3G71S

Co-crystal structure of bruceantin bound to the large ribosomal subunit
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3g71S00
3TYTA 4WFAQ 4WF9Q 1VBZA 2CQGA 2ZJPQ 2E5GA 2MKHA 2DNOA 3ZZZA 3PIOQ 1QVFR 3RW6A 3OW2R 4TU9A 3L3CA 2DNPA 2CQCA 3THPA 4QU6A 3MURP 3CCJS 1VBXA 1YIJS 5IM0A 5ITHA 3CC2S 3TP2A 1U1OA 2VOPA 1D9AA 2DNRA 1VQ5S 2EVZA 2KU7A 5DDPC 1U1KA 2G1DA 2NLWA 5DDQC 2HGNA 2X1FA 2RS8A 1VQ6S 1VQMS 1UP1A 3I55S 1QVGR 1WG5A 2KHCA 3MUVP 1M5VC 3DLLQ 2M52A 2N82B 2BOPA 3CPWR 2F9DA 2J76E 1JJHA 2I2YA 4IUFA 2KFYA 2MJUA 4C4WA 1M1KT 4WIIA 2MQOA 2JX2A 3N9UC 2RQCA 3CCRS 1VC0A 1KD1T 2MZQA 2VONA 5GMKa 3VALA 1U1MA 1H2VZ 1DZ5A 2MSSA 1VQ9S 5LXYA 2DIUA 1WHWA 2KVIA 4CQ1A 1VQ8S 3UCGA 2MY8A 2CPEA 3EX7B 5DM6Q 1Q82T 3VAIA 2D9OA 2KXNB 1OO0B 2DISA 1SJ4P 1WF2A 3CXCR 3PIPQ 5FJ4A 2EK1A 2HZCA 2YKAA 1YTYA 1WELA 2L08A 3CTRA 2LEAA 1JJ2R 1PGZA 1X5PA 2L9WA 3CUNA 1L3KA 3U1LA 3UCUP 2QEXS 2M0GB 2KRRA 1SJ3P 1KQSR 4ERDA 1R8PA 2U2FA 2M8DB 2N3OA 2LXUA 4WFNQ 2KM8B 2DHSA 2MKSA 2KYXA 2OSQA 1U6BA 1K9MT 1P1TA 1X5SA 2CQ1A 5IFMA 3G8SA 3FEXB 2XB2D 5JVHQ 2XNRA 3G8TA 1X4DA 2MZSA 2RVJA 3P6YC 1U1PA 2E5IA 5D78A 4Y00A 3SDEB 4CH0S 3K0JA 3MOJB 1OPIA 2DGXA 2DGTA 3HI9A 5H1SV 3S01A 3UD4P 2KRBA 2HVZA 2DNLA 4QQBA 2VOOA 2DIVA 2CQ0A 2XS5A 4YOEA 1NO8A 3G96A 2M70A 1AUDA 5HL7Q 3VAFA 3UD3P 1Q81T 1F9FA 1HL6A 3B4DA 2M88A 1WF0A 1VQLS 1WHVA 2D9PA 2FHOB 3MI7X 3MD3A 3VAKA 2LXIA 2KH9A 4UQTA 1G2EA 3U1MA 4ZKAA 1WWHA 1H2TZ 2E5HA 2KM8C 2DH9A 1HD1A 2K8GA 2RUGA 2QA4S 3MUMP 2CPHA 2QFJA 1VQ7S 2FY1A 1DHMA 5JVGQ 3CCES 2MJNA 1HA1A 2F3JA 2FPHX 2CQIA 3UCZP 1VC6A 1U1LA 1URNA 1UW4A 2JRSA 1ZH5A 1PO6A 2CPJA 2MZ1A 2OIHA 1NJIT 3SDEA 4CIOA 4LIRA 2DHXA 1WTBA 5GAGU 4WKRA 2YTCA 2MHNA 4WFBQ 2HYIB 1R8HA 4J5OA 2DGQA 2YH1A 2JVRA 5BJRA 2CJKA 1NU4A 4F02A 1IQTA 2MYFA 1X5OA 3NS5A 3NMRA 2DO0A 3H2UB 2MSTA 1YHQS 2GO9A 2KXHA 2KG0A 2RT3A 2J0SD 4OZ0A 2MY7A 2DNGA 2LA6A 1WI6A 3B4MA 1YI2S 2DGUA 4P6QA 1X4GA 1Q7YT 2DK2A 2WBRA 4F26A 3CC4S 2DNKA 4PR6A 2MQNA 2OTJS 2VODA 2E44A 2RQ4A 1ZZFA 2LCWA 2MQQA 3JB9k 3V4MA 3CCQS 2UP1A 5LJ3Y 5IQQA 2I38A 2AYEA 1HD0A 5CYJA 2M2BA 3EGNA 1A9NB 1WEZA 2AYMA 2MGZA 2DH8A 4TLQA 1YJ9S 1VBYA 3THTA 3HHNB 1WG4A 1M90T 4PKDB 3RW7A 4Z2XA 2MQLA 4QU7A 3IRWP 2DNZA 1M5OC 3SMZA 3CCSS 1DRZA 2DO4A 2JVOA 2FC8A 1N88A 2RRBA 1X4AA 5DDOC 2CPFA 3BEGB 2A3JA 2DHAA 3G71S 3P49B 2M4MA 3DXBA 4OZ1A 2DB1A 1FJ7A 5DM7Q 1X4BA 4BS2A 3VAGA 2XSFA 2DNHA 5LXRA 1FO1A 3CC7S 2N3LA 3NS6A 1SJFA 3CD6S 2KT5A 3SXLA 1WHYA 3VAJA 5LJ5Y 5GADU 3IWNC 1B7FA 1A7GE 2CQDA 2F9JA 2MQMA 1SJRA 3CMAS 5GVQA 1VC5A 2CPXA 1O0PA 2AD9A 5LSOA 3MXHP 3LQVA 3P5TL 1YJNS 3ZZYA 3NNHA 4FXVA 3J7ZT 1N54B 2J0QD 1FXLA 3VAHA 2Q79A 2DGOA 3VF0B 2DGWA 3BO2A 1SXLA 2BZ2A 4EGLA 3D2WA 2MZRA 2SXLA 2LKZA 5EN1A 1P27B 1ZZNA 1W2BR 1M5KC 4Y0FA 2HGMA 3CCMS 2XS7A 1JJ4A 4TU7A 1K73T 5D77A 2MQPA 4LMZA 1DBDA 3UE2A 2X1AA 2CQPA 3R1HA 1FJEB 2LYVA 1VQNS 2MGZB 2JWNA 1UAWA 2MKKA 2PEHA 4V19X 1WEYA 2K3KA 2AYGA 1VQPS 3Q2SC 1X5TA 2DNMA 1D8ZA 1QM9A 2LA4A 2KXFA 2AYBA 4YB1P 1XN9A 4CH1A 2LEBA 1K8AT 2EK6A 5DETA 2CPZA 1VQOS 1H2UX 3I56S 2V94A 4W92B 2MZJA 3G6ES 2MPUA 3BO4A 2M9KA 1KOHA 1FJCA 1U1QA 1RKJA 3LPYA 2OJ3A 3G9CA 3ULHA 2KI2A 1U2FA 1WHXA 2MKIA 1UFWA 3CF5Q 2CQ4A 2MZTA 1N52B 2DITA 1YWXA 2DNYA 2U1AA 3MDFA 2DNNA 2D3OR 3UWTA 4QPTA 1KOOA 5GAHU 1CVJA 1X4CA 2ZJQQ 2DGSA 1X4FA 2LECA 3J7YU 3CMES 2CPIA 2CQ3A 2E5JA 3G4SS 3BO3A 1U6FA 2GHPA 3S8SA 4PRFA 3NNAA 1YJWS 3R27A 2NZ4A 5CA5A 1H6KX 1OIAA 2RRAA 1VQKS 4TU8A 3NNCA 3S6EA 4C0OC 4W90B 1KC8T 2CQ2A 2M7SA 2X1GA 3CCLS 2RS2A 4LJMA 2MKCA 2MXYA 2J8AA 3CCUS 4ED5A 3EGZA 2RU3A 1FNXH 4RU2A 3FEYB 3S7RA 1BY9A 2HGLA 1X4EA 5CXTA 1RK8A 1U1NA 2X1BA 2ERRA 3US5A 2L41A 2XS2A 4IO9Q 2LQ5A 1S79A 2XNQA 4WCEQ 2YWKA 1N8RT 1SJQA 3P3DA 3Q2TC 1WEXA 4FXWA 1U1RA 1S72S 2O3DA 1X0FA 5DDRC 2DGVA 2G0CA 4U67Q 2RNEA 2B0GA 2M8HA 3BS9A 5IM0B 4M5DB 2ADBA 4F25A 3VAMA 1WG1A 4YUDA 2MB0B 2FC9A 4A8XA 2DH7A 4IOAQ 1JMTA 4IOCQ 1FT8A 3MUTP 2CPDA 2OTLS 1FHTA 5HO4A 1VQ4S 2YH0A 1WF1A 1YITS 1WI8A 3TO8A 2KG1A 3CULA 2DNQA 1OWXA 2OSRA 5LSLA 2G4BA 2ADCA 3H2VE 2CPYA 1M5PC 2PE8A 3CCVS 4UY8T 2MMYA 2MKJA 2ZJRQ 3R1LA 2KN4A 4C7QA 1X4HA 5MLCV 2N7CA 3MD1A 2CQBA 2LMIA 5GAEU 2DHGA 2CQHA 1Q86T
chains in the Genus database with same CATH superfamily
2CYYA 1IUJA 2LQBA 2I6WA 3ZZZA 1UVKA 3D68A 2FZGB 1OQ6A 4OHXA 3E01B 4P2SA 4K4YA 3THPA 3MEGB 2YNHA 3CE8A 4ID8A 1CBKA 2ZBIA 5F8MA 1X0PA 3BYRA 4LF4F 4DJBA 1GTEA 4TY8A 4F8RA 2XSJB 3OUYA 3I55S 2K1RA 3CGIA 3DLLQ 1S0OA 2M52A 2ALYB 2LU2A 4DQIA 2PA3A 2R7TA 2UV8A 2RQCA 1XERA 3A4TA 2JJ4D 2P9CA 4KHMA 2VBWA 4DX5A 4NASA 1H2VZ 1QE1A 3SCKE 5A6WA 1AFJA 1VQ8S 4WE1A 1S1XA 5HVFA 3NBPB 1N0UA 5A8WA 2AV5A 4OJHA 2A6MA 3BJYA 2VPXB 4DR5F 1IM6A 2YWGA 1UA1A 1T7PA 2FVQA 3A3NB 4KGKA 3ZTRA 2Q43A 4MKAA 4DL5A 3V6DA 2DVIA 5KFGA 3Q89A 3IR5B 3FUYA 2U2FA 2M8DB 4WFNQ 2FVRA 3QO9B 3ICLA 2E7VA 1RCOB 3G8TA 3MR6A 1RT4B 2V4JB 1TUWA 1PBUA 1RHQB 3A8KA 3CDEA 2L9DA 4MIWA 2IM3A 2CQ0A 4LF7J 1SQEA 1UVNA 5DQIA 2OO4A 4IFYA 4B3MF 2M88A 1VQLS 1FTRA 5ETTA 3PTWA 2YNFB 1KN6A 1VQYA 3U1MA 2WW4A 3QBCA 1FCAA 5KFUA 1FEHA 2CNNB 4DV0F 