3G73A

Structure of the foxm1 dna binding
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
90
structure length
90
Chain Sequence
SVSERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the FoxM1 DNA-recognition domain bound to a promoter sequence
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords Forkhead box protein M1
total genus 18
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3g73A00
4EJWA 2O61A 3RKXA 3FXRA 3QU3A 2A07F 1YFHA 2DK5A 4Q48A 5DV5A 2YX7A 4A2UA 2QM3A 1R5GA 3R61A 3GWZA 1FPQA 5IT9K 1STZA 1LDDA 2MH9A 4HYEA 1I1SA 5FFXA 4BXUA 4RB2C 1IF1A 2F2EA 2YR2A 1Z9CA 2K02A 4LK0F 3J81K 3E5QA 4Y15A 4G9YA 3K0LA 2GA1A 5K5QA 3J80Z 4FX0A 5IT3A 4ZZDA 2M8EA 5E1XA 4ETSA 2FBKA 1XB4A 3K69A 4NHJA 2P5KA 2ISYA 2EV6A 2W24A 4I09A 2HQRA 3HSFA 3O3KA 4RGUA 4PDKA 3C18A 2PG4A 5ICGA 1RIOH 1ZARA 1SMYF 4NQWA 1V3FA 3KCCA 3I0TA 5DCFA 3EYIA 3KEQA 1L0OC 2HR3A 4IVNA 4AIJA 3P9KA 3KETA 2PFBA 3ERED 5LHIA 4CGZA 4L9TA 4CHUA 4ZYGA 5D5UB 1J9IA 4WX9A 3QOPA 2FA5A 3R0JA 1Z6RA 3C3WA 2H94A 3HSRA 2JTVA 4KIFA 4IRGA 2B0LA 1ONVA 4U7BA 4KICA 3BJOA 2PJPA 2V1UA 1G3SA 3L00A 1XD7A 3BDDA 2ZMEA 4LB5A 2F5FA 3VEPA 2O3FA 1TW2A 4G94A 3W6KB 1AOYA 2BBYA 2YU3A 2VBZA 2F5CA 2W25A 3DKWA 4PGHA 3F6VA 2OZ6A 2XKOA 3KZYA 1FSEA 2XV4S 2J5OA 3BJ6A 1MGTA 3DP7A 1B59A 2ZMEB 4XSXF 1I1GA 4LLGF 2EWNA 1BM9A 1LEAA 4KA4A 3HRUA 1CGPA 2FBHA 2DK8A 4OIQF 5CVUA 3R0AA 1KQ8A 1FY7A 4ZYHA 2CSOA 2PMUA 2OAZA 4ESJA 4CO8A 2XVCA 5E18F 2DI3A 4ESFA 5A2QK 4M72A 2HTJA 3WTXC 3M8EA 2IP2A 5KVRA 1KU2A 3N4MA 1OYYA 3FM3A 1Q1HA 3QP6A 4IJAA 4A6DA 1W5TA 4ENNA 1ZH5A 1JE8A 3MCZA 2QENA 1DDNA 2Q2EA 1CF7B 1LQ1A 2DPDA 1GXPA 3B73A 2EFWA 1QQIA 2ZNZA 2XAHA 4M9XA 3WTYC 2OU2A 2D1VA 4EQQA 4U0YA 3HHGA 5E1WA 4EGYA 1J0RA 3VFZA 2XRNA 2VT2A 2DLLA 2HOEA 2XAQA 1G3WA 1ON2A 3K1MA 1J2XA 4L5IA 5ICCA 1H0MA 2JT1A 3BZ6A 3LWFA 2CWEA 2D2WA 1YO5C 3L7WA 5DUKA 4JK1X 2QZ8A 2PN6A 3WTSC 2V9VA 2A6EF 1BN5A 2A3SA 3LSTA 2VC0A 3WODF 2BE5F 3JTGA 1UHWA 1R22A 3V7SA 3V7RA 1S29A 1MD0A 3H92A 2MC3A 4HX7A 4IHTA 1D5VA 1YG2A 1IUYA 4IRHA 4G7HF 3ZMTA 2HDCA 3T0YA 1HBXG 4G7ZF 4AD9A 1Z6TA 1ZGAA 1YLFA 3CJNA 3FM5A 3ZN0A 1OYWA 5ICFA 1P4XA 1PUEE 3ZMSA 4FT8A 4BHCA 2FMYA 5D8LB 3KP7A 1QNTA 3E6CC 1IZ1A 1TQIA 1PP7U 4B8XA 1XGMA 5CVRA 2L01A 5CVJA 5K5OA 1J7KA 2AXLA 3PFIA 5D5XB 2FQ3A 4ON0A 4OIOF 2BEOA 2EA2A 4GGGA 2ESHA 1KYWA 2JPBA 4I0AA 5KK1A 1Y0UA 5FD5A 5BMZA 2P7VB 2RV8A 1K78A 2RNJA 3GO5A 2ZFWA 3BWGA 1RZ4A 4EMSA 4RB3C 4MEXF 2GAUA 4U0WA 3C7JA 3GVAA 3QP5A 5TJJA 2OQGA 2HYGD 1YS6A 2NNNA 3I59B 1WQ2A 4HX4A 5ILSA 2HS5A 1R36A 2FXAA 1QO0D 4UVBA 2QQAA 2KRFA 1G3YA 2P6TA 2EFOA 3R4KA 3LAJA 1B4AA 4HV6A 4I7HA 3BY6A 4P96A 2MH2A 3CUQC 3RKWA 5ILVA 5JHUA 3CDHA 1W7PD 5AONA 5AIQA 3WE2A 2IA1A 4N9IA 2LSOA 4MGRA 2ESNA 1G6NA 3ECHA 4E70A 2VN2A 2Q8KA 5LLQA 2MLKA 3TQNA 3ULQB 2UWMA 5HLHA 3IKVA 2A6HF 4EM2A 4MEYF 1BI0A 3ABUA 3QPHA 4KIGA 1I27A 4ENJA 2ACJA 1REPC 4YFNF 4EM0B 4LLNA 5ICEA 2KIMA 3V8JA 2L4AA 4DNCA 2A5YB 2NRAC 4BYYA 4O3MA 2Z5UA 1G3TA 1Z91A 3J81Z 2OD5A 3EUHA 2QLZA 4IPAA 3ISPA 2GXBA 4XBFA 4Z2YA 4HAMA 4LK1F 2CQKA 4WK8F 5F1RA 5ED4A 3KE2A 1FYLA 1XSVA 4ESBA 3GZ6A 3W6JB 3KFWX 2EB7A 3JW4A 1U2WA 1SMTA 1TTYA 1QZZA 4U0VA 5E1ZB 2D45A 2NYXA 4TV7A 3I58A 4RB0A 2HZTA 1IN8A 3IRQA 4P9FA 4GYGA 5F64A 1D8KA 1VTNC 3BPVA 3D0SA 5AIPA 4XSZF 3WGHA 1DPRA 1IN7A 2DT5A 4HZFA 4L5JA 5HOOA 2KJBA 1QZYA 1HQCA 2CO5A 4IHSA 3QPTA 5LEJA 1XMKA 1O57A 1FZPB 4HOBA 2FBIA 3R6SA 4ZYEA 3SZTA 3E6BA 3IWZA 5ILUA 4EJUA 2E1CA 4KUMA 2HWVA 5FFZA 2QUFA 3ZPLA 1R23A 3SHFA 3CO7C 4EJVA 1LVAA 4BQAA 1MJAA 3U2RA 1BIAA 1KU7A 3FX3A 4I01A 3FMSA 4HX8A 3U1DA 3L09A 3HUGA 1FBSA 1HW1A 2LF7A 2A61A 4RS8A 3MQ0A 1BI1A 3EQLF 3KP5A 1RUOA 4EV0A 1ZAOA 2Z9OA 2PMHA 4ASNA 1MDMA 4KN4X 5LEKA 5DYMA 4CYDA 2VBWA 4M6YA 1U3EM 5F6FA 3OV8A 1ZG5A 4G6DA 4I98B 4Y17A 1OR7A 3P9CA 4XLPF 1ZRFA 3V8KA 3KLNA 2BV6A 2CGPA 1O7FA 1HKTA 5D4RA 2ELHA 4EGZA 1FSHA 5HDKA 2UXXA 3RTRA 3I54A 4Q5SF 3F8MA 5LGTA 1ZREA 4I02A 4A5MA 2O8XA 3LA3A 2MBFA 2ZJ2A 2E7XA 1USSA 5E8IA 2COMA 2XUBA 3E6MA 2EFQA 4A0ZA 1S7AA 4MQVA 4WCGA 3RYPA 3ZMDA 1V4RA 3IHUA 3NRVA 1TBXA 4HF1A 1H9TA 1X3UA 4AIKA 4BH9A 1S7OA 3TO9A 2QQBA 2STTA 4M71A 2IRFG 3GEZA 4HF2A 3RPQA 2XAJA 1FWZA 1R1UA 3K2ZA 1WSUA 1DPUA 4HQMA 2EFPA 1ULYA 3CTAA 3I71A 1AWCA 5ERIA 3TGNA 1R1VA 3E3VA 2VE9A 1QBJA 2GWRA 4OINF 3WTVC 2QBYB 4UUVA 1TNTA 4RAZA 4HV5A 3WU1B 1PDNC 1R58A 4U7DA 2MA3A 2P7CB 1XMAA 1ON1A 2ADUA 1IN6A 4Q47A 5DCMA 1OYIA 4RGRA 5E17F 3GFIA 2R3SA 5CYVA 4G7OF 2RGVA 1MJ9A 2VODA 5D5WB 4M9SA 2DPUA 3WTWC 3MFKA 4UNOA 3WU0A 1UFMA 2HGCA 3D5LA 3JSOA 1YW8A 1F5TA 2CFXA 4IF4A 3KLOA 1U6GA 2QBYA 2FRHA 1JGSA 1ZLJA 1XDSA 4JBAA 4LGWA 4UVCA 1FYKA 3WTZA 3K1NA 2ZO4A 2IA2A 5DCMB 3V8LA 2EK5A 2NS0A 1WRJA 4NB5A 5HLGA 1YQAA 4ENMA 1BI2A 4AIHA 2P6SA 1T39A 2VOOA 4L9JA 5DDGA 2RC4A 5FLXK 1SD4A 2CYYA 3IL2A 3DV8A 2A68F 3GFLA 3MWMA 4N9HA 2VOPA 4FX4A 3G73A 3DPLC 3F8FA 4KYWA 1BI3A 2H27A 1I6XA 3E97A 1HKQA 2X0LA 5H6RA 2UXNA 4RGSA 4LB6B 4UV8A 4BHPA 2VONA 4UXNA 1FP1D 1ZLKA 1A04A 1BC7C 3SFZA 3BROA 3GFJA 1BBYA 4M73A 1XDUA 4CXFA 4AWXB 3WTTC 3HOSA 2YX4A 5LGUA 2HKOA 3F8BA 2P4WA 3GW2A 2NNYA 1U78A 2FMLA 4F7ZA 5LHHA 1Z7UA 3J80K 2AS5F 3GF2A 2XAFA 3U9GA 4P55A 2PI0A 1LEBA 4A6EA 3Q9SA 2H09A 4EJOA 3WGIA 1KYZA 2XASA 2M87A 1IXCA 2R7DA 4LMYA 1B6AA 3SQNA 1HW5A 3M1EA 3JTHA 4WXDA 2LKPA 4WXCA 2VT3A 1R5HA 3QAHA 1U5TC 1TW3A 3K9TA 4Q4ZF 1SD6A 4BHBA 4Y13A 1C0WA 2DAOA 1YIOA 4IRIA 3WTUC 5H6QA 1FLIA 2Y48A 4ENKA 2WTEA 4H0EA 1B9MA 2W57A 1NHAA 3CUQB 1W4MA 5BPDA 2P5LC 3RKYA 3T5XA 3QRFF 2ZXJA 2P8TA 2ZNYA 3HOTA 1ODDA 1TQPA 2H6BA 3TOAA 3DFGA 1JHHA 3WGGA 2HYFA 2MD5A 1SD7A 2UZKA 4L0ZB 3FXUA 1JHFA 5CLSA 2M5WA 2C6YA 5BOXA 1KQ0A 1FC3A 3P7NA 3BPXA 1LJ9A 1KU3A 1R1TA 1MKMA 2ETHA 1ZG1A 1HXDA 5D5VB 1HKSA 1U5TA 4B09A 3RJPA 4OU0A 4OMZA 5LRSA 2D1HA 1GXQA 3HSEA 4GXOA 4HBLA 2R7FA 3F8CA 3ML6A 3EYYA 2PBIA 4ZH4F 1EH6A 3B02A 3WE3A 2OZUA 2VBYA 1P2FA 2Q0OA 3FF5A 3HIFA 2TDXA 1YYVA 1J59A 5D8KB 1FP2A 2L54A 3FXQA 5L3GA 1EH7A 4HW0A 4YFXF 4OIRF 2K4BA 1FX7A 3ROUA 5JI6A 1B9NA 5DUIA 4HDUA 2RQPA 1ZG3A 4R79A 4KMUX 4K2EA 2XAGA 2P5VA 3KP6A 4KFCA 3HYIA 5D6FA 1S6LA 3I64A 3R60A 4L9VA 3DEUA 3OOPA 1XGOA 3T8TA 2DBBA 2K7LA 3O6BB 1Z05A 1ZRCA 5FB2A 5HS8A 2XKPA 4LD5A 3HRSA 3IWFA 2GXGA 1MJBA 4M74A 3NEUA 1XGNA 1P4WA 2KIUA 3BOQA 3WG9A 3KP2A 3GYHX 2FNPA 3PQKA 4EJTA 4HDVA 3FHZA 5E20A 2HKXA 2IW5A 1LDJA 4L9NA 4L18B 1EH8A 1XCVA 4LLLA 4A0YA 3IRRA 1IAWA 3KZZA 1BOAA 2JRTA 3ZMVA 1LDKB 4DQ2A 1IN4A 3H3UA 1HW2A 5L3BA 1P6RA 4U88A 5LHGA 1D3YA 2J5PA 4RB1A 3LA7A 3GZ5A 5L3EA 3ZN1A 3Q5FA 4KMFA 3J7AO 5EEHA 1W5SA 2LDUA 3JAMK 5D4SA 4EM1A 3MEXA 3REOA 4OOIA 1O3QA 3VODA 2L02A 4O6JA 2RVCA 1TQMA 2QWWA 2QVOA 5J8CA 2OQRA 2VC1A 2WV0A 2IA0A 3VB2A 1JXSA 3K1PA 3TDUC 5BS6A 2GZWA 2FU4A 1HSJA 2V79A 1ZHFA 1Z1DA 1OMIA 1R7JA 2EV5A 3F23A 1LNWA 4S04A 4YIIA 4YIFA 1OPCA 3CUOA 3ABTA 3LQRA 5HS7A 2RN7A 2CW0F 1IXRC 4YG2F 6PAXA 3ECOA 5JFRA 1U8RA 3IKTA 3FWEA 4RAYA 4WWCA 5JVTA 5L3CA 1SFUA 2FOKA 1T38A 2WWYA 3HTUA 3FMRA 5J8FA 2FEZA 2JPCA 4HQEA 3HHHA 1XGSA 1GHCA 5IT9Z 3ZQ7A 4BNCA 3HRTA 5DD8A 1KU9A 5EEGA 2FE3A 4L0YB 3VOEA 2ZBKA 4I2OA 4KN7X 2XGXA 4OIPF 2QYOA 3DF8A 1SFXA 4KT5C 4LG0A 3SZPA 1FYMA 1K79A 1CF7A 2PEXA 1O3TA 3ELKA 4S05A 1J75A 5FLXZ 3KEOA 2DW4A 2DFIA 4QWQA 3JAMZ 3HTSB 3HRMA 2HEOA 4EVIA 5J6XA 2VBXA 2G9WA 5HDNA 1P4AA 4PCQA 4LG0B 1J5YA 2IVMA 4KNYA 2ZCWA 4KDPA 2O03A 1K6OA 1QPMA 3LAPA 2L4MA 1O3SA 3RIRA 3TO7A 2F5DA 1XCBA 1MZBA 1D8JA 2RKHA 2MLGA 1FBQA 4UVAA 3O2PE 5L3DA 1T6SA 5CVVA 5DEQA 4ZZLA 1F1ZA 3TOBA 1PP8F 2V6CA 2Y0MA 3F8NA 1T2KA 3TO6A 4N0BA 1USTA 5L3FA 1XSDA 3EETA 3SXYA 3ZMZA 1E2XA 2Z3YA 2A69F 1O3RA 3DPTA 1TNSA 2DTRA 2JSCA 3JSPA 1FOKA 3F22A 1UHMA 3PQJA 4A0XA 1G4DA 1KGSA 1BC8C 4IXAA 4G6QA 2HQNA 5HVQC 1IXSB 1WWXA 2E7WA 5TRDA 3GUDA 2K86A 2XIGA 4WF2A 3F6OA 3LFKA 3GXOA 2ISZA 3KP3A 2PLYA 2DU9A 1L3LA 5CVIA 5JR3A 4FHTA 2OBPA 3QU6A 3F21A 2V1DA 4G8XA 3MAJA 2YPRA 1UB9A 1ZRDA 3FMQA 3M7GA 4XLNF 1RUNA 3V4GA 2GIVA 4XRFA 5HDGA 1YTYA 1IW7F 1GVJA 3DQVC 2DQLA 1H9GA 3F3XA 1YS7A 4MHGA 1YW9A 2HFHA 4BAYA 4ZYDA 4I0BA 4A5NA 4R8HA 1XSXA 2W84A 1K78B 4UHTA 4CDGA 4HA8A 4KIBA 4P9UA 2XHKA 2O6GE 4GO1A 5FGMA 4CICA 3I59A 1HSTA 5LBQA 4D0PA 3CLOA 2GQQA 2V1XA 3H3ZA 1FNNA 2STWA 1F4KA 4M9ZA 2H6CA 3T8RA 3AAFA 2M45A 2VE8A 1LB2A 1ZGJA 1TLHB 4HLYA 3EDPA 2EA4A 2IT0A 1O7LA 3BP8A 5D6EA 1BIBA 2X4HA 3RI4A 5A2QZ 2QQ9A 2LF8A 2WC2A 3I5UA 5K1YA 1B1BA 3GLXA 5LGNA 2E1NA 5DD4A 4MQ9F 5H20A 3RDIA 1P92A 2Z33A 4RGXA 2K27A 2JZYA 3DXJF 1DUXC 2F5EA 2KJCA 1IN5A 2G7UA 3RYRA 3MZYA 2RDPA 3RPUA 1BJAA 4LJZF 2DO7A 2L3DA 2GA2A 5E8GA 5BQTA 4LFUA 3COAC 2CG4A 4MNUA 3G3ZA 3V7CA 1T0FA 1KA8A 2M1BA 3F72A 3GX4X 1F9NA 3M8FA 1OKRA 3S2WA 2FF4A 2HTSA 5HS9A 4P5OA 4GCVA 2EFNA 1SAXA 2PQ8A 2IJLA 5BPIA 2O0YA 1KQ9A 3P9IA 4JQFA 2FSWA 1R00A 4UV9A 1W7PA 4CZZA 2BGCA 4OMYA 2Y75A 1WKMA 1S3JA 4PGGA 1EV7A 3Q9VA 2BYVE 1T98A 1IRFA 3LA2A 3E5UA 1QGPA 2DQRA 4HLXA 1FBUA 3C1DA 2ZKZA 3GFMA 2KIFA 2FNAA 3L2CA 2EJRA 5FO5A 2IPQX 1W7PB 3E6DA 1IRGA 1UCRA 2K4JA 1FT9A 4MTEA 4O5VA 2EV0A 1XN7A 4MTDA 5LRRA 3IC7A 3FZVA 2M30A 3CUQA 3T1BA 3TKYA 5K5RA 1SFEA 2W85A 1ZN2A 1RI7A 4HF0A 1I5ZA 4WXHA 1S8NA 1DP7P 4M6XA 3L9FA 1ZYRF 3ZP5A 1SD5A 1MDMB 4PZJA 3MZHA 1RNLA 3CO6C 3ZMUA 1E17A 2LNBA 3NQOA 3E5XA 4QLCU 4A12A 2NAZA 3LQQA 4YFKF 1K7AA 2OA4A 3TDZC 3N97A 3BJAA 2KKOA 1YW7A 5CJ9A 3M9AA 2G7HA 1U5TB 3I53A 3KP4A 2VXZA 3I4PA 1WI9A 4GYIA 5HLIA 2YSRA 4R1HA 4AVPA 2XROA 2Z99A 5FD6A
chains in the Genus database with same CATH superfamily
