XYHB 3K5OA 4GVBA 1F2HA 1KP6A 4KKOA 4RNHA 5F8MA 3CCSS 2D3O1 2OTJS 4C98A 2YWFA 1TTHB 3D68A 1ZBTA 2MZQA 1RTJA 2GIQA 2NPIA 5E33A 3THPA 1YIJS 3PG9A 3NWGA 1UJ6A 4H54A 1E6YA 2Y9HA 4AQYF 2W7PA 4ED1A 3HLUA 1YHQS 4OZJA 1RAOA 4DR4F 5DS7A 2FHKA 5KG6A 1O5JA 2DH9A 5L9XA 4K0KJ 3VAFA 3G82A 5DG9A 1Q8LA 5IQQA 4ES3A 2M8HA 2LA6A 2MKYA 1PO6A 4B3MF 2B6AB 4ZVSB 4Y2IA 3M2RA 1MWYA 1Y4ZB 2DGOA 5CA5A 2O5DA 4DV3J 1HNXF 4USTA 4CO5A 8RUCA 2DR5A 4K8RA 4CI0B 4I4BA 4PG6A 1RT5B 3V4MA 2AW0A 2FHJD 4ZN1A 1N48A 1TUGB 4PQUA 2IDEA 4R0EA 2QSWA 3BQ1A 3W1YC 5F41A 4IUFA 2ZZNA 5LM7E 2ZE2B 4C48A 3IWNC 3JTPA 2DO4A 4NXNF 3SBMA 4FF3A 1DQ9A 1KHVA 1NDLA 2EG2A 3QRQA 1T9XA 2GHVC 1UPMB 3G6ES 2PEBA 3AJDA 3KLFA 3VALA 1HBMB 2DNMA 2D9OA 3DRYA 3QGGA 4Y28C 3C19A 5C7PA 1Q81T 5E5NA 2EKNA 1C4CA 1FTCA 3PO4A 2BMBA 1SJ4P 1R7IA 3DU5A 1Y5LB 5AXLA 4JI4J 4LF7F 5C2CA 4UT4A 4PKDB 2YKMA 4XAKA 2F7VA 1N8RT 4RW7A 1NXIA 3M2UA 3HD2A 2VOOA 1JWWA 1RTDA 3MEEB 4P52A 1F9EB 1XIQA 1XMOJ 1HNIB 3QLHB 2J9DA 1NBEB 3HSZA 5HLFB 4WXOA 5KFUA 4ZVEA 3MUVP 1HWKA 1FRMA 5J1PA 2CJQA 1TAQA 4L73A 1JQGA 1U1KA 2E1PA 2F8MA 2KRRA 5F9NA 2N7CA 1RWKB 4Q43A 2JL9A 2XNQA 3OXGA 2QA4S 3GZ7A 1SH0A 3I56S 4PEOA 1NB2A 4F4AA 5L1KA 1UZHA 4ZLPA 1SIZA 1FXLA 1LW0A 1VC0A 2AHOB 5EX3A 3QRRA 1IXKA 4DL7A 1NSKL 2E1CA 3AA9A 2YNHA 3M4XA 1T8EA 2W01A 2ZJRQ 2OSRA 1B99A 1WHWA 5KFQA 3G82B 4NRTA 2MLXA 5KG0A 3HPOA 4G3IA 4RR5A 3MMAA 2XTJP 2POKA 5KOWA 1N5YA 1HWUA 3DLEA 4J9PA 1FERA 4FNIA 5A6WA 3OUYA 4LFCJ 4W92B 3NMAA 3UCUP 1EKRA 4CT8A 2C2RA 4NXMF 1APSA 2ZC3A 3W9JA 3Q8RB 1WI8A 4EU0A 1UWBA 3KJQB 4LRAA 5D6GA 1CBKA 5HANA 1WC0A 4O0IA 4M8LA 4LSLB 1UW4A 3MMJA 1U1QA 3W2VA 5A8RA 1VGYA 1WTFA 1TKTA 3AOBA 2HHXA 4KGZB 4TYAA 2IM0A 3GJSB 1XMQJ 1LW2A 4QR0A 3FGVA 4FXWA 1YJ7A 4R5PB 1JMTA 1UETA 2KM8C 3MCOA 5A6PA 3H0PA 5H9EJ 4U7UD 3CVKA 5A8WA 2VHGA 3ITHA 3ET6B 3L7PA 1UJ4A 3IR7B 2OKQA 1TV6A 2QV6A 4S0MA 4LFBJ 