4WK1A 3DYAA 4Y3CA 1U1LA 1URNA 1AZSA 3GMGA 1BQXA 4MYUA 2VQFJ 4CIOA 3A8JA 8RUCA 4ZCKA 1R27B 4AUKA 5BJRA 4F02A 2CDQA 3NS5A 1IR1A 2HNDB 3OL7A 1IBKF 1N5YA 1UCNA 1S7HA 1NDKA 2Y1JA 1FF2A 4TN2A 3K17A 1FK9B 1ZZFA 2XQCA 3NKYA 2HMIB 2I38A 4H4OA 4UTGA 3TVZA 4CT8A 1S1TB 1R8CA 5C7PA 4KB7A 3GQCA 5IC6B 2X7IA 2QMWA 3VVUA 2W9BA 1HNIA 1U4BA 2HHQA 1FVSA 1Y9OA 4UOFA 1ZOTA 3QIPB 1T95A 3KMQA 4B3RJ 3C3LA 3PXGa 2B8PA 2BKOA 2GVZA 2QZ8A 4FN5A 3LWMA 5K8NA 3BKTA 1SJ1A 1IWGA 1NK5A 1A7GE 3PCOB 3K5MA 1GX5A 3QMQA 4OYBA 4AQYF 4PG7A 3HHLD 1Q79A 1JLBB 4MK8A 4A8SA 1N54B 4CO2A 3VAHA 1ZBTA 1Y5LB 3IGNA 4NMXA 1SXLA 1AB8A 4OYXA 2IRYA 4N8OA 4C11A 2ZBRA 1ZAWA 2W2QP 4HH0A 4X65J 3ISND 2XS7A 3M32B 4O3SA 3K8VA 2VFTA 4LR7A 2J7KA 5DZ6A 3IP0A 2JWNA 1WEYA 4ANDA 5CABA 1Y3JA 4OZ2A 4MFBB 3WDOA 1R7IA 4I6YA 4YB1P 2HZAA 4USUA 2Y1IA 2ZNZA 2E1MC 4XDCA 4TQRA 4ETXA 1U24A 1YJTA 3G9CA 2J9DA 2ZH6A 4EBDA 2GGPA 2XMJA 2HG4A 2HIQA 3MMJA 4ZPVR 2Z57B 1TFYA 3H90A 4KO0B 3ZFVA 2IA6A 1C4CA 4KH0B 3R27A 4H54A 1OIAA 2OPRA 2PDAA 3N4WA 3IAM9 2QLXA 1RLCL 4C0OC 4C98A 4E98A 2C3OA 2RB7A 4RU2A 4Q7AA 5KFSA 3MPWA 4J91A 1BE4A 2E1AA 2XNQA 4RX6A 2NPFA 2C2MB 4ZMMA 2C42A 3LAKA 4U67Q 2NUUG 3OFGA 3MMAB 3Q86A 5HMYA 5KG5A 4L3KA 1BGXT 5HO4A 3TANA 1VQ4S 3M8PB 4EFAC 3RAQA 5LSLA 4I2QA 1UWAA 2VBZA 3IBWA 5CH7B 3FFIA 4B02A 5THWA 1TV6B 2R2SA 3HO1A 3IN5A 2DNOA 5DG8A 3RW6A 1UWBB 3ZZPA 1PIEA 3R5BA 3L3CA 3CCJS 1VBXA 1JLFB 5GAEI 5ETQA 3PO4A 2ZVSA 5E41A 4QWBA 3LW5C 1MSWD 1C0UB 3DRXA 2VBXA 2CRLA 4PAAA 3M8SA 1QVGR 1F3FA 1WG5A 2KHCA 2CJYB 2XLKA 1JJHA 2QL5B 3DRPA 4I1TA 2EPIA 3POTA 3JXOA 4LQ3A 1XJWB 4X62F 3Q83A 4LBPA 1MROA 4LSNB 3SCJE 4ZVUB 2D9OA 4I6AA 2VFUA 5ETLA 2DISA 2Y3YA 4X64F 2HS0A 1HQUA 2L9WA 3CUNA 4IOBA 1VQSA 1IVZA 1TMMA 1YLXA 3BDEA 2KM8B 4LRAA 4P2XA 5IFMA 2AP6A 4X4UA 3R97A 2D69A 3DMJA 2RQMA 2KRBA 4I64A 4F3OA 4PUOA 1SBRA 1FKAF 4HR2A 2XZDB 2ZE2B 3PJXA 1M5SA 1NO8A 5SZTA 3G96A 2PO4A 1WF0A 4C8MA 2BEFA 3CJKB 1QTMA 3I6PA 4WTOB 4UUXA 1HD1A 1AA1B 2VZ9A 4IG0B 2CDRB 1MMLA 3H2LA 4ANCA 5HMZA 4RW4A 2ZEJA 1RBLA 4USHA 5B0EA 1GQEA 4ED7A 1NJIT 2CWXA 3CVKA 3IG1A 3SDEA 5AJ3J 2R7WA 2YTCA 1V5IB 2DGQA 2WB1D 3DDKA 5C2CA 1UVJA 2MSTA 4DCOB 4BLGA 5A8KB 2E9RX 4Q0BB 1U02A 1YI2S 2B43A 2GMJA 2HWHA 4ZP9A 1FRKA 4USIA 2CVIA 5DO2A 3OR2A 2HQDA 1SKRA 4Q45A 2IC3A 1EIYB 2C2EA 4FYYB 4B9NA 1F1BB 4AXIA 4CNZA 2E1RA 4DDFA 1F5AA 1RCXB 4DS4A 2UXBJ 2JDJA 5LMUF 4LUBA 3NEKA 1NM2A 4RUHA 2QA2A 2GMLA 2C2OB 1M5OC 3AODA 3MOZA 2K7KA 3HP6A 2YKPA 4DV6J 4P74A 3VAGA 4WP3A 5K5MA 1S10A 3KFWX 2FZKB 3OPKA 3KK2A 4KPCA 3CMAS 4C2MA 4UZBA 4J9NA 2CJ9A 3VF0B 3R6LB 3PX0A 5FD1A 2OLWA 4NXMF 5GADI 2B8QA 1IKVB 1LWFA 1FNMA 2QGFB 1YRXA 4KAIA 2R7SA 4LFBF 3MEKA 3FBEA 5HLFB 2GAGC 2MHEA 3C6UA 3K2YA 4Z37A 4DV1J 5D15A 4LF4J 4NLOA 4KGXB 4EU0A 2UVUA 4V19X 3M8WA 1R8AA 4FBUA 4ZPCA 2AYBA 3PRVA 2LEBA 1K8AT 3M6XA 1HARA 2NUHA 2V94A 5K20B 3G6ES 4LRFA 1RTJB 4IDKB 2GVDA 4EYHB 3PYFA 4KC5A 3CJ4A 2DR9A 4B3OB 3BN7A 2DNNA 4OV6A 1X4CA 3IR6B 2JH3A 4RO0A 2PFDA 1RAHB 1FX4A 3KKFA 4Q44A 3NNAA 3WX4A 4W90B 3I0SB 3J7YI 1TL3B 3BBCA 1N6QB 4OZLA 1FNXH 3FEYB 2ZD1B 1F5CA 3M05A 1UJ5A 4KV8B 4QIVA 5EGYA 3MM9A 4ANEA 1N8RT 5B0DA 2IVYA 4Y2KA 3VGVA 1HQEA 4CM2A 1OY6A 2UUTA 2BANA 3KK3A 1D1UA 1E6YA 3UNYA 1U45A 4B3MJ 1P1LA 3VGTA 1ZETA 3H2VE 3DM2B 4UY8T 1VFJA 4L73A 4RNFA 5K8OA 1EQMA 2ZOMA 2DHGA 1HHTP 1TK0A 1XQIA 3ILOA 4DV0J 1JKHA 2QT7A 3TA0A 2W24A 4F67A 3OJUA 4OZJA 3SCLE 3KUGA 2VICA 4CH7A 3Q8QB 4B9TA 3SCIE 2WVFA 1H3DA 1MN7A 4HHHA 4DUYF 2G1DA 3FSYA 2OFGX 1C0TA 4RW6A 2Z2LA 2HRUA 5IT9U 3C46A 4Y2MA 1H7WA 3PEHA 4HEA9 4WYWA 4M5MA 3CB4A 5IWAJ 4ZOSA 4OJ1A 1MU2A 3QJJA 3ZZUA 2Q1LA 1JLGA 1XNQF 1NPRA 5C42B 1VQ9S 3KJFB 3HZGA 3EX7B 1LWEA 1PYTA 4R5PB 2PMZD 5J1EB 2EK1A 4DU7A 1WELA 4NLPA 3RJMB 2LEAA 3EVOA 3DKDA 3L4BC 3OTCA 2M0GB 1R8PA 2YNGA 1C1CB 4NA3A 3T41A 1V3ZA 4E8UA 2CQ1A 4QYZK 1LK7A 1J5EJ 2HWIA 1OPIA 2B5JA 2OH2A 4A48A 5KFEA 3WZ0A 1JLQA 2JEIA 2VOOA 4NLQA 2FJBB 4YQWA 3ET6B 3O3LA 1GX6A 4ICLA 3B4DA 5KT6A 1SQGA 2YKMA 3CJRA 3RG6A 3HSZA 3DGVA 1FWPA 2OEMA 5K8PA 1SL0A 4G1PA 5F3TA 1HA1A 4I56A 1TR0A 4LIWA 3A1YG 3IXQA 2OIHA 2HEKA 4LIRA 3ZTOA 2WZ1A 4NCAA 4ZVPB 3QT8A 4J9SA 2GO9A 2RT3A 1S1WB 2AKWB 4R8UB 4A4JA 1SUQA 2G2OA 2OD4A 3FQLA 1CJTA 3JSYA 5L9XA 4A8QA 3G87A 5SUHA 2ZOFA 3DOKA 1XMBA 4DN0A 2ZH5A 2JC0A 3AQPA 1AXQA 1WEZA 2XHWA 1MWYA 4C8KA 3OTOF 2HBRB 1NSPA 3O5TB 5LOQA 2CPFA 1WDTA 2OGUA 3SYZA 3G71S 2DB1A 2XSFA 5T14A 1TL7B 4GO7X 3RBXA 3AXKA 3CD6S 2ZBCA 1LKZA 3CD0A 2HQCA 4JI8J 2CQDA 5KFVA 1UVMA 1VC5A 1NKBA 2Z8QA 3T1YF 1OJ4A 1FDBA 2YKQA 1SQFA 4RPFA 1KS2A 5D4NA 1VBKA 5EWGA 3LGHA 3W2WA 3MWBA 5F9LA 3TAMB 1UAWA 4K4WA 2DT9A 1EX8A 4H4MB 2QRRA 3CDWA 1T02A 2XZTB 3L9ZA 3QRPA 4RW7B 3HSJA 3I96A 2HK2A 3M6VA 4DSJA 5EHHA 5J2QA 1B70B 1SC3B 3VZIA 3GG0A 2LDYA 4IQXA 3KHGA 4B9UA 4YR2A 5H9FK 2AGOA 4G1IA 3ELHA 4ZP6A 5F8GA 3KLGB 2XI3A 1GK8A 4NLWA 1L5UA 4C0HA 1H6KX 1DFDA 3DGPA 4CLWA 2VPZB 1KC8T 2VFVA 2MXYA 1L3VA 1RT1A 1X4EA 1E6VB 1U1NA 4ZPDA 3TRGA 3D66A 4H4KC 2YWKA 1U1RA 1TKZB 1RTHB 2BABA 1XR7A 3QGPA 4OFZA 3VV2B 3TZWA 2B56A 5KT2A 2V50A 3FZBA 2V4RA 4IOCQ 2OTLS 1FHTA 