4EJWA 2I5UA 4BQNA 2O61A 1JI8A 3RKXA 1P9QC 5KCMA 3FXRA 2X85A 3KIOA 4NC6A 3QU3A 2A07F 1FTZA 4B47A 1YFHA 2DK5A 3G71I 1WI3A 2KZGA 4Q48A 4D9JA 1B72B 5DV5A 2YX7A 4A2UA 2QM3A 1R5GA 3R61A 1VI0A 3GWZA 4H4KC 1FPQA 2LBFB 1HF0A 5IT9K 3K4KA 4DOZA 1STZA 1LDDA 2MH9A 4HYEA 4XQFA 1I1SA 1WJEA 2DJNA 2LK2A 2KRCA 2DA2A 5FFXA 3UKGA 2VL8A 4BXUA 4RB2C 1IF1A 2F2EA 2YR2A 1Z9CA 2K02A 4LK0F 3J81K 3FXKA 3E5QA 4Y15A 4G9YA 3GTJJ 4PUSA 2KQRA 2R7TA 4NQWB 3K0LA 4G6TB 2GA1A 4G12A 5K5QA 3J80Z 1SVLA 4FX0A 3L2UA 2HVRA 2KT0A 1WH5A 1NG7A 3L1PA 2LRDA 5EGOA 5IT3A 2W82A 3ERMA 3I3LA 2XGEA 4ZZDA 2M8EA 5E1XA 4ETSA 2FBKA 5CQGA 1XB4A 1D0XA 4KISA 4Y7NJ 3K69A 4NHJA 3LOCA 2HPIA 2P5KA 5F0CA 4RBOA 5KAFC 4W97A 2ISYA 2VJ4A 2EV6A 2W24A 2XB0X 4I09A 2HQRA 3HSFA 2KL4A 2H1KA 3O3KA 1YIJI 4RGUA 4PDKA 3FKJA 3BTIA 1A35A 3C18A 2PG4A 1G8XA 5ICGA 1RIOH 1ZARA 1SMYF 4CCNA 2DN0A 4NQWA 4C3IJ 1V3FA 3KCCA 4J01A 4RDUA 3I0TA 4JP0A 5DCFA 3EYIA 1JUPA 1MH4A 4BS9A 1X3WB 3KEQA 1TL8A 1MIJA 2UUZA 1L0OC 3W2VA 2B63J 2HR3A 4M3DA 4HEA2 4IVNA 4CCJA 4AIJA 2CU7A 3P9KA 3KETA 1X19A 3H5RA 2PFBA 4AM3A 3ERED 2LYCA 2FUG2 4A3KJ 2NS8A 4XLFA 2VIXA 2GBYA 4IQ4A 5LHIA 2VPRA 3ZGKA 5TISC 2UV1A 4A3FJ 4CGZA 2R7WA 4L9TA 5TGTA 1X58A 3HJEA 2WADA 5B5EC 5C4JJ 4KJZA 1M1EB 3PL8A 4CHUA 2CMPA 1RR7A 5JLWA 4BL0B 2MD0A 3PO3J 4ZYGA 1OCRH 3LSMA 5D5UB 4WX9A 1J9IA 2OC6A 2FA5A 3QOPA 3R0JA 2JA5J 1Z6RA 3C3WA 2H94A 3HSRA 2JTVA 4KIFA 3MMYB 4LG3A 4I76A 4IRGA 2HPMA 2B0LA 1ONVA 4U7BA 4KICA 3BJOA 2PJPA 3G1LA 2R7VA 2V1UA 1G3SA 3L00A 1XD7A 3BDDA 5E3OA 2ZMEA 1XTAA 4LB5A 2F5FA 2MFZA 2XAUA 4MIMA 3VEPA 1RR8C 4AIDA 2O3FA 3DLLF 2CQNA 1TW2A 1I3AA 4G94A 2VQGA 1DP3A 3W6KB 2BXYA 4AUXA 2QKMB 1PUFB 1AOYA 2BBYA 3OYMA 5FROA 4F93B 1WFXA 2YU3A 2VBZA 2F5CA 2W25A 1LFUP 3CC7I 2KDOA 2VJIA 3DKWA 4PGHA 3K7AJ 5HODA 3CC2I 1Q1VA 4M3FA 3F6VA 4IHWA 3GCMA 2OZ6A 5FLVA 3K4CA 2XKOA 3U21A 3KPHA 3KZYA 1MMAA 4A3DJ 1FSEA 2XV4S 2L9VA 2J5OA 3BR2A 4A3BJ 3BJ6A 3MD2A 1MGTA 3DP7A 1JTXA 1B59A 5F0FA 2ZMEB 4D1QA 4XSXF 1I1GA 4LLGF 4OAYA 2EWNA 1BM9A 1LEAA 4KA4A 3HRUA 1CGPA 2FBHA 2FQ4A 2DK8A 4OIQF 5CVUA 4YRVA 3R0AA 1KQ8A 1O4XA 4AYBA 1PUFA 1FY7A 4Y33A 2EZHA 3J7YJ 1VQ8I 2X1EA 3TP3A 2EINH 1SAUA 4ZYHA 2CSOA 2PMUA 3AG3H 2OAZA 4ESJA 3SEQA 4CO8A 2XVCA 2A5WA 3ZOBA 3OS0A 1HDDC 5E18F 4LIUA 3Q0VA 2DI3A 2QGUA 4ESFA 2VJ5A 5IP7J 1PVEA 5A2QK 4M72A 3VDXA 3I4MJ 2HTJA 5E3LA 1EKEA 1TWFJ 3WTXC 3M8EA 2IP2A 5KVRA 1KU2A 4PJJA 1H88C 3N4MA 1OYYA 3FM3A 4UB8C 1Q1HA 3QP6A 5IOYA 4IJAA 2V7FA 4A6DA 1W5TA 1MNDA 4A69C 4ENNA 3OYGA 1ZH5A 5M5YJ 2LKXA 1JE8A 2NVYJ 3MCZA 2QENA 4XLCA 2EIKH 2LREA 1DDNA 2Q2EA 3RZOJ 1CF7B 1LQ1A 2DPDA 1GXPA 2LMDA 3B73A 2EFWA 1QQIA 3QOEA 1IRZA 4MFEA 2ZNZA 4IHYA 2XAHA 1TWAJ 1I3QJ 3HXLA 4M9XA 4PJNA 4F92B 3WTYC 2OU2A 1W1WE 2D1VA 2X6WA 4EQQA 2W00A 2Z2SB 4U0YA 3HHGA 5J1RA 1OISA 5E1WA 3IH4A 1DGWY 4EGYA 4E6KG 1J0RA 3VFZA 1IV8A 1YX5A 3S1QJ 3DLAA 3FXLA 2XRNA 2VT2A 1DU6A 3E7LA 4BJ6C 2DLLA 1IDZA 2HOEA 2XAQA 3PNTA 1G3WA 4JOMA 2VI6A 1ON2A 3A03A 1SANA 3ASNH 1B8IB 2Q2EB 3K1MA 1BA5A 2V9PA 3M1CA 1J2XA 2M3AA 3HB9A 4L5IA 3PUBA 5ICCA 1H0MA 4E7JA 2JT1A 1LUJB 3BZ6A 3LWFA 3D5RC 4CA0A 2CWEA 5F0HA 2X6OA 2DDAA 4EATA 3S1RJ 2D2WA 1YO5C 2X6XA 3GTMJ 3L7WA 5DUKA 4JK1X 2QZ8A 2PN6A 4NC8A 1S7EA 3WTSC 3JREA 3OYCA 1YRNA 1VQ6I 2V9VA 2A6EF 1BN5A 2A3SA 3LSTA 2VC0A 4E7HA 3WODF 4ABZA 2BE5F 3JTGA 1UHWA 3B6AA 4OWRB 1R22A 3H5NA 3V7SA 3FXJA 3V7RA 1S29A 2R7UA 3RPUD 1MD0A 3HPGA 3H92A 2IGOA 3OSGA 2MC3A 5E3NA 4RM3A 4HX7A 1K61A 4IHTA 1D5VA 1YG2A 4XN3A 4ZYAA 1MH3A 1S9HA 1IUYA 4IRHA 2Q1ZB 3A01A 3LNQA 2CS3A 3PUFA 5B3SH 4G7HF 3G1MA 3ZMTA 2V26A 2D5VA 2HDCA 1X3ZB 3T0YA 3QYEA 3IUOA 1HBXG 4G7ZF 4AD9A 3AKZA 1Z6TA 1ZGAA 5F1JA 1YLFA 3CJNA 3FM5A 3J7ZI 5GTHC 3ZN0A 3S15J 1OYWA 5ICFA 1P4XA 3OYBA 1PUEE 3ZMSA 4FT8A 1LVKA 2VJJA 3DTIA 3UNGC 2LY2A 4FETA 4BHCA 2FMYA 1MNEA 5D8LB 3KP7A 1QNTA 3CZ6A 3PIPF 3E6CC 1IZ1A 4AVZA 1TQIA 1D0YA 1PP7U 2XPVA 4B8XA 3EUHC 1XGMA 5CVRA 2HQ5A 2L01A 2QF7A 5CVJA 3MVPA 5K5OA 1G2HA 1J7KA 3F0CA 2AXLA 3LSRA 3HL2A 2K5CA 3PFIA 5D5XB 2FQ3A 2H8WA 1WJAA 4ON0A 4OIOF 2YUSA 1A6IA 5J47A 2BEOA 2EA2A 4GGGA 2JUCA 2ESHA 2KIQA 2CQQA 1KYWA 4XKBA 1D1BA 4C9YA 2JPBA 3CCQI 4I0AA 3CCLI 5KK1A 3BR5A 2ZMEC 3CF5F 1Y0UA 2VASA 4FQGA 5FD5A 1IG7A 1VQ5I 2CUZA 5BMZA 3FDYA 4BQOA 1QA6A 2P7VB 2XC7A 2RV8A 2X51A 5LFAA 1K78A 2RNJA 1FMVA 2OUMA 5GTIC 5EDNA 3GO5A 2ZFWA 3BWGA 1BR2A 4JX6A 1RZ4A 4EMSA 4RB3C 3CMEI 2GAUA 4MEXF 4U0WA 2JA6J 2JA2A 2L9NA 3C7JA 4XKCA 4D7MA 3OOUA 5HLTA 1JKQC 3GVAA 3QP5A 5TJJA 2OQGA 3GLLA 2HYGD 5EEAA 3IP4B 1OCZH 1MSFC 1YS6A 2NNNA 3I59B 2XGCA 1Z3YA 3CCYA 1WQ2A 4ITVA 4HX4A 5ILSA 3JRIA 2DODA 2HS5A 4HNUA 1R36A 3CLQA 2FXAA 2ECBA 1HA8A 1QO0D 4UVBA 2QQAA 2KRFA 1AHDP 1G3YA 2P6TA 2EFOA 3R4KA 3LAJA 3QQAA 1UG2A 1B4AA 2DMPA 3H1CA 1YHQI 4HV6A 4I7HA 3BY6A 4P96A 2MH2A 3CUQC 3RKWA 2L2OA 4LIVA 3V42A 5ILVA 3E1SA 5JHUA 4AYBN 2BY0A 3QPLA 3CDHA 3AL0C 1W7PD 2CUFA 5F08A 5GAHJ 1N77A 5AONA 5IYCJ 3FISA 5AIQA 3CP2A 3WE2A 2IA1A 3OY9A 2MGQA 4JX5A 2DMTA 4N9IA 3AG1H 2LSOA 3BTJA 4DZPA 1A5JA 4V19K 4MGRA 2ESNA 1G6NA 3ECHA 4E70A 2VN2A 1IV6A 2LOOA 4Y3OA 2Q8KA 5LLQA 4CCLA 2MLKA 3TQNA 3ULQB 2UWMA 3CCMI 5HLHA 3IKVA 2A6HF 2CFOA 2XF7A 2XGDA 4MEYF 4EM2A 1IC8A 5KHDA 2ZXWH 4B3XA 1BI0A 2X9DA 3ABUA 3CCJI 3QPHA 4KIGA 5FJ8J 1I27A 4ENJA 3GBGA 2ACJA 4A3CJ 2VXDA 1REPC 4YFNF 4EM0B 4PFOA 4LLNA 5ICEA 5KAIC 2KIMA 3V8JA 5CQEA 2L4AA 4DNCA 4XL9A 2A5YB 5K7HA 2NRAC 4BYYA 2E5NA 3OYKA 2Z5UA 4O3MA 1G3TA 2B7EA 3H9GA 4HRIA 4XR6A 1Z91A 5EZGA 5J4VA 1GLNA 3J81Z 1LKXA 2OD5A 3EUHA 2QLZA 2CV2A 4IPAA 3ISPA 3D5SC 2GXBA 4XBFA 4IL6C 4Z2YA 4HAMA 2OTJI 4BGDA 5IP6A 4LK1F 2WBMA 2CQKA 4WK8F 5F1RA 5DM7F 5ED4A 3KE2A 4BDYA 1FYLA 1XSVA 4E7IA 2R7QA 4ESBA 3GZ6A 3W6JB 3KFWX 2EB7A 4N4OB 2BW3B 1HDPA 1JGGA 3JW4A 1U2WA 1SMTA 1TTYA 3SDBA 1QZZA 3LSGA 3HKZN 4U0VA 2DA4A 4CCKA 5E1ZB 4XKWA 2D45A 4XONA 3OYIA 4XK4A 2NYXA 4TV7A 1JJ6C 3MKZA 2FD5A 2ZC2A 3I58A 4C30A 3GTOJ 4RB0A 5F04A 2HZTA 2VB6A 3KZIC 1IN8A 3IRQA 1ETKA 4P9FA 4GYGA 5F64A 1D8KA 1IO2A 1RKTA 2LH9A 1VTNC 3FIWA 3BPVA 2R5YB 3D0SA 3TW6A 5AIPA 2NOJB 4XSZF 2R4GA 3WGHA 1DPRA 3BC8A 4GFBA 1IN7A 2DT5A 3NWTA 1S5LC 1K4SA 4XLHA 4HZFA 2LD5A 4L5JA 2LY1A 1VFCA 1BJZA 2EZLA 2XPWA 4HSTA 5HOOA 1P7IA 1UZCA 1X4OA 2KJBA 4DYQA 3DBRB 2BW3A 1QZYA 4A3EJ 4RAGA 1HQCA 2CO5A 4IHSA 3QPTA 2X6YA 4MLOA 2E19A 5LEJA 1WPKA 2VPLA 1XMKA 2P81A 4B48A 1F36A 1O57A 1FZPB 2KMUA 4HOBA 2FBIA 3BTLA 3R6SA 1MMSA 4ZYEA 3GTGJ 2ID3A 2M4KA 3SZTA 1TP4A 3E6BA 3IWZA 3Q3SA 4EJUA 5ILUA 1I50J 3S2HJ 2E1CA 4IHVA 4KUMA 2HWVA 2EIMH 5FFZA 2BVLA 2QUFA 2BHYA 3HDDA 3ZPLA 2ELKA 5GP9A 1R23A 3SHFA 3ABMH 3CO7C 1OCTC 2KP6A 4EJVA 1LVAA 4BQAA 3TW7A 3JRBA 2Y31A 2IGKA 1MJAA 3U2RA 3HOYJ 1BIAA 3W6VA 1KU7A 3G4SI 3FX3A 2BY2A 4I01A 4BACA 3FMSA 1TWCJ 2DCEA 4HX8A 3U1DA 2TCTA 3A02A 4RLFA 2JN6A 3L09A 3HUGA 2VKEA 1FBSA 2CJJA 4HPQA 4JYKA 1HW1A 2XF5A 2LF7A 2A61A 1MNMC 3LSPA 2E2JJ 4RS8A 3BQYA 3MQ0A 1BI1A 1JTYA 2PMZA 3EQLF 3KP5A 1RUOA 3BG7A 3HC7A 3HBLA 4EV0A 1ZAOA 3S8PA 2Z9OA 2PMHA 3JRCA 4ASNA 1MDMA 2E35A 2Y30A 3NWSA 4KN4X 5LEKA 5DYMA 4CYDA 3M3YJ 1E0EA 5JLXA 2VBWA 2ZSHB 4M6YA 1U3EM 3NAUA 2HXIA 5F6FA 3OV8A 2WY7Q 1ZG5A 4G6DA 1X2MA 4I98B 4Y17A 1OR7A 1YI2I 1Z67A 3P9CA 2XDVA 4XLPF 3CMAI 1ZRFA 1WJDA 3V8KA 1UAAA 2QKLB 2JUGA 3C2HA 2WAQN 4PSXA 2GOXB 3A1YA 3VWBA 1ETYA 2EBIA 3KLNA 4RAFA 2BV6A 4CUGA 2CGPA 1O7FA 1HKTA 4DZJA 5D4RA 2ELHA 1OCPA 3SEZA 3WU2C 4EGZA 4DBQA 1U8BA 1FSHA 5EZHA 1YJWI 5HDKA 2LVSA 3ESWB 2UXXA 4ANJA 3RTRA 1EJ9A 2DA5A 3I54A 4Q5SF 3F8MA 5LGTA 5K7FA 1ZREA 4B3AA 4I02A 2EPFA 2O8XA 2EZIA 4A5MA 2O5RA 3LA3A 2OCEA 4UB6C 2MBFA 2ZJ2A 2E7XA 2FJ1A 3FKIJ 3DEWA 1USSA 5E8IA 2COMA 3ZQFA 2XUBA 4B43A 3E6MA 4XRSA 2VQLA 3W2AA 2EFQA 4A0ZA 2R5ZA 1S7AA 4MQVA 4WCGA 3RYPA 1QZEA 3ZMDA 1V4RA 1YOVB 3IHUA 3NRVA 1TBXA 4HF1A 4BKXA 1H9TA 2BY3A 1X3UA 2E1MB 4AIKA 4BH9A 2ZSIB 3LSHA 2ECCA 4UUSA 1F43A 1S7OA 3TO9A 2QQBA 2LTPA 2STTA 2DYRH 2DA6A 3NARA 2HYJA 4M71A 4XRSG 2IRFG 1R49A 3GEZA 1ZR4A 4HF2A 3RPQA 2XAJA 1FWZA 1R1UA 1X1CA 3K2ZA 5GAGJ 1WSUA 1DPUA 2K9QA 2DA7A 4HQMA 2EFPA 3J7AY 1ULYA 1MMDA 3CTAA 2QEXI 2R0QC 3I71A 2COBA 3D1NI 1AWCA 5ERIA 3TGNA 1VQ9I 1R1VA 3E3VA 3FXOA 2VE9A 3CJQB 1QBJA 2GWRA 4BUPA 4OINF 3WTVC 1SC7A 2QBYB 9ANTA 4UUVA 4E7ZA 1TNTA 3W3CA 4RAZA 4HV5A 3FK7A 3PNYA 4XKVA 2LKSA 3WU1B 4PSWA 1D1CA 1PDNC 4C2TA 2R93J 1EA3A 1R58A 4U7DA 2MA3A 2P7CB 1E3HA 1XMAA 1ON1A 2ADUA 3G1OA 1IN6A 4YELA 4UUSB 4Q47A 5DCMA 3BCBA 2KDZA 1APLC 3B6CA 3Q0UA 1OYIA 4RGRA 1XC5A 2ME0A 5E17F 1T56A 3GFIA 2HDDA 1TT0A 2JA7J 2R3SA 3BCAA 5CYVA 4XN0A 4G7OF 4Y52J 1ORKA 1SVOA 2RGVA 4BDZA 1MJ9A 3K6GA 2VODA 5D5WB 2WAEA 3OSFA 4M9SA 2DPUA 2P0WA 3BG5A 3WTWC 3OS1A 2JSPA 3MFKA 4UNOA 1W36D 3WU0A 4M3BA 1UFMA 2IGMA 3RZDJ 2HGCA 3D5LA 3JSOA 2ZJPF 1YW8A 1F5TA 2CFXA 4IF4A 3HOXJ 3BTCA 3KLOA 3CCUI 1U6GA 4BE2A 2QBYA 3KYLA 2FRHA 2Y9YA 1GV5A 3EUAA 1JGSA 1ZLJA 1XDSA 4JBAA 4LGWA 1JJ8C 1N25A 4UVCA 1FYKA 2EIJH 3WTZA 1OJLA 4NUBA 1SFOJ 3CDLA 3K1NA 2ZO4A 2IA2A 2DA1A 3BR1A 3CCVI 1D1AA 4IZZA 2HOAA 5DCMB 3V8LA 2EK5A 2LFBA 3CDIA 3LL7A 2NS0A 1V55H 3KEYA 1WRJA 4NB5A 5HLGA 2DDBA 2R7RA 1YQAA 4ENMA 3GTKJ 1BI2A 2G0EA 5FKOA 4AIHA 3DU5A 2P6SA 1T39A 2VOOA 3M8JA 4L9JA 4OAZA 1VQOI 5DDGA 1FJLA 1W5CC 2K3FA 1QHGA 2RC4A 2L0KA 5FLXK 2QSHX 1SD4A 2E5ZA 2V9KA 2CYYA 3IL2A 4E7LA 3DV8A 2A68F 2Y2ZA 2K40A 4EEFG 3GFLA 3MWMA 4XLEA 4N9HA 2HOTA 4FX4A 2VOPA 3G73A 1XS9A 3KYDB 2VQCA 3DPLC 3F8FA 3CC4I 4KYWA 1BI3A 4II3A 5GPAA 5H2FC 2H27A 1I6XA 3E97A 5B1BH 1HKQA 2X0LA 5H6RA 2UXNA 4RGSA 4LB6B 3ZQIA 1FOYA 4A93J 4UV8A 1AKHB 4BHPA 2R7XA 2VONA 1QVTA 1N75A 4UXNA 1TWHJ 4F55A 2IXSA 1FP1D 4BQQA 1ZLKA 2NS7A 2VUMJ 1A04A 3GZNB 4BJTA 2CV1A 2XF6A 3P5JA 1BC7C 3SFZA 2DXIA 3BROA 3GFJA 3KYCB 1BBYA 4M73A 1XDUA 2DJIA 4CXFA 4AWXB 1Z0XA 5GADJ 3WTTC 2JJ7A 3SYTA 3HOSA 1V5EA 4CCOA 3I4NJ 2YX4A 5E79C 2K3PA 5LGUA 2FOWA 2HKOA 2L5QA 3F8BA 2P4WA 3GW2A 2NNYA 1U78A 1FEXA 3RQIA 2KLOA 3MKWB 2FMLA 4F7ZA 5LHHA 1Z7UA 2NVXJ 1Y6IA 2F6CA 3J80K 2VKHA 2O8KA 2EILH 3OMYA 2AS5F 3GF2A 1K83J 2XAFA 3K4NA 3U9GA 4P55A 4BEHB 2PI0A 2K9LA 1LEBA 4PFPA 4KITB 4A6EA 3Q9SA 5C3EJ 3AFHA 2DOAA 3CP8A 3S32A 2H09A 4EJOA 3WGIA 1KYZA 2CUEA 3A4CA 2WA0A 2XASA 2M87A 1IXCA 2R7DA 3BG6A 3JCUC 2ZFUA 1ZK8A 4LMYA 2M8GX 2N8GA 4AC0A 1B6AA 3SQNA 1HW5A 1QHHD 3M1EA 3JTHA 4C3HJ 4WXDA 1MBGA 2LKPA 2MABA 3DTKA 2EQRA 4WXCA 2VT3A 1JT0A 1R5ID 1R5HA 3QAHA 1U5TC 1TW3A 2YU9J 2E36A 4P1WA 3K9TA 2LG4A 4D5FA 4Q4ZF 4GDFA 4RA2A 1SD6A 4BHBA 4Y13A 1C0WA 1E3PA 4XORA 2DAOA 1YIOA 2NVTJ 2ZB9A 4IRIA 1JKPC 3SZGA 3WTUC 3IAM2 2XB5A 3JRDA 3PIOF 2GOMA 4CZCA 3EUKL 4ZTFA 2L7MP 5H6QA 1ENHA 1FLIA 2Y48A 4ENKA 3GMEA 2WTEA 4H0EA 1A31A 3S3MA 1B9MA 2W57A 1NHAA 2E71A 1B8IA 3CUQB 1W4MA 5BPDA 2FX0A 2P5LC 2JMWA 3RKYA 1HOMA 3DBHB 3T5XA 3QRFF 2ZXJA 2P8TA 4IX7A 1GV2A 2ZNYA 1A36A 3HOTA 1BR1A 2M0MA 2NOGA 