3G71S

Co-crystal structure of bruceantin bound to the large ribosomal subunit
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
b'SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3g71S00
2DNHA 5CA5A 3R1HA 2GO9A 2LKZA 2GHPA 3VAFA 1R8HA 2LQ5A 3EGNA 2CPHA 2DH7A 3CCRS 3SDEB 1WEYA 3BO2A 3TP2A 5GADU 2NZ4A 3CPWR 3B4MA 3THTA 1Q7YT 1YJNS 1HD0A 2YH1A 1YJWS 1BY9A 2MJNA 2VONA 1DHMA 2DNYA 2LEBA 2DGSA 4M5DB 1SJRA 2M0GB 3EX7B 4QQBA 1F9FA 1X4CA 5GAEU 2EK6A 5CYJA 4CIOA 2PE8A 2XNQA 3G4SS 2LA4A 5GAHU 1VQPS 3N9UC 1VQ5S 4WIIA 1WWHA 1FJCA 1VQKS 1VQ7S 1YJ9S 1VQMS 4W90B 2K8GA 1SJFA 2M8DB 1QM9A 3LQVA 3VAIA 2MKKA 1X4EA 1FO1A 2EK1A 3CCLS 2MY7A 5CXTA 3MDFA 4PR6A 1RKJA 2V94A 3IRWP 2DIVA 3BO4A 1VC6A 3V4MA 1JJ4A 3CC7S 1KQSR 3R27A 2MXYA 2K3KA 1X5SA 1K73T 2FPHX 2CPEA 3SDEA 3CCVS 2OJ3A 1YTYA 3J7YU 3H2VE 3VAHA 2KG1A 3DLLQ 2KH9A 1M5VC 2MQNA 3SMZA 3CC2S 3BS9A 1H2TZ 3MXHP 1WG5A 1SJQA 3TYTA 1U1RA 2G1DA 2L41A 2E5HA 2DHXA 3TO8A 2L08A 2MZTA 5IM0B 2CPYA 2DISA 3CCSS 2DGQA 2M4MA 3DXBA 3P5TL 1VQ4S 1IQTA 1X4HA 4C4WA 2SXLA 1AUDA 1OO0B 2CJKA 2BOPA 3B4DA 5GMKa 3LPYA 4PKDB 4ED5A 1VBYA 1OIAA 3CULA 1VQOS 2L9WA 1X4GA 2MQMA 5LXYA 2M70A 2QEXS 1M1KT 3ZZYA 4EGLA 3MURP 2MZSA 3RW6A 3MOJB 3S7RA 1FT8A 3CMES 4UQTA 2DHSA 2MQLA 2U1AA 2MKIA 1U6BA 2E5JA 3VAGA 1JJHA 3FEYB 2AYGA 1VC5A 1DRZA 2MJUA 3UE2A 1WF2A 3P49B 5GVQA 2N82B 2DIUA 2RRAA 4IUFA 2LMIA 2LXIA 5ITHA 4WKRA 2KXNB 1W2BR 1NJIT 3L3CA 2MB0B 3G8SA 2KRRA 1U1PA 5LSOA 2DHAA 2RT3A 4A8XA 2G0CA 2JVRA 2DGTA 3G8TA 2DGVA 2N7CA 4RU2A 4QPTA 2JRSA 5LJ5Y 1VQ8S 2JVOA 2G4BA 4CH0S 3CMAS 4UY8T 2CPDA 2CPXA 4WFBQ 2DNOA 2LECA 5IM0A 3Q2SC 3CUNA 2MGZB 1A7GE 4F26A 3PIOQ 2HYIB 2XS7A 1X5OA 2MHNA 2I2YA 2MYFA 3S6EA 1WI8A 3ULHA 4LJMA 3G71S 3CCMS 4PRFA 2M52A 1M5KC 2RS8A 5FJ4A 3MUVP 2MSSA 2NLWA 3IWNC 4QU7A 4IOAQ 2OSRA 1WEZA 2CQGA 2CQ2A 2CQ4A 5DDQC 5BJRA 2J0SD 3CTRA 1U1QA 1VQNS 2CPJA 3HI9A 2RVJA 3I56S 3MI7X 1HA1A 4CH1A 1WF0A 2F3JA 2XSFA 1UW4A 1QVFR 3P6YC 3OW2R 1HL6A 3NS6A 2N3OA 1L3KA 1VQLS 1S79A 1FXLA 2VOPA 3MD1A 2DNQA 5LJ3Y 2CQDA 2DB1A 3NNAA 1X4BA 3UCUP 2DNLA 3UWTA 2MQOA 3K0JA 2YWKA 2DH8A 2AYEA 2F9JA 2DGOA 1H2UX 1OWXA 1B7FA 4CQ1A 1UAWA 3CCJS 2M7SA 4F25A 1KOHA 2XNRA 3NNCA 1Q82T 1WEXA 4TU9A 2JX2A 2ERRA 1YWXA 2CPIA 1PGZA 2DHGA 5JVGQ 2AYBA 1UFWA 1ZH5A 1H2VZ 2XS5A 4ERDA 1WF1A 2MGZA 3UD3P 5HO4A 4J5OA 1U1KA 2ADCA 2CPZA 3NNHA 2RQCA 2MZ1A 2KXHA 2O3DA 2M9KA 4C7QA 3G6ES 3PIPQ 4IO9Q 2RS2A 1VBZA 1RK8A 1PO6A 1K9MT 2X1GA 2QA4S 1WHVA 3J7ZT 2Q79A 4WCEQ 3MD3A 3VAJA 1JJ2R 2J8AA 2MKJA 1FJEB 2MY8A 2RRBA 1H6KX 2EVZA 2CQBA 3Q2TC 3U1LA 4WFAQ 3R1LA 2DH9A 1YI2S 4Y0FA 2KG0A 2HZCA 2DNKA 1VBXA 2FC8A 1DBDA 1UP1A 2MSTA 5IQQA 5HL7Q 1WTBA 2XS2A 5H1SV 2M88A 2HVZA 2MQPA 1HD1A 3H2UB 1S72S 2CQ0A 1N8RT 1N54B 1M5PC 1CVJA 2J76E 2DITA 2ADBA 1U1NA 2LA6A 2YKAA 2DNGA 1WHYA 3HHNB 2I38A 1X5TA 2HGMA 4TU8A 3UD4P 1DZ5A 4QU6A 4F02A 4TU7A 1FNXH 3RW7A 4YB1P 1QVGR 4LMZA 2HGNA 3D2WA 1WG4A 3CCES 1KC8T 1P1TA 2KYXA 4FXVA 2OTLS 2E44A 1X4AA 2X1FA 1YHQS 2LCWA 1N52B 1VC0A 4WF9Q 5DM6Q 4P6QA 2KI2A 2CQHA 1U1LA 1X4FA 2DGXA 2MPUA 2MMYA 1M5OC 1VQ6S 3VF0B 5IFMA 2MKCA 4YUDA 1X4DA 2A3JA 2DNNA 1FJ7A 5EN1A 3BEGB 1A9NB 1WG1A 2MZJA 2DNRA 5DDRC 2BZ2A 2E5IA 3CD6S 3S01A 2F9DA 2LEAA 5DETA 1ZZFA 2CQPA 3G9CA 2X1AA 2AD9A 3BO3A 1U2FA 2CQ1A 3FEXB 5DDOC 2ZJQQ 3UCZP 2D3OR 2YTCA 3MUMP 1WHWA 5DM7Q 3US5A 2LYVA 2MQQA 3VAKA 1KD1T 4WFNQ 3S8SA 3CC4S 1URNA 4Y00A 5GAGU 1P27B 2KVIA 3CXCR 1K8AT 1XN9A 2ZJRQ 1U1OA 1D9AA 3G96A 1X0FA 5JVHQ 2KU7A 1KOOA 2ZJPQ 2UP1A 2AYMA 1M90T 4BS2A 2VODA 4TLQA 5MLCV 2PEHA 4V19X 2DNMA 4W92B 2B0GA 5LXRA 2KXFA 2U2FA 2OTJS 3ZZZA 2RQ4A 1NO8A 2KHCA 1WI6A 2KT5A 1VQ9S 4IOCQ 1WHXA 1SJ3P 1G2EA 1YITS 2E5GA 2KRBA 2KM8B 2DGUA 2MKHA 2MKSA 3NS5A 3U1MA 4LIRA 2CPFA 1X5PA 2CQIA 2QFJA 2FY1A 1U1MA 2RUGA 2D9OA 3UCGA 3EGZA 3VAMA 1FHTA 1Q81T 2DGWA 1NU4A 1D8ZA 1WELA 5D78A 2X1BA 2J0QD 2RU3A 5D77A 2FC9A 5DDPC 1U6FA 2KFYA 2LXUA 3SXLA 1O0PA 3NMRA 2OSQA 2KM8C 3CF5Q 4C0OC 1N88A 4ZKAA 2CQ3A 2YH0A 4U67Q 1Q86T 3THPA 2DO0A 2DO4A 4FXWA 3JB9k 2DNPA 3I55S 2CQCA 2DK2A 2MZQA 2WBRA 2XB2D 4YOEA 2D9PA 1JMTA 2VOOA 1OPIA 3MUTP 2DNZA 3VALA 1R8PA 2KN4A 5LSLA 4OZ1A 3CCQS 4OZ0A 2HGLA 4Z2XA 1SJ4P 2OIHA 2N3LA 1ZZNA 1SXLA 1YIJS 2M2BA 2FHOB 2JWNA 2RNEA 3CCUS 2MZRA 2M8HA 3P3DA
chains in the Genus database with same CATH superfamily
2F40A 2AJ4A 2W9AA 2HZAA 3CCTA 1RXOB 1WEYA 1ITPA 3MMAB 4OQJA 3ISNC 4CT9A 3M4XA 1CJVA 2DTJA 2Z2ZA 2APOA 4IRCA 2HFVA 4YP3A 1BQNA 4JI7F 4J9OA 2DCLA 1NEEA 2QA1A 2LP4A 3JSMA 4C2MA 3E01A 2CFXA 4ED3A 4USVA 2OFHX 1K44A 2E29A 3RBDA 3JQMA 4ECVA 4O3RA 2EK1A 2MY7A 2J7WA 1RKIA 1WOSA 4PR6A 1RKJA 2HWIA 2BE2A 2H1YA 3AJ1A 2RDJA 4WIQA 3RGIA 2GHWA 3MM5B 3CEDA 2OJ3A 2IVYA 3ZNUA 1ZTWA 3A8IA 4FVMA 3C46A 1SC1B 4DPOA 2WSFC 4URGA 3N5BA 2JC1A 4G65A 5IM0B 2DISA 1OJ4A 1X4HA 4QW9A 1FD8A 2QG9B 2CJKA 2KJVA 4ED4A 4X4NA 2AKWB 3BDPA 1Y11A 1UVNA 2B8PA 2L9WA 1X4GA 2J9EA 4EMDA 4B3SJ 1OY8A 1F5BA 5HK4A 1JJHA 1RAIB 2AYGA 1BGXT 1IUJA 2HVEA 2Z58B 3HD1A 2IRYA 4Q43A 1J5OA 5A0YA 1YBAA 1NJIT 2HAIA 5CD4A 4R8UA 3PYDA 3C2PA 3T6JA 4DZ6A 5ETTA 4DU7A 4RUCA 3K58A 4EFAC 