2PFFB 2CG8A 1ELOA 2FLLA 5G4DA 4EO8A 4EMDA 1RWUA 4GMKA 2KT3A 5M2PA 3T5HA 1S59A 5E3RA 2XY7A 1RT7B 2IYIA 2CQGA 2BBEA 2E5GA 5J2PA 3KWMA 1DTQA 5CZVA 3J81U 1VQ5S 1HWJA 2BOAA 4PWDB 1CS4B 1U6ZA 1VDHA 1WSRA 3VTIA 2N82B 4Y28C 4F04B 2VASA 3QGIA 2IAJB 3W2VB 3FKBA 3TA2A 1JLEA 3V81B 1FRHA 2KB2A 4JBCA 3EZOA 3R5DA 4IRCA 1S1UA 2IJFA 1Q82T 5D0HA 1FWLA 3QT5A 5LMUJ 1NK4A 1NK7A 3PIPQ 3BKFA 1U09A 2ACMA 4JB8B 2HQFA 1AW0A 3HK2A 1T9XA 3W66A 3T5LA 4EUVA 2QEXS 3DDIA 2ZC4A 3TEGA 4DL6A 3RRGA 2R2TA 3D6HB 2GFFA 4YMEA 2MKSA 4DPWA 1S9GB 3G8SA 1OMSA 4U8VA 2QSWA 4WP9A 3OR1A 2C2NA 5J2NB 2BACA 3AB4B 3NG8A 5EUHA 3M30A 3KLEA 2RSQA 3OFFA 4OI4A 4NXMJ 5B7WA 1AUSL 3UI3A 4YOEA 3UD3P 3MZIA 2FGCA 1HL6A 3W61A 4FBTA 1D3WA 4LF5J 1QTNB 1QSSA 2LXIA 1I1GA 2D3UA 2E5HA 4ECVA 1X7VA 1FJGF 3RZAA 3BQ1A 2F3JA 1VC6A 4LRBA 2MZ1A 3AD8C 3H98A 2GIRA 3O2IA 4NLSA 3Q8UA 4IG3B 2DCUB 2R8GA 2JVRA 4EK2A 3MM7B 3DNCA 2E29A 3DLHA 4NEYA 3SI8A 3BSCA 2BQ3A 2LA6A 5D3GB 1YX2A 2GJIA 2WBRA 2DNKA 4ITSA 4MK9A 2OTJS 2IY5B 4AD6A 2ASLA 3DLKB 4IH6A 2DR8A 1FRJA 2B7BB 3HHNB 3DOLA 4ID5B 3M8ZA 3CCSS 2IRUA 2ZH1A 2AEJA 5C24B 5HBMB 4ZPAA 2ZHBA 1FWKA 3GFZA 3V6JA 1S0NA 4OZ1A 5HATA 3MAAB 1X4BA 4R0JA 1RE1B 2B6AA 2DXEA 2XWXA 3WC0A 4DX8H 6AT1B 2J6TA 3HKZD 4LFAF 5KFCA 4H4KA 3IMQJ 3OTBA 3EVMA 2AD9A 2HHPA 2O66A 4MAKA 3NNHA 4G3IA 4X84A 4BWMA 1W2IA 2RIJA 1Y5IB 3F41A 2NS1B 4IR9A 3OT9A 5F8IA 1P27B 2OUGA 2HKEA 2I1RA 4DL7A 1T03A 3NY0A 3CJ0A 4XIUA 2Z58B 4O23A 3DXSX 2EXUA 3JYTB 1I5OB 5BR8F 5CAAA 2KT2A 2WVDA 4Y34A 2GJFA 1BWVA 2CJQA 4DL0C 2EFQA 2DNYA 1YVFA 1Y0HA 4FNHA 2XM3A 4NXNF 2X51A 4QR2A 2E5JA 1SPBP 1H7XA 1S1VB 3AXMA 2FUG9 3UO0A 3NWGA 2NZ4A 5AXNA 1HI1A 2HQGA 2YWHA 4FF1A 5IT4A 4ED5A 3NGKA 3S7RA 2OPSB 3FNNA 3K5PA 1NH8A 5AXKA 2V69A 3EVWA 4LR8A 4A8FA 3Q2TC 1S7IA 1G4CA 1CQNA 3KJNB 1TUGB 3IO1A 2F4FA 1FTCA 3FBBA 4DCJB 4YUDA 2DH7A 1Y4ZB 4P7TA 2GX8A 3PR5B 5DG7A 4B9VA 2R7VA 2ADCA 2YKNB 3CJ5A 3SSSA 2DPJA 5E3CA 1ZA2B 2V34A 3MEEA 3L7UA 2CQBA 5L38A 5HJYA 3MMCA 2DXDA 1DJ0A 5CD4H 4MYTA 3UD5A 4HL9A 2WONA 3OW2R 3IFEA 2CQCA 1CC7A 2QYCA 4WBFA 3C16A 1T8EA 3MGJA 4PQUA 1JXEA 2NLWA 1T9YA 2HGNA 1NNDA 1Q16B 2Z2MA 3MUVP 3M9OB 3DRSA 2NCKL 5U47A 2MJUA 2GMHA 4CLSA 4DHVA 4KHPF 1HBUA 2NR0A 2MZQA 1H74A 1EETB 1U1MA 2ZH2A 4Y2CA 2A18A 4ZITA 2B7CB 3ZTSA 3OSNA 3H25A 3UCGA 3HULA 2BM0A 4J9OA 3E01A 1HWKA 1JLCB 1B99A 2YKAA 1NK6A 2C3UA 3NCQA 2QG9B 2K06A 2VDIA 2XSJA 3U1LA 1OS5A 4QZVB 1SJ3P 1GXUA 3GIJA 1RT3B 1KHWA 3DLJA 1RAAB 3SFUA 2OSQA 3NOCA 4M1KA 3RU0A 5IT9Y 3OHBA 4JP8A 2WAQD 1DY3A 1UEUA 3ENVA 1HI8A 3PKMA 4F4ZA 2XHCA 1V5VA 3NBPA 4ZVOB 4K50A 2BA9A 3PKYA 1PKUA 5E3PA 4OQJA 2JSXA 4IKAA 3V6HA 1W26A 3G86A 2D9PA 3FZ2A 4NE9C 4PEOA 1G2EA 2MLXA 5I3UB 4ED0A 1CC8A 4OZNA 5G0RA 2RUGA 1HMVB 2QFJA 1LOUA 2G0JA 3QO9A 2FPHX 4OI6A 2V67A 1RT4A 4F4KA 5GAGU 3WIUA 2WSCC 3DU6A 4YHHJ 1SL1A 1X5OA 1IBLF 3QATA 2EKNA 2KG0A 1RI7A 5D6GA 2F1FA 1LQ9A 2E7XA 1OY8A 3EMTA 1NSQA 1NKCA 1FD2A 1IKYB 3PY8A 1TKXA 1CJVA 4ILMA 2J0XA 2LCWA 4CNYA 4PCQA 4RUBA 1QSLA 2W7OA 4NI2B 2XY5A 3CW2C 1ZYQA 5CQGA 2QTWA 3IRWP 5KFMA 1TL1B 2V8GA 1IXKA 3QWPA 2J6SA 4EYIB 3LOUA 2HNDA 2RRBA 3M6UA 3UN3A 3JTNA 2M4MA 3KJQB 2P6TA 5HN0A 1IN0A 5IXUA 5KFRA 1SC6A 2H1YA 1WHYA 1JLAB 3KHRA 3HD1A 4XTTA 4KSEB 3WIVA 3W9JA 2HMIA 3CDBA 1KSPA 4F4YA 2DGOA 2R8HA 1S1TA 3HHLB 2XBPA 5HP1A 4HT5A 3FK4A 2Q6CA 3TAQA 3GJTB 2GCFA 1H72C 5HROB 1K73T 2V4QA 3PDNA 1DBDA 4QWEA 2GZOA 4OX8A 3OLBA 1VQNS 1JWWA 2HSEB 2HHHF 1D8ZA 1O5JA 5B09A 4CH1A 1HBOB 1G3OA 1WKJA 3CJTA 1LW0A 3X1LB 3ENQA 1VLYA 4OJGA 2PEBA 1JLBA 4AL7A 2DR7A 2A0FB 1R43A 5E3AA 4PG6A 5KT4A 3BPDA 4ZHRB 1F2HA 3OBIA 4FYXB 2DITA 4KBIA 2UVRA 2MLZA 1KOOA 3CJ2A 2RF2B 4CTAA 3M32A 1FRLA 1BHNA 3CMES 2HVHA 1TFWA 1U6FA 3L7PA 3EWGA 2P8IA 4J9RA 3HFZB 3R7BB 1SC1B 3QLHB 3UDLA 4LRCA 2J7WA 5HMXA 3FSIA 2ERRA 2VG7B 4RNOA 1K44A 2F8HA 1G7CB 1X0FA 2C2ZB 5IC4B 3VCDA 3BS9A 2V8DA 3KK1B 1HFEL 3GG1A 4ELTA 2IJNA 3VGSA 3R6GB 4A8XA 2LDIA 5A8RB 1CJUB 1YRUA 4KO0A 1P9YA 4DZDA 3UDVA 4PG5A 1M5PC 2HHVA 5KFFA 4XO0A 2UUBJ 3R1LA 1FJGJ 1R0BG 2HFOA 3H8YA 2J5AA 3FBCA 2KO1A 2VFRA 3W5YA 4CLPA 1NDPA 5IV4A 4DR1F 1WKKA 4QCLA 3HVTA 2EFGA 3KLVA 2ZH4A 5DLGA 4QU6A 1K0TA 4G1QB 3NAHA 1TL4A 5D0GA 3MMAA 2GIQA 1S12A 4OZ5A 3N5BA 4F3MA 3DRYA 2YQ1A 2BRKA 1T05A 3M8PA 2WW8A 4DF4A 1UP1A 3DRRB 1B0PA 1REGX 2ZVIA 2C2DA 2RE1A 2UUCF 3CCRS 5ETPA 2YKOA 5CHCB 1JB0C 1TV6A 3O8WA 1M0SA 4ZJLA 1U25A 2CPEA 2AQ4A 3VAIA 2EFVA 2HVDA 2FHKA 1JLFA 1C1BB 4HHJA 2FJXA 1JJ2R 2KYZA 1C0UA 4B9SA 2VC0A 3J81Y 1UFLA 3TR5A 4NL5A 2EC0A 4BC9A 4LFAJ 4M94A 2W9CB 4TY8B 1X4DA 2E5IA 3OUYB 4LF9F 5CYMA 3W63A 4LSNA 2AF6A 3I31A 1A0OB 5J2MA 5IS2A 1PJ7A 3C66A 1EZZB 3R5GA 1IBMF 1WWHA 1XR5A 3MM5B 5A8WB 2BE2B 2XCAA 2QA4S 1YJ7A 4OL8A 2CPHA 1VQ7S 2V2KA 2YNIB 3MCSA 4LF1A 3O44A 3V6DB 2X3DA 4JI2F 3RTVA 2QJ3A 5BR8J 4OI2A 4WFBQ 2RHQB 2HYIB 4DLGA 4URQU 4ZN3A 4RUAA 1ZM9A 4GC7A 3TVKA 5KT7A 1XR6A 2ZE2A 1TKTA 4AYBD 5DG9A 2EFOA 4WJBA 2XMAA 4F4XA 4OYIA 3N79A 2Y1LB 3GSIA 2UU9F 3T5JA 4ZK7M 4IG0A 3M6WA 4KJIA 3ISNC 5A6PA 1QAXA 4DL4A 2FLOA 5F41A 4KFBA 1NUEA 1PYSB 4QWDA 1K0VA 2LU1A 2JFKA 3JSBA 1JQGA 5T7LA 