1VQLI 1ODDA 1TQPA 2H6BA 3TOAA 3DFGA 1JHHA 2RREA 3WGGA 2HYFA 2MD5A 1K6YA 1SD7A 2UZKA 4L0ZB 3FXUA 4QPQA 1JHFA 1VZ0A 2M5WA 3AG4H 5CLSA 2C6YA 1IRXA 2L7ZA 1YJNI 2XSJC 4A3MJ 5BOXA 1KQ0A 2MYSA 3LSIA 1FC3A 5EJCA 3P7NA 3U1KA 2DMQA 3BPXA 3E0JB 2LLKA 2JRMA 1LJ9A 4RM2A 4IHXA 2WB1A 3HGGA 2EH3A 4NNJA 4C2MJ 2MSYA 1WJFA 3RQ4A 1NK3P 1KU3A 1SVMA 1R1TA 1MKMA 2M34A 4C3JJ 3BZCA 1Z3XA 3TMOA 4UUTA 5JVGF 2ETHA 2CQ7A 2DFFA 1ZG1A 1UJ8A 1HXDA 3RSNA 3X2QH 5D5VB 3G6EI 2OPTA 3DBLB 1MMNA 3ASOH 4DGWB 1HKSA 3DWLE 2R7SA 4A3LJ 1U5TA 2Y0SN 4B09A 5F27A 3RJPA 4OU0A 4OMZA 4PK4A 1X1BA 5LRSA 3H35A 5BNGA 2D1HA 2Z1DA 3S14J 4BBSJ 3JRFA 3WHCA 1GXQA 3HSEA 4GXOA 4HBLA 2HDWA 2R7FA 3F8CA 1OFCX 3ML6A 1POGA 3EYYA 4V2FA 5EF6A 3CD6I 2PBIA 4ZH4F 1EH6A 3B02A 2DT7B 3WE3A 1T8IA 4FISA 2OZUA 2VBYA 1P2FA 3I55I 3L2QA 2Q0OA 3FF5A 3M07A 3HIFA 3L2VA 2TDXA 1YYVA 1RPWA 1J59A 5D8KB 1FP2A 1Z7LA 2L54A 1XMXA 3FXQA 3ZXSA 3GTQJ 4BXXJ 3VYRB 3ZQLA 1WCMJ 5L3GA 1EH7A 4XICA 4HW0A 4PJMA 3ZQCA 1Y1VJ 1LPQA 4YFXF 1B72A 4OIRF 2K4BA 1Y8RB 1FX7A 2W1OA 3ROUA 5JI6A 4DYRA 1B9NA 3K2AA 2DA3A 2LBFA 5DUIA 4Y4RA 4HDUA 2RQPA 1ETQA 1ZG3A 4R79A 4KMUX 2NVQJ 4K2EA 2XAGA 2DOFA 2P5VA 3KP6A 5M5XJ 4KFCA 3HYIA 5D6FA 1S6LA 3GTPJ 3I64A 3R60A 4L9VA 3DEUA 3OOPA 1XGOA 3T8TA 1W0UA 1N78A 3PSIA 2DBBA 2K7LA 2LC2A 1Z05A 3O6BB 1ZRCA 5FB2A 3OR1C 2H1LA 1MBJA 5HS8A 2XKPA 4LD5A 1U9OA 2NVUB 2KHMA 2DMUA 1V5GA 2F4IA 1U9NA 3HRSA 3IWFA 2GXGA 1MJBA 4A3GJ 5EGOB 4M74A 2HU9A 3NEUA 1XGNA 1P4WA 1VNDA 2KIUA 3BOQA 4QPOA 2GIZA 3WG9A 5B66C 1VQ4I 2DTZA 4C2UA 3KP2A 4BY1J 3GYHX 4E7KA 4HNVA 4X1EA 2FNPA 3H36A 3PQKA 4EJTA 4HDVA 1XG1A 3OYDA 3IV5A 3FHZA 5E20A 2HKXA 3VYSB 2V6EA 3DKYA 3FBNB 1QRYA 1T33A 2IW5A 3W2WA 1LDJA 4PJLA 4L9NA 4L18B 1EH8A 1XCVA 4LLLA 4A0YA 1FMWA 3IRRA 1IAWA 3KZZA 1BOAA 3CJTB 1LE8B 2JRTA 3ZMVA 1LDKB 2DYSH 4DQ2A 2JVHA 3H3UA 1IN4A 2XSDC 3A0HC 1HW2A 1V5FA 4LOCA 2JA8J 5L3BA 1P6RA 4U88A 5LHGA 3JRHA 2OJED 2E1OA 3JRGA 4B4CA 1D3YA 2J5PA 3HG9A 3VSKA 2W7NA 4RB1A 3LA7A 3GZ5A 5L3EA 2K85A 3ZN1A 4GRIA 4FE7A 1ZTRA 3H0GJ 3Q5FA 4KMFA 3J7AO 3HZJA 3OYFA 1JUSA 2Z16A 5EEHA 1S72I 1ZGWA 1OLTA 2M7BA 1W5SA 2LDUA 3JAMK 3PFYA 3TL4X 1GUUA 5D4SA 4EM1A 3MEXA 3SDGA 1V54H 3REOA 2CW8A 4OOIA 3OS2A 1GDTA 3OIPA 5J3LA 3UR3C 1LE8A 1O3QA 3QPSA 3O8GA 2K9MA 3KX2A 4V2GA 3VODA 1KONA 2L02A 2EZKA 1YITI 4O6JA 1ZQ3P 1TZLA 2RVCA 1TQMA 1FIAA 1ETXA 2F4OB 4I6ZA 1X2NA 1FOXA 3EPZA 4ZDOA 4BJ5C 1BW5A 2GXAA 2QWWA 2QVOA 2DFEA 5J8CA 2OQRA 4YEJA 2VC1A 2WV0A 2L7FP 4N4NB 1PJRA 2IA0A 3VB2A 3H0DA 2KFDA 1JXSA 3K1PA 3TDUC 5BS6A 3O8HA 2GZWA 5E3MA 4E4HA 1QVUA 2FU4A 4RMNA 1HSJA 2AO9A 2F4MB 2V79A 3CF2A 1ZHFA 1Z1DA 1G59A 4A3IJ 1OMIA 1R7JA 2F5VA 2EV5A 1HC8A 1ETVA 2OTLI 3F23A 1LNWA 4S04A 4YIIA 3A0BC 4YIFA 1OPCA 1FIPA 3CUOA 4XIDA 3DCFA 5B1AH 3ABTA 3LQRA 5HS7A 2RN7A 2CW0F 4CSWA 5KNLA 1IXRC 2WY8Q 3JRAA 3ONQA 3QYFA 4YG2F 6PAXA 3ECOA 5JFRA 1VQ7I 1U8RA 3IKTA 2IS6A 2QSGX 3FWEA 1WJCA 4RAYA 4WWCA 3Q0WA 5JVTA 5L3CA 1SFUA 2FOKA 4QTRA 1Y0NA 2ID6A 1T38A 2WWYA 1QPIA 3HTUA 1MBEA 3FMRA 5J8FA 2FEZA 2KZVA 3AG2H 3C2GA 2JPCA 4NBQA 4BXFA 3CCSI 4HQEA 5LD2C 3PSFA 2R5YA 2Y9ZA 3HHHA 1XGSA 1JKOC 1GHCA 2E1MC 3BR3A 5FKLA 4A3JJ 5IT9Z 3ZQ7A 2ME6A 4ZJZA 4BNCA 1JUMA 1SEUA 3DU6A 1XX5A 3HRTA 1WJ5A 4D5CA 5DD8A 1KU9A 2M7AA 5EEGA 3HOVJ 4S0HB 2FE3A 3QODA 4L0YB 3VOEA 2ZBKA 4I2OA 4KN7X 2XGXA 4OIPF 2IAIA 2QYOA 3DF8A 1SFXA 5JHFA 1WGXA 2KPMA 3OR2C 2GM4A 3OIQA 1VQKI 4DJAA 2BVMA 3ABKH 1BOBA 3FHNA 4KT5C 4LG0A 3ZR8X 1K4TA 3SZPA 1FYMA 1K79A 2AHQA 2LR8A 3BG9A 2HOSA 1CF7A 2VKVA 2PEXA 4IQJA 3HM5A 1O3TA 3ELKA 3DTEA 4S05A 1J75A 3HKZA 4XM3A 5IYDJ 3K70D 5FLXZ 4F52A 2V4JC 1FTTA 4IOAF 3KEOA 1OR7C 2DFIA 2DW4A 4QWQA 1H8AC 2QSFX 1UELB 4XOPA 2LP0A 2XRLA 5IYBJ 3JAMZ 1CQTA 2PJRB 2BXZA 1ITYA 3HRMA 2HEOA 3HTSB 2OV7A 4EVIA 1HCRA 5J6XA 2VBXA 4BY7J 2G9WA 5IOZA 2AXTC 5C4XJ 4E7SA 3AL0B 5HDNA 5FLMJ 1WJBA 3LMMA 3FK6A 4I99C 1P4AA 4F91B 3K10A 2CH0A 1BR4A 3ZQQA 4HSRA 4PCQA 4LG0B 3HOZJ 3OYEA 4B1RA 1J5YA 1DU0A 2IVMA 4KNYA 2ZCWA 4FCYA 4KDPA 1T0FC 2O03A 1ETOA 1QPMA 1K6OA 3LAPA 3PJRA 2L4MA 2I10A 1DQUA 5DM6F 3MKYB 1O3SA 2WV1A 2AQEA 3RIRA 3ZCOA 3TO7A 2F5DA 2M4GA 2RQQA 4AU7A 4CYCB 2IS4A 1XCBA 3QWLA 1MZBA 1D8JA 2RKHA 2MLGA 3K4BA 1I39A 1XPXA 1FBQA 2GLOA 4UVAA 1YRNB 3O2PE 2PJRA 1FOWA 5L3DA 4ZC3A 1T6SA 5CVVA 5DEQA 3ZQHA 4ZZLA 1F1ZA 1Y56A 3H9QA 4ZTJA 2H8RA 3TOBA 1PP8F 5CKTA 4BBRJ 3OYJA 2V6CA 2Y0MA 2JVGA 3F8NA 1T2KA 1TC3C 3HOUJ 3TO6A 2AQFA 3TP0A 3LSJA 4N0BA 1R4MB 1USTA 2TRTA 5L3FA 1XSDA 3EETA 3SXYA 3ZMZA 1E2XA 3OWTA 1A6QA 2Z3YA 1DGRM 3VYTB 2A69F 1O3RA 3DPTA 3OYHA 1TNSA 2DTRA 2JSCA 3RCOA 1R4NB 5J4YA 4RLQA 2X1CA 3JSPA 1FOKA 4D7NA 3A01B 3F22A 1UHMA 1NTCA 3DPUA 3I9V2 3PQJA 4A0XA 1G4DA 1KGSA 4UY8I 3BZKA 3K4MA 4CYCA 1BC8C 4IXAA 4G6QA 3S17J 2HQNA 5HVQC 4PJ0C 1IXSB 1WWXA 2E7WA 3H9JA 3L2WA 3OL4A 5TRDA 3GUDA 2K86A 2XIGA 2ZJRF 3VPRA 4WF2A 1WHUA 2BOLA 3F6OA 3GXOA 3LFKA 1RESA 4ZDPA 2ISZA 3BR0A 3KP3A 2PLYA 2DU9A 1L3LA 5CVIA 2M0CA 2MG4A 1MBFA 2JWTA 3LFUA 3VYUB 5JR3A 4FHTA 2R5ZB 3M4OJ 2OBPA 3QU6A 1E3OC 3F21A 2V1DA 4G8XA 3GTLJ 1I6HJ 3FBIB 3MAJA 2YPRA 3K70C 1UB9A 2Y69H 1ZRDA 3FXMA 3FMQA 2DMNA 4ZDLA 4KT6A 3M7GA 4XLNF 1RUNA 1W36C 3G2BA 3V4GA 2GIVA 4XRFA 3OYLA 4X6AJ 5HDGA 1Z77A 1YTYA 2R7ZJ 1IW7F 1GVJA 3DQVC 2DQLA 1H9GA 3F3XA 1YS7A 3BT9A 4CCMA 2JQ7A 4MHGA 1W0TA 5FKKA 1YW9A 2HFHA 2F48A 1ZR2A 1MBHA 4BAYA 4BE1A 1RC9A 1RRJA 4ZYDA 1IGNA 2K9SA 1LFBA 2CQXA 4I0BA 4A5NA 4R8HA 2HVQA 3CMYA 1XSXA 1YJ9I 2W84A 2ZXHA 3S16J 2K9NA 1Z21A 2M2EA 1K78B 4UHTA 3IAS2 4CDGA 2R92J 4HA8A 4KIBA 1QU3A 1GT0C 4HNTA 4P9UA 3MZ8A 2LY9A 2XHKA 4NC7A 2O6GE 3H3VK 1PYVA 2BY1A 1OCOH 4LITA 4XLAA 1VQMI 1P7JA 4GO1A 5FGMA 1WH7A 4CICA 5FRNA 3I59A 4BE0A 1WZ2A 2A05A 1HSTA 3ZRGA 5LBQA 4D0PA 2X48A 1YX3A 3CLOA 2GQQA 3N05A 1Y39A 2BZTA 2V1XA 3H3ZA 1FNNA 2STWA 1F4KA 4QSHA 3RKQA 2CW7A 2H6CA 4M9ZA 3CMMA 3T8RA 3TEDA 1ETWA 3CESA 2R7OA 3AAFA 2WB1N 2M45A 2VE8A 3L2RA 1LB2A 1ZGJA 1TLHB 2MC4A 4HLYA 2O7OA 2EA4A 3EDPA 4XNFA 1O7LA 4DW6A 2IT0A 4YIRX 3BP8A 4L5EA 1ERDA 5D6EA 2IS1A 1BIBA 5EG0B 2IS2A 2X4HA 5IP9J 3RI4A 5A2QZ 2L9RA 2QQ9A 1H89C 2LF8A 4M3GA 5IPAA 2WC2A 3I5UA 2QCOA 5K1YA 1YE9A 4CH7A 1B1BA 3GLXA 5LGNA 5DTDA 1R6RA 3HGYA 3H5AA 3S93A 2E1NA 1D5YA 5DD4A 2DOEA 4MQ9F 5H20A 4F3QA 5C44J 1X1PA 3RDIA 3CCEI 1MBKA 1P92A 2Z33A 4RGXA 2K27A 2JZYA 2V1NA 3DXJF 1DUXC 1MSEC 2M9HA 2F5EA 2MW8A 4IOCF 2KJCA 3K4LA 1IN5A 4DYCA 4JX4A 1TWGJ 3S1MJ 1TT5B 2G7UA 2Y0SA 3SFIA 3RYRA 4XOTA 3MZYA 5EG0A 1GVDA 2RDPA 1NH3A 3RPUA 2ZXIA 1BJAA 1J09A 1OQYA 3CJRB 1ACIA 4LJZF 3OL3A 2DO7A 3HOWJ 2WAQA 1MMGA 4NDLA 2L3DA 3A2KA 2GA2A 5E8GA 5BQTA 1BW6A 1AKHA 4LFUA 3COAC 5K7ZA 2CG4A 2JK3A 4MNUA 2L7KA 2RNGA 3G3ZA 1VQPI 2L9SA 2OCCH 2W4SA 3PO2J 1WVRA 1T0FA 3V7CA 1KA8A 2M1BA 1UHSA 1ZKGA 3TBIA 3WG7H 3F72A 2E2IJ 3GX4X 1UG0A 5M5WJ 1F9NA 1AA7A 3M8FA 1OKRA 1RETA 2VLAA 2DFHA 3S2WA 2FF4A 2HTSA 3DEEA 4XMYA 3C2BA 5HS9A 5J40A 4P5OA 5J1YA 4GCVA 2EFNA 1SAXA 2PQ8A 3OIOA 2IJLA 2ELJA 3MKLA 5CPRB 4J00A 2CUJA 5BPIA 4II2A 3S3NA 5HNHA 2QA4I 2O0YA 4IO9F 1EF4A 1KQ9A 1OCCH 1X4PA 3P9IA 4JQFA 2XPUA 4W1UA 3S3OA 2FSWA 4BEHA 1R00A 4UV9A 3PNVA 2E2HJ 1W7PA 2YS9A 3OYAA 4CZZA 2RAEA 2BGCA 2E34A 4OMYA 2Y75A 1BL0A 5M3MJ 2PX9A 1WKMA 1S3JA 4FE4A 1Y1WJ 2IBDA 4PGGA 2OF7A 1EV7A 3Q9VA 1X1DA 5IY5H 2BYVE 2NXNB 4IKFA 1T98A 3SJMA 1IRFA 3LA2A 3E5UA 2HNHA 2O9LA 3ZQGA 1QGPA 3S2DJ 2ICWG 3CQZJ 2IGNA 2DQRA 4HLXA 1JT6A 1D0ZA 1FBUA 2A6TA 4DBRA 3F9KA 4M6VA 1Y8QB 3HPHA 3C1DA 1R71A 2ZKZA 4FTHA 1RKWA 2IEKA 3GFMA 2KIFA 2HQAA 2FNAA 3HEFA 2BHZA 2KRHA 4BU2A 3L2CA 2EJRA 2W48A 3DKXA 3K4JA 3BLYA 4QIWN 1ZELA 5FO5A 3S1NJ 2IPQX 1W7PB 1AU7A 5FRMA 4M3EA 3E6DA 1LFPA 1IRGA 1UCRA 2K4JA 2HZDA 2ZJQF 2VQHA 3BQZA 1FT9A 3OYNA 4HG2A 4MTEA 4O5VA 1NK2P 2EV0A 1XN7A 4MTDA 5LRRA 2HXOA 1R9TJ 2QQ8A 3IC7A 3FZVA 2M30A 3CUQA 3T1BA 3TKYA 3VSLA 5K5RA 1SFEA 2W85A 1ZN2A 3HUGB 1RI7A 5HNFA 5J1UA 4HF0A 1IJWC 3BR6A 1I5ZA 4WXHA 2HI3A 1IDYA 1S8NA 1DP7P 4FASD 1IUFA 4M6XA 1VF9A 3L9FA 1VQNI 1ZYRF 2X1DA 4DIQA 2PMZN 3ZP5A 3I56I 5DS9A 1SD5A 1T08B 2CV0A 1MDMB 2CRGA 4PZJA 3MZHA 1RNLA 1NG6A 3CO6C 3JR9A 3ZMUA 1E17A 1MW7A 2LNBA 3NQOA 1KZHA 4MFDA 1UMQA 3IH3A 4MO7A 3ABLH 3E5XA 4Z6YA 5FKMA 2DT6A 4QLCU 4A12A 5EYRA 2NAZA 3MN2A 1JKRC 3PM1A 3BG3A 3LQQA 4YFKF 1K7AA 2OA4A 3TDZC 3N97A 1U0JA 3BJAA 2KKOA 3WHBA 2WAFA 1YW7A 5CJ9A 4B44A 3M9AA 2G7HA 1U5TB 1T95A 2KISA 3I53A 3KP4A 2B9SA 3CCRI 2VKDA 2VXZA 3I4PA 2E60A 2HVSA 5GAEJ 3LSKA 4J19A 1WI9A 4GYIA 4X0GA 5HLIA 5M3FJ 2YSRA 4R1HA 4U87A 5GPCA 4IEJA 3QYBA 2I8DA 4XRMA 1X1AA 4AVPA 2XROA 2Z99A 5FKNA 5FD6A 3IH2A 1SFKA 1HLVA
chains in the Genus database with same CATH topology
4EJWA 2O61A 3RKXA 3FXRA 3QU3A 2A07F 1YFHA 2DK5A 4Q48A 5DV5A 2YX7A 4A2UA 2QM3A 1R5GA 3R61A 3GWZA 1FPQA 5IT9K 1STZA 1LDDA 2MH9A 4HYEA 1I1SA 5FFXA 4BXUA 4RB2C 1IF1A 2F2EA 2YR2A 1Z9CA 2K02A 4LK0F 3J81K 3E5QA 4Y15A 4G9YA 3K0LA 2GA1A 5K5QA 3J80Z 4FX0A 5IT3A 4ZZDA 2M8EA 5E1XA 4ETSA 2FBKA 1XB4A 3K69A 4NHJA 2P5KA 2ISYA 2EV6A 2W24A 4I09A 2HQRA 3HSFA 3O3KA 4RGUA 4PDKA 3C18A 2PG4A 5ICGA 1RIOH 1ZARA 1SMYF 4NQWA 1V3FA 3KCCA 3I0TA 5DCFA 3EYIA 3KEQA 1L0OC 2HR3A 4IVNA 4AIJA 3P9KA 3KETA 2PFBA 3ERED 5LHIA 4CGZA 4L9TA 4CHUA 4ZYGA 5D5UB 1J9IA 4WX9A 3QOPA 2FA5A 3R0JA 1Z6RA 3C3WA 2H94A 3HSRA 2JTVA 4KIFA 4IRGA 2B0LA 1ONVA 4U7BA 4KICA 3BJOA 2PJPA 2V1UA 1G3SA 3L00A 1XD7A 3BDDA 2ZMEA 4LB5A 2F5FA 3VEPA 2O3FA 1TW2A 4G94A 3W6KB 1AOYA 2BBYA 2YU3A 2VBZA 2F5CA 2W25A 3DKWA 4PGHA 3F6VA 2OZ6A 2XKOA 3KZYA 1FSEA 2XV4S 2J5OA 3BJ6A 1MGTA 3DP7A 1B59A 2ZMEB 4XSXF 1I1GA 4LLGF 2EWNA 1BM9A 1LEAA 4KA4A 3HRUA 1CGPA 2FBHA 2DK8A 4OIQF 5CVUA 3R0AA 1KQ8A 1FY7A 4ZYHA 2CSOA 2PMUA 2OAZA 4ESJA 4CO8A 2XVCA 5E18F 2DI3A 4ESFA 5A2QK 4M72A 2HTJA 3WTXC 3M8EA 2IP2A 5KVRA 1KU2A 3N4MA 1OYYA 3FM3A 1Q1HA 3QP6A 4IJAA 4A6DA 1W5TA 4ENNA 1ZH5A 1JE8A 3MCZA 2QENA 1DDNA 2Q2EA 1CF7B 1LQ1A 2DPDA 1GXPA 3B73A 2EFWA 1QQIA 2ZNZA 2XAHA 4M9XA 3WTYC 2OU2A 2D1VA 4EQQA 4U0YA 3HHGA 5E1WA 4EGYA 1J0RA 3VFZA 2XRNA 2VT2A 2DLLA 2HOEA 2XAQA 1G3WA 1ON2A 3K1MA 1J2XA 4L5IA 5ICCA 1H0MA 2JT1A 3BZ6A 3LWFA 2CWEA 2D2WA 1YO5C 3L7WA 5DUKA 4JK1X 2QZ8A 2PN6A 3WTSC 2V9VA 2A6EF 1BN5A 2A3SA 3LSTA 2VC0A 3WODF 