5CH7B 1HBOA 1QE1B 2GIFA 5T7LA 1PSDA 4KKOA 4K4VA 2QL7B 2VPYB 4OZ2A 3MM8A 3M8QA 1EARA 5DDQC 1EETA 3CTRA 5IT9U 3MAAA 3I0SA 4KHRA 3KJNB 2CPJA 1N5QA 3HI9A 2UXDF 3I56S 3MI7X 3O6QA 2F3JA 4NCGB 4DSLA 3U27A 5CQGA 1XMBA 4YDXA 4ZP8A 1Q16B 4R5PB 3V6DA 1TL3A 4GMKA 4DQSA 2V50A 3OTBA 3CCJS 5DQHA 5F8HA 3T9ZA 1S6OA 4F7VA 4HLBA 2YQ3A 1UFWA 4PYDA 4MIAA 2YQ0A 4JI5J 3UPFA 4LBPA 3SCJE 3EYZA 4FS2A 3PIPQ 1JLCB 2IM0A 1H72C 1IVZA 2KVQE 4NYPA 1SC6A 4NPOA 2AX0A 5F3TA 5IZHA 5KAKA 1XERA 2J8AA 1RU2A 3DM2B 3C6TB 2DR6A 3PM9A 4IO1A 4TYBA 1Q5VA 3MEGA 4W4MA 3BGRA 2QA4G 1M5PC 2UVVA 2CA9A 3UD4P 3V6JA 2E1CA 2VG7B 3TUZC 4D3GA 3BKUA 1P1TA 2OTLS 3EDRB 1IKVA 1CJTB 1NK0A 2HHWA 4QCLA 4C9DA 4NZ0A 1M5OC 3R2CJ 3Q8VA 4JB8B 1C0TA 4L76A 4FYWB 2C2NA 2RMLA 3BEGB 1H7WA 3KNAA 2GQQA 2MZJA 4DZDA 3LH2S 1ZZFA 2K1RA 2VFVA 1S1WB 1VISA 4J9QA 2VPWB 3VGTA 3S8SA 1IBKF 3R9LA 2ZBRA 2OAUA 2VUGA 4K4UA 1TL1A 2CDRB 5D0HA 5KFRA 2V4QA 5C25B 3T19A 1K0VA 4DLEA 3QZ7A 2HFSA 2KT5A 3HK2A 1F0XA 2KRBA 1Q79A 4KO0B 2AEJA 1MW7A 4GKJF 4USIA 4HKQA 2PGCA 3FBEA 1HNVA 4IQMA 4J37A 3GV7B 3TZYA 3RBZA 4B9TA 2WBRA 2CWKA 3I5AA 2HFUA 5C2GA 3KKFA 1HNZJ 1FTCA 2FGCA 2Y1IA 1R7IA 1E6YB 1U26A 1B0PA 2F63A 4AQYJ 3QIDA 1RTJA 3QGIA 1O8BA 4B9LA 2P8IA 5KG1A 2UXCJ 1V5IB 3CCRS 4TQRA 3BO2A 3ZXWA 2E1RA 5L8RC 2WW4A 1S6PB 4M5IA 4EU0A 2DNYA 3NP5A 4ID5A 5KG3A 4M5DB 4ID8A 3QIPB 2OMOA 4Q2MA 4OLPA 3GYGA 4N47A 3G4SS 4J9VA 2OPSA 2IA6A 4NXMF 4V1Ak 4CM0A 2EC0A 3CJ2A 3MDFA 1OY9A 2ZEJA 2VBXA 3MTJA 1TKDA 1XNQJ 4IR9A 2MLZA 1IM6A 4PPDA 1SKWA 5KFAA 3VAHA 3FFIA 1RTDB 3OVSA 4KRWA 3MXHP 1SJQA 3OFEA 2ATLA 1U1RA 1N4LA 3G2XA 4DV5J 5ETMA 4BC9A 4BBYA 2YKMB 1M1GA 1TVRA 4P2FA 1FD2A 1CJVB 2ZWOA 2A1BA 1BQNB 3LPYA 1VBYA 4LF9F 3PRVA 2R7XA 3GFZA 3JSMB 5DZ6A 4WJBA 4P10A 1AUSL 1RWVB 3KUEA 3FEYB 3QPIA 2R2TA 1U0HA 4X4OA 1YSJA 1I94F 1UPMB 4WKRA 1RA7A 3ENAA 4DS4A 4CT8A 1W2BR 3UDVA 5L1KA 4MKYA 1D09B 1PAEX 2DGTA 5AJ3J 2PN6A 2JVOA 2QGFB 2R7RA 3WIVA 2XY6A 2HK3A 1YG0A 5ETNA 2LDIA 5HP1A 2B4OA 1I1GA 3L09A 4HYKA 1RHMB 3N79A 3VQTA 3AJDA 1F9HA 2GZOA 1ZAXA 1VQNS 2RVJA 3M2RB 1HR0J 1SI9A 4UOHA 4FKYA 4LFCJ 1L3UA 1HNXF 2QSFA 4CLZA 3K0JA 2Y8YA 1F6TA 1RLDA 5A0YB 5HROA 3ETMA 4OX6A 3AY0A 2JX2A 2ALZA 4RUAA 4XDCA 2DHGA 3W66A 1RT4B 5HAOA 3U1NA 1LW0A 2HRTA 3IN5A 2ZOMA 1EB0A 4FVCA 4KHPJ 1HBOB 1AZSB 4NA2A 1XJWB 4DV2J 3MD3A 2JNJA 3OTDA 1RSCA 3MM8B 5DLGA 2W8LA 4RWXA 4CLFA 3MAAB 2HW3A 2YKQA 7FD1A 3D68A 3H42A 5KG6A 2MQPA 3BB5A 2QYCA 3MR5A 3W5XA 4F02A 3AD7C 1S0MA 3RU0A 3N5FA 5IV4A 3V4IA 3K5OA 4QIEA 3OR1A 1UPPA 1RT6A 4JI2J 4MJKA 2ZBCA 2B51A 3D6TB 5KFSA 2DEIA 3V81B 5D4NA 2LQ9A 2KJWA 3CNQP 2ZKTA 2DNRA 1LQ9A 3MM6A 2W9CB 1UWAA 2WVCA 5F41A 4ED6A 1GMUA 1FRLA 5F8LA 5GMEA 3CJRA 2OMLA 3MUMP 4ZVHA 1B0VA 5AT1B 4CLSA 3IR7B 3GTYX 1UVKA 4Y00A 1GXUA 9ATCB 3NWGA 1D9AA 5E5NA 2OPRA 3BGRB 3CVKA 1KS2A 2J7KA 2W2NP 4JYAF 4QIWD 4LQ9A 4ZS6A 2KXFA 2OUGA 5J2PB 3MMCA 4YDDB 2XEXA 2KHCA 1A6LA 4ED2A 1VGYA 1ZA1B 4CP5A 4QJVA 2BE9B 1NDKA 2CPFA 4DV7J 4CO4A 4URSA 2ZZMA 5E2QA 4GKKF 1RAGB 1U6FA 1CEZA 3BREA 3M9OB 1FKAF 4U67Q 4FXWA 1RTIA 3H98A 1NZAA 3CJ5A 2MZQA 3HVAA 5DG9A 4C8NA 1R0AA 2RU9A 1AYEA 2ZDOA 4C0BA 1T95A 3AXMA 1FFGB 4Z2XA 3M1VA 1TL1B 5ETSA 2N3LA 3K8WA 5LL6d 3G6YA 1N6QA 4KYZA 1Y0HA 1VK8A 1TMMA 1EHWA 4ZVFA 1REGX 2ACYA 1R8HA 3CJ8A 3OR2A 2P9GA 4U6PA 3LO3A 1XIQA 4TYAA 1GQEA 2W24A 5H9FK 4P75A 1YJWS 3LP2A 3O1LA 4OX9J 4DCPB 3TWZA 4DR3F 3C6UB 3BGFA 4EK2A 1VQPS 5KFTA 1WC1A 4WU2A 4RKUC 2VL1A 5BR8F 2M8DB 2MDAA 3R8YA 2MLXA 1P1LA 1N0VC 1WC3A 2IHR1 1O6XA 1ELOA 4IG0A 4U9RA 3IO1A 1C1BA 3V4MA 4FF2A 1QY7A 4HHJA 2RRNA 3M32B 3CCVS 3LP0A 2KH9A 1FNOA 1YRUA 2DR8A 2L41A 3TEGA 2DXEA 3QT7A 3HFZB 4KE5A 5B0CA 3GG1A 2B5JB 3DXBA 1MN7A 1UJ4A 4D3HA 2V2QA 4ZJOA 2GMHA 3MR3A 2MQMA 2YKPA 1TKZB 3AOCA 1CULA 1TL7A 1OPZA 3I9V9 2Z57B 2ZH8A 3J81Y 2ZVSA 3W2VA 3BGUA 1RAJA 1Q53A 2XGPA 2HIQA 1XK8A 1UEVA 1DFDA 2BEFA 3FFIB 1ZAVA 2DNOA 4IH7A 1N5YB 4DQQA 3HSGA 4MKBA 3L7UA 3W1YC 2MYFA 4EZ9A 1N33F 2CJAA 2M52A 1S4EA 4C3LA 5HN0A 1WEZA 1GEHA 2KT3A 1N36J 1S6UA 4UUXA 4NI2B 1UVIA 3SQGA 2N3OA 2IPOB 2VOPA 3ET6B 2HNYB 2WSCC 2NXCA 5KFGA 3IS9A 3CGIA 3AQOA 3QT8A 1DY3A 1RT3A 3HSJA 1H2UX 4EBCA 4F2RA 1G7CB 3H5SA 4MYTA 2M7SA 5HQLA 5CCLA 4ILMA 4PWDA 1Q82T 1NDPA 4OHZA 1RUSA 4OZLA 2NQPA 2XS5A 4PEOA 2RQCA 4PWWA 2CZVC 2M9KA 3HHDA 3G6ES 3H5YA 2F65A 4IFYB 4B9VA 8AT1B 4B02A 2VG6B 3HKWA 1WACA 1WHVA 3TUJC 3RB0A 4OYZA 1R6VA 2W4DA 4DX8H 4XO0A 4B3TJ 4N8NA 1DTQA 3M8RA 1RHKB 2IIHA 4L72B 1WTBA 1NJXA 1YJ7A 5AXNA 1RT5A 3DGPA 2HQDA 5KT5A 4RW4A 2W2OP 3IBWA 7FDRA 2YKAA 4P7VA 4DR4F 3BSOA 3GV5B 3E3XA 5L38A 3CCES 1T11A 2DRAA 2YY3A 5C2CA 1X4AA 2CNKB 3ZZ0A 1PIEA 1E6VB 3QZ8A 1HBNA 1LW0B 2MMYA 2I6WA 2N4CA 3MCOA 1T7PA 4LF5F 1RABB 1YDLA 3AQPA 2BZ2A 4HACB 3S01A 4DV1F 5CZXA 3OT9A 1JLBB 2D3OR 4RBTA 5KT7A 4RNNA 2WW8A 2MQQA 3RYLA 3G86A 1TKXA 3G96A 4K4WA 2VDIA 4F4AA 3D0HE 5J2MB 4C3KA 2VODA 2DXDA 1KLNA 3KK1A 3V4IB 3PYGA 3OR1B 3AOAA 2A2DA 1X7VA 4F4YA 3EGVA 1U25A 1SJ3P 1FKPA 4G1QB 1FK9B 1Z4UA 3TARA 1KWMA 2QL5B 3DLJA 4NMLA 2P2CB 4N8OA 3UCGA 5DG7A 4OI6A 1WELA 3MM6B 4NA1A 3RB4A 3LP1A 4ECXA 4NYZA 3MF5A 3PX6A 4NRTA 