1HBNB 3GV8B 1AW0A 1S6QB 3BBCA 3FZ2A 3G96A 4WFZA 2LQ9A 4WFNQ 2HNZA 3PX6A 5HMZA 2WOMA 2FVCA 1GEHA 2KN4A 2HVDA 3T19A 1FX2A 1Q7LB 2A0FB 4M5JA 2RSQA 5GAEI 2EK6A 3A12A 4J9RA 5KFFA 3U7JA 4B9MA 2E66A 2FHMA 3MECA 2MKIA 3M8RA 3ILJA 5GMDA 4WE1B 4HHUA 3FBEA 1LQ9A 2XMVA 5KFIA 4DLEA 1RKJA 1WDTA 5LMUJ 2LFVA 3QIDA 4PXEA 2ZH5A 2QN6B 1NKBA 4WFXA 3PY8A 1VRUA 3QO9A 4Y0FA 3J80Y 2CJKA 1V3RA 1H98A 4CO0A 2J7WA 5I4MA 1VK8A 1P1LA 3SQGA 1KLMA 3T5HA 3NCQA 4DSLA 4C11B 3F73A 2F4FA 2NR0A 4ECXA 2JC0A 4FKXA 3MURP 1CJTA 1NPPA 4OI3A 5KFVA 4DDFA 1W2BR 4USIA 3PW4A 1U49A 1G3OA 4DZ6A 1FE0A 1RT7A 1CQNA 2KXHA 4C11A 4X2BA 2AEMA 4GKJJ 3M1VB 5SUHA 3QZ7A 1N5SA 5EGYA 2M8DB 1TL3B 4B3SF 1TQLA 1J27A 3DOLB 1U4BA 5IT9U 3I4HX 1NJIT 2BV3A 2WB4A 1RAHB 3G8TA 1K0VA 2PC6A 4F8RA 3EWGA 2DNZA 4N7TA 2WK4A 3DGVA 2OD4A 4PWWA 3PW2A 4CLFA 4IDKA 2YKQA 1U7LA 4C8LA 2I5JA 3PKYA 1I94J 4O4GA 4NX9A 4DX5A 3MI7X 1UTAA 1PBUA 2XSJA 2OFGX 1SL2A 3P4UB 1MMNA 2MHEA 3A8IA 1U2FA 1H0HB 3KMSA 1BLUA 5A76A 1HQ2A 3DRRA 1DLOA 4KRWA 2J6UA 3R6LB 1YKWA 1CJKA 1TV6B 2CPXA 1HYSB 3IM9A 2N3OA 2R7WA 1RZMA 1YRUA 5C24A 4QWBA 3I0SB 2HHPA 2VJUA 4DV2F 3V6DA 1SJQA 2C2MB 2XC9A 2LA4A 2RRNA 3T6JA 1NDPA 5LSLA 2XY7A 1T3OA 1UEUA 1VLOA 3KK1A 3TZXA 1X4HA 3BEGB 1Q0NA 1T02A 2K06A 3NWRA 3O3LA 4P2FA 5BR8F 5DLFA 2KVQE 5B7WA 2YNGB 3UCZP 1IBMJ 2QTWA 2AYGA 4WF9Q 2QMXA 1FKPB 4X4VA 1TELA 2P5VA 4WE1A 2CJXB 4F04B 4PG8A 1RT6B 4URGA 4JBCA 2Z2MA 2HGNA 3MEDA 2B4OA 2IJRA 3GCXP 1HNWJ 1R8AA 3L09A 2C3MA 1VC5A 3THTA 3BSAA 2PMZD 1SC3B 3EXCX 4G1QB 3W5XA 2H54B 4B9UA 4NEYA 1IKWB 2WHOA 1S0OA 1N6QB 2AZ1A 2MY7A 4GVLA 2LU1A 4NOHA 4U96A 3TAMA 1RISA 2PA3A 1FWPA 2YQ0A 3TZYA 4X4SA 3JS9A 4DF8A 5L38A 2R7XA 1G7CB 1EP4B 2EG1A 4A8FA 1LXNA 1O8BA 3DXBA 4Z7YA 2XMAA 1DQAA 2VL1A 3MUMP 3FSXA 2AJFE 1C0UB 1G6BA 4LFAJ 2JLGA 3WBZA 1TR0A 2G9OA 4C8NA 2QT7A 1M1KT 2M5YA 3H90A 5A8KA 2X51A 4R25A 5KT6A 5DZ6A 2FYXA 