2BE5F 3JTGA 1UHWA 1R22A 3V7SA 3V7RA 1S29A 1MD0A 3H92A 2MC3A 4HX7A 4IHTA 1D5VA 1YG2A 1IUYA 4IRHA 4G7HF 3ZMTA 2HDCA 3T0YA 1HBXG 4G7ZF 4AD9A 1Z6TA 1ZGAA 1YLFA 3CJNA 3FM5A 3ZN0A 1OYWA 5ICFA 1P4XA 1PUEE 3ZMSA 4FT8A 4BHCA 2FMYA 5D8LB 3KP7A 1QNTA 3E6CC 1IZ1A 1TQIA 1PP7U 4B8XA 1XGMA 5CVRA 2L01A 5CVJA 5K5OA 1J7KA 2AXLA 3PFIA 5D5XB 2FQ3A 4ON0A 4OIOF 2BEOA 2EA2A 4GGGA 2ESHA 1KYWA 2JPBA 4I0AA 5KK1A 1Y0UA 5FD5A 5BMZA 2P7VB 2RV8A 1K78A 2RNJA 3GO5A 2ZFWA 3BWGA 1RZ4A 4EMSA 4RB3C 4MEXF 2GAUA 4U0WA 3C7JA 3GVAA 3QP5A 5TJJA 2OQGA 2HYGD 1YS6A 2NNNA 3I59B 1WQ2A 4HX4A 5ILSA 2HS5A 1R36A 2FXAA 1QO0D 4UVBA 2QQAA 2KRFA 1G3YA 2P6TA 2EFOA 3R4KA 3LAJA 1B4AA 4HV6A 4I7HA 3BY6A 4P96A 2MH2A 3CUQC 3RKWA 5ILVA 5JHUA 3CDHA 1W7PD 5AONA 5AIQA 3WE2A 2IA1A 4N9IA 2LSOA 4MGRA 2ESNA 1G6NA 3ECHA 4E70A 2VN2A 2Q8KA 5LLQA 2MLKA 3TQNA 3ULQB 2UWMA 5HLHA 3IKVA 2A6HF 4EM2A 4MEYF 1BI0A 3ABUA 3QPHA 4KIGA 1I27A 4ENJA 2ACJA 1REPC 4YFNF 4EM0B 4LLNA 5ICEA 2KIMA 3V8JA 2L4AA 4DNCA 2A5YB 2NRAC 4BYYA 4O3MA 2Z5UA 1G3TA 1Z91A 3J81Z 2OD5A 3EUHA 2QLZA 4IPAA 3ISPA 2GXBA 4XBFA 4Z2YA 4HAMA 4LK1F 2CQKA 4WK8F 5F1RA 5ED4A 3KE2A 1FYLA 1XSVA 4ESBA 3GZ6A 3W6JB 3KFWX 2EB7A 3JW4A 1U2WA 1SMTA 1TTYA 1QZZA 4U0VA 5E1ZB 2D45A 2NYXA 4TV7A 3I58A 4RB0A 2HZTA 1IN8A 3IRQA 4P9FA 4GYGA 5F64A 1D8KA 1VTNC 3BPVA 3D0SA 5AIPA 4XSZF 3WGHA 1DPRA 1IN7A 2DT5A 4HZFA 4L5JA 5HOOA 2KJBA 1QZYA 1HQCA 2CO5A 4IHSA 3QPTA 5LEJA 1XMKA 1O57A 1FZPB 4HOBA 2FBIA 3R6SA 4ZYEA 3SZTA 3E6BA 3IWZA 5ILUA 4EJUA 2E1CA 4KUMA 2HWVA 5FFZA 2QUFA 3ZPLA 1R23A 3SHFA 3CO7C 4EJVA 1LVAA 4BQAA 1MJAA 3U2RA 1BIAA 1KU7A 3FX3A 4I01A 3FMSA 4HX8A 3U1DA 3L09A 3HUGA 1FBSA 1HW1A 2LF7A 2A61A 4RS8A 3MQ0A 1BI1A 3EQLF 3KP5A 1RUOA 4EV0A 1ZAOA 2Z9OA 2PMHA 4ASNA 1MDMA 4KN4X 5LEKA 5DYMA 4CYDA 2VBWA 4M6YA 1U3EM 5F6FA 3OV8A 1ZG5A 4G6DA 4I98B 4Y17A 1OR7A 3P9CA 4XLPF 1ZRFA 3V8KA 3KLNA 2BV6A 2CGPA 1O7FA 1HKTA 5D4RA 2ELHA 4EGZA 1FSHA 5HDKA 2UXXA 3RTRA 3I54A 4Q5SF 3F8MA 5LGTA 1ZREA 4I02A 4A5MA 2O8XA 3LA3A 2MBFA 2ZJ2A 2E7XA 1USSA 5E8IA 2COMA 2XUBA 3E6MA 2EFQA 4A0ZA 1S7AA 4MQVA 4WCGA 3RYPA 3ZMDA 1V4RA 3IHUA 3NRVA 1TBXA 4HF1A 1H9TA 1X3UA 4AIKA 4BH9A 1S7OA 3TO9A 2QQBA 2STTA 4M71A 2IRFG 3GEZA 4HF2A 3RPQA 2XAJA 1FWZA 1R1UA 3K2ZA 1WSUA 1DPUA 4HQMA 2EFPA 1ULYA 3CTAA 3I71A 1AWCA 5ERIA 3TGNA 1R1VA 3E3VA 2VE9A 1QBJA 2GWRA 4OINF 3WTVC 2QBYB 4UUVA 1TNTA 4RAZA 4HV5A 3WU1B 1PDNC 1R58A 4U7DA 2MA3A 2P7CB 1XMAA 1ON1A 2ADUA 1IN6A 4Q47A 5DCMA 1OYIA 4RGRA 5E17F 3GFIA 2R3SA 5CYVA 4G7OF 2RGVA 1MJ9A 2VODA 5D5WB 4M9SA 2DPUA 3WTWC 3MFKA 4UNOA 3WU0A 1UFMA 2HGCA 3D5LA 3JSOA 1YW8A 1F5TA 2CFXA 4IF4A 3KLOA 1U6GA 2QBYA 2FRHA 1JGSA 1ZLJA 1XDSA 4JBAA 4LGWA 4UVCA 1FYKA 3WTZA 3K1NA 2ZO4A 2IA2A 5DCMB 3V8LA 2EK5A 2NS0A 1WRJA 4NB5A 5HLGA 1YQAA 4ENMA 1BI2A 4AIHA 2P6SA 1T39A 2VOOA 4L9JA 5DDGA 2RC4A 5FLXK 1SD4A 2CYYA 3IL2A 3DV8A 2A68F 3GFLA 3MWMA 4N9HA 2VOPA 4FX4A 3G73A 3DPLC 3F8FA 4KYWA 1BI3A 2H27A 1I6XA 3E97A 1HKQA 2X0LA 5H6RA 2UXNA 4RGSA 4LB6B 4UV8A 4BHPA 2VONA 4UXNA 1FP1D 1ZLKA 1A04A 1BC7C 3SFZA 3BROA 3GFJA 1BBYA 4M73A 1XDUA 4CXFA 4AWXB 3WTTC 3HOSA 2YX4A 5LGUA 2HKOA 3F8BA 2P4WA 3GW2A 2NNYA 1U78A 2FMLA 4F7ZA 5LHHA 1Z7UA 3J80K 2AS5F 3GF2A 2XAFA 3U9GA 4P55A 2PI0A 1LEBA 4A6EA 3Q9SA 2H09A 4EJOA 3WGIA 1KYZA 2XASA 2M87A 1IXCA 2R7DA 4LMYA 1B6AA 3SQNA 1HW5A 3M1EA 3JTHA 4WXDA 2LKPA 4WXCA 2VT3A 1R5HA 3QAHA 1U5TC 1TW3A 3K9TA 4Q4ZF 1SD6A 4BHBA 4Y13A 1C0WA 2DAOA 1YIOA 4IRIA 3WTUC 5H6QA 1FLIA 2Y48A 4ENKA 2WTEA 4H0EA 1B9MA 2W57A 1NHAA 3CUQB 1W4MA 5BPDA 2P5LC 3RKYA 3T5XA 3QRFF 2ZXJA 2P8TA 2ZNYA 3HOTA 1ODDA 1TQPA 2H6BA 3TOAA 3DFGA 1JHHA 3WGGA 2HYFA 2MD5A 1SD7A 2UZKA 4L0ZB 3FXUA 1JHFA 5CLSA 2M5WA 2C6YA 5BOXA 1KQ0A 1FC3A 3P7NA 3BPXA 1LJ9A 1KU3A 1R1TA 1MKMA 2ETHA 1ZG1A 1HXDA 5D5VB 1HKSA 1U5TA 4B09A 3RJPA 4OU0A 4OMZA 5LRSA 2D1HA 1GXQA 3HSEA 4GXOA 4HBLA 2R7FA 3F8CA 3ML6A 3EYYA 2PBIA 4ZH4F 1EH6A 3B02A 3WE3A 2OZUA 2VBYA 1P2FA 2Q0OA 3FF5A 3HIFA 2TDXA 1YYVA 1J59A 5D8KB 1FP2A 2L54A 3FXQA 5L3GA 1EH7A 4HW0A 4YFXF 4OIRF 2K4BA 1FX7A 3ROUA 5JI6A 1B9NA 5DUIA 4HDUA 2RQPA 1ZG3A 4R79A 4KMUX 4K2EA 2XAGA 2P5VA 3KP6A 4KFCA 3HYIA 5D6FA 1S6LA 3I64A 3R60A 4L9VA 3DEUA 3OOPA 1XGOA 3T8TA 2DBBA 2K7LA 3O6BB 1Z05A 1ZRCA 5FB2A 5HS8A 2XKPA 4LD5A 3HRSA 3IWFA 2GXGA 1MJBA 4M74A 3NEUA 1XGNA 1P4WA 2KIUA 3BOQA 3WG9A 3KP2A 3GYHX 2FNPA 3PQKA 4EJTA 4HDVA 3FHZA 5E20A 2HKXA 2IW5A 1LDJA 4L9NA 4L18B 1EH8A 1XCVA 4LLLA 4A0YA 3IRRA 1IAWA 3KZZA 1BOAA 2JRTA 3ZMVA 1LDKB 4DQ2A 1IN4A 3H3UA 1HW2A 5L3BA 1P6RA 4U88A 5LHGA 1D3YA 2J5PA 4RB1A 3LA7A 3GZ5A 5L3EA 3ZN1A 3Q5FA 4KMFA 3J7AO 5EEHA 1W5SA 2LDUA 3JAMK 5D4SA 4EM1A 3MEXA 3REOA 4OOIA 1O3QA 3VODA 2L02A 4O6JA 2RVCA 1TQMA 2QWWA 2QVOA 5J8CA 2OQRA 2VC1A 2WV0A 2IA0A 3VB2A 1JXSA 3K1PA 3TDUC 5BS6A 2GZWA 2FU4A 1HSJA 2V79A 1ZHFA 1Z1DA 1OMIA 1R7JA 2EV5A 3F23A 1LNWA 4S04A 4YIIA 4YIFA 1OPCA 3CUOA 3ABTA 3LQRA 5HS7A 2RN7A 2CW0F 1IXRC 4YG2F 6PAXA 3ECOA 5JFRA 1U8RA 3IKTA 3FWEA 4RAYA 4WWCA 5JVTA 5L3CA 1SFUA 2FOKA 1T38A 2WWYA 3HTUA 3FMRA 5J8FA 2FEZA 2JPCA 4HQEA 3HHHA 1XGSA 1GHCA 5IT9Z 3ZQ7A 4BNCA 3HRTA 5DD8A 1KU9A 5EEGA 2FE3A 4L0YB 3VOEA 2ZBKA 4I2OA 4KN7X 2XGXA 4OIPF 2QYOA 3DF8A 1SFXA 4KT5C 4LG0A 3SZPA 1FYMA 1K79A 1CF7A 2PEXA 1O3TA 3ELKA 4S05A 1J75A 5FLXZ 3KEOA 2DW4A 2DFIA 4QWQA 3JAMZ 3HTSB 3HRMA 2HEOA 4EVIA 5J6XA 2VBXA 2G9WA 5HDNA 1P4AA 4PCQA 4LG0B 1J5YA 2IVMA 4KNYA 2ZCWA 4KDPA 2O03A 1K6OA 1QPMA 3LAPA 2L4MA 1O3SA 3RIRA 3TO7A 2F5DA 1XCBA 1MZBA 1D8JA 2RKHA 2MLGA 1FBQA 4UVAA 3O2PE 5L3DA 1T6SA 5CVVA 5DEQA 4ZZLA 1F1ZA 3TOBA 1PP8F 2V6CA 2Y0MA 3F8NA 1T2KA 3TO6A 4N0BA 1USTA 5L3FA 1XSDA 3EETA 3SXYA 3ZMZA 1E2XA 2Z3YA 2A69F 1O3RA 3DPTA 1TNSA 2DTRA 2JSCA 3JSPA 1FOKA 3F22A 1UHMA 3PQJA 4A0XA 1G4DA 1KGSA 1BC8C 4IXAA 4G6QA 2HQNA 5HVQC 1IXSB 1WWXA 2E7WA 5TRDA 3GUDA 2K86A 2XIGA 4WF2A 3F6OA 3LFKA 3GXOA 2ISZA 3KP3A 2PLYA 2DU9A 1L3LA 5CVIA 5JR3A 4FHTA 2OBPA 3QU6A 3F21A 2V1DA 4G8XA 3MAJA 2YPRA 1UB9A 1ZRDA 3FMQA 3M7GA 4XLNF 1RUNA 3V4GA 2GIVA 4XRFA 5HDGA 1YTYA 1IW7F 1GVJA 3DQVC 2DQLA 1H9GA 3F3XA 1YS7A 4MHGA 1YW9A 2HFHA 4BAYA 4ZYDA 4I0BA 4A5NA 4R8HA 1XSXA 2W84A 1K78B 4UHTA 4CDGA 4HA8A 4KIBA 4P9UA 2XHKA 2O6GE 4GO1A 5FGMA 4CICA 3I59A 1HSTA 5LBQA 4D0PA 3CLOA 2GQQA 2V1XA 3H3ZA 1FNNA 2STWA 1F4KA 4M9ZA 2H6CA 3T8RA 3AAFA 2M45A 2VE8A 1LB2A 1ZGJA 1TLHB 4HLYA 3EDPA 2EA4A 2IT0A 1O7LA 3BP8A 5D6EA 1BIBA 2X4HA 3RI4A 5A2QZ 2QQ9A 2LF8A 2WC2A 3I5UA 5K1YA 1B1BA 3GLXA 5LGNA 2E1NA 5DD4A 4MQ9F 5H20A 3RDIA 1P92A 2Z33A 4RGXA 2K27A 2JZYA 3DXJF 1DUXC 2F5EA 2KJCA 1IN5A 2G7UA 3RYRA 3MZYA 2RDPA 3RPUA 1BJAA 4LJZF 2DO7A 2L3DA 2GA2A 5E8GA 5BQTA 4LFUA 3COAC 2CG4A 4MNUA 3G3ZA 3V7CA 1T0FA 1KA8A 2M1BA 3F72A 3GX4X 1F9NA 3M8FA 1OKRA 3S2WA 2FF4A 2HTSA 5HS9A 4P5OA 4GCVA 2EFNA 1SAXA 2PQ8A 2IJLA 5BPIA 2O0YA 1KQ9A 3P9IA 4JQFA 2FSWA 1R00A 4UV9A 1W7PA 4CZZA 2BGCA 4OMYA 2Y75A 1WKMA 1S3JA 4PGGA 1EV7A 3Q9VA 2BYVE 1T98A 1IRFA 3LA2A 3E5UA 1QGPA 2DQRA 4HLXA 1FBUA 3C1DA 2ZKZA 3GFMA 2KIFA 2FNAA 3L2CA 2EJRA 5FO5A 2IPQX 1W7PB 3E6DA 1IRGA 1UCRA 2K4JA 1FT9A 4MTEA 4O5VA 2EV0A 1XN7A 4MTDA 5LRRA 3IC7A 3FZVA 2M30A 3CUQA 3T1BA 3TKYA 5K5RA 1SFEA 2W85A 1ZN2A 1RI7A 4HF0A 1I5ZA 4WXHA 1S8NA 1DP7P 4M6XA 3L9FA 1ZYRF 3ZP5A 1SD5A 1MDMB 4PZJA 3MZHA 1RNLA 3CO6C 3ZMUA 1E17A 2LNBA 3NQOA 3E5XA 4QLCU 4A12A 2NAZA 3LQQA 4YFKF 1K7AA 2OA4A 3TDZC 3N97A 3BJAA 2KKOA 1YW7A 5CJ9A 3M9AA 2G7HA 1U5TB 3I53A 3KP4A 2VXZA 3I4PA 1WI9A 4GYIA 5HLIA 2YSRA 4R1HA 4AVPA 2XROA 2Z99A 5FD6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EJW A;  2O61 A;  3RKX A;  3FXR A;  3QU3 A;  2A07 F;  1YFH A;  2DK5 A;  4Q48 A;  5DV5 A;  2YX7 A;  4A2U A;  2QM3 A;  1R5G A;  3R61 A;  3GWZ A;  1FPQ A;  5IT9 K;  1STZ A;  1LDD A;  2MH9 A;  4HYE A;  1I1S A;  5FFX A;  4BXU A;  4RB2 C;  1IF1 A;  2F2E A;  2YR2 A;  1Z9C A;  2K02 A;  4LK0 F;  3J81 K;  3E5Q A;  4Y15 A;  4G9Y A;  3K0L A;  2GA1 A;  5K5Q A;  3J80 Z;  4FX0 A;  5IT3 A;  4ZZD A;  2M8E A;  5E1X A;  4ETS A;  2FBK A;  1XB4 A;  3K69 A;  4NHJ A;  2P5K A;  2ISY A;  2EV6 A;  2W24 A;  4I09 A;  2HQR A;  3HSF A;  3O3K A;  4RGU A;  4PDK A;  3C18 A;  2PG4 A;  5ICG A;  1RIO H;  1ZAR A;  1SMY F;  4NQW A;  1V3F A;  3KCC A;  3I0T A;  5DCF A;  3EYI A;  3KEQ A;  1L0O C;  2HR3 A;  4IVN A;  4AIJ A;  3P9K A;  3KET A;  2PFB A;  3ERE D;  5LHI A;  4CGZ A;  4L9T A;  4CHU A;  4ZYG A;  5D5U B;  1J9I A;  4WX9 A;  3QOP A;  2FA5 A;  3R0J A;  1Z6R A;  3C3W A;  2H94 A;  3HSR A;  2JTV A;  4KIF A;  4IRG A;  2B0L A;  1ONV A;  4U7B A;  4KIC A;  3BJO A;  2PJP A;  2V1U A;  1G3S A;  3L00 A;  1XD7 A;  3BDD A;  2ZME A;  4LB5 A;  2F5F A;  3VEP A;  2O3F A;  1TW2 A;  4G94 A;  3W6K B;  1AOY A;  2BBY A;  2YU3 A;  2VBZ A;  2F5C A;  2W25 A;  3DKW A;  4PGH A;  3F6V A;  2OZ6 A;  2XKO A;  3KZY A;  1FSE A;  2XV4 S;  2J5O A;  3BJ6 A;  1MGT A;  3DP7 A;  1B59 A;  2ZME B;  4XSX F;  1I1G A;  4LLG F;  2EWN A;  1BM9 A;  1LEA A;  4KA4 A;  3HRU A;  1CGP A;  2FBH A;  2DK8 A;  4OIQ F;  5CVU A;  3R0A A;  1KQ8 A;  1FY7 A;  4ZYH A;  2CSO A;  2PMU A;  2OAZ A;  4ESJ A;  4CO8 A;  2XVC A;  5E18 F;  2DI3 A;  4ESF A;  5A2Q K;  4M72 A;  2HTJ A;  3WTX C;  3M8E A;  2IP2 A;  5KVR A;  1KU2 A;  3N4M A;  1OYY A;  3FM3 A;  1Q1H A;  3QP6 A;  4IJA A;  4A6D A;  1W5T A;  4ENN A;  1ZH5 A;  1JE8 A;  3MCZ A;  2QEN A;  1DDN A;  2Q2E A;  1CF7 B;  1LQ1 A;  2DPD A;  1GXP A;  3B73 A;  2EFW A;  1QQI A;  2ZNZ A;  2XAH A;  4M9X A;  3WTY C;  2OU2 A;  2D1V A;  4EQQ A;  4U0Y A;  3HHG A;  5E1W A;  4EGY A;  1J0R A;  3VFZ A;  2XRN A;  2VT2 A;  2DLL A;  2HOE A;  2XAQ A;  1G3W A;  1ON2 A;  3K1M A;  1J2X A;  4L5I A;  5ICC A;  1H0M A;  2JT1 A;  3BZ6 A;  3LWF A;  2CWE A;  2D2W A;  1YO5 C;  3L7W A;  5DUK A;  4JK1 X;  2QZ8 A;  2PN6 A;  3WTS C;  2V9V A;  2A6E F;  1BN5 A;  2A3S A;  3LST A;  2VC0 A;  3WOD F;  2BE5 F;  3JTG A;  1UHW A;  1R22 A;  3V7S A;  3V7R A;  1S29 A;  1MD0 A;  3H92 A;  2MC3 A;  4HX7 A;  4IHT A;  1D5V A;  1YG2 A;  1IUY A;  4IRH A;  4G7H F;  3ZMT A;  2HDC A;  3T0Y A;  1HBX G;  4G7Z F;  4AD9 A;  1Z6T A;  1ZGA A;  1YLF A;  3CJN A;  3FM5 A;  3ZN0 A;  1OYW A;  5ICF A;  1P4X A;  1PUE E;  3ZMS A;  4FT8 