3AOBA 2XB2D 3D1OA 1BXNA 4ECTA 2XZDB 3T1YJ 4JI0F 3TVYA 2O1PA 3OFHA 2Q43A 3B54A 3TAMA 4M1KA 3OBIA 2OGUA 3W5YA 5LSRA 3ZZTA 5I3UB 3NRBA 4DV0J 4K59A 3MMCB 3E2EA 1ZOTA 2PI4A 4M5NA 3VAFA 3T41A 1REVA 3EGNA 3MMJA 2RILA 4J9UE 5BYQA 2AGQA 4CO1A 1BY9A 1BWVA 5IWAJ 5E3RA 4HEA9 1FXDA 1F9EB 2WAQD 1FJGJ 1WKKA 4FYYB 4K4YA 4CIOA 1VLOA 1NPKA 2LA4A 2IVFB 3H2LA 2JHEA 2F4VF 1HQUA 2K7JA 4ATNA 2XZWA 1FJCA 5DLFA 3MGJA 1HNIA 3M2UB 2HIYA 1X4EA 2D3UA 3CCLS 4USJC 5D4PA 3HDSA 3J7YI 1MU2A 2Z2LA 2AJFE 3SDEA 3GIKA 3TJAA 3GLJA 1S49A 5AXMA 3TUPA 3CC2S 3HSZA 1IM4A 1X9SA 2GO8A 3CMQA 3PO4A 3KJVB 5KG2A 3P5TL 1LWFB 1VQ4S 4U95A 4DUZF 1AUDA 4LF8F 1TELA 3CD5A 2BOPA 2EG2A 2FVPA 1P9YA 3A12A 1XBWA 2Z0GA 3NAIA 5KG7A 1KKHA 2UUAF 3RW6A 4RLEA 1V6HA 2CNNB 1FDDA 1RTHA 4DL5A 3MFIA 4BCAA 2G1HA 5KFXA 4CLWA 5EHHA 1FRHA 4ZCMA 3VHQA 2KXNB 2F1FA 5LM7E 4ED0A 1ZETA 1NSQA 4N77A 4QPTA 2ZC4A 2R7VA 2DYAA 3LP0B 3CMAS 2CPDA 3I5BA 3QRPA 5CYMB 3T1AA 1RISA 2J5AA 3R5JB 3QYYA 2Y0SD 3EICA 1WI8A 5A2QU 1S57A 1AFJA 1OYEA 3GZ7A 4IOAQ 1QSYA 5MAOA 2OEKA 5CABA 5LMNJ 2BKNA 5FLXY 4NLWA 2OPQB 3PKMA 4I4BA 3LWMA 1QJHA 1NAQA 4ZPBA 4IH6A 3WBZA 1C0UA 1H73A 2H5IB 3MR6A 1YRTA 3AHPA 2W2PP 1NLKL 5GMDA 3PX4A 3HX9A 3IC1A 3CCZA 1JLAB 3ISZA 1IJFB 2FB0A 5D0GA 2CPZA 3ILLA 1WC5A 3JQKA 1RLCL 2KXHA 5A8RB 5HBMB 5SUHA 3T1HJ 3HSDA 5G0RA 2XG8A 3ONQA 2EVZA 3D28A 1Q95G 1DLOA 1PC4A 1RDRA 4HTJA 3MHYA 2MSTA 3CD7A 3BBFA 4CDIA 1OMSA 2KO1A 3SQGB 4F50A 4CYUA 2V8DA 1MMDA 2AU0A 1CPZA 3MEEA 3FBCA 3KHHA 3Q83A 1CLFA 1RT3B 2EKNA 2HGNA 3ZTPA 1KC8T 2KYXA 4PWDB 4FXVA 3PJXA 1KTVA 3TVZA 3I0RA 1BLUA 2ZH9A 3BSAA 5CZVA 4YUDA 4QWCA 4LFBJ 3VGUA 2H9ZA 1TK8A 2BJEA 2G13A 2GNKA 1VRTA 2PD1A 2CQPA 2AV5A 1EX8A 5FIIA 5GAHI 5J2NB 2E5LJ 4C98A 3EDQB 4MH8A 3VAKA 1DTQB 4ZVUB 4DEZA 2KVIA 3CXCR 3QJPA 3FGVA 2VD3A 4EYHB 4DPUA 3OUYA 5CYQA 4AL7A 3RAQA 4EWTA 2IM1A 1OS5A 4ZVPB 3AH6A 3R5GA 4PQUA 3ITHB 3AA8A 3KXDA 1ROFA 5SZTA 3HXMA 2P5VA 3SV3A 1LXJA 4IOCQ 4WBFA 2P6SA 3FZBA 2B9EA 3NS5A 5D0EA 3CJ0A 4OI0A 1X5PA 2W7AA 3H25A 2DY1A 3ENVA 2KFYA 1RT7B 4NASA 4UZCA 2OSQA 3UW1A 3K5PA 4Q0BA 4DOZA 1Q0NA 4GVBA 1N0UA 3UR3C 2GIRA 4K0KF 3HHLA 1PBAA 1RBLA 1TKXB 3OTCA 5KG0A 4UOGA 3HVWA 5LSLA 1HFEL 2NREA 1N32F 3P96A 4WWSA 2ASJA 4JI6J 2HVHA 4Z37A 3KK1B 1TQLA 4JI8J 2IY5B 3TA1A 4NZ6A 3TUIC 2IA0A 1FWKA 4X62J 5GADU 3VQSA 2GA7A 1HD0A 3MM7B 3PTWA 5LMUF 3OL7A 3CDWA 3W9JA 1S9FA 4LSNB 4RBUA 3LP1B 2COLA 1KQGB 2F7VA 3LWLA 4XK8C 4RL1A 1PG5B 1U2RA 3D67A 3R97A 3CJKB 4OI1A 4OJGA 3LQVA 4CI0B 2NSCA 2DIVA 5K8MA 4CM2A 4LF6J 4Y2AA 3TA0A 1HYSA 1HWKA 2K3KA 1K73T 2Z8QA 3HPOA 2R3VA 1AT1B 2PMWA 5KT3A 1RI7A 4WPAA 3KLIA 3OFFA 4DJBA 2GHVC 2QYGA 4OYAA 5B0FA 3CCSS 2HQIA 2EBEA 1QSLA 4DG1B 2FDNA 5EGYA 2YKOA 4B3OA 3GR0A 1LXNA 5LXYA 2HKEA 4UQTA 4ZDNA 2YWWA 3Q89A 3KHLA 1HNIB 5J2QA 3GCWP 3HMJG 2LMIA 5ITHA 2B9YA 4CH7A 5DO2A 1FWLA 1RTZA 3GIIA 4LF2A 4YR2A 2R4FA 4KIAA 3DRRA 2DRDA 2H65B 4MIWA 1HLWA 2HFOA 1VQ8S 2G4BA 4LQ3A 3PW0A 1RAFB 4DMZA 1S1VA 4F26A 4AL6A 2CYYA 2XCAA 4NEYA 5L1JA 5KFNA 4KTQA 2RS8A 3JSYA 2XO7A 3BR8A 3FVYA 2J0SD 3NGDA 2OEMA 5DGAA 4P2SA 1NK5A 1RHQB 5KFFA 1S1XB 4I0WA 1B7YB 3KG0A 1OSDA 2DD8S 2H5EA 5IS2A 4TU9A 4FS1A 3G8QA 4IOBA 1XTZA 2F5GA 5KFIA 2MGZA 5HO4A 3H90A 4FYDA 1CS4B 3GR1A 4QYZJ 4Y2MA 3A3PB 1D3WA 2J7UA 3ELHA 1AXQA 3QRQA 3M6VA 3QSYB 3OHBA 2AZ3A 1MN9A 2XMTA 3RZAA 4DXLA 4DQIA 3QQCD 1H3DA 4B3SF 3CIMA 1YI2S 1UKUA 4TY8A 4RW9A 2GMJA 5B0DA 4M5KA 2FC8A 5HL7Q 4NLYA 1TFWA 3CJSA 1RAAB 4FF3A 2ADBA 2IJFA 2DNGA 2RIJA 2I38A 1X5TA 4HDGA 1DARA 2CJXB 3M9MB 1T9UA 2V5HG 1WG4A 1EQMA 4J90A 4K2JA 2XMAA 4H54A 3OV7A 5U47A 1FE0A 1VC0A 1JWWA 4NLRA 2BJDA 3PW4A 1TUVA 1FWPA 2R7QA 3UNGC 3GJTB 1S0NA 1HMVA 3TJ8A 3M30B 1AB8A 5E3QA 4ECWA 1YK9A 2PFDA 5DETA 4CNYA 5DDOC 3DI6A 1S9EA 2OD6A 3PVXA 3CC4S 5GAGU 3V5RA 2ZJRQ 4CYUB 2DR5A 1S1UA 4ZITA 3MEEB 2QLFB 2P6TA 1HQEA 1M90T 4F4ZA 3V6KA 3OL9A 3H20A 1QAJA 1HHSA 3IGNA 2OTJS 4RZRA 4ZPVR 4JI5F 3EVOA 2OP5A 5E3PA 2ZM6J 1WI6A 2C2DA 1G2EA 1F5CA 4IH5A 2BBEA 2KZMA 1FEHA 4J7CA 3ENWA 4ZA1A 5AXLA 1QAXA 2FHJD 3C14A 2D9OA 3Q8SB 2CADA 1Q81T 2VF3A 5C7PA 4JUZA 5DDPC 2UUTA 3GIRA 2HWTA 5CAAA 4AXIA 4O3NA 2Y8WA 2WOMA 2DNPA 2ROGA 1JLGA 1Y5NB 2O5DA 3D3BJ 2AEMA 2HSEB 1CJUA 3SFUA 1YIJS 4DS5A 1EAYC 2ZOFA 2Z2YB 2QFIA 3QJLA 1RHUB 2H51B 2ZBPA 5FDLA 2GO9A 2VJVA 1WC6A 1EP4A 2CPHA 2ZNYA 3R7BB 3DYAB 5I42A 2OFGX 3TP2A 1SKUB 2BQ3A 5FLXU 3B4MA 5GAEI 1XR5A 4I2PA 1DHMA 1FFSB 4J9KA 5L9XA 8RUCA 3MM9B 3NY0A 1CJKA 3Q23A 2AP6A 4EO8A 2WB1D 2PC6A 3M8ZA 3N9UC 4HVZA 4NWBA 3CSKA 2M3DA 3HHLB 2RE1A 3IR6B 2HFNA 2BE7D 3JYTB 4FKXA 1JJ4A 1X5SA 3KLFA 3TEHB 3LAKA 2Y0BB 3HHLC 1PYOB 3C15B 3GIJA 5KT6A 3BS9A 1U48A 2PMHA 2BA9A 2LFVA 4DU8A 2B4VA 3WX8A 2CPYA 4JV5J 5KFDA 4N5SA 2I9SA 1HHQA 1HPZA 4LFAJ 3PR5B 4WP3A 2XLIA 4NXNJ 3QO9A 2UUCJ 1PYTA 3RRGA 1HNZF 2G0IA 3H0PA 1V3ZA 4O3QA 1Q1KA 4JI4J 2VB6A 5GVQA 3TOQA 3BQ1A 2FLPA 4OHYA 2DIUA 5ETKA 3PYEA 4AQYF 4ZCLA 3DOMB 2V9WA 4DFJA 4U8YA 1SKRA 2UXCF 2HHHJ 2EG1A 2ZNZA 3IGVA 1SV5B 4ECSA 1RAOA 4L3NA 2RUSA 2O66A 4ANDA 3CUNA 2QMUB 3QAEA 1KVIA 2NUHA 1FFWB 2NXUA 3OTEA 3S6EA 2WB4A 2Y1JA 5T14A 2HVIA 4ZPWR 2GVZB 