2Z4PA 2F63A 3CWJA 2VG7A 2C3OA 5RUBA 2E9RX 3MMCA 3UW1A 4DV6F 3MEGB 1JLGB 2P6SA 5DG7A 1FFSB 4LQ3A 3OTDA 5CHCB 1DTQB 3MD1A 1Z4UA 4ICLA 3DCAA 3UWTA 3W5YA 5ETQA 4C9DA 2QE5A 1X4FA 1Z2ZA 2JHEA 3N6NA 1NHVA 2OMOA 2DGXA 2YVSA 3GYGA 3IBFB 4PXDA 2QL9B 3VQSA 1F2GA 4I6AA 3TVKA 2IBKA 1RWMB 2GAGC 2HGMA 3NGSA 2KZZA 1JKHA 3OTEA 2DRDA 4C0HA 4Q45A 5IQ6A 3O5TB 3IAM9 3BJYA 2HBYB 4KT0C 5HSPA 4P6QA 2W1BA 1NPKA 2OMLA 2QIFA 2YNHB 3L9ZA 4DR3F 4K4XA 5J2NA 1M1HA 1MWZA 3NGTA 4DPWA 3LGMA 3DGPB 4LSZB 1RDRA 2GCFA 1SC1B 4FPRA 3DLLQ 3SXLA 3H5XA 4DG1A 4YN3B 5E3QA 4DFJA 2V34A 4RW6B 4WXWA 1TUWA 1NSQA 4RU9A 1RT4B 4PWUA 1FKAF 4N41A 1WNEA 4DR6F 4FF1A 3R2DJ 5MAOA 2H5IB 3MM6B 1PYOB 3J7Z5 2Q6BA 2J9DE 1F1BB 1S1UA 2CADA 3R7BB 2MQOA 4A8MP 4EBEA 1YTYA 2IM2A 2QJ3A 3I9V9 2RAQA 3E8OA 1S97A 2MB0B 1UEKA 3Q83A 4TY8A 3MDFA 3WQPA 2RDJA 4QOTA 3C3LA 2B7CB 1RQ0A
chains in the Genus database with same CATH topology
1VHFA 5H9FJ 1WF1A 2ACYA 4H4OA 1UVKA 1XR6A 3PEJA 4HDHA 2OPPA 4OLOA 2COLA 3AB4B 3NBPB 3LWMA 3T9ZA 1WEXA 2BR0A 4DS5A 2JFKA 5G0RB 2ZD1B 2MQQA 5KG3A 1TKTB 2KXFA 4KR0B 2R2UA 1ZTTA 1Y0HA 3PRDA 3EYZA 3PKMA 2WB1D 4M5DB 1FA0A 2I38A 3DM2A 4I7FB 4WYWA 1HNVB 3OUYB 1G1XA 6FDRA 1O0PA 3KLGA 4LF9F 4UQTA 2GGPA 5F8IA 2WBMA 3DMJA 3QWUA 1HPZB 3CT9A 1NK5A 2GMJA 3TAQA 1UEVA 2KJWA 3BGFA 4UY8T 1E6VB 2HHTA 2VFUA 3MMBB 2O01C 4BDPA 2JWNA 3BO4A 3FMBA 1JJHA 3J7YU 1TK5A 3LW5C 3DLBA 4IOAQ 1GQEA 3DRSA 4ZPCA 3NAHA 2ZD1A 1OQ3A 2J76E 2QO3A 1HQUA 2RH3A 5T41A 2OPQA 1QY7A 3MEEA 3S6EA 3WDOA 5KFOA 4HT5A 4LF4F 1S9EA 3BGUA 4ILLA 1JLFB 2G1DA 5LT5A 3HFKA 3TAPA 2QLXA 3DOMA 3M05A 1ZPVA 2YKOA 5CD4H 4LVNP 1KNZA 3CDWA 3LALA 3DM2B 4I7FA 1HWJA 4QWDA 4RW4A 4YR0A 1DJ0A 5E7OB 2WBRA 3DLKB 3UQSA 1H2UX 1Z2LA 5HROB 2PIIA 4PG7A 3H40A 2OJ3A 1XR7A 4OX7A 4DSKA 3PV8A 1FESA 2R7OA 5DLGA 3AQOA 4PPDA 4BWJA 4ES1A 3H4DA 1HQEB 1QAJA 4HEA9 3JYTB 1HHTP 4DV5F 1MW7A 