A;  4BHC A;  2FMY A;  5D8L B;  3KP7 A;  1QNT A;  3E6C C;  1IZ1 A;  1TQI A;  1PP7 U;  4B8X A;  1XGM A;  5CVR A;  2L01 A;  5CVJ A;  5K5O A;  1J7K A;  2AXL A;  3PFI A;  5D5X B;  2FQ3 A;  4ON0 A;  4OIO F;  2BEO A;  2EA2 A;  4GGG A;  2ESH A;  1KYW A;  2JPB A;  4I0A A;  5KK1 A;  1Y0U A;  5FD5 A;  5BMZ A;  2P7V B;  2RV8 A;  1K78 A;  2RNJ A;  3GO5 A;  2ZFW A;  3BWG A;  1RZ4 A;  4EMS A;  4RB3 C;  4MEX F;  2GAU A;  4U0W A;  3C7J A;  3GVA A;  3QP5 A;  5TJJ A;  2OQG A;  2HYG D;  1YS6 A;  2NNN A;  3I59 B;  1WQ2 A;  4HX4 A;  5ILS A;  2HS5 A;  1R36 A;  2FXA A;  1QO0 D;  4UVB A;  2QQA A;  2KRF A;  1G3Y A;  2P6T A;  2EFO A;  3R4K A;  3LAJ A;  1B4A A;  4HV6 A;  4I7H A;  3BY6 A;  4P96 A;  2MH2 A;  3CUQ C;  3RKW A;  5ILV A;  5JHU A;  3CDH A;  1W7P D;  5AON A;  5AIQ A;  3WE2 A;  2IA1 A;  4N9I A;  2LSO A;  4MGR A;  2ESN A;  1G6N A;  3ECH A;  4E70 A;  2VN2 A;  2Q8K A;  5LLQ A;  2MLK A;  3TQN A;  3ULQ B;  2UWM A;  5HLH A;  3IKV A;  2A6H F;  4EM2 A;  4MEY F;  1BI0 A;  3ABU A;  3QPH A;  4KIG A;  1I27 A;  4ENJ A;  2ACJ A;  1REP C;  4YFN F;  4EM0 B;  4LLN A;  5ICE A;  2KIM A;  3V8J A;  2L4A A;  4DNC A;  2A5Y B;  2NRA C;  4BYY A;  4O3M A;  2Z5U A;  1G3T A;  1Z91 A;  3J81 Z;  2OD5 A;  3EUH A;  2QLZ A;  4IPA A;  3ISP A;  2GXB A;  4XBF A;  4Z2Y A;  4HAM A;  4LK1 F;  2CQK A;  4WK8 F;  5F1R A;  5ED4 A;  3KE2 A;  1FYL A;  1XSV A;  4ESB A;  3GZ6 A;  3W6J B;  3KFW X;  2EB7 A;  3JW4 A;  1U2W A;  1SMT A;  1TTY A;  1QZZ A;  4U0V A;  5E1Z B;  2D45 A;  2NYX A;  4TV7 A;  3I58 A;  4RB0 A;  2HZT A;  1IN8 A;  3IRQ A;  4P9F A;  4GYG A;  5F64 A;  1D8K A;  1VTN C;  3BPV A;  3D0S A;  5AIP A;  4XSZ F;  3WGH A;  1DPR A;  1IN7 A;  2DT5 A;  4HZF A;  4L5J A;  5HOO A;  2KJB A;  1QZY A;  1HQC A;  2CO5 A;  4IHS A;  3QPT A;  5LEJ A;  1XMK A;  1O57 A;  1FZP B;  4HOB A;  2FBI A;  3R6S A;  4ZYE A;  3SZT A;  3E6B A;  3IWZ A;  5ILU A;  4EJU A;  2E1C A;  4KUM A;  2HWV A;  5FFZ A;  2QUF A;  3ZPL A;  1R23 A;  3SHF A;  3CO7 C;  4EJV A;  1LVA A;  4BQA A;  1MJA A;  3U2R A;  1BIA A;  1KU7 A;  3FX3 A;  4I01 A;  3FMS A;  4HX8 A;  3U1D A;  3L09 A;  3HUG A;  1FBS A;  1HW1 A;  2LF7 A;  2A61 A;  4RS8 A;  3MQ0 A;  1BI1 A;  3EQL F;  3KP5 A;  1RUO A;  4EV0 A;  1ZAO A;  2Z9O A;  2PMH A;  4ASN A;  1MDM A;  4KN4 X;  5LEK A;  5DYM A;  4CYD A;  2VBW A;  4M6Y A;  1U3E M;  5F6F A;  3OV8 A;  1ZG5 A;  4G6D A;  4I98 B;  4Y17 A;  1OR7 A;  3P9C A;  4XLP F;  1ZRF A;  3V8K A;  3KLN A;  2BV6 A;  2CGP A;  1O7F A;  1HKT A;  5D4R A;  2ELH A;  4EGZ A;  1FSH A;  5HDK A;  2UXX A;  3RTR A;  3I54 A;  4Q5S F;  3F8M A;  5LGT A;  1ZRE A;  4I02 A;  4A5M A;  2O8X A;  3LA3 A;  2MBF A;  2ZJ2 A;  2E7X A;  1USS A;  5E8I A;  2COM A;  2XUB A;  3E6M A;  2EFQ A;  4A0Z A;  1S7A A;  4MQV A;  4WCG A;  3RYP A;  3ZMD A;  1V4R A;  3IHU A;  3NRV A;  1TBX A;  4HF1 A;  1H9T A;  1X3U A;  4AIK A;  4BH9 A;  1S7O A;  3TO9 A;  2QQB A;  2STT A;  4M71 A;  2IRF G;  3GEZ A;  4HF2 A;  3RPQ A;  2XAJ A;  1FWZ A;  1R1U A;  3K2Z A;  1WSU A;  1DPU A;  4HQM A;  2EFP A;  1ULY A;  3CTA A;  3I71 A;  1AWC A;  5ERI A;  3TGN A;  1R1V A;  3E3V A;  2VE9 A;  1QBJ A;  2GWR A;  4OIN F;  3WTV C;  2QBY B;  4UUV A;  1TNT A;  4RAZ A;  4HV5 A;  3WU1 B;  1PDN C;  1R58 A;  4U7D A;  2MA3 A;  2P7C B;  1XMA A;  1ON1 A;  2ADU A;  1IN6 A;  4Q47 A;  5DCM A;  1OYI A;  4RGR A;  5E17 F;  3GFI A;  2R3S A;  5CYV A;  4G7O F;  2RGV A;  1MJ9 A;  2VOD A;  5D5W B;  4M9S A;  2DPU A;  3WTW C;  3MFK A;  4UNO A;  3WU0 A;  1UFM A;  2HGC A;  3D5L A;  3JSO A;  1YW8 A;  1F5T A;  2CFX A;  4IF4 A;  3KLO A;  1U6G A;  2QBY A;  2FRH A;  1JGS A;  1ZLJ A;  1XDS A;  4JBA A;  4LGW A;  4UVC A;  1FYK A;  3WTZ A;  3K1N A;  2ZO4 A;  2IA2 A;  5DCM B;  3V8L A;  2EK5 A;  2NS0 A;  1WRJ A;  4NB5 A;  5HLG A;  1YQA A;  4ENM A;  1BI2 A;  4AIH A;  2P6S A;  1T39 A;  2VOO A;  4L9J A;  5DDG A;  2RC4 A;  5FLX K;  1SD4 A;  2CYY A;  3IL2 A;  3DV8 A;  2A68 F;  3GFL A;  3MWM A;  4N9H A;  2VOP A;  4FX4 A;  3G73 A;  3DPL C;  3F8F A;  4KYW A;  1BI3 A;  2H27 A;  1I6X A;  3E97 A;  1HKQ A;  2X0L A;  5H6R A;  2UXN A;  4RGS A;  4LB6 B;  4UV8 A;  4BHP A;  2VON A;  4UXN A;  1FP1 D;  1ZLK A;  1A04 A;  1BC7 C;  3SFZ A;  3BRO A;  3GFJ A;  1BBY A;  4M73 A;  1XDU A;  4CXF A;  4AWX B;  3WTT C;  3HOS A;  2YX4 A;  5LGU A;  2HKO A;  3F8B A;  2P4W A;  3GW2 A;  2NNY A;  1U78 A;  2FML A;  4F7Z A;  5LHH A;  1Z7U A;  3J80 K;  2AS5 F;  3GF2 A;  2XAF A;  3U9G A;  4P55 A;  2PI0 A;  1LEB A;  4A6E A;  3Q9S A;  2H09 A;  4EJO A;  3WGI A;  1KYZ A;  2XAS A;  2M87 A;  1IXC A;  2R7D A;  4LMY A;  1B6A A;  3SQN A;  1HW5 A;  3M1E A;  3JTH A;  4WXD A;  2LKP A;  4WXC A;  2VT3 A;  1R5H A;  3QAH A;  1U5T C;  1TW3 A;  3K9T A;  4Q4Z F;  1SD6 A;  4BHB A;  4Y13 A;  1C0W A;  2DAO A;  1YIO A;  4IRI A;  3WTU C;  5H6Q A;  1FLI A;  2Y48 A;  4ENK A;  2WTE A;  4H0E A;  1B9M A;  2W57 A;  1NHA A;  3CUQ B;  1W4M A;  5BPD A;  2P5L C;  3RKY A;  3T5X A;  3QRF F;  2ZXJ A;  2P8T A;  2ZNY A;  3HOT A;  1ODD A;  1TQP A;  2H6B A;  3TOA A;  3DFG A;  1JHH A;  3WGG A;  2HYF A;  2MD5 A;  1SD7 A;  2UZK A;  4L0Z B;  3FXU A;  1JHF A;  5CLS A;  2M5W A;  2C6Y A;  5BOX A;  1KQ0 A;  1FC3 A;  3P7N A;  3BPX A;  1LJ9 A;  1KU3 A;  1R1T A;  1MKM A;  2ETH A;  1ZG1 A;  1HXD A;  5D5V B;  1HKS A;  1U5T A;  4B09 A;  3RJP A;  4OU0 A;  4OMZ A;  5LRS A;  2D1H A;  1GXQ A;  3HSE A;  4GXO A;  4HBL A;  2R7F A;  3F8C A;  3ML6 A;  3EYY A;  2PBI A;  4ZH4 F;  1EH6 A;  3B02 A;  3WE3 A;  2OZU A;  2VBY A;  1P2F A;  2Q0O A;  3FF5 A;  3HIF A;  2TDX A;  1YYV A;  1J59 A;  5D8K B;  1FP2 A;  2L54 A;  3FXQ A;  5L3G A;  1EH7 A;  4HW0 A;  4YFX F;  4OIR F;  2K4B A;  1FX7 A;  3ROU A;  5JI6 A;  1B9N A;  5DUI A;  4HDU A;  2RQP A;  1ZG3 A;  4R79 A;  4KMU X;  4K2E A;  2XAG A;  2P5V A;  3KP6 A;  4KFC A;  3HYI A;  5D6F A;  1S6L A;  3I64 A;  3R60 A;  4L9V A;  3DEU A;  3OOP A;  1XGO A;  3T8T A;  2DBB A;  2K7L A;  3O6B B;  1Z05 A;  1ZRC A;  5FB2 A;  5HS8 A;  2XKP A;  4LD5 A;  3HRS A;  3IWF A;  2GXG A;  1MJB A;  4M74 A;  3NEU A;  1XGN A;  1P4W A;  2KIU A;  3BOQ A;  3WG9 A;  3KP2 A;  3GYH X;  2FNP A;  3PQK A;  4EJT A;  4HDV A;  3FHZ A;  5E20 A;  2HKX A;  2IW5 A;  1LDJ A;  4L9N A;  4L18 B;  1EH8 A;  1XCV A;  4LLL A;  4A0Y A;  3IRR A;  1IAW A;  3KZZ A;  1BOA A;  2JRT A;  3ZMV A;  1LDK B;  4DQ2 A;  1IN4 A;  3H3U A;  1HW2 A;  5L3B A;  1P6R A;  4U88 A;  5LHG A;  1D3Y A;  2J5P A;  4RB1 A;  3LA7 A;  3GZ5 A;  5L3E A;  3ZN1 A;  3Q5F A;  4KMF A;  3J7A O;  5EEH A;  1W5S A;  2LDU A;  3JAM K;  5D4S A;  4EM1 A;  3MEX A;  3REO A;  4OOI A;  1O3Q A;  3VOD A;  2L02 A;  4O6J A;  2RVC A;  1TQM A;  2QWW A;  2QVO A;  5J8C A;  2OQR A;  2VC1 A;  2WV0 A;  2IA0 A;  3VB2 A;  1JXS A;  3K1P A;  3TDU C;  5BS6 A;  2GZW A;  2FU4 A;  1HSJ A;  2V79 A;  1ZHF A;  1Z1D A;  1OMI A;  1R7J A;  2EV5 A;  3F23 A;  1LNW A;  4S04 A;  4YII A;  4YIF A;  1OPC A;  3CUO A;  3ABT A;  3LQR A;  5HS7 A;  2RN7 A;  2CW0 F;  1IXR C;  4YG2 F;  6PAX A;  3ECO A;  5JFR A;  1U8R A;  3IKT A;  3FWE A;  4RAY A;  4WWC A;  5JVT A;  5L3C A;  1SFU A;  2FOK A;  1T38 A;  2WWY A;  3HTU A;  3FMR A;  5J8F A;  2FEZ A;  2JPC A;  4HQE A;  3HHH A;  1XGS A;  1GHC A;  5IT9 Z;  3ZQ7 A;  4BNC A;  3HRT A;  5DD8 A;  1KU9 A;  5EEG A;  2FE3 A;  4L0Y B;  3VOE A;  2ZBK A;  4I2O A;  4KN7 X;  2XGX A;  4OIP F;  2QYO A;  3DF8 A;  1SFX A;  4KT5 C;  4LG0 A;  3SZP A;  1FYM A;  1K79 A;  1CF7 A;  2PEX A;  1O3T A;  3ELK A;  4S05 A;  1J75 A;  5FLX Z;  3KEO A;  2DW4 A;  2DFI A;  4QWQ A;  3JAM Z;  3HTS B;  3HRM A;  2HEO A;  4EVI A;  5J6X A;  2VBX A;  2G9W A;  5HDN A;  1P4A A;  4PCQ A;  4LG0 B;  1J5Y A;  2IVM A;  4KNY A;  2ZCW A;  4KDP A;  2O03 A;  1K6O A;  1QPM A;  3LAP A;  2L4M A;  1O3S A;  3RIR A;  3TO7 A;  2F5D A;  1XCB A;  1MZB A;  1D8J A;  2RKH A;  2MLG A;  1FBQ A;  4UVA A;  3O2P E;  5L3D A;  1T6S A;  5CVV A;  5DEQ A;  4ZZL A;  1F1Z A;  3TOB A;  1PP8 F;  2V6C A;  2Y0M A;  3F8N A;  1T2K A;  3TO6 A;  4N0B A;  1UST A;  5L3F A;  1XSD A;  3EET A;  3SXY A;  3ZMZ A;  1E2X A;  2Z3Y A;  2A69 F;  1O3R A;  3DPT A;  1TNS A;  2DTR A;  2JSC A;  3JSP A;  1FOK A;  3F22 A;  1UHM A;  3PQJ A;  4A0X A;  1G4D A;  1KGS A;  1BC8 C;  4IXA A;  4G6Q A;  2HQN A;  5HVQ C;  1IXS B;  1WWX A;  2E7W A;  5TRD A;  3GUD A;  2K86 A;  2XIG A;  4WF2 A;  3F6O A;  3LFK A;  3GXO A;  2ISZ A;  3KP3 A;  2PLY A;  2DU9 A;  1L3L A;  5CVI A;  5JR3 A;  4FHT A;  2OBP A;  3QU6 A;  3F21 A;  2V1D A;  4G8X A;  3MAJ A;  2YPR A;  1UB9 A;  1ZRD A;  3FMQ A;  3M7G A;  4XLN F;  1RUN A;  3V4G A;  2GIV A;  4XRF A;  5HDG A;  1YTY A;  1IW7 F;  1GVJ A;  3DQV C;  2DQL A;  1H9G A;  3F3X A;  1YS7 A;  4MHG A;  1YW9 A;  2HFH A;  4BAY A;  4ZYD A;  4I0B A;  4A5N A;  4R8H A;  1XSX A;  2W84 A;  1K78 B;  4UHT A;  4CDG A;  4HA8 A;  4KIB A;  4P9U A;  2XHK A;  2O6G E;  4GO1 A;  5FGM A;  4CIC A;  3I59 A;  1HST A;  5LBQ A;  4D0P A;  3CLO A;  2GQQ A;  2V1X A;  3H3Z A;  1FNN A;  2STW A;  1F4K A;  4M9Z A;  2H6C A;  3T8R A;  3AAF A;  2M45 A;  2VE8 A;  1LB2 A;  1ZGJ A;  1TLH B;  4HLY A;  3EDP A;  2EA4 A;  2IT0 A;  1O7L A;  3BP8 A;  5D6E A;  1BIB A;  2X4H A;  3RI4 A;  5A2Q Z;  2QQ9 A;  2LF8 A;  2WC2 A;  3I5U A;  5K1Y A;  1B1B A;  3GLX A;  5LGN A;  2E1N A;  5DD4 A;  4MQ9 F;  5H20 A;  3RDI A;  1P92 A;  2Z33 A;  4RGX A;  2K27 A;  2JZY A;  3DXJ F;  1DUX C;  2F5E A;  2KJC A;  1IN5 A;  2G7U A;  3RYR A;  3MZY A;  2RDP A;  3RPU A;  1BJA A;  4LJZ F;  2DO7 A;  2L3D A;  2GA2 A;  5E8G A;  5BQT A;  4LFU A;  3COA C;  2CG4 A;  4MNU A;  3G3Z A;  3V7C A;  1T0F A;  1KA8 A;  2M1B A;  3F72 A;  3GX4 X;  1F9N A;  3M8F A;  1OKR A;  3S2W A;  2FF4 A;  2HTS A;  5HS9 A;  4P5O A;  4GCV A;  2EFN A;  1SAX A;  2PQ8 A;  2IJL A;  5BPI A;  2O0Y A;  1KQ9 A;  3P9I A;  4JQF A;  2FSW A;  1R00 A;  4UV9 A;  1W7P A;  4CZZ A;  2BGC A;  4OMY A;  2Y75 A;  1WKM A;  1S3J A;  4PGG A;  1EV7 A;  3Q9V A;  2BYV E;  1T98 A;  1IRF A;  3LA2 A;  3E5U A;  1QGP A;  2DQR A;  4HLX A;  1FBU A;  3C1D A;  2ZKZ A;  3GFM A;  2KIF A;  2FNA A;  3L2C A;  2EJR A;  5FO5 A;  2IPQ X;  1W7P B;  3E6D A;  1IRG A;  1UCR A;  2K4J A;  1FT9 A;  4MTE A;  4O5V A;  2EV0 A;  1XN7 A;  4MTD A;  5LRR A;  3IC7 A;  3FZV A;  2M30 A;  3CUQ A;  3T1B A;  3TKY A;  5K5R A;  1SFE A;  2W85 A;  1ZN2 A;  1RI7 A;  4HF0 A;  1I5Z A;  4WXH A;  1S8N A;  1DP7 P;  4M6X A;  3L9F A;  1ZYR F;  3ZP5 A;  1SD5 A;  1MDM B;  4PZJ A;  3MZH A;  1RNL A;  3CO6 C;  3ZMU A;  1E17 A;  2LNB A;  3NQO A;  3E5X A;  4QLC U;  4A12 A;  2NAZ A;  3LQQ A;  4YFK F;  1K7A A;  2OA4 A;  3TDZ C;  3N97 A;  3BJA A;  2KKO A;  1YW7 A;  5CJ9 A;  3M9A A;  2G7H A;  1U5T B;  3I53 A;  3KP4 A;  2VXZ A;  3I4P A;  1WI9 A;  4GYI A;  5HLI A;  2YSR A;  4R1H A;  4AVP A;  2XRO A;  2Z99 A;  5FD6 A; 