1HQ2A 1IWGA 1ULRA 2CQ2A 2DBBA 3QWPA 4F3QA 3PJWA 3GV8B 3P6YC 4WFZA 3NS6A 5F8JA 4FF4A 1VQLS 1FXLA 3RAXA 3PV8A 2C2EA 5J2QB 5KOWA 1XNQF 4F25A 4CRJA 3L95X 2HLUA 1PJ6A 1LFWA 1ZH5A 3K8VA 2IYIA 1J2VA 4J5OA 2UU9J 1S59A 4DV5F 1BQMA 4C7QA 2GAGC 3FCVA 4WE1A 5KFHA 2VH7A 4PABA 1S9GB 5ETPA 3ZFVA 2VKZG 2IJRA 1H7XA 2DJWA 1XMQJ 1N8RT 2J76E 2NUUG 4WFXA 3PACA 3EE3A 4DL7A 2EFOA 2QLJB 4TU8A 5AJ3F 2I8EA 2W9BA 2YNGB 3HF5A 2LCWA 1N52B 2HNDA 2E1AA 4RW6B 4P6QA 2KI2A 1NCLA 3B8HA 2DGXA 1EKRA 3PW2A 1RWWB 3ZZRA 4I2QA 3QSIA 2XLJA 2QT7A 4P52A 4Y34A 4WK3A 1N56A 3BSNA 2AWZA 1GTHA 5HLFB 2BJ1A 1HR0F 4GRSA 3ISND 1UTAA 4LFCF 2YTCA 2FJDB 2P9EA 4TY8B 4MK8A 3CDBA 2V4JA 2A6OA 3NCPA 3M2VA 2H5JB 3DOLB 1SKSA 3DRSA 5ETOA 4ELVA 2YXLA 6FDRA 1SQGA 3DRPA 1SCJB 3DLKB 2ZD1B 4KPCA 1SVDA 1N5VA 4KHPF 5EUHA 3NWRA 3I32A 1MWQA 2WVBA 2RKIA 4OYMA 2JOQA 4WZMA 1QLNA 1DJ0A 4DV2F 4E0DA 1R27B 2GQ2A 1RWUA 5M2RA 2D69A 5THWA 5LT5A 2FC9A 2C2MB 5CHCB 4TN2A 2QA2A 1FXRA 3F41A 1N88A 1ZA2B 3K5MA 2PA3A 5F8IA 4OZNA 4LBIA 4ZVQB 1IR2A 1PBUA 4A8SA 1TU0B 4JI2F 3H5UA 4PXEA 3T5LA 2ZE2B 4ETZA 3Q8PB 3EXYA 3P3DA 4Q44A 4CLUA 4R0JA 3MR7A 4RUBA 3VVUA 2BVZA 3DN9A 4NLDA 2LEBA 2C2ZB 4WTYA 1X4CA 3SBMA 1T05A 4CTAB 1W7WA 4B3RJ 1VQ5S 4RWWA 3FC9A 3ILJA 2LQBA 3DMJA 4ZP9A 2XYGB 2HBZB 2IAJA 2CZ9A 5CXTA 2VFUA 2FJWA 4F0HA 2N4DA 4I68A 2CIMA 4C3MA 4M8LA 3H2VE 1M5VC 4DV7F 2J6UA 3AA9A 3K2YA 1SL0A 5I42B 5C42A 1TK0A 4DPYA 1D1UA 1PC5A 3N01A 2DGQA 2VG5A 1UEUA 2HEKA 5M2UA 2RD5C 2RAQA 1RT1B 2ZH2A 3F73A 3K57A 3GE9A 2C3OA 4J9NA 1N48A 3L7OA 4ANEA 4YQWA 2U1AA 3E51A 3SFGA 4P71A 3O2IA 3T3FA 2PT0A 4FZVA 2ATCB 4B9SA 4K0KJ 1FDAA 1FESA 2YNFA 4MAKA 2RT3A 2G0CA 2AZ1A 3KLFB 1Y3JA 2IRXA 4OYBA 1UA0A 4ED8A 1RB0A 3AAWB 2QZ8A 1ZBTA 1D9FA 1IXKA 4OX9F 3BZQA 2LU2A 1GAOA 4AYBD 5L39A 3A1YG 2BANA 3KJQB 2MSSA 2DEJA 2WONA 3DDIA 2OSRA 4A8OA 5L46A 4KB7A 1S1TB 4DI6A 1HA1A 4AUKA 4UZBA 1YJVA 3OW2R 3R6LB 2EFGA 3QO9B 4IFVA 3FDSA 4FPIA 3QATA 3OL8A 1YBTA 1T9XA 2IC3A 2DGOA 1OWXA 1B7FA 2VBWA 4Y2IA 1XWLA 1HI1A 1YZ7A 3K89A 3IFEA 3C16B 3UD3P 2YPYA 4E2FB 3BQ2A 1EZZB 2ASDA 4QIGA 3F56A 4ZK7M 1A0OB 3VR1A 5J1EA 3L9ZA 1RBAA 2HHTA 2MKJA 3OLAA 3Q8YA 1OYDA 5E41A 5A6WA 2PI5A 1Z2LA 2R2SA 4IG3B 3KUGA 2CNOB 1IBLJ 1KVJA 4IKAA 3H2UB 4TXSA 2QMXA 3W61A 1HHTP 2KT2A 3G6VA 1Q4RA 5K5MA 2Q1LA 1VJWA 1RWNB 1WDTA 4DV3J 3B82A 2UVWA 3AXKA 3HVTB 3I9ZA 1JB0C 1RADB 1EJ7L 1VQ6S 5E33A 1RCOB 1Y3KA 2RF2A 2A3JA 2DNNA 2HS4A 2YNIA 4IRDA 1IKXB 1F3VA 3VV2B 1A9NB 5DDRC 4KT0C 1N36F 1ZPWX 4O4GA 4XIUA 4WE1B 4AE5A 2GV1A 4ZLNA 4FXDA 3US5A 4WFNQ 3DLEB 3IA0A 1IKYA 1RCXB 3BYRA 4BLGA 1JLFA 4L75A 5BYSA 2Y1LB 3G82A 2B0GA 2W9BB 2DR7A 1DAXA 3N6LA 5G4DA 5K8OA 2WSEC 4WYWA 4LF7J 1JKHB 4GC7A 4EYIB 1WJ9A 2Y9HA 1P9QC 2FY1A 3SQOP 4WYLA 3KLEA 3W9HA 1HBMB 5M2PA 4F4XA 2AT1B 4B3TF 5D77A 1X31C 3D1HA 4RPFA 3MCSA 1UFLA 4LRDA 3R5CA 5DS7A 3J7Z5 3I55S 1SH0A 3LANA 3Q8QB 2D9PA 4F3OA 2FHMA 1HBUA 2C3MA 1O5JA 3H8YA 3M2VB 1TUGB 3KK2A 2VBYA 1XMOJ 4S0MA 3MEDB 2M2BA 4G3IA 2FHOB 4C97A 5DRKA 2RNEA 3CCUS 4NZ7A 2M8HA 3BV8A 3LF0A 3IBCB 3BKTA 3MR2A 2JEIA 2E7WA 3NGUA 3HT0A 4PUOA 4DX7A 5BXIA 1UWBA 3M6UA 2FVSA 2MQ8A 4F3MA 2BM1A 5GAHU 3THVA 3KLGA 4WIIA 3R6GB 4XPEA 4I7FB 3TX8A 1FA0A 4ZHRA 5HMWA 3SIPB 1TKTA 4DFKA 3KK3B 4DR7J 1LWEA 4I1TA 4F4WA 5E0OA 2FPHX 2HMIA 5KFBA 2XLKA 1IR1A 3TQ1A 2KG1A 2EXUA 2G2YA 1X9MA 4DQPA 1GMWA 2OI2A 4M94A 1IJEB 1UFKA 2A10A 3M05A 3J7AN 1DQAA 1IQTA 2FGOA 3UNYA 3KDOA 3IG1A 1PAUB 5HQMA 3D7SB 3T1YF 2C22A 3J80Y 2HQCA 5B0EA 4ZN1A 2XBPA 3DFEA 3DMJB 2OD4A 5IQ6A 2QSWA 3JAMY 3VAGA 2X3GA 3MPYA 4M5GA 1JNZB 2B8QA 1WORA 2K06A 2DRBA 3L3CA 1ZS6A 2AGPA 4DV0F 2I1RA 4MTPA 4KAIA 2DHAA 1VRQC 2Z30B 1Y5IB 4KH1B 4ECZA 3BF4A 4X66J 2V6AA 4O4RA 1W26A 3MCNA 5IWAF 1X5OA 4NE9C 3F44A 4OX8A 3GIMA 4LR8A 1FJGF 4WKYA 1M5KC 3MUVP 3IWNC 4QU7A 3NGRA 2CQGA 1RT2A 3DKDA 4H4MA 4N76A 2OPPB 2HNZB 4Q5VA 4TY9A 1KRPA 5HANA 3MOZA 2EPIA 3F0NA 1FDNA 4YMEA 3X1LB 2V0NA 2CDQA 3JSBA 4CQ1A 2HVDA 3GFXA 2XNRA 2ZDPA 1KLMA 1S12A 3JXOA 2YNFB 1PGZA 3L7PA 2AYBA 2BKOA 1H2VZ 3IAS9 1QD1A 3GMGA 4OV1A 2DVIA 5DQIA 4YEAA 2R8KA 5DJBA 1BWEA 4MKAA 1RHRB 4NLOA 3QGHA 2D1CA 2YVSA 4MT1A 4ZVSB 4I67A 4CLYA 2UVUA 3NEKA 1HD1A 4R25A 4IFVB 4KFBA 1S72S 5ETQA 1VFJA 3RR7A 1S99A 3NXZA 2J6TA 1WSVA 4TU7A 1S97A 1FNXH 4YB1P 3DOKA 3U7JA 4I6YA 3RRHA 2HWHA 2MKYA 1Q8BA 2GFFA 1U47A 4N56A 2IDLA 2B6AA 4OJ1A 3KDNA 4ZP7A 1L3SA 1TFYA 4AXJA 1YJRA 4UY85 5LMNF 2B9XA 3QGGA 4ILLA 5ETLA 2X1AA 4LRBA 1U2FA 4Q8FA 5HMYA 1B70B 4WU3A 1YZ6A 4ZPTR 3UVJB 1U1OA 5D3GA 2ZC3A 4KSEB 1TV6B 4ZVGA 2ZJPQ 3DRYA 4G1IA 3GJRB 4ICLA 3JTNA 3CO0P 3ZZZA 2O67A 4F0KA 5IC4B 1NO8A 3BH7B 1JLEB 3UN3A 4KV8A 1TK5A 1U8WA 3T1HF 4DX5A 1QTMA 3EM1A 2E5GA 3GQCA 2MKHA 3FMBA 2CQIA 3EPGA 4USWA 1NU4A 2R7SA 2CJBA 3OXLA 1RWXB 2RU3A 2FVQA 3LGNA 3NLCA 2GJ2A 3CF5Q 1NRKA 2V8GA 4M5MA 3FRYA 4QYRA 1T3NA 2XMKA 4HL9A 4OL8A 1NHUA 1SQFA 4JI1J 4RW8A 2H3EB 2I5JA 1SJ1A 3E01B 1TL5A 4UT4A 3LGMA 3MPUB 2F4FA 1U7LA 1YJTA 3GFYA 4QR2A 1PJ5A 3NGTA 2AF6A 4N7TA 3C66A 2BE2B 4LRCA 2AEFA 4DHVA 1V3RA 4LFBF 2YNHA 2LQ5A 3ZNJ1 2HHUA 3JSRA 1KFDA 1T03A 3RB6A 3BBCA 4R0EA 2E5LF 1R43A 2MHEA 4GO7X 