3IS9B 3G86A 2HFNA 2OPPB 3NMRA 1DTTB 3K5PA 3CCES 3AQPA 3PW0A 3D1OA 2MJNA 1C0TB 1NKCA 1FT8A 2BXJA 3DMJB 2R4FA 3GMGA 4NCBA 1AFIA 3RTVA 4OZ1A 2XGQA 4JOUA 1LWCA 1ZYQA 1Q82T 1S9GA 2XI3A 4GO7X 1RTHA 1Q86T 1K9MT 2ZITA 1VQMS 2V4JB 1VQSA 4IG0A 1SJRA 1FDAA 3GFHA 3ISND 2W9BB 2I2YA 5KFRA 1IN0A 1YGYA 3Q2SC 2YWEA 4NA3A 2AGPA 1RT3B 4LFBF 3I0SA 2DNLA 2ABYA 5HL7Q 1QUVA 3W7BA 1NK0A 1BWEA 4HLBA 2D7SA 5K5MA 4DSIA 1HYSA 4LF5F 4DLGA 3TUIC 3CJ4A 3V81A 1N4LA 3QWPA 4OL8A 2FY1A 1TFYA 1FRJA 1HQEA 2C3YA 4XPEA 1A9NB 4IFVB 4NZ7A 2I9SA 2ZDPA 4O4GB 3D5MA 2DNOA 4J9MA 1NK4A 4B9NA 4WK1A 2ZNZA 2VB6A 3T1YF 4UOCA 3UFCX 3G6YA 1SB6A 3R1LA 4ID5B 1X9MA 3MM6A 3TRGA 4ITSA 3V4IA 3BO3A 1XTZA 3IA0A 1HI8A 5LXYA 1NK8A 2V4RA 1RTHB 2X1FA 3NNCA 2Q1LA 1VQ5S 3SCIE 1T03B 4WZMA 2F40A 4DFKA 3W2WA 1RT7B 1P8GA 1LWFA 5HMYA 3MAHA 1LWEB 4L72B 1JLBB 3FEYB 3QJLA 2AJ1A 3QJJA 2OTLS 4YDXA 3E01A 1S7HA 1LW0B 3ZC4A 1S0NA 4N76A 2XMKA 3AH6A 2HW3A 2HVIA 4OI1A 1IM4A 2CPHA 2KO1A 3SQGB 4QWAA 3KK3A 2R8IA 2QEXS 1NZAA 3RB6A 4G1QA 1D8ZA 3BSCA 1F60B 3FFIA 3FSYA 4M95A 1X5PA 2AF6A 2HRYA 2I8EA 2LQ5A 2APOA 2M9KA 2MQOA 2JC1A 3AHPA 4Y2MA 1LFWA 2V4QA 2HNZB 4K2XA 2CQ2A 3X1LB 4F2RA 4KFBB 5HP1B 4OQJA 3CO9A 4JV2A 4PUOA 4C2MA 2AX1A 4LF8F 2K1RA 4RW9A 2CPDA 5DDOC 4CH7A 3IRXB 3VAJA 3BN7A 1HD0A 2VG5A 1UMJA 1R8CA 4O44A 1BY9A 2HS4A 1EP4A 1LW2B 3QGIA 4RZRA 4R5PA 1FNMA 1VS3A 2DGUA 1JNZB 4TU8A 1WG1A 3DRSB 3G4SS 3T5LA 4ELVA 1R8HA 2GQ2A 1MROA 3PIPQ 1X0FA 2V9WA 2UUTA 2Y1IA 4OX6A 4C0OC 1S6UA 2NXUA 2DGWA 1V3ZA 2CVIA 4J37A 3BQ0A 5B0EA 2EKYA 4KO0B 4ZPBA 2VODA 3I32A 1S1XA 1N0UA 1H2VZ 2CPZA 4RNOA 2YNGA 4QW9A 1AFJA 4CIOA 4M63A 4EBCA 1B0PA 5LJ5Y 4JV5F 4KIAA 2ZC4A 4I56A 2MQLA 3PFEA 2RF2A 2FJEB 3OFEA 4OHWA 3ZFVA 1FCAA 6FD1A 2W8LA 3E01B 5HO4A 4DWIA 2LCWA 3K8VA 2HNYB 4PG4A 4RW6A 2KG0A 4TU9A 4KHMA 1DARA 1H38A 1EETB 1FKOA 2KJVA 2OPSA 2W4DA 2WTFA 1HMVA 1W2IA 3OL9A 2W4PA 