3M8RA 4W4MA 1AZSB 5A8KA 2N4CA 4Q0BA 3IBCB 4DF8A 4LSLB 3ZZ0A 3RB3A 1HW8A 3D0HE 3NS6A 4B3RF 4O3PA 1NB7A 3R3TA 4ELUA 2MQMA 3R5AA 3CT9A 2M3DA 4QR1A 3BGRB 2VF3A 5KFZA 3BH7B 1N5YB 4N7TA 7FDRA 2KKHA 2K3IA 4O44B 1NK8A 2D41A 1IJEB 3DLGB 2FLPA 3DCAA 4OX7A 4EBEA 3AY0A 4UOCA 4ZVRB 1YBUA 4DFMA 2ZDOA 2ZZNA 2KXFA 1BC6A 4Z7YA 2MZJA 2JLGA 2GVZB 2OJ3A 3W62A 1YZ6A 5M2UA 1N48A 1RTDA 4KHPJ 1Q1KA 1TAUA 1TKDA 4LF8J 1IKVA 1VOMA 1M1GA 2W25A 3CEDA 4YB7A 1V3RA 3J7Z5 1VK8A 2JLFA 1FD8A 2CQ3A 3G4SS 2W4PA 4DR4F 2HHSA 1O8BA 4PRFA 5CA5A 4ZVFA 1N36F 4TU8A 2EBGA 3EPGA 3VGUA 5HAOA 2M7SA 4IYQA 4YS2A 2LFVA 3EDRB 4F36A 1NZAA 2F4VF 4IDKA 3US5A 1X60A 1K47A 2H5EA 4WCEQ 2F5GA 3TUJC 1FA0A 1SH3A 1WKLA 1V6HA 4MH8A 2QE5A 4DBQA 4B3OA 3EICA 3ZTQA 3E2EA 2B4UA 4RWWA 1OWXA 2G4BA 3KLHB 1QSYA 1S99A 4YEAA 4CWBA 4RBUA 3I0SA 2N4DA 2N7CA 4KGZB 1RBAA 1N6QA 2ZD1A 4ECQA 3MPDA 4YDDB 2A1BA 5HANA 3UN5A 3GILA 1T9UA 3PIOQ 1PSDA 4KV8A 1J2VA 2OPRB 3N01A 3H20A 3A12A 1H73A 1U1OA 2BJEA 4P52A 4OLOA 4TXSA 1IBLJ 3JAMU 2XO6A 2QLWA 2VQEF 1F9EB 4L74A 2ZHOA 1HWLA 3DM2A 4IUFA 2KFYA 4MT1A 1B4SA 4C4WA 4WIIA 3AFGA 3QIDA 3GE9A 1VC0A 1RT5B 3FGVA 3OJSA 5KG1A 4S0MA 4U95A 2LQJA 1Y3KA 5KFOA 4K5SA 4LBIA 1SJ4P 4QW8A 1XC9A 4CM0A 3M7VA 4MIBA 3CCZA 3MMBB 4G6VB 1RWKB 3AD7C 3JTOA 3DDNA 4K0KF 4QIGA 3TNVA 3GV8B 1Q5VA 2V5HG 1K9MT 1X5SA 4P10A 2H9ZA 2XNRA 5LMNF 2ZNYA 2RVJA 2H48B 4C48A 1X9SA 1S6QB 2KFNA 5KG6A 5C42A 3SV4A 3J81j 2HHUA 4ES1A 3J7AN 4NX9A 1TZ0A 2W9AA 4R5PA 3POTB 3M9MB 3VHQA 2RJZA 5J1EA 2HS4A 3FEZA 1UPMB 1IM4A 3BBFA 3ILJA 5HMWA 4JI7F 3GJSB 4DQQA 2XMVA 4K4SA 3AJ1A 2FY1A 3CCES 1JIHA 3KG0A 4RWXA 2PD1A 2HNYA 1HQUB 2V68A 3ITHB 5E5NA 1Q8BA 2Z30B 3I9ZA 3SEOA 3NMRA 2DO0A 1YHQS 3EDQB 5AJ3F 3GYXB 2B9WA 3WX8A 1ZPVA 1WI6A 3B4MA 3HD2A 3DMJB 3D67A 4PUOB 2DK2A 1IKWB 2R2RA 2OI2A 1SH2A 3UW1A 1KWMA 3M2VA 2VFSA 5CYJA 2XO7A 4BCAA 4M5NA 4MMOA 5M2RA 1A9NB 3GR1A 5F8HA 2MGZA 3MECB 2QA4G 4OMFG 5CYQB 5KG2A 4XDDA 4P75A 3SBMA 1QDUB 2QC3A 4DPXA 2UXBF 4RW4B 1XTZA 5AXMA 4BBYA 5J1NA 3G6VA 3HZEA 4R8UA 3NWRA 5LXRA 4LR9A 4DG1B 2JL9A 4CLYA 4ZA1A 5HQ8A 3BSOA 1WJ9A 5ETNA 2HNZB 4DV6F 1O0PA 3ZZOA 3WBZA 3W8GA 3BO2A 4J9VA 2DTJA 3OR2B 4NLVA 1Q5YA 1LWCB 3DOMB 4AL6A 3B78A 3CJQA 3NP5A 3M8QB 3KDOA 1NJZA 4CLTA 2RD5C 3H4BA 2RU9A 2LQ9A 3NAIA 3D1HA 2FHJA 3SQGB 2MKKA 2F8EX 3V5RA 2NQPA 4WZQA 1PCAA 2QL9B 1TK8A 2J9EA 4C8ZA 4F2RA 4DV1F 5DETA 5KG4A 5F3ZA 4OHWA 2UUCJ 1U2FA 3T5KA 1SKSA 2X3GA 1RSCA 3A8EA 2DY9A 3KK2B 1YWXA 3UWTA 4NLXA 1NRKA 4F0HA 1BLUA 1CVJA 4PG8A 2VU5A 2ILYA 1DTTB 2ZOGA 2WRMA 3JSRA 3TAMA 2B3TB 3FMBA 4Q8FA 3C15B 2OKQA 4HDHA 3C6UB 3D0IE 3LPEA 3I0RA 1HI0P 2XTJP 3FRZA 4RW7A 2LQ5A 3RRKA 4CZCA 2IIHA 2O3DA 3B82A 4LF9J 2G0CA 2RNEA 1PAEX 4M5DB 2CWKA 4RW9B 1UZDA 2AJ1A 2CPDA 2E66A 3AD9C 4DSLA 1XWLA 3I5BA 1FKPB 1L3SA 1MG7A 3CULA 2DNQA 1TMJA 5HSPA 2RKIB 1SVDA 4RW8A 4Y6IA 3RYLA 1IBMJ 2KN4A 4GVBB 1MLAA 4ZPBA 2VD3A 4AXJA 3L09A 4YB5A 2YWFA 4WF9Q 1E6VA 1VISA 1XIQA 4JI2J 4ZLPA 3TA1A 2AEMA 1TKZA 1RTHA 1OY9A 4CLKA 2E5LJ 2CZVC 1RDRA 1U48A 2Y0SD 4IR1A 5DDQC 1NKEA 1VQ6S 5KFJA 4B17A 3EUNA 4ED2A 1HQEB 4C9DA 4JV0A 3TOQA 3KK3B 1Z2ZA 2UU9J 1RTZA 4D3HA 5DS7A 1P8GA 5GMKa 3VALA 1VGYA 5IWAF 1WD6A 1RT7A 4I4BA 1WHWA 1ZM3A 2Z0GA 4BWJA 3TUZC 1LWXA 3OV7A 1OO0B 4TNOA 3HKWA 4BC7A 3NS7B 5FJ4A 2IM1A 4WIQA 1DARA 2L08A 3CTRA 4ATNA 7AT1B 1RU2A 4JV1A 4PWDA 2KRRA 1CS4A 2LXUA 3T1AA 4DS5A 4JI6F 2KTQA 2Q3PA 2OD6A 1N34F 1P1TA 4FP9A 5JVHQ 1WOSA 1C0TB 3HJVA 2AJFE 5BYQA 1F2GA 2DGXA 3G82B 1HIYA 3HPOA 1Q8IA 1S77D 5IT0A 4PWUA 1WC3A 5HJXA 1MU2B 1J5EF 2Z2YB 2W2OP 1KKHA 1LK5A 3VAFA 1NH7A 1RAFB 1WHVA 1RKIA 4UQTA 3KLFB 2FVSA 1R0CB 1LWEB 2DH9A 1ZAVA 4UF4A 1P6TA 1S57A 2IFXA 1S9GA 2CPJA 4HKQA 5IQ6A 1UKUA 4WKRA 2YNGB 1GAOA 5J2NA 2DY1A 4J37A 3OTDA 3D5MA 2CJKA 1U0HA 4IFVB 1KLMB 2KXHA 1EQ0A 2DNGA 4M5LA 4P6QA 2BJ7A 1Q7YT 3D4JA 4B3TF 4Q2LA 4WYLA 2CZ4A 1QAIA 3SFGA 3HFKA 2E44A 1NEEA 4DR4J 3CCQS 2UP1A 3HF5A 2IDLA 1N36J 4PXCA 3MEDB 4PXDA 3THTA 2F4VJ 4IG3A 1SH0A 2YPZA 2DO4A 1UZHA 2GHVC 5KT5A 2ALZA 1XEZA 1Y7PA 3ZC4A 3BH6B 2D3ZA 1XK8A 5D3GA 2C2KB 1YZ7A 2ZUAA 2R3VA 2QFIA 2KL8A 2BJDA 3VQTA 4RR5A 1SJRA 2AGQA 1XBWA 2FHMA 3CD5A 5AE1A 4K4XA 3QT6A 3GR0A 4JI8F 1SL2A 4NA1A 5LSRA 2BKPA 4CYUB 4LVOP 3UPFA 3CCMS 1HNVB 5AE3A 4OX9F 5KFDA 2BVZA 4O3RA 5C24A 5HBMA 2CQPA 3MAAA 3MFHA 1N56A 3Q2SC 1ZAXA 2CAJA 2VQEJ 2R2UA 2GW8A 3LANA 1VJQA 4ZCIA 2MPUA 1FJCA 2HHWA 4ED3A 2HWTA 3ULHA 4CP5A 5CD4A 1S97A 4BDPA 2R7XA 3MM8B 4I69A 1FVQA 2PSZA 4M5HA 3W60A 1RLDA 3LH2S 3MCMA 3KJVB 2PT0A 2ZJQQ 3PW0A 2LLZA 2CPIA 1PC4A 2FD2A 3PJWA 3N28A 4DWIA 1KQGB 5C5JA 2V9KA 5KG7A 4OJ3A 3HHKA 2FHJD 3QRRA 3CCLS 4LJMA 4K0KJ 2RU3A 3MTJA 2GQQA 3TX0A 4IO9Q 2UZAA 5LMNJ 1WEXA 1Q95G 1Q4RA 2DGVA 1I94F 2M8HA 1SCJB 3M2RB 2JZ5A 4F25A 2CJBA 3VAMA 4GVLA 1ICEB 2FJVA 4ECXA 3D3BJ 3EJMA 3GYNA 3QFWA 2I5JB 3OVBA 4AT1B 4OIXA 3PVXA 5CCMA 2MEWA 2MKJA 1F9HA 2OP5A 4JI7J 3W8PA 3MD1A 3K59A 4C3LA 2F8MA 3LTOA 1F6TA 2OPSA 2AEFA 3EM1A 4DV2J 2ZUGA 1G1XA 2DNPA 3DGPB 1D09B 3HSDA 4ZN1A 3OD2A 2ILZA 1RACB 1UJ6A 5D4OA 4V1Ak 3QJPA 2KVQE 1RYRA 4NLTA 2HLTA 4DU8A 2FYXA 4P73A 4AE5A 1ZM4A 