1Z1ZA 4YHHJ 3PNIA 1DQ8A 1R0BG 1IN0A 4AD6A 5IT9Y 1MROA 3PJ9A 4KR0B 1VQMS 4KH0B 1JNRB 4UUWA 3CJQA 1FO1A 1HBUB 4IQXA 1H0HB 4C8KA 1GT8A 2FJVA 3UD5A 3KK2B 3CCWA 2WCXA 4DR5J 1XR7A 2LDYA 1S76D 2R2UA 1J5OB 3DDNA 4LT6A 5HVGA 4B08A 4R8UB 4JI3J 1X8DA 3IAM9 3MMAA 1XNRJ 4MK9A 2FLNA 2CXEA 4PWUA 4YY3J 5KFMA 2KYZA 4K4SA 4PUOB 3HHEA 4URQU 4BDPA 1I3OB 1UWBB 5T7LB 4PG7A 5HJXA 4KKOB 1RAEB 2V2ZA 4FPRA 4QYZK 2B56A 3M8QB 2W4CA 4M5LA 1VI7A 3D1QA 1EETB 3I0SB 3KLGB 4JI6F 2FYXA 2MJUA 3P49B 2HHPA 4I64A 2VPZB 2RRAA 2V68A 2LXIA 2B7BB 1F5AA 4JI8F 1VRUA 3V6DB 5ETVA 1TL3B 1U1PA 2BJ8A 3G8TA 4RU2A 2WK4A 2HS3A 2W7OA 2FHKA 2QE5A 4X62F 5KOXA 3GONA 5IM0A 3J7A1 3CJTA 3AB2B 2I2YA 1VOMA 3G71S 2ZH1A 1H98A 1NK9A 2XHCA 1R0CB 4OI4A 3ETOA 3B78A 3IG1B 1MMNA 3FRZA 1U1QA 4M5JA 4IDKA 4CH1A 3KMQA 3LW5C 4O44A 5T41A 1U02A 2JLGA 5IOLA 3RAMA 5D0RA 4KBIA 1SB6A 2H4WB 1M0SA 4LF6F 3UWTA 3MEGB 1N5SA 1RWMB 2ZBQA 2DH8A 1BQXA 2ZH3A 1JQGA 1IKWA 2DHHA 1S0OA 3MPWA 1NDCA 4EI2A 5E3AA 3H7HB 1IKVB 1QE1A 4DCJB 1EIYB 1C1CA 4RNOA 3I87A 3UFCX 2VKRA 1BHNA 1C0TB 2NXJA 3G87A 1WOPA 4ZPCA 4NCGA 4CO5A 4ZMMA 2BV3A 1Y10A 3R1LA 4C8LA 4USUA 4Y0FA 4K4ZA 1DBDA 5KFUA 2K1RB 3D3CJ 1SPBP 2KDOA 1QAIA 4O0NA 3NG8A 1MWZA 2ZH4A 1I6JA 3HHNB 3TNVA 2EWHA 4ES2A 2KKHA 1I51B 2BMBA 2EEYA 3RW7A 2QMWA 3Q22A 2X1FA 1YHQS 4QWAA 2C42A 1HWIA 1SC4B 5AE3A 1Y9OA 3EZ5A 4ELTA 3DM2A 3M6XA 3MTKA 3NGKA 1ZM9A 1AA1B 3HLUA 1BUXA 2JL9A 4QZVB 3MAQA 2LYVA 2QLXA 1HNVB 1K8AT 3BR9A 1XR6A 4X84A 2R8HA 4TLQA 3CO9A 4G6VB 1PYSB 3UDEA 2U2FA 2DY9A 2V34A 3DOKB 2VASA 1GFWB 4LSLA 1VQ9S 2G2OA 4M5HA 1RTJB 4WP9A 3W9IA 1HKAA 3O44A 3PEHA 1N34J 2J0WA 2BJ3A 4CLTA 4ZN3A 3EGZA 3KG1A 1NJYA 3MPDA 3M9NB 4NEZA 1SH2A 4ID5B 2XC9A 3K59A 1JX4A 4C0OC 1C2PA 4ZKAA 2V69A 4ZP6A 2FJEB 2IVMA 4ZIVA 2OPSB 5C25A 4DLGA 1NXIA 2HHSA 5AE2A 4FNHA 4ICLB 2V4RA 1T9TA 2BJ9A 4USHA 3NCQA 1UJ5A 3QFHA 3HULA 2GIQA 3MECA 3R1HA 5DZ7A 4DPTA 4K4TA 1U24A 4QWEA 1GNKA 4OYIA 2YH1A 2PFFB 2DGSA 1G4CA 1OQ6A 4A8WA 1FX2A 4FBUA 3W3SA 1Q8IA 3EX7B 2LVWA 1ICEB 2IDEA 2UUBJ 2EK6A 1TVRB 1GXTA 3D66A 3UN2A 2C3PA 1R8CA 2XY7A 2XYPB 1WWHA 4ETXA 3RJMB 5A8WA 2D41A 3CDUA 4RW8B 2I5JB 2ROEA 3WIUA 2YX7A 5DGBA 2BACA 2AMCB 4DR1J 4UOCA 1U0HB 2ZM6F 4MYUA 3CW2C 3EUNA 1OY6A 1DTTA 3W8PA 3AD9C 2EFNA 3TRGA 1UCNA 1UJ6A 2PMZD 4RU9A 2XWXA 1S6PA 4M5DA 2Y3YA 2AIRB 1T03B 4LSZB 3QIPA 3NBPA 3MPVA 3N6MA 4YR0A 4DSEA 5HP1B 4ED5A 1TZ0A 3DLGA 5HATA 3ZC4A 2MQLA 2XTJP 1U6BA 4HH1A 2XMUA 3UQSA 4P73A 4YB5A 3SCIE 6AT1B 1VYAA 3OD2A 2EC2A 2FQQB 4XPCA 3PG9A 2AJQA 5LSOA 1RTDA 5HROB 2N7CA 4X4UA 5BYRA 4CH0S 2CPXA 5K20B 2J0XA 2YKMA 2UVRA 4M63A 2ABYA 3ULHA 1KSPA 4JV2A 4EZ6A 2OKQA 3X3UA 3FJ2A 1IBMJ 3R5AA 1FRMA 3SZ2A 2VFSA 4DQRA 4QW8A 3FSYA 4RNMA 2AJ2A 3KOAA 1L3KA 3A3NB 2DNQA 2F8HA 2GW8A 2Z56B 2FJAB 3I6PA 3AT1B 5IC6B 4TKTA 2ASLA 4KGVB 1HWJA 3ENQA 1LWCA 1VRUB 1YWXA 3Q24A 1PILA 2H4YB 2NXEA 2L3MA 3R5DA 3FEZA 3N0VA 1RT6B 5LOQA 1MLAA 2L48A 4F4KA 4JV5F 4IO9Q 2NPIA 2VQFJ 2L9DA 4OHVA 3BPSP 3CIZA 3P4UB 3KYLA 4LFAF 2E1PA 4KC5A 3VAJA 3GJSB 4NXNF 4OJ3A 3M2RA 3Q2TC 4F0MA 1NKBA 5HQ8A 2UUCF 3IWXA 1T0TV 4RNFA 3MAHA 4IDKB 1UP1A 5IQQA 5EWFA 4JI4F 2XS2A 4FDFA 4O44B 1VJQA 2W1BA 3HJVA 1FNMA 1CG2A 4U96A 2OPRB 2E7XA 1QVGR 2HHHF 4LMZA 1IKWB 4J91A 1RT4A 3D2WA 1XQIA 2R7UA 3EVMA 3OHAA 1AZSA 4J9SA 2DKOB 1C1CB 2YBVA 1J5EJ 2DCUB 4DSIA 3VCDA 4DL4A 2EFVA 2A18A 3CD6S 2ZH5A 3H59A 3R7NB 1YLXA 2J8SA 2BM0A 3IBFB 5D8HB 3GPAA 3NOGA 2CRLA 3NKYA 2K3IA 1URNA 1AFIA 5JVHQ 3TQEA 4OIXA 1T02A 5KFCA 1RTIB 2ZH7A 1R0AB 4YFUA 3V6HA 3CJ4A 3W5ZA 3QMQA 3LALA 4MMOA 3M1VB 2ALYB 3ILIA 2UU9F 3PX0A 2IRUA 2RQ4A 3DU5A 3OSNA 3V81A 2NYHA 1N6QB 2AJ0A 3QT5A 4HI1A 2V9KA 3SSQA 2OELA 1T3OA 1XC9A 2W9CA 1U1MA 2VC1A 3OR2B 2RUGA 2XSJA 5A8KA 1FHTA 2DGWA 2Y1RI 3CDEA 5D15A 3I31A 1O51A 3LP2B 3P8BB 4DFPA 1XMQF 3MEKA 2DO0A 4ECUA 2DK2A 2R8IA 3BBBA 5B0BA 1JMTA 5E3CA 5J1NA 1IWAA 4OZ1A 5HI7A 3CCQS 2KFZA 1ZZNA 1SXLA 2GVDA 5J2PA 5F9LA 3LOUA 4IG0B 2FZCB 1C1BB 4UOFA 5GADI 2ZHOA 4LSLB 1RHJB 2UXBJ 4OZ5A 2EFPA 4YB6A 2IYGA 3H40A 3THTA 2N7YA 2VDHA 4RUHA 3B6BA 4PG8A 2GMLA 2QO3A 3R3TA 3K5LA 4X4VA 3NS7B 1YJ9S 4W90B 3GYXB 1CULB 2Z2MA 2VU5A 4A8FA 1TL7B 3PZPA 4DV4J 1FDBA 2BUNA 2F8MA 1SBRA 3CC7S 1YBUA 3RB3A 3OTOJ 1HNWJ 3EZOA 3W2VB 1RP5A 4DR6J 1SQEA 2E7VA 3MECB 2BW2A 3SMZA 1ZM4A 2D74B 2JH3A 2G1DA 3TO8A 1FVSA 3FK4A 3FCHA 3C6UA 2M4MA 4UTGA 4OYXA 1NKCA 4USMA 1OIAA 4QR0A 2BX6A 1VQOS 1RWOB 4EGLA 1RE1B 1FT8A 4DF8A 1DRZA 1QUVA 5A8WB 3W62A 1OQ3A 3M32A 1HI0P 4UF4A 4YB7A 3N28A 2HAFA 4HDHA 4TLRA 3IS9B 4MK7A 2RSQA 1HIYA 4L74A 4NMXA 1S48A 2DGVA 4FN5A 3DHXA 2ASYA 1DTTB 1F2HA 3CT9A 1MNEA 1FKOA 2WTFA 1NK6A 2X51A 2B5JA 4NA3A 4ZVEA 1CC8A 4X65J 3BH6B 2IFXA 2QN6B 5D4LA 3NBPB 4B9UA 1RGVA 1TKZA 4B3RF 1U6ZA 3DLGB 2AGOA 3I4PA 3SCLE 1Q8LA 1VHIA 2MLYA 2VICA 4CLLA 2DB1A 3A8EA 1B99A 1LEOA 3ZTRA 2MQOA 2YWKA 2AYEA 1U0SA 3JQJA 3PRDA 4NLTA 1RT5B 3DGPB 2J6SA 4RW4B 4QIFA 3NNCA 2VBZA 2V63A 3TZWA 1N5YA 2GQCA 4DUYJ 4KQZA 2O3DA 1HBNB 3SV4A 1K1QA 1VBZA 2OO4A 1TTHB 2K7KA 1X9WA 1Q8KA 4OYOA 2Q79A 3T5HA 3AFGA 3HCXA 3PHTA 4NI2A 2MY8A 2RB7A 4XAKA 2DH9A 3ET6A 2HNYA 2DNKA 5F3ZA 