#chains in the Genus database with same CATH topology
 4EJW A;  2I5U A;  4BQN A;  2O61 A;  1JI8 A;  3RKX A;  1P9Q C;  5KCM A;  3FXR A;  2X85 A;  3KIO A;  4NC6 A;  3QU3 A;  2A07 F;  1FTZ A;  4B47 A;  1YFH A;  2DK5 A;  3G71 I;  1WI3 A;  2KZG A;  4Q48 A;  4D9J A;  1B72 B;  5DV5 A;  2YX7 A;  4A2U A;  2QM3 A;  1R5G A;  3R61 A;  1VI0 A;  3GWZ A;  4H4K C;  1FPQ A;  2LBF B;  1HF0 A;  5IT9 K;  3K4K A;  4DOZ A;  1STZ A;  1LDD A;  2MH9 A;  4HYE A;  4XQF A;  1I1S A;  1WJE A;  2DJN A;  2LK2 A;  2KRC A;  2DA2 A;  5FFX A;  3UKG A;  2VL8 A;  4BXU A;  4RB2 C;  1IF1 A;  2F2E A;  2YR2 A;  1Z9C A;  2K02 A;  4LK0 F;  3J81 K;  3FXK A;  3E5Q A;  4Y15 A;  4G9Y A;  3GTJ J;  4PUS A;  2KQR A;  2R7T A;  4NQW B;  3K0L A;  4G6T B;  2GA1 A;  4G12 A;  5K5Q A;  3J80 Z;  1SVL A;  4FX0 A;  3L2U A;  2HVR A;  2KT0 A;  1WH5 A;  1NG7 A;  3L1P A;  2LRD A;  5EGO A;  5IT3 A;  2W82 A;  3ERM A;  3I3L A;  2XGE A;  4ZZD A;  2M8E A;  5E1X A;  4ETS A;  2FBK A;  5CQG A;  1XB4 A;  1D0X A;  4KIS A;  4Y7N J;  3K69 A;  4NHJ A;  3LOC A;  2HPI A;  2P5K A;  5F0C A;  4RBO A;  5KAF C;  4W97 A;  2ISY A;  2VJ4 A;  2EV6 A;  2W24 A;  2XB0 X;  4I09 A;  2HQR A;  3HSF A;  2KL4 A;  2H1K A;  3O3K A;  1YIJ I;  4RGU A;  4PDK A;  3FKJ A;  3BTI A;  1A35 A;  3C18 A;  2PG4 A;  1G8X A;  5ICG A;  1RIO H;  1ZAR A;  1SMY F;  4CCN A;  2DN0 A;  4NQW A;  4C3I J;  1V3F A;  3KCC A;  4J01 A;  4RDU A;  3I0T A;  4JP0 A;  5DCF A;  3EYI A;  1JUP A;  1MH4 A;  4BS9 A;  1X3W B;  3KEQ A;  1TL8 A;  1MIJ A;  2UUZ A;  1L0O C;  3W2V A;  2B63 J;  2HR3 A;  4M3D A;  4HEA 2;  4IVN A;  4CCJ A;  4AIJ A;  2CU7 A;  3P9K A;  3KET A;  1X19 A;  3H5R A;  2PFB A;  4AM3 A;  3ERE D;  2LYC A;  2FUG 2;  4A3K J;  2NS8 A;  4XLF A;  2VIX A;  2GBY A;  4IQ4 A;  5LHI A;  2VPR A;  3ZGK A;  5TIS C;  2UV1 A;  4A3F J;  4CGZ A;  2R7W A;  4L9T A;  5TGT A;  1X58 A;  3HJE A;  2WAD A;  5B5E C;  5C4J J;  4KJZ A;  1M1E B;  3PL8 A;  4CHU A;  2CMP A;  1RR7 A;  5JLW A;  4BL0 B;  2MD0 A;  3PO3 J;  4ZYG A;  1OCR H;  3LSM A;  5D5U B;  4WX9 A;  1J9I A;  2OC6 A;  2FA5 A;  3QOP A;  3R0J A;  2JA5 J;  1Z6R A;  3C3W A;  2H94 A;  3HSR A;  2JTV A;  4KIF A;  3MMY B;  4LG3 A;  4I76 A;  4IRG A;  2HPM A;  2B0L A;  1ONV A;  4U7B A;  4KIC A;  3BJO A;  2PJP A;  3G1L A;  2R7V A;  2V1U A;  1G3S A;  3L00 A;  1XD7 A;  3BDD A;  5E3O A;  2ZME A;  1XTA A;  4LB5 A;  2F5F A;  2MFZ A;  2XAU A;  4MIM A;  3VEP A;  1RR8 C;  4AID A;  2O3F A;  3DLL F;  2CQN A;  1TW2 A;  1I3A A;  4G94 A;  2VQG A;  1DP3 A;  3W6K B;  2BXY A;  4AUX A;  2QKM B;  1PUF B;  1AOY A;  2BBY A;  3OYM A;  5FRO A;  4F93 B;  1WFX A;  2YU3 A;  2VBZ A;  2F5C A;  2W25 A;  1LFU P;  3CC7 I;  2KDO A;  2VJI A;  3DKW A;  4PGH A;  3K7A J;  5HOD A;  3CC2 I;  1Q1V A;  4M3F A;  3F6V A;  4IHW A;  3GCM A;  2OZ6 A;  5FLV A;  3K4C A;  2XKO A;  3U21 A;  3KPH A;  3KZY A;  1MMA A;  4A3D J;  1FSE A;  2XV4 S;  2L9V A;  2J5O A;  3BR2 A;  4A3B J;  3BJ6 A;  3MD2 A;  1MGT A;  3DP7 A;  1JTX A;  1B59 A;  5F0F A;  2ZME B;  4D1Q A;  4XSX F;  1I1G A;  4LLG F;  4OAY A;  2EWN A;  1BM9 A;  1LEA A;  4KA4 A;  3HRU A;  1CGP A;  2FBH A;  2FQ4 A;  2DK8 A;  4OIQ F;  5CVU A;  4YRV A;  3R0A A;  1KQ8 A;  1O4X A;  4AYB A;  1PUF A;  1FY7 A;  4Y33 A;  2EZH A;  3J7Y J;  1VQ8 I;  2X1E A;  3TP3 A;  2EIN H;  1SAU A;  4ZYH A;  2CSO A;  2PMU A;  3AG3 H;  2OAZ A;  4ESJ A;  3SEQ A;  4CO8 A;  2XVC A;  2A5W A;  3ZOB A;  3OS0 A;  1HDD C;  5E18 F;  4LIU A;  3Q0V A;  2DI3 A;  2QGU A;  4ESF A;  2VJ5 A;  5IP7 J;  1PVE A;  5A2Q K;  4M72 A;  3VDX A;  3I4M J;  2HTJ A;  5E3L A;  1EKE A;  1TWF J;  3WTX C;  3M8E A;  2IP2 A;  5KVR A;  1KU2 A;  4PJJ A;  1H88 C;  3N4M A;  1OYY A;  3FM3 A;  4UB8 C;  1Q1H A;  3QP6 A;  5IOY A;  4IJA A;  2V7F A;  4A6D A;  1W5T A;  1MND A;  4A69 C;  4ENN A;  3OYG A;  1ZH5 A;  5M5Y J;  2LKX A;  1JE8 A;  2NVY J;  3MCZ A;  2QEN A;  4XLC A;  2EIK H;  2LRE A;  1DDN A;  2Q2E A;  3RZO J;  1CF7 B;  1LQ1 A;  2DPD A;  1GXP A;  2LMD A;  3B73 A;  2EFW A;  1QQI A;  3QOE A;  1IRZ A;  4MFE A;  2ZNZ A;  4IHY A;  2XAH A;  1TWA J;  1I3Q J;  3HXL A;  4M9X A;  4PJN A;  4F92 B;  3WTY C;  2OU2 A;  1W1W E;  2D1V A;  2X6W A;  4EQQ A;  2W00 A;  2Z2S B;  4U0Y A;  3HHG A;  5J1R A;  1OIS A;  5E1W A;  3IH4 A;  1DGW Y;  4EGY A;  4E6K G;  1J0R A;  3VFZ A;  1IV8 A;  1YX5 A;  3S1Q J;  3DLA A;  3FXL A;  2XRN A;  2VT2 A;  1DU6 A;  3E7L A;  4BJ6 C;  2DLL A;  1IDZ A;  2HOE A;  2XAQ A;  3PNT A;  1G3W A;  4JOM A;  2VI6 A;  1ON2 A;  3A03 A;  1SAN A;  3ASN H;  1B8I B;  2Q2E B;  3K1M A;  1BA5 A;  2V9P A;  3M1C A;  1J2X A;  2M3A A;  3HB9 A;  4L5I A;  3PUB A;  5ICC A;  1H0M A;  4E7J A;  2JT1 A;  1LUJ B;  3BZ6 A;  3LWF A;  3D5R C;  4CA0 A;  2CWE A;  5F0H A;  2X6O A;  2DDA A;  4EAT A;  3S1R J;  2D2W A;  1YO5 C;  2X6X A;  3GTM J;  3L7W A;  5DUK A;  4JK1 X;  2QZ8 A;  2PN6 A;  4NC8 A;  1S7E A;  3WTS C;  3JRE A;  3OYC A;  1YRN A;  1VQ6 I;  2V9V A;  2A6E F;  1BN5 A;  2A3S A;  3LST A;  2VC0 A;  4E7H A;  3WOD F;  4ABZ A;  2BE5 F;  3JTG A;  1UHW A;  3B6A A;  4OWR B;  1R22 A;  3H5N A;  3V7S A;  3FXJ A;  3V7R A;  1S29 A;  2R7U A;  3RPU D;  1MD0 A;  3HPG A;  3H92 A;  2IGO A;  3OSG A;  2MC3 A;  5E3N A;  4RM3 A;  4HX7 A;  1K61 A;  4IHT A;  1D5V A;  1YG2 A;  4XN3 A;  4ZYA A;  1MH3 A;  1S9H A;  1IUY A;  4IRH A;  2Q1Z B;  3A01 A;  3LNQ A;  2CS3 A;  3PUF A;  5B3S H;  4G7H F;  3G1M A;  3ZMT A;  2V26 A;  2D5V A;  2HDC A;  1X3Z B;  3T0Y A;  3QYE A;  3IUO A;  1HBX G;  4G7Z F;  4AD9 A;  3AKZ A;  1Z6T A;  1ZGA A;  5F1J A;  1YLF A;  3CJN A;  3FM5 A;  3J7Z I;  5GTH C;  3ZN0 A;  3S15 J;  1OYW A;  5ICF A;  1P4X A;  3OYB A;  1PUE E;  3ZMS A;  4FT8 A;  1LVK A;  2VJJ A;  3DTI A;  3UNG C;  2LY2 A;  4FET A;  4BHC A;  2FMY A;  1MNE A;  5D8L B;  3KP7 A;  1QNT A;  3CZ6 A;  3PIP F;  3E6C C;  1IZ1 A;  4AVZ A;  1TQI A;  1D0Y A;  1PP7 U;  2XPV A;  4B8X A;  3EUH C;  1XGM A;  5CVR A;  2HQ5 A;  2L01 A;  2QF7 A;  5CVJ A;  3MVP A;  5K5O A;  1G2H A;  1J7K A;  3F0C A;  2AXL A;  3LSR A;  3HL2 A;  2K5C A;  3PFI A;  5D5X B;  2FQ3 A;  2H8W A;  1WJA A;  4ON0 A;  4OIO F;  2YUS A;  1A6I A;  5J47 A;  2BEO A;  2EA2 A;  4GGG A;  2JUC A;  2ESH A;  2KIQ A;  2CQQ A;  1KYW A;  4XKB A;  1D1B A;  4C9Y A;  2JPB A;  3CCQ I;  4I0A A;  3CCL I;  5KK1 A;  3BR5 A;  2ZME C;  3CF5 F;  1Y0U A;  2VAS A;  4FQG A;  5FD5 A;  1IG7 A;  1VQ5 I;  2CUZ A;  5BMZ A;  3FDY A;  4BQO A;  1QA6 A;  2P7V B;  2XC7 A;  2RV8 A;  2X51 A;  5LFA A;  1K78 A;  2RNJ A;  1FMV A;  2OUM A;  5GTI C;  5EDN A;  3GO5 A;  2ZFW A;  3BWG A;  1BR2 A;  4JX6 A;  1RZ4 A;  4EMS A;  4RB3 C;  3CME I;  2GAU A;  4MEX F;  4U0W A;  2JA6 J;  2JA2 A;  2L9N A;  3C7J A;  4XKC A;  4D7M A;  3OOU A;  5HLT A;  1JKQ C;  3GVA A;  3QP5 A;  5TJJ A;  2OQG A;  3GLL A;  2HYG D;  5EEA A;  3IP4 B;  1OCZ H;  1MSF C;  1YS6 A;  2NNN A;  3I59 B;  2XGC A;  1Z3Y A;  3CCY A;  1WQ2 A;  4ITV A;  4HX4 A;  5ILS A;  3JRI A;  2DOD A;  2HS5 A;  4HNU A;  1R36 A;  3CLQ A;  2FXA A;  2ECB A;  1HA8 A;  1QO0 D;  4UVB A;  2QQA A;  2KRF A;  1AHD P;  1G3Y A;  2P6T A;  2EFO A;  3R4K A;  3LAJ A;  3QQA A;  1UG2 A;  1B4A A;  2DMP A;  3H1C A;  1YHQ I;  4HV6 A;  4I7H A;  3BY6 A;  4P96 A;  2MH2 A;  3CUQ C;  3RKW A;  2L2O A;  4LIV A;  3V42 A;  5ILV A;  3E1S A;  5JHU A;  4AYB N;  2BY0 A;  3QPL A;  3CDH A;  3AL0 C;  1W7P D;  2CUF A;  5F08 A;  5GAH J;  1N77 A;  5AON A;  5IYC J;  3FIS A;  5AIQ A;  3CP2 A;  3WE2 A;  2IA1 A;  3OY9 A;  2MGQ A;  4JX5 A;  2DMT A;  4N9I A;  3AG1 H;  2LSO A;  3BTJ A;  4DZP A;  1A5J A;  4V19 K;  4MGR A;  2ESN A;  1G6N A;  3ECH A;  4E70 A;  2VN2 A;  1IV6 A;  2LOO A;  4Y3O A;  2Q8K A;  5LLQ A;  4CCL A;  2MLK A;  3TQN A;  3ULQ B;  2UWM A;  3CCM I;  5HLH A;  3IKV A;  2A6H F;  2CFO A;  2XF7 A;  2XGD A;  4MEY F;  4EM2 A;  1IC8 A;  5KHD A;  2ZXW H;  4B3X A;  1BI0 A;  2X9D A;  3ABU A;  3CCJ I;  3QPH A;  4KIG A;  5FJ8 J;  1I27 A;  4ENJ A;  3GBG A;  2ACJ A;  4A3C J;  2VXD A;  1REP C;  4YFN F;  4EM0 B;  4PFO A;  4LLN A;  5ICE A;  5KAI C;  2KIM A;  3V8J A;  5CQE A;  2L4A A;  4DNC A;  4XL9 A;  2A5Y B;  5K7H A;  2NRA C;  4BYY A;  2E5N A;  3OYK A;  2Z5U A;  4O3M A;  1G3T A;  2B7E A;  3H9G A;  4HRI A;  4XR6 A;  1Z91 A;  5EZG A;  5J4V A;  1GLN A;  3J81 Z;  1LKX A;  2OD5 A;  3EUH A;  2QLZ A;  2CV2 A;  4IPA A;  3ISP A;  3D5S C;  2GXB A;  4XBF A;  4IL6 C;  4Z2Y A;  4HAM A;  2OTJ I;  4BGD A;  5IP6 A;  4LK1 F;  2WBM A;  2CQK A;  4WK8 F;  5F1R A;  5DM7 F;  5ED4 A;  3KE2 A;  4BDY A;  1FYL A;  1XSV A;  4E7I A;  2R7Q A;  4ESB A;  3GZ6 A;  3W6J B;  3KFW X;  2EB7 A;  4N4O B;  2BW3 B;  1HDP A;  1JGG A;  3JW4 A;  1U2W A;  1SMT A;  1TTY A;  3SDB A;  1QZZ A;  3LSG A;  3HKZ N;  4U0V A;  2DA4 A;  4CCK A;  5E1Z B;  4XKW A;  2D45 A;  4XON A;  3OYI A;  4XK4 A;  2NYX A;  4TV7 A;  1JJ6 C;  3MKZ A;  2FD5 A;  2ZC2 A;  3I58 A;  4C30 A;  3GTO J;  4RB0 A;  5F04 A;  2HZT A;  2VB6 A;  3KZI C;  1IN8 A;  3IRQ A;  1ETK A;  4P9F A;  4GYG A;  5F64 A;  1D8K A;  1IO2 A;  1RKT A;  2LH9 A;  1VTN C;  3FIW A;  3BPV A;  2R5Y B;  3D0S A;  3TW6 A;  5AIP A;  2NOJ B;  4XSZ F;  2R4G A;  3WGH A;  1DPR A;  3BC8 A;  4GFB A;  1IN7 A;  2DT5 A;  3NWT A;  1S5L C;  1K4S A;  4XLH A;  4HZF A;  2LD5 A;  4L5J A;  2LY1 A;  1VFC A;  1BJZ A;  2EZL A;  2XPW A;  4HST A;  5HOO A;  1P7I A;  1UZC A;  1X4O A;  2KJB A;  4DYQ A;  