4O3PA 3MGJA 2VQEF 4WTYA 3CJ3A 3GE9A 4OMFG 2EK1A 4OX9F 1BQMA 1RTIA 3VF0B 5H9EJ 1IJFB 1HNIA 3QLHA 4DUYF 2ZOGA 3DOKA 2EI5A 4J9LA 2FLOA 5DQHA 2DT9A 2ZBIA 3PJWA 4O4RA 1U6BA 5KFZA 1BQNB 1UWBB 3K2YA 3IR6B 3MM9A 2YKMB 3R5CA 2RS2A 4IQXA 3H5YA 1BQNA 3MPWA 2QA4G 1VQ7S 1TKXA 1X9SA 3SFUA 5DGAA 3M32A 4IFYB 2HFOA 3CDEA 3DNCA 3TVZA 1WI6A 2LKZA 1WEYA 3DDNA 1ZZFA 2VD3A 3KMQA 3DDKA 1BQMB 3M6XA 4YR2A 1BGXT 4NLWA 1SKWA 1JB0C 5KFBA 3LAKA 3ULHA 2J9EA 4MIWA 4ZHRB 1X4GA 2AX0A 4RBVA 4ZS6A 3OL6A 2KVIA 2KFNA 4NYOA 1C1CB 3TO8A 4JI8F 3RU0A 2N4CA 1UAWA 3MMBA 4AUKA 2CPYA 2DNHA 2RKIA 1E6VA 3FRZA 2YTCA 2WOMB 3CDUA 3OFFA 4YB5A 3KLVA 2CQIA 2DPJA 1D1UA 4J5OA 4Q2MA 2B51A 5F3ZA 2VFSA 2HFZA 1QUPA 2CQPA 2C42A 3OTCA 2FTRA 2NSCA 4ZP9A 4BBYA 1SUQB 1FTRA 5GADI 4AFFA 4YB1P 4OJHA 1FXDA 4TNOA 5EX0A 3IS9A 3O6QA 1UVIA 1S0VA 3UD3P 3BO2A 1RTIB 3HP6A 1SXLA 5L8RC 4KGMA 1XBWA 2ZVSA 4MAKA 3OL7A 2XO7A 3UNGC 1D8YA 5KFLA 2YX7A 4PRFA 2MJUA 5C24B 3GV7B 2HHSA 4XDDA 3MR2A 4NLTA 2LQJA 4B3RF 1HBUB 1RT2B 3V6JA 2FJAB 2R7TA 4D3GA 3BN4A 2R7QA 4RW4B 3ZZUA 1CPZA 3HHEA 4DEZA 4AYBD 2YNFA 2VPYB 4GO5X 4JI2F 4C8KA 2DIVA 2P6TA 5FJ4A 3BREA 1XR5A 2FDNA 3D1HA 2BDPA 5EN1A 2CQHA 2QZ8A 1YJWS 4ALZA 4NLQA 1JK9B 1S6OA 2RKIB 4N8NA 5ADZA 4A8KA 2XMUA 3G8QA 4FF2A 3R5BA 4RU2A 3FQLA 2EBGA 3MWBA 2MKHA 2YY3A 3P5TL 2HLTA 4FVMA 1HQUB 1X0PA 2JX2A 3SCLE 1FK9B 3DLJA 5KFGA 5IT4A 2R7RA 3HVTA 2XCAA 2LU2A 2HHVA 3IR5B 5L1JA 4B02A 2YKAA 3M9NB 4U9RA 3SCJE 3PHEA 3ENWA 1MSWD 2RMLA 4EYIB 3PO5A 2YQ3A 3N79A 5I42B 4B3OA 3OQ2A 2A18A 2IM1A 1RA7A 5F8NA 4Y2KA 4QYRA 4JV0A 2LYVA 1KFDA 3N01A 2RIJA 2Z2LA 3RBEA 3P96A 2BE2A 3ZZYA 2V0NA 2UV8A 4A8FA 3M32B 4IFYA 2DHGA 4ZCMA 2V8HA 3H5UA 4J9OA 5L1LA 1OSCA 4RW9B 4FF4A 1ZAVA 4FS1A 3I6PA 1XC9A 3DYAB 3IG1B 4DOZA 5KFHA 3GFXA 5K8PA 4ILMA 4HTJA 4HKQA 2OPQB 1YVFA 2KT2A 1O51A 2ASJA 1K1QA 2X1AA 4F3QA 2B4VA 1KHWA 3CD6S 1JIHA 4JI6F 4HHJA