3RBXA 1KFSA 3J81U 3FNNA 4HT5A 3BSCA 4PPZA 1T9WA 3DC2A 3MFHA 4HTIA 4QU6A 3KHGA 3UN5A 4X64J 1LWCB 2J9DE 3PW5A 2DT9A 4P2MA 2ZZTA 1KR4A 4IFYA 4PXCA 1F60B 2VG6A 4QIVA 1X4DA 1LW2A 1EQ0A 1FJ7A 1S4FA 3HFVA 2XMJA 3SCKE 3HJFA 1FKPB 2H54B 1NK7A 4RX6A 3DGVA 2E9RX 4F04B 3GCXP 1CBKA 3S1TA 1NK4A 5GAGI 2CQ1A 1SC3B 5HSPA 3FBFA 4OYPA 2QJ3A 4GVLA 3M7VA 2KU7A 2BW7A 2AYMA 1ZAWA 2BDPA 1KQFB 3R7SB 4A8KA 4V19X 3BJYA 1E6VA 3AODA 4NLVA 3TAMB 5CD4H 5JUMA 1FF2A 1JJCB 3RUBL 4OI3A 3EVWA 4RBVA 1KP6A 3HZGA 4NOHA 3HHLD 4HACA 2ZKUA 1REVB 3PCOB 3ILOA 1BD6A 1JLBA 3K7RA 2X1BA 1FRXA 1ZM2A 2LXUA 1O0PA 3QNWB 1V3SA 2V8VA 1IBLF 5J2MA 2DO4A 2W2MP 4YOEA 1WOOA 3VALA 4G1PA 2CUYA 3H5XA 4I69A 3GP9A 1HQUB 3KLHA 2GCFA 1SJ4P 2HBYB 3VZIA 2QIFA 4DV3F 1YRXA 2VQEJ 5IV3A 4EO6A 4G1QA 1FK9A 2FVRA 2W7PA 1C4AA 1MU2B 1D9DA 3SDEB 4OFZA 2YX1A 3KG4A 4B9MA 1VQYA 3Q0AA 3LPEA 4LRAA 2XSJB 3KNGA 5A8KB 2FJBB 2GJFA 3OVBA 4Q2LA 3WZ0A 3DHWC 2PIIA 5A2QY 3KMSA 1GXLA 3CE8A 2XNQA 2BQUA 2VV5A 5KFJA 2IMWP 2BR0A 2H48B 2WBMA 5JXSA 1VHFA 4F67A 1SJFA 2YPZA 2RQKA 2D3O1 3A13A 5I3UA 1RYRA 1RTHB 2GVDB 5I3QA 5IT0A 1RACB 3ZTQA 4LF7F 3CWJA 2K2PA 4B3MJ 4W98A 1YTYA 3T5KA 4PAAA 2Q6BA 2GJIA 5F0UA 5HVHA 1H2TZ 3GB0A 1QDUB 2ILYA 1CC7A 1T8EA 3NL0A 2KFNA 1G6BA 3B4DA 5GMKa 4K2XA 4FYVB 4JP8A 4L73A 4WFYA 3M2UA 4LREA 2CNLB 5EDWA 2QTWA 3S7RA 2XI3A 1XMOF 3EZUA 3A4TA 4RR5A 1WF2A 4CO3A 2N82B 3I5CA 4Y3CA 2XMVA 2MB0B 3PRBA 3ZZPA 4EUVA 3NOCA 4O3PA 1C0UB 3R5BA 5KFYA 4CZCA 4PQAA 2FZKB 3Q2SC 3UO0A 1TMJA 3KJVA 3PIOQ 1LWFA 2V67A 3OVAA 2LEPA 5K9FA 1PJ7A 2XQCA 3KFWX 2NLWA 3C8YA 5G0RB 3PFEA 4X4PA 2Z4PA 1K0TA 2V2KA 4GC6A 4LF4J 1DLOB 4ZCIA 3AD8C 4U8VA 2CQDA 1SUQA 4DSKA 3QGPA 4DR7F 1NSAA 2DNLA 2ZITA 1NSKL 2W25A 3SYZA 4MKVA 2I0XA 2ERRA 2R8GA 5JVGQ 4ERDA 2W8KA 5CYMA 5H9EJ 2ADCA 5C5JA 2MZ1A 5KFKA 3I4HX 1FKOB 2C2KB 3BYPA 3I0RB 4Q7AA 1JXLA 2VPXB 4Q45A 3ZTSA 5B0GA 3VZHA 1K9MT 2X1GA 3IWLA 1JJ2R 1GK8A 5HJYA 1SIZA 3BKFA 2OPQA 1VRTB 2CQBA 4C8MA 5KFZA 4NLPA 4KY3A 2HZCA 4Z7YA 3M8PA 1FRJA 2XWYA 3KHRA 4K5RA 1LWXA 2P9CA 5F0WA 2CQ0A 1N54B 2POKA 2DITA 4PG4A 1D0EA 2LU1A 2JLEA 1JLAA 4X66F 3OUYB 3HP6A 4TNOA 5CYQB 2NS1B 2HQFA 4DV6J 4ZOSA 4DL6A 5A8RA 5HBMA 5B09A 4PQUB 2NZCA 4HHHA 2F8EX 4YN3B 1L3TA 4ZCKA 4ZPAA 3ZTOA 3GJQB 4UQGA 2F9DA 3PEJA 2LEAA 4ANCA 2AD9A 3FEXB 1NDLA 2GS8A 3RTVA 1KD1T 4JI7J 2LLZA 4HT7A 1JLQA 2XYHB 3M8YA 2HHQA 2ZFHA 1FRKA 4Q0BB 2HQ3A 3O5TB 2CAJA 4GVBB 1KOOA 2D3ZA 2XHWA 4BS2A 4JOUA 2AHOB 2PEHA 2DNMA 4W92B 4NLXA 1QTNB 3FSXA 3C3LA 4LVOP 4Y6IA 5KFEA 5EX0A 4RNHA 4PXBA 3ZZUA 2ZH6A 4PG5A 2CG4A 1JK9B 5F9NA 3H4BA 2DGUA 1LW2B 3U1MA 2BRKA 5HMZA 2WHOA 4QWBA 4P72A 2NSBA 4KPYA 5J2NA 5D78A 4NLSA 2J0QD 3PW7A 1NH8A 2FVCA 3SXLA 1S7IA 5AXKA 2Q3PA 2CQ3A 4OMFG 2HLTA 3P45B 2CQCA 3TI0A 1LK5A 2J9DA 2PSZA 4K7QA 1NMEB 4FF1A 3MUTP 2NXNA 4A46A 3ITHA 1MWYA 4ZPDA 1YX2A 2PA8D 1HYSB 1LKZA 2KL8A 4B9NA 4CCHA 2YWFA 3LA0A 2JZ5A 4MFBA 1YJUA 3W64A 2HG4A 3KLIB 2HHVA 2VONA 3QLHA 1RT7A 2NR0A 5B7WA 4ES1A 4O0IA 4CLKA 4C6AA 4H4OA 5K8NA 4EBDA 4B3OB 2UXDJ 4J9MA 1VQKS 3RBEA 2B4UA 3KLHB 4MIBA 4C8YA 1VC6A 2AX1A 4CO0A 3EJMA 2MXYA 2HRYA 1KVKA 3WX4A 3D4JA 3QAUA 3D6FB 5K14A 4NX9A 1VS3A 3DRRB 3ZO7A 4KHMA 2GC8A 3MM7A 5EWEA 3TYTA 1NM2A 5AE1A 1UMJA 2DR9A 2YWEA 2LQ8A 4LSNA 2MZTA 1S1VB 5KT2A 4C48A 2W2QP 2HFZA 1WKLA 4PKDB 1RWKB 4JI1F 4QWDA 1JIHA 3CJKA 5IXUA 3TZZA 2MZSA 4M95A 3PDNA 1Z2ZA 4FBTA 3R2DJ 2GGPA 1FTRA 2ACMA 2ZUAA 1S5ZA 5KFOA 1S6QA 4DPWA 5KFWA 2XM3A 3PR4A 4E8UA 4WFBQ 4P2XA 2MGZB 4LR7A 4K50A 3EPIA 2XS7A 4DG1A 2MHNA 5HVFA 1J27A 1UEKA 4LJMA 3BGLA 4A4JA 2R7TA 2E9ZA 2XO6A 4YHHF 3Q8RB 4ALZA 3TANA 1K47A 2CWXA 2A0FB 1UW4A 4Y65A 4RW9B 3I96A 4ENOA 1IBKJ 3WC2A 1R89A 4DR5F 2F9JA 1NHVA 4CWBA 4JI3F 1RU1A 2OLWA 2A6MA 1XNRF 1R31A 3OL6A 4KGXB 2QL9B 2RDDA 3PYFA 3GILA 4YY3F 1W25A 4I56A 4F36A 3K5NA 2YWGA 4NL5A 8ATCB 5L1IA 5B08A 3EMTA 4QR1A 5KFQA 4PCQA 3J7ZT 1FJEB 3OPKA 2RRBA 5D6GA 1HMVB 4DL0C 4GKJJ 3PO5A 4FNIA 3A8KA 5H1SV 1UVLA 3DI6B 1S1XA 1S9EB 2EBGA 2A2CA 1UETA 6FD1A 1SUQB 2FTRA 2LA6A 1D8YA 4XTTA 3JTOA 4NLUA 1S1UB 1HQEB 4OZJA 3BN7A 1CS4A 3O8WA 1B4SA 2V8HA 4LRFA 4O3OA 1U1LA 1X4FA 1FEEA 3D6HB 3Q86A 3VWSA 3VF0B 5IFMA 3VTIA 2YKNA 4J9PA 2JJ4D 3HT3A 1Y5LB 1F3FA 3C14B 3IP0A 3QFWA 3W8GA 4DX6A 1UL3A 2W01A 3BO3A 3UCZP 4F2SA 2JFDA 2KTQA 1BC6A 3M8PB 2V8PA 1P27B 3GSDA 1XN9A 1P6TA 2Q66A 2WOMB 2UP1A 3FQKA 2X7IA 4LF1A 4NXMJ 1JLGB 2C28A 1WKJA 1CJUB 2C1EB 2UUWA 3RRKA 1U49A 1FERA 1WHXA 3HO1A 2BABA 2WVEA 3M30A 5FDLB 3POTA 1NPPA 1Q78A 4O23A 1EP4B 2QFJA 1B0TA 1RQ0A 3M8WA 4L6V3 3IM8A 4QOTA 4I2PB 3GWCA 3V2UC 1WDDA 1GMVA 2BYCA 4IYQA 3TAPA 4KGZB 3GSIA 2HQGA 1Q86T 1JLQB 2ZHBA 1CJKB 4LF9J 1AROP 4DSFA 2KN4A 1S10A 2FY8A 4OZ0A 2HGLA 5KFLA 3TR5A 2HRUA 1TAUA 1I94J 2JWNA 1MSWD 1APSA 5JJBA 4DN0A 2JEFA 3DRXA 2LKZA 1VIOA 1M1HA 2XZTB 2KZZA 2DH7A 4ZIWA 1HWLA 1U8SA 2NZ4A 1R8AA 4OI2A 3CPWR 1VIXA 5F8MA 2MJNA 2QLBB 1SJRA 2M0GB 4QQBA 1LV5A 3A3OB 1UA1A 4QBUA 1RWPB 1HPZB 2LXFA 4ZVRB 4JBCA 1LNQA 3FUYA 4X2BA 5DG8A 1VQ7S 2XMWA 1IBCB 4OYWA 1QM9A 4Z7CA 1NPRA 1HNXJ 3IRWP 1QUPA 1W2IA 2J9CA 4DBQA 3BO4A 2OEJA 1KQSR 3R27A 4K4XA 1U45A 1TR0A 3DYAA 