1UW9A 2MDAA 1HNZF 4O3NA 1HHQA 2FGOA 2YKNA 2QX0A 3MR7A 5KFXA 1FESA 3GJRB 1DZ5A 1FEEA 4ZVSB 4UY85 1NCLA 4C97A 1FXRA 4B08A 1VJWA 1IQZA 3Q23A 4Q8EA 1R89A 1VMBA 5ETSA 2H3EB 4HI2A 1IJFB 3UCUP 3IRXB 3GPAA 3QSYB 1DTQB 2N3OA 1WC6A 3EE3A 3JAMY 5L1IA 4ZJOA 3R8YA 1U7LA 4MK7A 4FKYA 3OLAA 2MTLA 3P6YC 1Q7LB 1GMVA 2NZCA 3HI9A 5KFNA 1JLCA 2IM0A 1F9FA 1XMOF 2GO8A 3M1VA 4QWAA 4LQ9A 1S1UB 3GWCA 4USTA 3J7A1 1RT3A 1KHVA 4LF5F 4DV3F 3RBEA 4ZS6A 4HHUA 4V19J 4R25A 4K4TA 2JRSA 1WNEA 5EWEA 3MPVA 3UQSA 3D1OA 4N5SA 2YH1A 3MTKA 2NXUA 2MYFA 4DV4F 3A3OB 3TJAA 2BXJA 3GJQB 4QIFA 3QNWB 2BV3A 4OZ0A 1RTIA 2CNKB 3R5CA 3THVA 2QA1A 3CC4S 3GP9A 2V0NA 5I3UA 3KLEB 4HI1A 4RNHA 1N5SA 3ZO7A 3K7RA 1HMVA 4ZP8A 5IQQA 2VG5B 1S48A 4A8YA 1HD0A 3U7JA 4WU3A 1YDLA 2P9GA 2J7UA 2M2BA 3TVYA 5B08A 3F73A 4K2XA 1RZMA 3ETMA 4UQGA 2MQLA 1WTFA 4YFUA 2NXNA 1L3TA 3H5UA 3H0PA 5KTQA 4ZP7A 1FXDA 2A3JA 2DHAA 2H4YB 5DZ7A 5KOWA 2OEJA 3L95X 3PYEA 1FO1A 4M5KA 1IKYA 2B4OA 2KT5A 4WFYA 5T41A 5F8JA 1P9QC 2VDHA 2HFUA 5HQLA 4NI2A 3OFEA 1NZ8A 4CLFA 4FVMA 3LP1A 4K5RA 4WWSA 1PYOB 3UNGC 1TL1A 2JEGA 3BSNA 2H5JB 4LMZA 1JJCB 1Q53A 4KYZA 1NXIA 2P2CB 3OHAA 3KUHA 2PEHA 5L1LA 3O6QA 2EKYA 2B51A 2JHEA 4J9UE 2WCXA 2LA4A 2YX1A 1XN9A 1JLAA 3PM9A 1S9EB 3I56S 3PRBA 3BO4A 2LVWA 2KI2A 2YX7A 3R5JB 4ECTA 2XMMA 1UFWA 1DURA 2BDPA 1N52B 5DQHA 3OSPA 4CRJA 1KLNA 2FJDB 4WFXA 2LECA 1UETA 5A2QU 4FPIA 3UDCA 3S8SA 4F4WA 3EPIA 2HZVA 3RAMA 2HHTA 2R4FA 4U96A 2BUNA 4MKBA 1HBOA 2PI5A 4JI6J 1N0VC 1BY9A 2HGLA 1N34J 2DCLA 4GO5X 1RP5A 2UVWA 5MAOA 2QLJB 1S6PA 2ZITA 4ZHRA 5IM0B 3BBBA 1X9MA 3RBZA 2RF2A 2D3O1 3F44A 4CT9A 1H38A 2AJ2A 4RLEA 3DI6B 4DZ6A 2B9XA 1X4HA 4KRWA 3QLHA 2RAQA 3IR7B 3CCWA 1Y5NB 4NCGB 4ZLNA 1GH8A 1Q86T 3TYTA 2UVVA 2L48A 4FYDA 2WK4A 3LP0B 2VG7A 1QVFR 3T3FA 2YPYA 3LP2B 4P71A 1RBOB 1O51A 1ACMB 3DLEB 3KK1A 2DEJA 5D0EA 4WPAA 2WVEA 3ONQA 4I7FB 5A8RA 1CJUA 4LF2A 4U6PA 1LXNA 1U47A 2ZZMA 2IMOA 5K14B 2J8SA 1PC5A 5KFHA 1SIZA 2A10A 1X9WA 4B3TJ 5E33A 1CJKA 2JX2A 1KTVA 1RGVA 3P45B 5F8LA 3AJ2A 1RABB 2DIUA 4CQ1A 4FS1A 4A46A 4U8YA 2RDJA 3BN4A 1WF2A 3W9HA 4G1QA 3BGUA 1LFWA 5HQMA 4FYVB 1R0AA 3CIZA 5AE2A 1L3KA 2ZH3A 4ERDA 4JI0F 3FC9A 3DRRA 4HTIA 1HHSA 3D9BA 3C16B 2GAHC 1T3NA 2MZSA 2CNLB 4Y00A 2R8JA 3HT0A 2PMHA 5H1SV 3WC2A 2HVZA 4CI0B 3ZZRA 2DIVA 3FDSA 1WC1A 1IR0A 3IC1A 1IKXB 3MR5A 4ELVA 2M70A 1KNZA 5DQGA 3C14B 2E9TA 3N6LA 4OX9J 1ZPWX 2KH9A 1H2TZ 2EWHA 3QWUA 4TY9A 5E7OB 1RJJA 3UR0A 2MQ8A 2VG6B 5I42A 1B7YB 2QLBB 2CQIA 4LFCF 3ADAC 3P5BP 2ZM6J 1TVRB 2W9CA 3HT3A 2GQ2A 3ENWA 2J6UA 3ZNUA 4L76A 1GEHA 2VJVA 4HACB 2YVSA 1Q8LA 1I51B 2LQ8A 3ENAA 1YJUA 2MY7A 3TAPA 5GAGI 1X8DA 4EBCA 1LW2B 5KOXA 1K1QA 3OXLA 4YHHF 2RUSA 1X4GA 4KPYA 1REVB 2ZH9A 3MF5A 1NB2A 2RQ4A 3MM5A 3V4MA 2BJ1A 1MMNA 2BE2A 4MTPA 3TARA 2QLFB 2IPOB 2YNIA 1RISA 2EG1A 3D6TB 2V9WA 1RAOA 4UW2A 2DH8A 5G0RB 3W5XA 2C22A 1R3NA 3NMAA 3V4IA 1TELA 4KKOA 1I94J 4K4VA 3FJ2A 1LXJA 4DUTA 4LREA 2XMTA 3IGVA 4ED6A 3GV5B 3H4DA 1M1HA 5L1KA 3C6TB 4M5JA 5GMEA 2DNHA 2XCPA 1OYEA 4CO5A 2KFZA 3SXLA 1T94A 5LJ5Y 3CNQP 3IWNC 5FDLB 4OYMA 4O3QA 3M8YA 1BQNB 2ZBQA 3GIKA 2J0QD 3DHXA 1UFKA 2VH7A 1N5TA 2WB4A 4KGMA 1TKXB 1CJVB 2SXLA 4OYZA 1XNRF 2GV1A 3WQPA 1ZZNA 2D7SA 1KFDA 4B9MA 1C2PA 1G6BA 8AT1B 1ULRA 1RHRB 2OELA 4LSLA 4X4QA 2K3KA 3OTEA 1QUVA 2IBKA 4GKKF 4NRTA 4JI4F 1QM9A 4URGA 1HNZJ 4OLPA 3TJ9A 3D3CJ 2YQ0A 1H2UX 3UVJA 1YSJA 3BGRA 4NLGA 3RR7A 2DD8S 4PQAA 3Q8SB 2CA9A 4QYRA 3CF5Q 3RRHA 1OPZA 1R6VA 3RAXA 4O44A 3DLGA 1QAYA 4JOUA 1NHVA 4DCPB 2IBOA 1YJWS 2ZWOA 3HFVA 5HP1B 5LL6d 4RNMA 5ETVA 1OSDA 4J9PA 7FD1A 2CG4A 3NGDA 3PG9A 2R8KA 2QSFA 3T6JA 4WTYA 1RK8A 2XMWA 1HR0F 2XS2A 2HBYB 3CMQA 4YR3A 3CJ3A 2W01A 4Y2IA 3KLIB 1LW0B 4RBTA 1WG1A 4IOAQ 1GT8A 1YITS 4NCBA 1XMOJ 3BM7A 2BM1A 4ZLLA 4D3GA 2PE8A 4OYPA 4P2FA 4QIEA 4CTAB 5MLCV 4R0EA 1ZM2A 3CCTA 3ZZTA 2Y8WA 4DV3J 3QZ8A 2UUBF 1JXVA 4GKJJ 3KG1A 3J80U 4KHRA 2E7WA 3MURP 3DFEA 4X4TA 3M4XA 5ITHA 1D0EA 3S1TA 3QFHA 4USWA 2ROGA 5A0YA 4KGVB 4JI5F 2AJ4A 3TW0A 1YKWA 4DV4J 1HBNA 4DL3A 1GTHA 3F0NA 1RU1A 1VYAA 3KLHA 2BOPA 1GFWB 1KEKA 2VPYB 1KFSA 3NCRA 1VRQC 1HPZA 1Q78A 2AX0A 3SIPB 1KVKA 5ETOA 3AOAA 2MQOA 1KBRA 4ETZA 5ADZA 2H4WB 2JLEA 4NLYA 4ZIVA 2MSSA 3QT7A 3N6NA 3CJ8A 2HBZB 3TEHB 1RWXB 2ACYA 3GB0A 1DLOB 5DLFA 3CXCR 4UOGA 2NYIA 3M2UB 1S0MA 1EP4A 2COLA 3HVTB 1KQSR 4O4RA 1SKUB 2UXDJ 4DSIA 2IM2A 1MW7A 1S76D 4ZPTR 2AMCB 2XB2D 1RT5A 5BXIA 1T05B 3E51A 3MM6B 1U0SA 1V9OA 1D8YA 1PILA 3D6MB 1PJ5A 4DV5F 4LBHA 4N8NA 3U1NA 1Q81T 5K9FA 2W2PP 3MHYA 3BB5A 1BD6A 1BMQB 3MMBA 4YDXA 2DYAA 4RU9A 3UFCX 4ECUA 3KDNA 1O6XA 1WOPA 1NHUA 4NRUA 5KFKA 2AW0A 4PWWA 2CVEA 1S6QA 2DHXA 4ZJQA 4EZ6A 3MR2A 2E9ZA 4K8RA 3H2UB 2ZWPA 1BQMB 1EAYC 3CSKA 1U2CA 1RHKB 4WU2A 5CYMB 5KG0A 4IQMA 1MWQA 3VVTA 5J2MB 3KNAA 4IH5A 5JMNA 1L3UA 3FSXA 1B64A 3HVRA 1T9WA 1JX4A 2AYEA 2HIYA 3FBFA 1HBMB 2ZH7A 2VKRA 2EEYA 1OQ3A 3GTYX 4HLBA 3ITHA 3NGUA 1XMQF 4ZIWA 3MAQA 1S5ZA 4KR0B 4QU7A 1YJRA 3PRDA 2JVOA 3H5YA 4JV2A 1N88A 1BXNA 5HI7A 3D1QA 2AZ3A 2ZH8A 2N3LA 2F40A 1IKWA 1VCTA 1SJFA 2XGPA 1QD1A 1TKTB 3A3PB 5RUBA 3MXHP 3L7OA 4C3MA 1Q0NA 2BE7D 4EGLA 