3DBR B;  2BW3 A;  1QZY A;  4A3E J;  4RAG A;  1HQC A;  2CO5 A;  4IHS A;  3QPT A;  2X6Y A;  4MLO A;  2E19 A;  5LEJ A;  1WPK A;  2VPL A;  1XMK A;  2P81 A;  4B48 A;  1F36 A;  1O57 A;  1FZP B;  2KMU A;  4HOB A;  2FBI A;  3BTL A;  3R6S A;  1MMS A;  4ZYE A;  3GTG J;  2ID3 A;  2M4K A;  3SZT A;  1TP4 A;  3E6B A;  3IWZ A;  3Q3S A;  4EJU A;  5ILU A;  1I50 J;  3S2H J;  2E1C A;  4IHV A;  4KUM A;  2HWV A;  2EIM H;  5FFZ A;  2BVL A;  2QUF A;  2BHY A;  3HDD A;  3ZPL A;  2ELK A;  5GP9 A;  1R23 A;  3SHF A;  3ABM H;  3CO7 C;  1OCT C;  2KP6 A;  4EJV A;  1LVA A;  4BQA A;  3TW7 A;  3JRB A;  2Y31 A;  2IGK A;  1MJA A;  3U2R A;  3HOY J;  1BIA A;  3W6V A;  1KU7 A;  3G4S I;  3FX3 A;  2BY2 A;  4I01 A;  4BAC A;  3FMS A;  1TWC J;  2DCE A;  4HX8 A;  3U1D A;  2TCT A;  3A02 A;  4RLF A;  2JN6 A;  3L09 A;  3HUG A;  2VKE A;  1FBS A;  2CJJ A;  4HPQ A;  4JYK A;  1HW1 A;  2XF5 A;  2LF7 A;  2A61 A;  1MNM C;  3LSP A;  2E2J J;  4RS8 A;  3BQY A;  3MQ0 A;  1BI1 A;  1JTY A;  2PMZ A;  3EQL F;  3KP5 A;  1RUO A;  3BG7 A;  3HC7 A;  3HBL A;  4EV0 A;  1ZAO A;  3S8P A;  2Z9O A;  2PMH A;  3JRC A;  4ASN A;  1MDM A;  2E35 A;  2Y30 A;  3NWS A;  4KN4 X;  5LEK A;  5DYM A;  4CYD A;  3M3Y J;  1E0E A;  5JLX A;  2VBW A;  2ZSH B;  4M6Y A;  1U3E M;  3NAU A;  2HXI A;  5F6F A;  3OV8 A;  2WY7 Q;  1ZG5 A;  4G6D A;  1X2M A;  4I98 B;  4Y17 A;  1OR7 A;  1YI2 I;  1Z67 A;  3P9C A;  2XDV A;  4XLP F;  3CMA I;  1ZRF A;  1WJD A;  3V8K A;  1UAA A;  2QKL B;  2JUG A;  3C2H A;  2WAQ N;  4PSX A;  2GOX B;  3A1Y A;  3VWB A;  1ETY A;  2EBI A;  3KLN A;  4RAF A;  2BV6 A;  4CUG A;  2CGP A;  1O7F A;  1HKT A;  4DZJ A;  5D4R A;  2ELH A;  1OCP A;  3SEZ A;  3WU2 C;  4EGZ A;  4DBQ A;  1U8B A;  1FSH A;  5EZH A;  1YJW I;  5HDK A;  2LVS A;  3ESW B;  2UXX A;  4ANJ A;  3RTR A;  1EJ9 A;  2DA5 A;  3I54 A;  4Q5S F;  3F8M A;  5LGT A;  5K7F A;  1ZRE A;  4B3A A;  4I02 A;  2EPF A;  2O8X A;  2EZI A;  4A5M A;  2O5R A;  3LA3 A;  2OCE A;  4UB6 C;  2MBF A;  2ZJ2 A;  2E7X A;  2FJ1 A;  3FKI J;  3DEW A;  1USS A;  5E8I A;  2COM A;  3ZQF A;  2XUB A;  4B43 A;  3E6M A;  4XRS A;  2VQL A;  3W2A A;  2EFQ A;  4A0Z A;  2R5Z A;  1S7A A;  4MQV A;  4WCG A;  3RYP A;  1QZE A;  3ZMD A;  1V4R A;  1YOV B;  3IHU A;  3NRV A;  1TBX A;  4HF1 A;  4BKX A;  1H9T A;  2BY3 A;  1X3U A;  2E1M B;  4AIK A;  4BH9 A;  2ZSI B;  3LSH A;  2ECC A;  4UUS A;  1F43 A;  1S7O A;  3TO9 A;  2QQB A;  2LTP A;  2STT A;  2DYR H;  2DA6 A;  3NAR A;  2HYJ A;  4M71 A;  4XRS G;  2IRF G;  1R49 A;  3GEZ A;  1ZR4 A;  4HF2 A;  3RPQ A;  2XAJ A;  1FWZ A;  1R1U A;  1X1C A;  3K2Z A;  5GAG J;  1WSU A;  1DPU A;  2K9Q A;  2DA7 A;  4HQM A;  2EFP A;  3J7A Y;  1ULY A;  1MMD A;  3CTA A;  2QEX I;  2R0Q C;  3I71 A;  2COB A;  3D1N I;  1AWC A;  5ERI A;  3TGN A;  1VQ9 I;  1R1V A;  3E3V A;  3FXO A;  2VE9 A;  3CJQ B;  1QBJ A;  2GWR A;  4BUP A;  4OIN F;  3WTV C;  1SC7 A;  2QBY B;  9ANT A;  4UUV A;  4E7Z A;  1TNT A;  3W3C A;  4RAZ A;  4HV5 A;  3FK7 A;  3PNY A;  4XKV A;  2LKS A;  3WU1 B;  4PSW A;  1D1C A;  1PDN C;  4C2T A;  2R93 J;  1EA3 A;  1R58 A;  4U7D A;  2MA3 A;  2P7C B;  1E3H A;  1XMA A;  1ON1 A;  2ADU A;  3G1O A;  1IN6 A;  4YEL A;  4UUS B;  4Q47 A;  5DCM A;  3BCB A;  2KDZ A;  1APL C;  3B6C A;  3Q0U A;  1OYI A;  4RGR A;  1XC5 A;  2ME0 A;  5E17 F;  1T56 A;  3GFI A;  2HDD A;  1TT0 A;  2JA7 J;  2R3S A;  3BCA A;  5CYV A;  4XN0 A;  4G7O F;  4Y52 J;  1ORK A;  1SVO A;  2RGV A;  4BDZ A;  1MJ9 A;  3K6G A;  2VOD A;  5D5W B;  2WAE A;  3OSF A;  4M9S A;  2DPU A;  2P0W A;  3BG5 A;  3WTW C;  3OS1 A;  2JSP A;  3MFK A;  4UNO A;  1W36 D;  3WU0 A;  4M3B A;  1UFM A;  2IGM A;  3RZD J;  2HGC A;  3D5L A;  3JSO A;  2ZJP F;  1YW8 A;  1F5T A;  2CFX A;  4IF4 A;  3HOX J;  3BTC A;  3KLO A;  3CCU I;  1U6G A;  4BE2 A;  2QBY A;  3KYL A;  2FRH A;  2Y9Y A;  1GV5 A;  3EUA A;  1JGS A;  1ZLJ A;  1XDS A;  4JBA A;  4LGW A;  1JJ8 C;  1N25 A;  4UVC A;  1FYK A;  2EIJ H;  3WTZ A;  1OJL A;  4NUB A;  1SFO J;  3CDL A;  3K1N A;  2ZO4 A;  2IA2 A;  2DA1 A;  3BR1 A;  3CCV I;  1D1A A;  4IZZ A;  2HOA A;  5DCM B;  3V8L A;  2EK5 A;  2LFB A;  3CDI A;  3LL7 A;  2NS0 A;  1V55 H;  3KEY A;  1WRJ A;  4NB5 A;  5HLG A;  2DDB A;  2R7R A;  1YQA A;  4ENM A;  3GTK J;  1BI2 A;  2G0E A;  5FKO A;  4AIH A;  3DU5 A;  2P6S A;  1T39 A;  2VOO A;  3M8J A;  4L9J A;  4OAZ A;  1VQO I;  5DDG A;  1FJL A;  1W5C C;  2K3F A;  1QHG A;  2RC4 A;  2L0K A;  5FLX K;  2QSH X;  1SD4 A;  2E5Z A;  2V9K A;  2CYY A;  3IL2 A;  4E7L A;  3DV8 A;  2A68 F;  2Y2Z A;  2K40 A;  4EEF G;  3GFL A;  3MWM A;  4XLE A;  4N9H A;  2HOT A;  4FX4 A;  2VOP A;  3G73 A;  1XS9 A;  3KYD B;  2VQC A;  3DPL C;  3F8F A;  3CC4 I;  4KYW A;  1BI3 A;  4II3 A;  5GPA A;  5H2F C;  2H27 A;  1I6X A;  3E97 A;  5B1B H;  1HKQ A;  2X0L A;  5H6R A;  2UXN A;  4RGS A;  4LB6 B;  3ZQI A;  1FOY A;  4A93 J;  4UV8 A;  1AKH B;  4BHP A;  2R7X A;  2VON A;  1QVT A;  1N75 A;  4UXN A;  1TWH J;  4F55 A;  2IXS A;  1FP1 D;  4BQQ A;  1ZLK A;  2NS7 A;  2VUM J;  1A04 A;  3GZN B;  4BJT A;  2CV1 A;  2XF6 A;  3P5J A;  1BC7 C;  3SFZ A;  2DXI A;  3BRO A;  3GFJ A;  3KYC B;  1BBY A;  4M73 A;  1XDU A;  2DJI A;  4CXF A;  4AWX B;  1Z0X A;  5GAD J;  3WTT C;  2JJ7 A;  3SYT A;  3HOS A;  1V5E A;  4CCO A;  3I4N J;  2YX4 A;  5E79 C;  2K3P A;  5LGU A;  2FOW A;  2HKO A;  2L5Q A;  3F8B A;  2P4W A;  3GW2 A;  2NNY A;  1U78 A;  1FEX A;  3RQI A;  2KLO A;  3MKW B;  2FML A;  4F7Z A;  5LHH A;  1Z7U A;  2NVX J;  1Y6I A;  2F6C A;  3J80 K;  2VKH A;  2O8K A;  2EIL H;  3OMY A;  2AS5 F;  3GF2 A;  1K83 J;  2XAF A;  3K4N A;  3U9G A;  4P55 A;  4BEH B;  2PI0 A;  2K9L A;  1LEB A;  4PFP A;  4KIT B;  4A6E A;  3Q9S A;  5C3E J;  3AFH A;  2DOA A;  3CP8 A;  3S32 A;  2H09 A;  4EJO A;  3WGI A;  1KYZ A;  2CUE A;  3A4C A;  2WA0 A;  2XAS A;  2M87 A;  1IXC A;  2R7D A;  3BG6 A;  3JCU C;  2ZFU A;  1ZK8 A;  4LMY A;  2M8G X;  2N8G A;  4AC0 A;  1B6A A;  3SQN A;  1HW5 A;  1QHH D;  3M1E A;  3JTH A;  4C3H J;  4WXD A;  1MBG A;  2LKP A;  2MAB A;  3DTK A;  2EQR A;  4WXC A;  2VT3 A;  1JT0 A;  1R5I D;  1R5H A;  3QAH A;  1U5T C;  1TW3 A;  2YU9 J;  2E36 A;  4P1W A;  3K9T A;  2LG4 A;  4D5F A;  4Q4Z F;  4GDF A;  4RA2 A;  1SD6 A;  4BHB A;  4Y13 A;  1C0W A;  1E3P A;  4XOR A;  2DAO A;  1YIO A;  2NVT J;  2ZB9 A;  4IRI A;  1JKP C;  3SZG A;  3WTU C;  3IAM 2;  2XB5 A;  3JRD A;  3PIO F;  2GOM A;  4CZC A;  3EUK L;  4ZTF A;  2L7M P;  5H6Q A;  1ENH A;  1FLI A;  2Y48 A;  4ENK A;  3GME A;  2WTE A;  4H0E A;  1A31 A;  3S3M A;  1B9M A;  2W57 A;  1NHA A;  2E71 A;  1B8I A;  3CUQ B;  1W4M A;  5BPD A;  2FX0 A;  2P5L C;  2JMW A;  3RKY A;  1HOM A;  3DBH B;  3T5X A;  3QRF F;  2ZXJ A;  2P8T A;  4IX7 A;  1GV2 A;  2ZNY A;  1A36 A;  3HOT A;  1BR1 A;  2M0M A;  2NOG A;  1VQL I;  1ODD A;  1TQP A;  2H6B A;  3TOA A;  3DFG A;  1JHH A;  2RRE A;  3WGG A;  2HYF A;  2MD5 A;  1K6Y A;  1SD7 A;  2UZK A;  4L0Z B;  3FXU A;  4QPQ A;  1JHF A;  1VZ0 A;  2M5W A;  3AG4 H;  5CLS A;  2C6Y A;  1IRX A;  2L7Z A;  1YJN I;  2XSJ C;  4A3M J;  5BOX A;  1KQ0 A;  2MYS A;  3LSI A;  1FC3 A;  5EJC A;  3P7N A;  3U1K A;  2DMQ A;  3BPX A;  3E0J B;  2LLK A;  2JRM A;  1LJ9 A;  4RM2 A;  4IHX A;  2WB1 A;  3HGG A;  2EH3 A;  4NNJ A;  4C2M J;  2MSY A;  1WJF A;  3RQ4 A;  1NK3 P;  1KU3 A;  1SVM A;  1R1T A;  1MKM A;  2M34 A;  4C3J J;  3BZC A;  1Z3X A;  3TMO A;  4UUT A;  5JVG F;  2ETH A;  2CQ7 A;  2DFF A;  1ZG1 A;  1UJ8 A;  1HXD A;  3RSN A;  3X2Q H;  5D5V B;  3G6E I;  2OPT A;  3DBL B;  1MMN A;  3ASO H;  4DGW B;  1HKS A;  3DWL E;  2R7S A;  4A3L J;  1U5T A;  2Y0S N;  4B09 A;  5F27 A;  3RJP A;  4OU0 A;  4OMZ A;  4PK4 A;  1X1B A;  5LRS A;  3H35 A;  5BNG A;  2D1H A;  2Z1D A;  3S14 J;  4BBS J;  3JRF A;  3WHC A;  1GXQ A;  3HSE A;  4GXO A;  4HBL A;  2HDW A;  2R7F A;  3F8C A;  1OFC X;  3ML6 A;  1POG A;  3EYY A;  4V2F A;  5EF6 A;  3CD6 I;  2PBI A;  4ZH4 F;  1EH6 A;  3B02 A;  2DT7 B;  3WE3 A;  1T8I A;  4FIS A;  2OZU A;  2VBY A;  1P2F A;  3I55 I;  3L2Q A;  2Q0O A;  3FF5 A;  3M07 A;  3HIF A;  3L2V A;  2TDX A;  1YYV A;  1RPW A;  1J59 A;  5D8K B;  1FP2 A;  1Z7L A;  2L54 A;  1XMX A;  3FXQ A;  3ZXS A;  3GTQ J;  4BXX J;  3VYR B;  3ZQL A;  1WCM J;  5L3G A;  1EH7 A;  4XIC A;  4HW0 A;  4PJM A;  3ZQC A;  1Y1V J;  1LPQ A;  4YFX F;  1B72 A;  4OIR F;  2K4B A;  1Y8R B;  1FX7 A;  2W1O A;  3ROU A;  5JI6 A;  4DYR A;  1B9N A;  3K2A A;  2DA3 A;  2LBF A;  5DUI A;  4Y4R A;  4HDU A;  2RQP A;  1ETQ A;  1ZG3 A;  4R79 A;  4KMU X;  2NVQ J;  4K2E A;  2XAG A;  2DOF A;  2P5V A;  3KP6 A;  5M5X J;  4KFC A;  3HYI A;  5D6F A;  1S6L A;  3GTP J;  3I64 A;  3R60 A;  4L9V A;  3DEU A;  3OOP A;  1XGO A;  3T8T A;  1W0U A;  1N78 A;  3PSI A;  2DBB A;  2K7L A;  2LC2 A;  1Z05 A;  3O6B B;  1ZRC A;  5FB2 A;  3OR1 C;  2H1L A;  1MBJ A;  5HS8 A;  2XKP A;  4LD5 A;  1U9O A;  2NVU B;  2KHM A;  2DMU A;  1V5G A;  2F4I A;  1U9N A;  3HRS A;  3IWF A;  2GXG A;  1MJB A;  4A3G J;  5EGO B;  4M74 A;  2HU9 A;  3NEU A;  1XGN A;  1P4W A;  1VND A;  2KIU A;  3BOQ A;  4QPO A;  2GIZ A;  3WG9 A;  5B66 C;  1VQ4 I;  2DTZ A;  4C2U A;  3KP2 A;  4BY1 J;  3GYH X;  4E7K A;  4HNV A;  4X1E A;  2FNP A;  3H36 A;  3PQK A;  4EJT A;  4HDV A;  1XG1 A;  3OYD A;  3IV5 A;  3FHZ A;  5E20 A;  2HKX A;  3VYS B;  2V6E A;  3DKY A;  3FBN B;  1QRY A;  1T33 A;  2IW5 A;  3W2W A;  1LDJ A;  4PJL A;  4L9N A;  4L18 B;  1EH8 A;  1XCV A;  4LLL A;  4A0Y A;  1FMW A;  3IRR A;  1IAW A;  3KZZ A;  1BOA A;  3CJT B;  1LE8 B;  2JRT A;  3ZMV A;  1LDK B;  2DYS H;  4DQ2 A;  2JVH A;  3H3U A;  1IN4 A;  2XSD C;  3A0H C;  1HW2 A;  1V5F A;  4LOC A;  2JA8 J;  5L3B A;  1P6R A;  4U88 A;  5LHG A;  3JRH A;  2OJE D;  2E1O A;  3JRG A;  4B4C A;  1D3Y A;  2J5P A;  3HG9 A;  3VSK A;  2W7N A;  4RB1 A;  3LA7 A;  3GZ5 A;  5L3E A;  2K85 A;  3ZN1 A;  4GRI A;  4FE7 A;  1ZTR A;  3H0G J;  3Q5F A;  4KMF A;  3J7A O;  3HZJ A;  3OYF A;  1JUS A;  2Z16 A;  5EEH A;  1S72 I;  1ZGW A;  1OLT A;  2M7B A;  1W5S A;  2LDU A;  3JAM K;  3PFY A;  3TL4 X;  1GUU A;  5D4S A;  4EM1 A;  3MEX A;  3SDG A;  1V54 H;  3REO A;  2CW8 