3P5BP 2FLOA 3J7YU 5DQGA 4DUTA 1N34F 3KJFB 4YS2A 1WG5A 3W63A 3MWBA 4MFBB 1S7HA 4AFFA 2L08A 3MM9A 3QLHB 3T9NA 3TVKA 2JLFA 2D7SA 3PXGa 3CULA 1NH7A 1SIWB 3M6WA 1UZHA 1HW9A 2M70A 2QEXS 4L3KA 1M1KT 4NLQA 4N41A 4H4OB 1G1XA 4Y2KA 2DHSA 3JYTA 2MKIA 3SSSA 5KFVA 1NB2A 1VC5A 2EI5A 4H4KA 1JXVA 1VK3A 3BGOP 4IUFA 2R42A 3G8SA 2KRRA 3W60A 3C15A 4DFMA 4A8XA 4PZVA 3LAMA 2VA2A 2JVRA 4C8OA 3HFKA 5K14B 4UY8T 4OX7A 2HYIB 4Y28C 2R9LA 3PFOA 1BQMB 2UUBF 2MTLA 3SI8A 2CQ4A 5BJRA 4DR2F 2E1MC 3W7BA 1Q7LB 3CDAA 4K8RA 4Q8EA 2XULA 2VZ9A 1KTQA 1S79A 3HHKA 3MD1A 2FZGB 4DR1F 2DPIA 3NNAA 3UCUP 1GTEA 3DOMA 2CVIA 2GGPB 2XI2A 1KN6A 2QX0A 2HS0A 2IJNA 2XY5A 1WEXA 4JYAJ 1S6QB 1SV5A 2ZHAA 1WUUA 3RG6A 3QBCA 1WF1A 3ZZOA 3MMBA 1VBKA 3NNHA 3KWMA 3D9BA 2HNDB 1RAHB 2GVZA 3UDLA 2RJZA 5EX3A 4RW7A 4C8ZA 1T94A 3JTPA 2PO4A 2FUG9 4OZ3A 4I2QB 2C3YA 1XEZA 3QWUA 1SH3A 3U1LA 4WFAQ 4GO5X 4GKKJ 1YGYA 3C19A 1KONA 1G3OA 4EBEA 2HVZA 3ADAC 3DNCA 1R6YA 1ACMB 1VMBA 1NNDA 1ZM3A 2CJYB 3M8SA 1AW0A 2HGMA 1DZ5A 2V4JB 3TX0A 4C11A 2E44A 3DRSB 5HMXA 4A8QA 3OJUA 1ZPVA 4WF9Q 3DRPB 2CQHA 2MPUA 3FSIA 5EN1A 1NSPA 1IBMF 2JC0A 5A76A 4CO2A 2RKIB 4PG6A 1S9GA 5KG4A 2R7WA 5KT4A 1R3NA 1U4BA 4U7UD 5E7OB 1MMLA 1GH8A 2X3DA 2ZJQQ 4XDDA 3VVTA 4DR3J 5J1PA 5L1LA 1YQHA 3GYNA 1R8BA 2YNGA 1VCTA 3DU6A 5BR8J 3BM7A 2E66A 1L3VA 1HARA 3TA2A 3TJ9A 5LXRA 4RW6A 4ES3A 1L5UA 2HURA 4ZJLA 2VQFF 2KM8B 2ZBIA 4ZVTB 1T9YA 5HLFA 2WVFA 2B3TB 2JEJA 3VAMA 2YKNB 3G6XA 4ZLPA 1NBEB 3OXGA 2M5YA 2AJ1A 1FI4A 2KM8C 4NRUA 4AL5A 2ZOGA 1FE4A 3JB9k 2CJQA 4I6WA 1PKUA 3DOLA 1T05B 2UZAA 4ECYA 1F2GA 4NCBA 2FD2A 4OJHA 2FHJA 2OIHA 2IMOA 2IAJB 2QRRA 3DLKA 2ZD1A 3LTOA 1I5OB 3RR8A 1NUEA 2DNHA 3MZIA 1J5EF 3IR5B 3EGWB 4WXWA 4C0HA 2EFQA 3POTB 2VA3A 1X0PA 1VLYA 2B43A 1Q7YT 5A6PA 1KHWA 1FCAA 5C42B 1F9FA 1N33J 5CYJA 2RDIA 2VG5B 2PE8A 1B3TA 1FRIA 4A48A 1YKWA 2HK2A 1FX4A 4RO0A 4P9SA 3EXCX 4DL2A 2K8GA 1Y7PA 3VAIA 1Y4ZB 2MKKA 2BRLA 3GFHA 2ZE2A 1KBRA 4PYAA 1QAYA 1GMWD 4A8YA 7AT1B 3K17A 2R7OA 2UV8A 2CPEA 4ZLJA 4KGMA 2RQMA 2MQNA 5JMNA 4ELUA 3FBBA 3KTQA 4YR3A 1U2CA 1DQ9A 3WQPA 1TL4A 2VFRA 5CCMA 1N5TA 3SSRA 3OLBA 4TQSA 1IR0A 3NMAA 4CTAA 1VR6A 3FKBA 4LR9A 2BANB 4I6AA 2WONB 3Q8UA 4DL3A 3ZZYA 1Y00A 3CMES 4WZQA 4RJVA 5H9FJ 1WC0A 2BJ7A 4DR4J 2EW9A 3PKYA 1UVJA 2IC3B 3OXFA 2UXBF 3IRXA 1T9VA 4ED7A 1KHVA 3BQ0A 3N4WA 1UW9A 3VGVA 1A7GE 3QT6A 3FQLA 1RT1A 3CCMS 4PRFA 3WC0A 2FIUA 3KUHA 4LF5J 5FJ4A 3H4DA 1KEKA 1WD6A 3KLVA 2YX4A 3W2WA 4ECQA 5J1EB 1VQSA 4DV1J 1WF0A 2XSFA 3TW0A 1HL6A 3GG0A 4OHXA 1RZMA 3OQ2A 2G0JA 4LBHA 4DV4F 2BQRA 2LQJA 4IRKA 4JV1A 3DXSX 2ZWPA 5K8PA 4DPXA 3OTOF 2MEWA 1UAWA 3D5MA 1HNWF 3IMQJ 1KOHA 4DR6F 1V5VA 2C2RA 3E8OA 3NGSA 1U1KA 2OH2A 4H4KC 1F1BB 2IM3A 4X4SA 4WP8A 5C24A 1GX5A 1RK8A 3NCRA 3IXQA 4USKA 2RF2B 2ZZNA 1S1TA 2YNIB 1CSJA 4BHQA 2JFKA 3JS9A 4LVNP 4O4GB 5ADZA 1KDNA 3FCWA 1C4CA 2M88A 4HH0A 4ED1A 1HWUA 2BOAA 4UW2A 4K5SA 2CG8A 4WK1A 1U1NA 1YVFA 3SEOA 3UR0A 1WHYA 2FJXA 1IKYB 1S77D 3HVRA 2JDJA 2KHDA 4JI0J 1JLFB 3C16A 4USTA 4ILRA 3CB4A 3G82B 3UI3A 1GX6A 3MMBB 3HKZD 4ZJQA 2MKCA 4X65F 2NYIA 2W4PA 4DCOB 1WG1A 4RW7B 2E5IA 4IG3A 3KLEB 1WTFA 3AB4B 2O01C 4OHWA 1WHWA 2V2VA 5DM7Q 4P7TA 2NPFA 1LOUA 5KG5A 4FP9A 5ETRA 2F4VJ 5MLCV 2ROPA 9RUBA 3HVTA 1TAQA 2G9OA 2IBOA 4DUYF 4C11B 2L9NA 3HZEA 2C2OB 3D54A 1IKXA 1NZ8A 1YITS 2JSXA 2MKSA 3DDKA 4Y2CA 3LUYA 1LK7A 2UV8G 1M5HA 3DLEA 4V19J 4A8MP 3HM9A 3NMRA 4DUZJ 1MG7A 4LF8J 2YH0A 5IT4A 2RHQB 2AW0A 2E9TA 2B7CB 3BN4A 2VOOA 4KJIA 4NLGA 1OPIA 2DNZA 1R8PA 2ZVIA 2CJ9A 1H74A 2UUAJ 1OSCA 4U7CA 4X64F 1TP7A 4ZHRB 1TKTB 1JKHA 1V9OA 4LIWA 4J9RA 2B4PA 3MM5A 1LWEB 1HW8A 5CA5A 4HR2A 3BDEA 2GHPA 3VGSA 4WTOB 2HMIB 3T6BA 2WZ1A 4PXDA 1HBMA 1QSSA 4ECRA 1P8GA 1YJNS 3FZ2A 1WSRA 4EEYA 5GAEU 2AQ4A 1RBOB 1K1SA 4X4QA 2RH3A 1M5SA 1PCAA 1RA6A 2ILZA 2YQ1A 2VC0A 2Q6CA 3MEDA 1SL2A 2V94A 3T5JA 1HI8A 3AJ2A 3D0GE 4ZVOB 3DLLQ 1CQNA 2WRMA 2IBKA 2E5HA 2DHXA 3QRRA 4CNZA 1NJZA 4C4WA 2SXLA 1OO0B 1NJWA 5H9EK 4DF4A 2HBQB 2ZUGA 4I7FA 1RT2B 4H4MB 3WDOA 3MURP 3WHIA 3MOJB 3QJJA 1DURA 2XMMA 2XGQA 2E5JA 2VIHA 3KK3A 3UE2A 4R5PA 1UVMA 3A8JA 1IQZA 2FLLA 2VQEF 1EKSA 2PDAA 2HZVA 3EWGA 1ZTTA 3NAHA 2VJUA 3TAQA 5FD1A 1TUWA 2JRSA 5LJ5Y 1KLMB 3DLBA 1KNZA 4ITSA 1JLCA 2LECA 1LFPA 1VDHA 4WXOA 3PY8A 5KFPA 4BWMA 4O3SA 1CQMA 3C6TA 4JV0A 2R2RA 2OHDA 1SL1A 4U7UK 3O3LA 3D6MB 1BMQB 1QVFR 1RYSA 1UZDA 1Q5YA 4X4TA 1H38A 5LJ3Y 1X4BA 1NHKL 2VG7A 4KFBB 5KTQA 3HD2A 4B3MF 4P74A 2PEBA 4DDFA 1NK8A 3PHEA 1CJTA 3ICLA 2CPIA 1B64A 3GU0A 1X60A 3IRXB 4DN9A 4A47A 3U02A 2R8JA 3N6NA 2RS2A 2IM2A 4DWIA 1PO6A 2HHXA 2QA4S 2DXFA 2HPUA 3OFGA 2OPPA 4WCEQ 1URRA 3J80U 2HNZA 3OJSA 2B6AB 1H6KX 3CD0A 1S1WA 3W2WB 3JAMU 2KG0A 1VBXA 2WVDA 1NB7A 2G2ZA 3IM9A 2XCPA 3MCMA 1NKEA 2YWHA 1CVJA 5D3GB 3TZXA 4HI2A 1N32J 1RJJA 4OV6A 3UDCA 2QV6A 2HBRB 2C3UA 1ZYQA 4LUBA 5DM6Q 1U09A 2CZ4A 3LGHA 1WNEA 2VHGA 4KO0A 4NCAA 4ER8A 4AT1B 4KV8B 5L9NA 2CKWA 5C24B 2KB2A 2VFTA 3CJ3A 4B17A 3L4BC 5B0AA 5I3PA 3FMWA 5RUBA 1WC4A 2EKYA 3I82A 3G9CA 5D4OA 4LF4F 4X4RA 5LMUJ 4BC7A 2QLWA 5I4MA 1S0VA 2JEGA 1X0FA 2CVEA 1FVQA 4ZLLA 4DR2J 4HHUA 2BKPA 4OLOA 1E6YA 4IR1A 2DPJA 4DSJA 2GX8A 2QC3A 2B9WA 4KGKA 2BXJA 5F8NA 4LIRA 2YNHB 4QPXA 2RHSB 3DCAA 1KQKA 3W65A 1D8ZA 3J81j 4NYOA 4CLPA 3UVJA 3DLHA 1BE4A 1TV6A 3THPA 3BPDA 1JXEA 2NCKL 2GAHC 4FYXB 5F8GA 4BWJA 1MROB 5EWGA 3D0IE 3OSPA 4DV6F 4TVAB 1JLEA 4E98A 2MZRA 4F8RA 4J9LA