3D2WA 2OFHX 2LKZA 3MECA 1N5QA 2K7JA 5CYQA 4Y0FA 3AHPA 2MLYA 3PJ9A 3U02A 3JSMB 3H59A 2X1AA 1SV5A 2EFPA 2RILA 3Q8VA 4KE5A 1NBEB 3I87A 2V8PA 4X4OA 1X5TA 4KFBB 4DG1A 5JUMA 4HYKA 1VRTB 5T7LB 3W9IA 2HNZA 2CPZA 1TAQA 1RXOB 4OZ3A 2M9KA 4ZVQB 2VKZG 1HYSA 1QJHA 1I6JA 1KR4A 1VS3A 3B8HA 2AJQA 3GIRA 1KDNA 2WOMB 5D0RA 2MZTA 4DI6A 3GCWP 3IM8A 1LWCA 2ZKUA 5L9NA 2D3OR 1R31A 2Y9HA 2WSEC 1DQAA 5GAHU 3DOMA 4NYZA 3M8QA 2I0XA 1NAQA 2DGSA 4PXEA 4X4RA 4LF8F 2DPIA 3BO3A 2EFNA 1U8SA 2EW9A 4KT0C 4O3OA 1NHKL 3SQGA 4E2FB 5JJBA 2RRAA 3EXCX 1SB6A 4C8YA 3KOAA 3MEGA 3EGVA 4JI0J 2C28A 1NPKA 4I2PB 2FJWA 2J8AA 3BV8A 1HQ2A 2X1BA 1PBAA 4WK3A 5L1JA 3NGRA 1SJQA 1RT2B 1AROP 2GS8A 1VIXA 2UUAJ 4LF6F 3IWLA 1VHFA 2YH0A 1DTTA 2G2ZA 4ZVGA 1RTDB 2KG1A 2NYHA 2OSRA 1KONA 5KT3A 3D0GE 3C15A 3G6YA 2K2PA 5B0GA 5A2QY 2LMIA 2CQHA 2VV5A 1FDDA 4LFCJ 4TU9A 4AFFA 3QQCD 5HVGA 1YIJS 1NPPA 3NCPA 5IOLA 3CDUA 2VOPA 4M5DA 3TP2A 1D9AA 5L46A 4Q43A 4RW9A 4IO1A 2V4JA 1FKPA 5HVHA 2I8EA 4CO1A 3KHHA 1FX2A 3I82A 3CPWR 3DHWC 2F9DA 5KFYA 1IR2A 2RKIA 2PN6A 2V2VA 3GYGA 3LUYA 4IRKA 4GVBA 4A8MP 5LT5A 3IS9B 3GIMA 2VONA 1NJWA 4DR5J 4OYWA 2YNFA 3W65A 4O4GB 3DC2A 1NDCA 1I3OB 4ED1A 2PA8D 1WC0A 1SKWA 5BYSA 2D1CA 3JQMA 4DSEA 4C6AA 4Y65A 3QRQA 1RWWB 1D9DA 2ATCB 1WORA 4PG4A 3NL0A 3HHEA 2W8LA 2O67A 3G6XA 5IV3A 2E1CA 1PJ6A 4C3KA 2OPPB 3FEXB 1VHIA 3NRBA 4NLUA 3GU0A 5D78A 3K0JA 4CH0S 4J7CA 2B4VA 2IDEA 4ES2A 3AT1B 3P96A 1FK9A 2XS5A 4J90A 2CJXB 2KZZA 4DPOA 3Q24A 2GA7A 1XNRJ 4FF4A 2V2QA 5HL7Q 1NMEB 3GV7B 4DX6A 3TX8A 4LT6A 2C1EB 4XK8C 4DR6F 4EO6A 1FKOB 2KM8C 5H9EJ 4X4SA 4GKKJ 4JI4J 2NXEA 3QIPA 2CUYA 3UCZP 4FKXA 2VBYA 4QYZJ 2W4CA 2XGQA 1B0TA 2BRLA 1RAIB 1IBKJ 1U8WA 3G82A 2GQCA 2XG8A 3BR8A 3SSRA 2F7VA 4N77A 1S6UA 4IH7A 4F0KA 4ECSA 3IBFB 3RB4A 2NPIA 5KFTA 2VA2A 2OPQB 3IA0A 1T9TA 3KLFA 1DQ9A 3D6FB 3FCVA 2MQQA 3PW4A 4USMA 4M5IA 4OI3A 4J9KA 4LRDA 5C25B 2G1HA 2F65A 5K8MA 4IRDA 1CSJA 4CDIA 3NGTA 4TLRA 1YJ9S 1HR0J 1M90T 2W2MP 4MFBA 5H9EK 4DX7A 2AJ0A 2V8VA 3K5OA 4IFVA 1KLMA 2HNYB 5DJBA 1X4AA 2IRXA 1VRUB 1H0HB 4AQYJ 2POKA 3BYPA 3CWJA 4OI0A 2LXFA 2VA3A 3MCNA 2JFDA 4L75A 5D4PA 4AL5A 1YJNS 3ZZYA 2ZZTA 1RHJB 4JI3F 2FVCA 3N0VA 1RT6B 3MEDA 2V6AA 1J27A 3PX4A 2W1BA 4F4AA 4KY3A 2UXCF 2DRBA 4DV7F 1URRA 1JJ4A 3M2VB 4TU7A 1NJYA 4OX6A 1J5OB 2MGZB 4JI5J 4NOHA 2DNMA 2AHOB 2UV8G 3AH6A 1U2RA 2DHHA 4DR7F 4P72A 1KOHA 5DGAA 4L3NA 1WHXA 5KFQA 2MKIA 1N33F 3P4UB 1CULB 4ZVHA 3SQOP 3BREA 3TJ8A 4QPTA 4CYUA 1CLFA 1NJXA 1HNVA 1X4FA 3VWSA 2HLUA 3EZ5A 3ZTPA 1R8BA 2GHPA 3AA8A 2BQUA 2HS3A 1UWBA 2AGPA 2HFNA 1F60B 1RAJA 2MKCA 5ETRA 2YXLA 1Y10A 5CXTA 4DR2F 3GFHA 1T0TV 4RBVA 1S72S 4FZVA 5JXSA 2YNHB 3MM8A 2OAUA 2MB0B 2FC9A 4URSA 1Z4UA 5H9FJ 3VQSA 4DV5J 3KJVA 3T1HF 1WF1A 3OVAA 2K1RB 4DPUA 4DN9A 2BW7A 4MIAA 2LP4A 4PYDA 3LWLA 3H42A 2PIIA 1SI9A 4N76A 4A8WA 1RADB 5GAEU 2HQ3A 3HLUA 4O0NA 3CD7A 1QE1B 1RWPB 3OXFA 1VBZA 4WE1B 1S1XB 2XWYA 3R7SB 5ETKA 2BR0A 3PNIA 4TQSA 3I0RB 3M2RA 4YY3F 2R7OA 2EVZA 2RQKA 2IYGA 2HAIA 2NSCA 2QIFA 4HDGA 2I5JA 4PYAA 2E5LF 4X62J 1W25A 2IHR1 5E0OA 2JNJA 3HVWA 4X64J 4C0BA 2Y1RI 4OHZA 4WP8A 3CJKA 2KVIA 2C3PA 4RW8B 1XMQJ 4JYAF 1TUVA 4IFYB 2V8HA 2H51B 4ZDNA 3J80Y 4QBUA 3BQ0A 3AQOA 3R7NB 2O01C 1HLWA 2ASYA 4ECYA 2PMWA 2DHSA 1B0VA 5B0FA 3DYAB 2RH3A 2W7PA 5GMDA 1YG0A 3TQEA 5B0AA 4B9LA 4HT7A 4DQPA 2WSFC 1RWVB 1LEOA 2APOA 4Y2AA 3DLBA 1VIOA 4K2JA 5I3QA 2HRTA 2WTFA 1LNQA 3I9V9 4JV5F 2FHOB 1WUUA 2OEKA 3MI7X 2XYHB 4PPZA 2A2DA 1JNRB 1Z2LA 2K8GA 3I4HX 3IRXA 2DXFA 2HQIA 2VHGA 4QPXA 3MUMP 3JS9A 1DHMA 4H4OB 5JVGQ 4ZVTB 2DR5A 1K1SA 1FDNA 4P2MA 4UUWA 4Q5VA 2L9NA 1UW4A 2FTRA 2AZ1A 1A6LA 2OHDA 4RUCA 3K89A 2HAFA 1WTBA 4ILLA 2FJAB 3EYZA 2W9BB 2L3MA 1HNIB 1MNEA 1NU4A 1IQTA 1TL5A 3K8WA 3NXZA 4C8LA 3RB0A 2VPWB 4WXOA 2F63A 3KMSA 4PR6A 2MQNA 2VODA 4YB6A 1ITPA 5FIIA 2FZCB 3HVAA 5HLFA 3GIIA 1CEZA 1H98A 2IVMA 1GMWA 1YRTA 4OV1A 4TLQA 2QO3A 4C11B 2VIHA 1CQMA 4Z2XA 5EWFA 1AFIA 2FC8A 4KH1B 3FCWA 4DXLA 3BEGB 4FPRA 3I4PA 1RTJA 3DXBA 3QGHA 4LF6J 2R8IA 4WZMA 5DM7Q 3M9NB 2XI2A 3N5FA 3UDEA 1U0HB 5BYRA 3HCXA 5GADU 2XC9A 3K57A 2VG5A 1WACA 4LFBJ 4F50A 2Q79A 2GGPB 4QOTA 4CO3A 1MMDA 1N5VA 1W2BR 1EB0A 1W7WA 3I5CA 1EJ7L 1TL3A 1RA7A 4K4ZA 4FYWB 5FLXU 1YBTA 4XPEA 4NPOA 3TQ1A 3AA9A 6FDRA 2RDDA 1RYSA 1VQOS 4FXDA 4DEZA 2CJAA 2H5IB 5KFPA 4OYOA 3KNGA 3PEJA 1NLKL 1GMUA 2U1AA 5I3PA 1ZTWA 3GONA 1FRIA 2BMBA 1IWAA 3J7YU 2B9YA 4I2QB 3AAWB 1U49A 4WXWA 4B3SF 1EARA 4USJC 3FFIB 2CQ2A 4RJVA 3T9ZA 3UR3C 4DSKA 1S9EA 5J1PA 1N32F 2M5YA 2L41A 2FB0A 4NYPA 1F5BA 4TVAB 3P3DA 4FXWA 2PGCA 5DDRC 1JMTA 1FT8A 4MKVA 2R9LA 2FJEB 1FRXA 2DBBA 4GC6A 4DPYA 4ES3A 4M8LA 4ZPWR 3DRPB 1T11A 4DR6J 1RAGB 2YY3A 3LF0A 2YX4A 1MROB 2MKHA 1VK3A 4DUYJ 1V3SA 2HW3A 3R9LA 3W64A 4F2SA 1C1CA 3OVSA 2KDOA 2P6SA 5IM0A 4I0WA 3CC2S 4DOZA 2DNRA 1VR6A 2A2CA 4DV2F 5DDPC 1U1KA 4A47A 2HHXA 2X1FA 1XNQJ 4W98A 4F7VA 3HXMA 1KQKA 3DI6A 3ET6A 1RWOB 4QR0A 1MN9A 2CXEA 1QAJA 1KD1T 2AU0A 2R42A 1YJVA 4G65A 4NCGA 2DJWA 3PFOA 1WOOA 2MY8A 3LP0A 4YR0A 5DM6Q 2KXNB 4DQRA 3HMJG 3TI0A 3LP2A 1UVLA 1VI7A 4HH1A 3D54A 3ETOA 2HZCA 1FE4A 3DLEA 4X66F 