chains in the Genus database with same CATH topology
2F40A 1HYSB 1LKZA 4DHVA 1V3RA 2AJ4A 4LFBF 2W9AA 4B9NA 3TA1A 2YNHA 4CCHA 2LQ5A 4NZ6A 2YWFA 3CCTA 3TUIC 2JZ5A 2IA0A 2HHUA 3JSRA 4MFBA 1WEYA 1YJUA 1KFDA 1T03A 3RB6A 5GADU 2HG4A 3MMAB 3VQSA 2GA7A 3KLIB 1HD0A 2HHVA 4OQJA 3MM7B 3ISNC 2VONA 3QLHA 1RT7A 4CT9A 3M4XA 4R0EA 5LMUF 3OL7A 2NR0A 3CDWA 5B7WA 2DTJA 4ES1A 2E5LF 1R43A 2MHEA 2APOA 4IRCA 4O0IA 4YP3A 1BQNA 1S9FA 4JI7F 4LSNB 4RBUA 4GO7X 3LP1B 1Z1ZA 2COLA 4J9OA 3PNIA 2DCLA 1KQGB 1NEEA 2QA1A 1DQ8A 3JSMA 4C2MA 2F7VA 1IN0A 5K8NA 4H4OA 3LWLA 4EBDA 3E01A 4XK8C 2CFXA 4B3OB 5IT9Y 1MROA 4ED3A 4KR0B 2OFHX 1U2RA 4J9MA 1VQKS 1VQMS 3RBEA 2E29A 1JNRB 3CJKB 3RBDA 4OI1A 4OJGA 4UUWA 4ECVA 4O3RA 3LQVA 1FO1A 2EK1A 1HBUB 2MY7A 1H0HB 4IQXA 4CI0B 4C8KA 1GT8A 2B4UA 2J7WA 1RKIA 3KLHB 2NSCA 4MIBA 4PR6A 1RKJA 2HWIA 2FJVA 2BE2A 3KK2B 4C8YA 2DIVA 5K8MA 3CCWA 2WCXA 1VC6A 1XR7A 2LDYA 4Y2AA 2AX1A 3AJ1A 3TA0A 4CO0A 2R2UA 2RDJA 1S76D 1HYSA 1HWKA 2MXYA 2K3KA 1J5OB 1K73T 3DDNA 2Z8QA 2HRYA 3HPOA 4LT6A 2GHWA 3WX4A 3MM5B 3QAUA 4B08A 3CEDA 2OJ3A 5K14A 4R8UB 1X8DA 2IVYA 3IAM9 4NX9A 5KT3A 1ZTWA 3MMAA 1RI7A 1VS3A 3DRRB 3KLIA 3OFFA 4KHMA 2GC8A 4DJBA 3MM7A 4FVMA 4MK9A 5EWEA 3C46A 2FLNA 3TYTA 4PWUA 5AE1A 1UMJA 2WSFC 4DPOA 2DR9A 2GHVC 5KFMA 2KYZA 4URGA 3N5BA 2JC1A 4K4SA 2YWEA 5B0FA 4PUOB 4LSNA 2MZTA 3HHEA 4URQU 5IM0B 2DISA 3CCSS 4BDPA 1S1VB 2HQIA 2EBEA 1QSLA 5KT2A 4DG1B 1X4HA 4QW9A 1UWBB 1FD8A 2CJKA 2KJVA 2HFZA 2FDNA 4X4NA 5T7LB 5EGYA 4PG7A 3BDPA 4KKOB 4PKDB 2YKOA 4B3OA 1UVNA 4FPRA 3GR0A 2B56A 4JI1F 4QWDA 1JIHA 1LXNA 3M8QB 2L9WA 1X4GA 2W4CA 2J9EA 1VI7A 3CJKA 3D1QA 1EETB 5IXUA 5LXYA 2MZSA 3I0SB 4UQTA 1F5BA 3KLGB 4JI6F 4ZDNA 1JJHA 2AYGA 4M95A 2MJUA 3P49B 1BGXT 3KHLA 3PDNA 1IUJA 1HNIB 1Z2ZA 2HHPA 4FBTA 5J2QA 2IRYA 4I64A 4Q43A 2GGPA 1FTRA 2VPZB 2RRAA 1J5OA 5A0YA 3HMJG 1YBAA 2LMIA 2LXIA 2B7BB 5ITHA 2B9YA 1F5AA 4CH7A 1NJIT 5DO2A 4JI8F 2HAIA 3GIIA 5KFOA 1VRUA 3V6DB 4R8UA 4YR2A 1S6QA 2R4FA 1TL3B 1U1PA 4KIAA 3DRRA 4MIWA 5KFWA 3C2PA 3G8TA 3T6JA 4RU2A 2WK4A 2HFOA 1VQ8S 2HS3A 3PR4A 2W7OA 2FHKA 2G4BA 4E8UA 2QE5A 4X62F 5KOXA 3PW0A 4LQ3A 4WFBQ 4RUCA 3K58A 4DMZA 4EFAC 5CH7B 5IM0A 2MGZB 3J7A1 1S1VA 4F26A 4AL6A 4K50A 1HBOA 3EPIA 2CYYA 3AB2B 4DG1A 2MHNA 2XCAA 2I2YA 2XS7A 1VOMA 1QE1B 5L1JA 4LJMA 3G71S 3BGLA 4A4JA 5T7LA 5KFNA 2E9ZA 1PSDA 2R7TA 4KKOA 4K4VA 4KTQA 2VPYB 2RS8A 4YHHF 2ZH1A 3Q8RB 3MM8A 1H98A 1NK9A 3JSYA 3M8QA 4ALZA 2XO7A 3BR8A 3FVYA 1EETA 4OI4A 5DDQC 2J0SD 3CTRA 3ETOA 3B78A 3IG1B 1MMNA 3FRZA 3I0SA 4KHRA 3TANA 1U1QA 2CPJA 1N5QA 3HI9A 2UXDF 3I56S 4IDKA 3MI7X 3O6QA 3NGDA 4CH1A 2F3JA 3KMQA 3LW5C 4NCGB 1UW4A 4Y65A 4DSLA 4O44A 5T41A 3U27A 2JLGA 5CQGA 1XMBA 4YDXA 3RAMA 4RW9B 3I96A 5DGAA 4KBIA 4ZP8A 1SB6A 4P2SA 1Q16B 1NK5A 1M0SA 1R89A 3WC2A 4LF6F 4DR5F 3UWTA 3MEGB 4R5PB 3V6DA 1N5SA 5KFFA 1S1XB 1TL3A 2DH8A 1BQXA 2F9JA 4GMKA 2ZH3A 4DQSA 3OTBA 4I0WA 1IKWA 3KG0A 3CCJS 1OSDA 5DQHA 1NHVA 2DD8S 2H5EA 5F8HA 5IS2A 4TU9A 4JI3F 4FS1A 3T9ZA 2OLWA 3G8QA 1S0OA 1S6OA 3MPWA 4IOBA 1XNRF 1XTZA 4HLBA 1R31A 2YQ3A 5E3AA 1UFWA 3OL6A 5KFIA 2MGZA 5HO4A 4FYDA 4MIAA 3GILA 3GR1A 4QYZJ 4Y2MA 3UPFA 1IKVB 4YY3F 1QE1A 1W25A 3SCJE 3EYZA 1C1CA 3PIPQ 1D3WA 4I56A 4RNOA 4FS2A 1JLCB 3K5NA 2IM0A 2YWGA 3I87A 2J7UA 1AXQA 3UFCX 4NL5A 5L1IA 4NYPA 1SC6A 3M6VA 5B08A 3OHBA 2VKRA 4NPOA 2AX0A 5F3TA 1C0TB 4QR1A 5KFQA 4PCQA 5IZHA 5KAKA 3J7ZT 1XERA 2XMTA 3RZAA 4DQIA 2J8AA 1H3DA 1FJEB 4ZPCA 3OPKA 2RRBA 3DM2B 4NCGA 4CO5A 1HMVB 5D6GA 4B3SF 3C6TB 4ZMMA 2BV3A 3PM9A 4DL0C 3R1LA 3CIMA 1YI2S 4C8LA 3PO5A 1UKUA 4Y0FA 4TY8A 4FNIA 2GMJA 4IO1A 4RW9A 4TYBA 5B0DA 4K4ZA 2FC8A 1DBDA 5HL7Q 5KFUA 2K1RB 4NLYA 5H1SV 3MEGA 1TFWA 2KDOA 1UVLA 3DI6B 1S1XA 1S9EB 2EBGA 1QAIA 3BGRA 3NG8A 2A2CA 1UETA 1MWZA 2QA4G 6FD1A 1M5PC 1SUQB 2UVVA 4FF3A 2FTRA 2ZH4A 2ADBA 2LA6A 2IJFA 1D8YA 2DNGA 1I6JA 3HHNB 3TNVA 2EWHA 2RIJA 2I38A 3JTOA 1X5TA 3UD4P 4NLUA 4ES2A 4HDGA 1DARA 1S1UB 2KKHA 3M9MB 3V6JA 2E1CA 2V5HG 3RW7A 2VG7B 3TUZC 1HQEB 4OZJA 4D3GA 3BN7A 1WG4A 1P1TA 2QMWA 2OTLS 3Q22A 2X1FA 1IKVA 4H54A 3OV7A 1YHQS 5U47A 1FE0A 3O8WA 1VC0A 1NK0A 2V8HA 1JWWA 4O3OA 1U1LA 1X4FA 4NLRA 1FEEA 2BJDA 3PW4A 4QCLA 4QWAA 2HHWA 4C9DA 1TUVA 2C42A 4NZ0A 3VWSA 1M5OC 1HWIA 3VF0B 5IFMA 2R7QA 3UNGC 1C0TA 5AE3A 1Y9OA 3EZ5A 2RMLA 3BEGB 4ELTA 3VTIA 1S0NA 1H7WA 3DM2A 1HMVA 2YKNA 2GQQA 3KNAA 4J9PA 2MZJA 3M30B 2JJ4D 3M6XA 5E3QA 4ECWA 3HT3A 1Y5LB 3MTKA 3NGKA 3LH2S 1ZM9A 3HLUA 5DETA 1ZZFA 1UL3A 2K1RA 2JL9A 4QZVB 2VFVA 3MAQA 4CNYA 3BO3A 5DDOC 1S1WB 3DI6A 1S9EA 3UCZP 4F2SA 2OD6A 2JFDA 2LYVA 4J9QA 2VPWB 2KTQA 1BC6A 2QLXA 3M8PB 1HNVB 3S8SA 3PVXA 1IBKF 3CC4S 5GAGU 1P27B 3GSDA 1K8AT 3BR9A 1XN9A 3V5RA 1XR6A 1P6TA 2ZJRQ 2Q66A 2DR5A 4X84A 2OAUA 1S1UA 2VUGA 4K4UA 3MEEB 2WOMB 2UP1A 2P6TA 1HQEA 3FQKA 1TL1A 1M90T 2R8HA 4TLQA 4F4ZA 3CO9A 4G6VB <