2BQRA 3PFEA 3GFYA 4I7FA 1LFPA 5CZXA 5K14A 4UZCA 4DL2A 1JK9B 2FVPA 1U6BA 1UMJA 2QMXA 3K5LA 1U1PA 1S1WA 2HURA 3IG1B 3SDEB 3MOJB 5HK4A 3S01A 2XZWA 4JI3J 8ATCB 3PYDA 3OL6A 2BE9B 2UXCJ 3CO0P 3RUBL 4DV7J 2YQ3A 1BUXA 1FDAA 3X3UA 3H5SA 3VAKA 5EDWA 2FDNA 1WC4A 2WVCA 2IC3B 3C2PA 2QN6B 3IWXA 5KFAA 1WSVA 1HWIA 2ZKTA 1ZTTA 5KFIA 1GXLA 5E3QA 1FRMA 2BYCA 2FQQB 4DR7J 3HM9A 3BZQA 5L8RC 3ZXWA 4JI1F 3GFXA 2MHNA 1TL7A 1R8HA 3I5AA 1Q8KA 4DUZF 3EZUA 4FNIA 3NOGA 3RGIA 2J9CA 4GRSA 1UA0A 1N33J 3BKUA 1HNXF 1IKXA 3JQKA 1R6YA 3PX6A 2W4DA 3C14A 4RNNA 4Z7CA 3NLCA 3AJDA 4J9MA 3BPSP 5A76A 4ZCMA 2JEJA 5KFWA 1TTHB 5LJ3Y 2VG6A 1B3TA 3OTOJ 1JNZB 3EGNA 3M1VB 4MKYA 1TVRA 4C8NA 1LWFB 1RWMB 1VBYA 1WG4A 4DR2J 2Z2ZA 3E8OA 2LEPA 4H4MA 5F0WA 3IM9A 2HBQB 4TYAA 2UUWA 4HACA 1LV5A 4K4UA 1UTAA 3P49B 2O1PA 1EKRA 4NZ7A 1LW2A 4N47A 1REVA 3T1YJ 1IBCB 4DR3F 3T1HJ 3QAUA 3V2UC 2GC8A 3DN9A 3CJSA 5KAKA 2W7AA 2HFVA 5GVQA 4N41A 3QPIA 3P5TL 3MPUB 2GVDB 1FFSB 1RTIB 1UEKA 1APSA 2DGWA 3KLGA 4LSZB 2MZRA 4USVA 1GMWD 2BJ9A 3PHTA 4A8OA 2HGMA 5D4LA 4FF2A 2Z4PA 2CNOB 2ZBPA 2CFXA 2MQPA 5I4MA 4YY3J 4F3QA 3PHEA 3LA0A 3C6TA 3C8YA 2EK6A 1QLNA 5FDLA 3LALA 1SC4B 1UVIA 3LPYA 1BQNA 3MM9B 4CLUA 1HKAA 2CQ4A 2XY6A 2JEFA 2XULA 2BANB 5F9NA 2ZFHA 2KJVA 1E6YB 3GLJA 3AB2B 3SV3A 4JYAJ 1X31C 2R7QA 4PXBA 4UT4A 1CG2A 2YBVA 4X4NA 2QYGA 2H54B 3LP1B 3R2DJ 1HNWF 2CZ9A 4QJVA 1VQKS 2XYGB 3PACA 4EZ9A 1BWEA 2IMWP 2X1GA 3IAS9 2HRYA 2NSBA 3EXYA 1JKHB 4ZVEA 1TP7A 2GJ2A 4XPCA 1S4FA 2FIUA 2DKOB 2B0GA 1RUSA 4NYOA 2EBEA 1GXTA 3MUTP 2IAJA 4RW6B 4CO4A 3W2VA 3ZNJ1 2ROEA 4F0MA 3V81A 4Q2MA 4JV5J 4CLLA 2HFZA 2QL7B 1UL3A 1JLGB 3ILIA 2BJ3A 3HDSA 3FCHA 3I32A 2QMUB 1FE0A 4DMZA 1YBAA 3CO9A 3KLIA 2HVIA 5F8NA 4OI1A 2KU7A 2I9SA 2NXJA 2BW2A 1SIWB 2XLJA 2DRAA 3PV8A 1WDDA 1M5VC 1S6PB 3TZZA 3N9UC 3GZ7A 3MFIA 3BGFA 2CADA 2B5JB 2OMOA 3K58A 3TWZA 9ATCB 5LXYA 1JLQB 1D9FA 5LM7E 1YQHA 1OSCA 2J0WA 4HVZA 1KTQA 3QSIA 4L72B 3FMWA 4ICLB 2DR6A 2G0IA 1X5PA 2YKMB 2C3MA 3VZHA 3BGOP 2DRDA 2GNKA 3AOBA 4YN3B 4NMLA 3CDAA 3MM7A 3PW5A 2VC1A 1T3OA 5KG3A 3GSDA 2XEXA 4NZ0A 1UEVA 1S6OA 3V6KA 3UD4P 3Q8RB 2DNLA 4QQBA 2WBMA 2AX1A 2IA0A 1CJKB 1DLOA 2PC6A 3M2UA 3DLKA 1SUQB 1EKSA 1CJTB 1VLOA 3K5NA 3ISZA 4ID5A 3W5ZA 3DOKB 2MJNA 1R0AB 1PO6A 1PAUB 5KFLA 2V2ZA 1NK9A 2HFSA 3MM6A 2XLIA 4J5OA 4RZRA 1DAXA 1FERA 2ZM6F 1TK5A 4X2BA 3PYGA 1HWUA 2J9DE 2J0SD 4NWBA 3WHIA 4P9SA 2Q6BA 4CO0A 3HJFA 2DGUA 3LO3A 1NSAA 1Y11A 3OQ2A 3N6MA 1JXLA 2V63A 3JB9k 4FS2A 5KFBA 1ZA1B 4B3SJ 1T9VA 3BR9A 4JUZA 4ILRA 2VUGA 1GNKA 1QY7A 4O0IA 2AYMA 3TZXA 1N32J 4PKDB 4TYBA 3SMZA 1DRZA 4USKA 5I42B 3W2WB 2BKNA 3JYTA 3BSAA 1BQMA 2P9EA 3JTPA 1F0XA 4M5GA 2B4PA 5B0BA 1ROFA 1B7FA 4U7CA 3OXGA 1FNOA 1U26A 2CPXA 3A8IA 3KXDA 3LQVA 1S49A 4FXVA 5J2QB 3HHDA 2WVBA 1HBMA 3GCXP 1S1VA 4LF7F 2G2YA 5EN1A 3G2XA 1M5KC 2JOQA 2W2NP 2BJ8A 4BHQA 2LYVA 5F0UA 5D8HB 3FVYA 4E0DA 2CKWA 3LGMA 5B0CA 2AYGA 4ALZA 4DFPA 3U27A 5E2QA 2KJWA 3RBDA 5C2GA 3V4IB 1RT1B 4KKOB 2VQFF 2KZMA 1HW9A 2YWWA 4PZVA 1U1QA 3HHLC 3VR1A 2IVFB 4MJKA 2R7UA 4NXNJ 1NK0A 1AYEA 3CIMA 2NREA 2ZHAA 4I6WA 1FFGB 3TUPA 3MDFA 3H40A 4OYAA 1AT1B 4NA2A 3PR4A 4NLDA 3JSMA 4X66J 1RQ0A 1ZS6A 3DU5A 3T6BA 2W8KA 3HX9A 3B54A 4K59A 2R7RA 1RA6A 1FFWB 3KUEA 1VRTA 5FLXY 2RS2A 3NGSA 3EGZA 4C8OA 2Z56B 5J2PB 1S79A 1CPZA 4QW9A 2WOMA 2FLNA 5AT1B 3HSGA 2ADBA 3UVJB 2ATLA 3Q22A 3RB6A 1EETA 4LVNP 1WI8A 3KG4A 1C4AA 1RHMB 3CCVS 2MMYA 2ZJRQ 4C7QA 4M95A 3KTQA 6FD1A 4I2PA 3D7SB 1JLEB 1KQFB 1RHUB 3QJLA 4WFAQ 3G8QA 4KTQA 4ED8A 2ZJPQ 2G9OA 4ECZA 4YP3A 3PO5A 4X65F 1RT2A 4JI1J 5IZHA 2BX6A 3AOCA 4CLZA 4DUZJ 1QUPA 1PG5B 4GKJF 1N4LA 4TKTA 1HNXJ 3SSQA 1OYDA 2RS8A 2C3YA 3EGWB 4U7UK 1VQMS 2AWZA 2J76E 2EG2A 2I2YA 3FRYA 1YGYA 3E3XA 4M63A 1M1KT 4ER8A 3OR1B 2C2RA 3M30B 4HTJA 3T9NA 4OHYA 3KHLA 1S4EA 3KYLA 4DFKA 4ECWA 3OFHA 3F56A 2EI5A 1YTYA 1KVJA 5EX3A 4X4PA 3MAHA 1PGZA 1NDLA 1Y00A 9RUBA 4L6V3 2JC1A 2VJUA 2HVEA 2B9EA 1EHWA 2KHDA 3TUIC 2KYXA 4DR3J 5A0YB 4QWCA 4J9LA 3BDPA 1HBNB 3A13A 1UJ4A 2UXDF 2RHSB 3IS9A 3JQJA 2DGTA 1TQLA 4O4GA 2RMLA 1F3VA 1HPZB 2Q66A 2QV6A 2IJRA 3UN2A 2YWEA 1RWNB 2H65B 4K7QA 1AUDA 2OMLA 2GHWA 3MD3A 3H7HB 4ZKAA 2WHOA 2HPUA 2DEIA 2ROPA 1MWZA 3W3SA 3O1LA 3QYYA 1S9FA 2RRNA 4EEYA 2OPPA 1ZH5A 5AXLA 1EP4B 2N7YA 2VB6A 4DQSA 2PI4A 3DOLB 1DQ8A 3PW7A 4XAKA 4FVCA 4DLEA 4ENOA 2MKYA 2A6OA 4WFZA 3B6BA 1YK9A 2Y8YA 2B6AB 4KIAA 4F26A 3HHLA 2GIFA 1FI4A 1FKOA 1UPPA 4DSFA 5ETMA 2CIMA 2ASDA 1HNWJ 5HROA 1NSKL 4OHVA 1RB0A 3RW7A 3P8BB 2DNZA 3OL8A 5DDOC 1T03B 4U7UD 4I68A 3W1YC 2XMUA 1FJ7A 3QZ7A 4BS2A 2OPQA 4X4VA 3BF4A 2G13A 2NXCA 3CC7S 3LAMA 3OL9A 3VAJA 2D74B 2F9JA 2O5DA 2XYPB 5LSOA 1TU0B 5CCLA 3Q8PB 4EWTA 3J7ZT 1KVIA 1FXLA 5C25A 3LGNA 2RDIA 2BZ2A 4WKYA 3Q0AA 4QIWD 2HHHJ 5D77A 4RKUC 3UE2A 3MR3A 4U9RA 4KQZA 3R1HA 1FJEB 1VRUA 3SZ2A 4NEZA 1VQPS 3QGGA 4UOHA 2ZC3A 1WC5A 4ED4A 5DRKA 4W92B 1Z1ZA 2EC2A 1RKJA 3R2CJ 3BGLA 4PABA 4I67A 1RAEB 2FY8A 1RT6A 4FDFA 3FQKA 2Y0BB 4J9QA 3MCOA 1KP6A 4ECRA 4CCHA 3C19A 4PPDA 3PZPA 4DFJA 2HK3A 4ZCLA 1J5OA 4DPTA 4N56A 4A8KA 5GAHI 2VL1A 4NZ6A 3NNCA 3S6EA 4P7VA 3H5XA 3MEEB 3Q8YA 4EI2A 3CCUS 3TZYA 2ABYA 2AIRB 3RR8A 1SV5B 3D28A 3MMCB 3T19A 2AT1B 5EX0A 3PW2A 2WONB 4NLRA 2E1PA 1KRPA 1CULA 2P5VA 1S0VA 4RL1A 4FF3A 3W7BA 3ILLA 4PQUB 1HYSB 3BQ2A 5L39A 3TO8A 1M5HA 3MPYA 4ZLJA 2CPYA 2UUAF 3DRSB 3QAEA 4DR1J 2ZDPA 5DGBA 1HBUB 2ASJA 1C1BA 2XMKA
chains in the Genus database with same CATH topology
3OXFA 2CYYA 3MMCA 1VBZA 2OPSA 1IUJA 1DJ0A 5CD4H 4MYTA 4WE1B 1S1XB 2LQBA 2XWYA 3ZZZA 1UVKA 2ZUGA 2BR0A 4HL9A 1OQ6A 4OHXA 2WONA 3E01B 3OW2R 3IFEA 1G1XA 2DNPA 2CQCA 3PNIA 4P2SA 3THPA 4K4YA 1CC7A 2QYCA 3MEGB 4TQSA 2YNHA 3CE8A 4ID8A 3I0RB 3M2RA 1T8EA 2ILZA 2ZBIA 3MGJA 1UJ6A 5D4OA 4YY3F 2R7OA 3QJPA 2EVZA 5F8MA 1X0PA 4PQUA 4LF4F 1JXEA 4DJBA 1RYRA 4NLTA 2HLTA 2RQKA 2IYGA 1GTEA 4TY8A 4F8RA 2NLWA 2HAIA 2NSCA 2XSJB 3OUYA 2QIFA 2HGNA 4AE5A 1ZM4A 4HDGA 2MDAA 1HNZF 3I55S 1NNDA 2I5JA 1Q16B 2K1RA 2Z2MA 4O3NA 3CGIA 3MUVP 1S0OA 3DLLQ 2E5LF 2M52A 3M9OB 1W25A 2FGOA 2IHR1 2YKNA 3DRSA 2LU2A 4DQIA 5U47A 2MJUA 2GMHA 2PA3A 5E0OA 2R7TA 2UV8A 4DHVA 2RQCA 5KFXA 1XERA 4KHPF 3HVWA 1HBUA 2JJ4D 1FESA 2NR0A 2P9CA 4KHMA 2MZQA 4C0BA 1EETB 2VBWA 2Y1RI 4OHZA 2ZH2A 1U1MA 1H2VZ 4Y2CA 1DZ5A 1QE1A 2A18A 2B7CB 3CJKA 1FEEA 3SCKE 3OSNA 3H25A 2KVIA 5A6WA 1AFJA 2C3PA 1VQ8S 4WE1A 1S1XA 3UCGA 4UY85 3NBPB 1N0UA 4RW8B 2BM0A 4C97A 5A8WA 1FXRA 4J9OA 2AV5A 4OJHA 3E01A 4JYAF 4B08A 1VJWA 1HWKA 3BJYA 1IQZA 1JLCB 2VPXB 4DR5F 1TUVA 4IFYB 2YWGA 1UA1A 2YKAA 1NK6A 2C3UA 2V8HA 1T7PA 2FVQA 3NCQA 4KGKA 4ZDNA 3J80Y 3Q23A 2Q43A 4Q8EA 4MKAA 4QBUA 4DL5A 3V6DA 1R89A 5KFGA 2DVIA 1VMBA 3BQ0A 4HI2A 3AQOA 1IJFB 2XSJA 3U1LA 3UCUP 1OS5A 4QZVB 1SJ3P 3IR5B 3IRXB 1GXUA 2O01C 3GIJA 1DTQB 1RT3B 2U2FA 2N3OA 2M8DB 4WFNQ 1KHWA 2ASYA 4ECYA 3DLJA 3JAMY 2DHSA 2FVRA 5L1IA 3QO9B 1B0VA 3SFUA 2OSQA 3ICLA 5B0FA 3DYAB 4M1KA 3RU0A 5IT9Y 3OHBA 2RH3A 3G8TA 1U7LA 4MK7A 2W7PA 3OLAA 3P6YC 1Q7LB 3MR6A 1RT4B 2V4JB 1YG0A 2WAQD 1UEUA 3ENVA 5B0AA 3HI9A 1HI8A 3PKMA 4F4ZA 4B9LA 3CDEA 4HT7A 4DQPA 2L9DA 4MIWA 3NBPA 2WSFC 2IM3A 2CQ0A 4K50A 2APOA 2BA9A 1SQEA 3PKYA 1UVNA 4Y2AA 5DQIA 3DLBA 5E3PA 5KFNA 2OO4A 1VIOA 4OQJA 2JSXA 1JLCA 4IKAA 2IM0A 4IFYA 3V6HA 4B3MF 1F9FA 1XMOF 5I3QA 2WTFA 2M88A 1VQLS 3G86A 3I9V9 1FTRA 2D9PA 4JV5F 2FHOB 3FZ2A 3MI7X 2YNFB 2GO8A 1KN6A 3M1VA 4QWAA 1G2EA 1VQYA 3U1MA 5I3UB 4LQ9A 1S1UB 4ED0A 1CC8A 3GWCA 1FCAA 4OZNA 4PPZA 2A2DA 1JNRB 5G0RA 1Z2LA 2K8GA 2RUGA 3I4HX 3IRXA 5KFUA 1HMVB 3J7A1 1RT3A 2HQIA 1FEHA 4QPXA 3MUMP 2QFJA 1LOUA 1KHVA 1DHMA 4H4OB 5JVGQ 4LF5F 4DV3F 3RBEA 2DR5A 1K1SA 4DV0F 4WK1A 3QO9A 1FDNA 2FPHX 4ZS6A 4V19J 3DYAA 4R25A 4Y3CA 4OI6A 4UUWA 4Q5VA 4K4TA 1U1LA 2L9NA 1URNA 1UW4A 2JRSA 2FTRA 1WNEA 3GMGA 5EWEA 3MPVA 3UQSA 1BQXA 4MYUA 1A6LA 1RT4A 4RUCA 4F4KA 4CIOA 3D1OA 1WTBA 5GAGU 4ILLA 2FJAB 4N5SA 3EYZA 2W9BB 2L3MA 2WSCC 3DU6A 1HNIB 1R27B 4ZCKA 4AUKA 5BJRA 2YH1A 1SL1A 1MNEA 1NU4A 3MTKA 2CDQA 4F02A 2NXUA 1IQTA 2MYFA 1X5OA 3NS5A 1IBLF 4DV4F 2HNDB 3OL7A 1TL5A 3K8WA 2BXJA 4C8LA 2KG0A 1IBKF 4QIFA 1RI7A 2BV3A 4OZ0A 5D6GA 1N5YA 2F1FA 1LQ9A 3RB0A 1S7HA 2E7XA 1RTIA 2Y1JA 3R5CA 3THVA 2QA1A 2VPWB 4WXOA 1FF2A 1NKCA 3CC4S 1FD2A 1IKYB 4TN2A 3KMSA 2V0NA 3PY8A 5I3UA 4PR6A 3KLEB 2MQNA 1TKXA 1FK9B 2VODA 4ILMA 4HI1A 4RNHA 1N5SA 1ZZFA 2J0XA 2LCWA 4CNYA 3K7RA 3NKYA 4PCQA 1QSLA 1HMVA 4ZP8A 2HMIB 4YB6A 2W7OA 5FIIA 2VG5B 5IQQA 3HVAA 1S48A 5HLFA 3GIIA 2I38A 4H4OA 1CEZA 4A8YA 1HD0A 3U7JA 4WU3A 2XY5A 1H98A 2P9GA 2IVMA 2J7UA 2M2BA 3TVZA 4CT8A 1S1TB 3TVYA 1ZYQA 1R8CA 1YRTA 4OV1A 4TLQA 2QO3A 4C11B 4KB7A 3GQCA 5B08A 3F73A 1CQMA 4K2XA 5CQGA 4Z2XA 4UQGA 2MQLA 5EWFA 2QMWA 3IRWP 2W9BA 5KFMA 1TL1B 1HNIA 1WTFA 1U4BA 1FVSA 1Y9OA 2V8GA 2HHQA 1AFIA 4YFUA 1IXKA 3QWPA 1ZOTA 1L3TA 3QIPB 3H5UA 5KTQA 1T95A 3LOUA 4EYIB 2FC8A 2J6SA 3KMQA 2HNDA 2RRBA 4ZP7A 1FXDA 3BEGB 3M6UA 4FPRA 3C3LA 2A3JA 3I4PA 3PXGa 3JTNA 2DHAA 1RTJA 2M4MA 3DXBA 3QGHA 2P6TA 5HN0A 1IN0A 5KOWA 2R8IA 4WZMA 2QZ8A 5DM7Q 3M9NB 4FN5A 2XI2A 5K8NA 3N5FA 5IXUA 3LWMA 5KFRA 3L95X 1SC6A 1FO1A 1IKYA 1SJ1A 2B4OA 2KT5A 4WFYA 5BYRA 1WHYA 5T41A 1JLAB 3KHRA 1NK5A 5GADU 2XC9A 5F8JA 1A7GE 4KSEB 3K5MA 1GX5A 3QMQA 1P9QC 4AQYF 4PG7A 3HHLD 1Q79A 2HMIA 3K57A 1JLBB 2VG5A 3CDBA 1WACA 4MK8A 4A8SA 1KSPA 4F4YA 1N54B 4CO2A 4F50A 3VAHA 1ZBTA 2Q79A 2DGOA 2R8HA 2GGPB 1Y5LB 3OFEA 3IGNA 1SXLA 4FVMA 1S1TA 3HHLB 2XBPA 2IRYA 3LP1A 4N8OA 4QOTA 4C11A 4CO3A 4HT5A 5HP1A 4K5RA 1ZAWA 1MMDA 2Q6CA 3UNGC 1N5VA 4HH0A 1W2BR 1TL1A 3ISND 2XS7A 3M32B 3TAQA 3BSNA 2JEGA 4O3SA 3I5CA 1TL3A 2GCFA 1RA7A 5HROB 3K8VA 2V4QA 1K73T 3PDNA 4K4ZA 4LMZA 1DBDA 2VFTA 1Q53A 4QWEA 2J7KA 4OX8A 3OLBA 4XPEA 1VQNS 1JWWA 2JWNA 3OHAA 2PEHA 5L1LA 1WEYA 3O6QA 4NPOA 3TQ1A 3AA9A 2EKYA 1Y3JA 2HHHF 6FDRA 4MFBB 1D8ZA 2B51A 3WDOA 2JHEA 1R7IA 2WCXA 2LA4A 1O5JA 2YX1A 4I6YA 1XN9A 5B09A 4YB1P 4CH1A 1JLAA 1HBOB 1RYSA 1G3OA 1LW0A 2Y1IA 3PM9A 2ZNZA 3X1LB 1VQOS 2E1MC 1S9EB 4XDCA 3I56S 3ENQA 1VLYA 4OJGA 4TQRA 3PRBA 3BO4A 4ETXA 1JLBA 1U24A 4AL7A 2DR7A 1YJTA 4FXDA 3G9CA 1R43A 2J9DA 2ZH6A 2LVWA 4DEZA 2KI2A 2YX7A 2CJAA 5E3AA 4PG6A 2GGPA 4EBDA 5KT4A 5KFPA 4ECTA 2XMMA 3KNGA 1UFWA 1DURA 3PEJA 2XMJA 4ZHRB 2HG4A 2BDPA 3OBIA 2HIQA 1N52B 5DQHA 2DITA