A;  4OOI A;  3OS2 A;  1GDT A;  3OIP A;  5J3L A;  3UR3 C;  1LE8 A;  1O3Q A;  3QPS A;  3O8G A;  2K9M A;  3KX2 A;  4V2G A;  3VOD A;  1KON A;  2L02 A;  2EZK A;  1YIT I;  4O6J A;  1ZQ3 P;  1TZL A;  2RVC A;  1TQM A;  1FIA A;  1ETX A;  2F4O B;  4I6Z A;  1X2N A;  1FOX A;  3EPZ A;  4ZDO A;  4BJ5 C;  1BW5 A;  2GXA A;  2QWW A;  2QVO A;  2DFE A;  5J8C A;  2OQR A;  4YEJ A;  2VC1 A;  2WV0 A;  2L7F P;  4N4N B;  1PJR A;  2IA0 A;  3VB2 A;  3H0D A;  2KFD A;  1JXS A;  3K1P A;  3TDU C;  5BS6 A;  3O8H A;  2GZW A;  5E3M A;  4E4H A;  1QVU A;  2FU4 A;  4RMN A;  1HSJ A;  2AO9 A;  2F4M B;  2V79 A;  3CF2 A;  1ZHF A;  1Z1D A;  1G59 A;  4A3I J;  1OMI A;  1R7J A;  2F5V A;  2EV5 A;  1HC8 A;  1ETV A;  2OTL I;  3F23 A;  1LNW A;  4S04 A;  4YII A;  3A0B C;  4YIF A;  1OPC A;  1FIP A;  3CUO A;  4XID A;  3DCF A;  5B1A H;  3ABT A;  3LQR A;  5HS7 A;  2RN7 A;  2CW0 F;  4CSW A;  5KNL A;  1IXR C;  2WY8 Q;  3JRA A;  3ONQ A;  3QYF A;  4YG2 F;  6PAX A;  3ECO A;  5JFR A;  1VQ7 I;  1U8R A;  3IKT A;  2IS6 A;  2QSG X;  3FWE A;  1WJC A;  4RAY A;  4WWC A;  3Q0W A;  5JVT A;  5L3C A;  1SFU A;  2FOK A;  4QTR A;  1Y0N A;  2ID6 A;  1T38 A;  2WWY A;  1QPI A;  3HTU A;  1MBE A;  3FMR A;  5J8F A;  2FEZ A;  2KZV A;  3AG2 H;  3C2G A;  2JPC A;  4NBQ A;  4BXF A;  3CCS I;  4HQE A;  5LD2 C;  3PSF A;  2R5Y A;  2Y9Z A;  3HHH A;  1XGS A;  1JKO C;  1GHC A;  2E1M C;  3BR3 A;  5FKL A;  4A3J J;  5IT9 Z;  3ZQ7 A;  2ME6 A;  4ZJZ A;  4BNC A;  1JUM A;  1SEU A;  3DU6 A;  1XX5 A;  3HRT A;  1WJ5 A;  4D5C A;  5DD8 A;  1KU9 A;  2M7A A;  5EEG A;  3HOV J;  4S0H B;  2FE3 A;  3QOD A;  4L0Y B;  3VOE A;  2ZBK A;  4I2O A;  4KN7 X;  2XGX A;  4OIP F;  2IAI A;  2QYO A;  3DF8 A;  1SFX A;  5JHF A;  1WGX A;  2KPM A;  3OR2 C;  2GM4 A;  3OIQ A;  1VQK I;  4DJA A;  2BVM A;  3ABK H;  1BOB A;  3FHN A;  4KT5 C;  4LG0 A;  3ZR8 X;  1K4T A;  3SZP A;  1FYM A;  1K79 A;  2AHQ A;  2LR8 A;  3BG9 A;  2HOS A;  1CF7 A;  2VKV A;  2PEX A;  4IQJ A;  3HM5 A;  1O3T A;  3ELK A;  3DTE A;  4S05 A;  1J75 A;  3HKZ A;  4XM3 A;  5IYD J;  3K70 D;  5FLX Z;  4F52 A;  2V4J C;  1FTT A;  4IOA F;  3KEO A;  1OR7 C;  2DFI A;  2DW4 A;  4QWQ A;  1H8A C;  2QSF X;  1UEL B;  4XOP A;  2LP0 A;  2XRL A;  5IYB J;  3JAM Z;  1CQT A;  2PJR B;  2BXZ A;  1ITY A;  3HRM A;  2HEO A;  3HTS B;  2OV7 A;  4EVI A;  1HCR A;  5J6X A;  2VBX A;  4BY7 J;  2G9W A;  5IOZ A;  2AXT C;  5C4X J;  4E7S A;  3AL0 B;  5HDN A;  5FLM J;  1WJB A;  3LMM A;  3FK6 A;  4I99 C;  1P4A A;  4F91 B;  3K10 A;  2CH0 A;  1BR4 A;  3ZQQ A;  4HSR A;  4PCQ A;  4LG0 B;  3HOZ J;  3OYE A;  4B1R A;  1J5Y A;  1DU0 A;  2IVM A;  4KNY A;  2ZCW A;  4FCY A;  4KDP A;  1T0F C;  2O03 A;  1ETO A;  1QPM A;  1K6O A;  3LAP A;  3PJR A;  2L4M A;  2I10 A;  1DQU A;  5DM6 F;  3MKY B;  1O3S A;  2WV1 A;  2AQE A;  3RIR A;  3ZCO A;  3TO7 A;  2F5D A;  2M4G A;  2RQQ A;  4AU7 A;  4CYC B;  2IS4 A;  1XCB A;  3QWL A;  1MZB A;  1D8J A;  2RKH A;  2MLG A;  3K4B A;  1I39 A;  1XPX A;  1FBQ A;  2GLO A;  4UVA A;  1YRN B;  3O2P E;  2PJR A;  1FOW A;  5L3D A;  4ZC3 A;  1T6S A;  5CVV A;  5DEQ A;  3ZQH A;  4ZZL A;  1F1Z A;  1Y56 A;  3H9Q A;  4ZTJ A;  2H8R A;  3TOB A;  1PP8 F;  5CKT A;  4BBR J;  3OYJ A;  2V6C A;  2Y0M A;  2JVG A;  3F8N A;  1T2K A;  1TC3 C;  3HOU J;  3TO6 A;  2AQF A;  3TP0 A;  3LSJ A;  4N0B A;  1R4M B;  1UST A;  2TRT A;  5L3F A;  1XSD A;  3EET A;  3SXY A;  3ZMZ A;  1E2X A;  3OWT A;  1A6Q A;  2Z3Y A;  1DGR M;  3VYT B;  2A69 F;  1O3R A;  3DPT A;  3OYH A;  1TNS A;  2DTR A;  2JSC A;  3RCO A;  1R4N B;  5J4Y A;  4RLQ A;  2X1C A;  3JSP A;  1FOK A;  4D7N A;  3A01 B;  3F22 A;  1UHM A;  1NTC A;  3DPU A;  3I9V 2;  3PQJ A;  4A0X A;  1G4D A;  1KGS A;  4UY8 I;  3BZK A;  3K4M A;  4CYC A;  1BC8 C;  4IXA A;  4G6Q A;  3S17 J;  2HQN A;  5HVQ C;  4PJ0 C;  1IXS B;  1WWX A;  2E7W A;  3H9J A;  3L2W A;  3OL4 A;  5TRD A;  3GUD A;  2K86 A;  2XIG A;  2ZJR F;  3VPR A;  4WF2 A;  1WHU A;  2BOL A;  3F6O A;  3GXO A;  3LFK A;  1RES A;  4ZDP A;  2ISZ A;  3BR0 A;  3KP3 A;  2PLY A;  2DU9 A;  1L3L A;  5CVI A;  2M0C A;  2MG4 A;  1MBF A;  2JWT A;  3LFU A;  3VYU B;  5JR3 A;  4FHT A;  2R5Z B;  3M4O J;  2OBP A;  3QU6 A;  1E3O C;  3F21 A;  2V1D A;  4G8X A;  3GTL J;  1I6H J;  3FBI B;  3MAJ A;  2YPR A;  3K70 C;  1UB9 A;  2Y69 H;  1ZRD A;  3FXM A;  3FMQ A;  2DMN A;  4ZDL A;  4KT6 A;  3M7G A;  4XLN F;  1RUN A;  1W36 C;  3G2B A;  3V4G A;  2GIV A;  4XRF A;  3OYL A;  4X6A J;  5HDG A;  1Z77 A;  1YTY A;  2R7Z J;  1IW7 F;  1GVJ A;  3DQV C;  2DQL A;  1H9G A;  3F3X A;  1YS7 A;  3BT9 A;  4CCM A;  2JQ7 A;  4MHG A;  1W0T A;  5FKK A;  1YW9 A;  2HFH A;  2F48 A;  1ZR2 A;  1MBH A;  4BAY A;  4BE1 A;  1RC9 A;  1RRJ A;  4ZYD A;  1IGN A;  2K9S A;  1LFB A;  2CQX A;  4I0B A;  4A5N A;  4R8H A;  2HVQ A;  3CMY A;  1XSX A;  1YJ9 I;  2W84 A;  2ZXH A;  3S16 J;  2K9N A;  1Z21 A;  2M2E A;  1K78 B;  4UHT A;  3IAS 2;  4CDG A;  2R92 J;  4HA8 A;  4KIB A;  1QU3 A;  1GT0 C;  4HNT A;  4P9U A;  3MZ8 A;  2LY9 A;  2XHK A;  4NC7 A;  2O6G E;  3H3V K;  1PYV A;  2BY1 A;  1OCO H;  4LIT A;  4XLA A;  1VQM I;  1P7J A;  4GO1 A;  5FGM A;  1WH7 A;  4CIC A;  5FRN A;  3I59 A;  4BE0 A;  1WZ2 A;  2A05 A;  1HST A;  3ZRG A;  5LBQ A;  4D0P A;  2X48 A;  1YX3 A;  3CLO A;  2GQQ A;  3N05 A;  1Y39 A;  2BZT A;  2V1X A;  3H3Z A;  1FNN A;  2STW A;  1F4K A;  4QSH A;  3RKQ A;  2CW7 A;  2H6C A;  4M9Z A;  3CMM A;  3T8R A;  3TED A;  1ETW A;  3CES A;  2R7O A;  3AAF A;  2WB1 N;  2M45 A;  2VE8 A;  3L2R A;  1LB2 A;  1ZGJ A;  1TLH B;  2MC4 A;  4HLY A;  2O7O A;  2EA4 A;  3EDP A;  4XNF A;  1O7L A;  4DW6 A;  2IT0 A;  4YIR X;  3BP8 A;  4L5E A;  1ERD A;  5D6E A;  2IS1 A;  1BIB A;  5EG0 B;  2IS2 A;  2X4H A;  5IP9 J;  3RI4 A;  5A2Q Z;  2L9R A;  2QQ9 A;  1H89 C;  2LF8 A;  4M3G A;  5IPA A;  2WC2 A;  3I5U A;  2QCO A;  5K1Y A;  1YE9 A;  4CH7 A;  1B1B A;  3GLX A;  5LGN A;  5DTD A;  1R6R A;  3HGY A;  3H5A A;  3S93 A;  2E1N A;  1D5Y A;  5DD4 A;  2DOE A;  4MQ9 F;  5H20 A;  4F3Q A;  5C44 J;  1X1P A;  3RDI A;  3CCE I;  1MBK A;  1P92 A;  2Z33 A;  4RGX A;  2K27 A;  2JZY A;  2V1N A;  3DXJ F;  1DUX C;  1MSE C;  2M9H A;  2F5E A;  2MW8 A;  4IOC F;  2KJC A;  3K4L A;  1IN5 A;  4DYC A;  4JX4 A;  1TWG J;  3S1M J;  1TT5 B;  2G7U A;  2Y0S A;  3SFI A;  3RYR A;  4XOT A;  3MZY A;  5EG0 A;  1GVD A;  2RDP A;  1NH3 A;  3RPU A;  2ZXI A;  1BJA A;  1J09 A;  1OQY A;  3CJR B;  1ACI A;  4LJZ F;  3OL3 A;  2DO7 A;  3HOW J;  2WAQ A;  1MMG A;  4NDL A;  2L3D A;  3A2K A;  2GA2 A;  5E8G A;  5BQT A;  1BW6 A;  1AKH A;  4LFU A;  3COA C;  5K7Z A;  2CG4 A;  2JK3 A;  4MNU A;  2L7K A;  2RNG A;  3G3Z A;  1VQP I;  2L9S A;  2OCC H;  2W4S A;  3PO2 J;  1WVR A;  1T0F A;  3V7C A;  1KA8 A;  2M1B A;  1UHS A;  1ZKG A;  3TBI A;  3WG7 H;  3F72 A;  2E2I J;  3GX4 X;  1UG0 A;  5M5W J;  1F9N A;  1AA7 A;  3M8F A;  1OKR A;  1RET A;  2VLA A;  2DFH A;  3S2W A;  2FF4 A;  2HTS A;  3DEE A;  4XMY A;  3C2B A;  5HS9 A;  5J40 A;  4P5O A;  5J1Y A;  4GCV A;  2EFN A;  1SAX A;  2PQ8 A;  3OIO A;  2IJL A;  2ELJ A;  3MKL A;  5CPR B;  4J00 A;  2CUJ A;  5BPI A;  4II2 A;  3S3N A;  5HNH A;  2QA4 I;  2O0Y A;  4IO9 F;  1EF4 A;  1KQ9 A;  1OCC H;  1X4P A;  3P9I A;  4JQF A;  2XPU A;  4W1U A;  3S3O A;  2FSW A;  4BEH A;  1R00 A;  4UV9 A;  3PNV A;  2E2H J;  1W7P A;  2YS9 A;  3OYA A;  4CZZ A;  2RAE A;  2BGC A;  2E34 A;  4OMY A;  2Y75 A;  1BL0 A;  5M3M J;  2PX9 A;  1WKM A;  1S3J A;  4FE4 A;  1Y1W J;  2IBD A;  4PGG A;  2OF7 A;  1EV7 A;  3Q9V A;  1X1D A;  5IY5 H;  2BYV E;  2NXN B;  4IKF A;  1T98 A;  3SJM A;  1IRF A;  3LA2 A;  3E5U A;  2HNH A;  2O9L A;  3ZQG A;  1QGP A;  3S2D J;  2ICW G;  3CQZ J;  2IGN A;  2DQR A;  4HLX A;  1JT6 A;  1D0Z A;  1FBU A;  2A6T A;  4DBR A;  3F9K A;  4M6V A;  1Y8Q B;  3HPH A;  3C1D A;  1R71 A;  2ZKZ A;  4FTH A;  1RKW A;  2IEK A;  3GFM A;  2KIF A;  2HQA A;  2FNA A;  3HEF A;  2BHZ A;  2KRH A;  4BU2 A;  3L2C A;  2EJR A;  2W48 A;  3DKX A;  3K4J A;  3BLY A;  4QIW N;  1ZEL A;  5FO5 A;  3S1N J;  2IPQ X;  1W7P B;  1AU7 A;  5FRM A;  4M3E A;  3E6D A;  1LFP A;  1IRG A;  1UCR A;  2K4J A;  2HZD A;  2ZJQ F;  2VQH A;  3BQZ A;  1FT9 A;  3OYN A;  4HG2 A;  4MTE A;  4O5V A;  1NK2 P;  2EV0 A;  1XN7 A;  4MTD A;  5LRR A;  2HXO A;  1R9T J;  2QQ8 A;  3IC7 A;  3FZV A;  2M30 A;  3CUQ A;  3T1B A;  3TKY A;  3VSL A;  5K5R A;  1SFE A;  2W85 A;  1ZN2 A;  3HUG B;  1RI7 A;  5HNF A;  5J1U A;  4HF0 A;  1IJW C;  3BR6 A;  1I5Z A;  4WXH A;  2HI3 A;  1IDY A;  1S8N A;  1DP7 P;  4FAS D;  1IUF A;  4M6X A;  1VF9 A;  3L9F A;  1VQN I;  1ZYR F;  2X1D A;  4DIQ A;  2PMZ N;  3ZP5 A;  3I56 I;  5DS9 A;  1SD5 A;  1T08 B;  2CV0 A;  1MDM B;  2CRG A;  4PZJ A;  3MZH A;  1RNL A;  1NG6 A;  3CO6 C;  3JR9 A;  3ZMU A;  1E17 A;  1MW7 A;  2LNB A;  3NQO A;  1KZH A;  4MFD A;  1UMQ A;  3IH3 A;  4MO7 A;  3ABL H;  3E5X A;  4Z6Y A;  5FKM A;  2DT6 A;  4QLC U;  4A12 A;  5EYR A;  2NAZ A;  3MN2 A;  1JKR C;  3PM1 A;  3BG3 A;  3LQQ A;  4YFK F;  1K7A A;  2OA4 A;  3TDZ C;  3N97 A;  1U0J A;  3BJA A;  2KKO A;  3WHB A;  2WAF A;  1YW7 A;  5CJ9 A;  4B44 A;  3M9A A;  2G7H A;  1U5T B;  1T95 A;  2KIS A;  3I53 A;  3KP4 A;  2B9S A;  3CCR I;  2VKD A;  2VXZ A;  3I4P A;  2E60 A;  2HVS A;  5GAE J;  3LSK A;  4J19 A;  1WI9 A;  4GYI A;  4X0G A;  5HLI A;  5M3F J;  2YSR A;  4R1H A;  4U87 A;  5GPC A;  4IEJ A;  3QYB A;  2I8D A;  4XRM A;  1X1A A;  4AVP A;  2XRO A;  2Z99 A;  5FKN A;  5FD6 A;  3IH2 A;  1SFK A;  1HLV A; 
#chains in the Genus database with same CATH homology
 4EJW A;  2O61 A;  3RKX A;  3FXR A;  3QU3 A;  2A07 F;  1YFH A;  2DK5 A;  4Q48 A;  5DV5 A;  2YX7 A;  4A2U A;  2QM3 A;  1R5G A;  3R61 A;  3GWZ A;  1FPQ A;  5IT9 K;  1STZ A;  1LDD A;  2MH9 A;  4HYE A;  1I1S A;  5FFX A;  4BXU A;  4RB2 C;  1IF1 A;  2F2E A;  2YR2 A;  1Z9C A;  2K02 A;  4LK0 F;  3J81 K;  3E5Q A;  4Y15 A;  4G9Y A;  3K0L A;  2GA1 A;  5K5Q A;  3J80 Z;  4FX0 A;  5IT3 A;  4ZZD A;  2M8E A;  5E1X A;  4ETS A;  2FBK A;  1XB4 A;  3K69 A;  4NHJ A;  2P5K A;  2ISY A;  2EV6 A;  2W24 A;  4I09 A;  2HQR A;  3HSF A;  3O3K A;  4RGU A;  4PDK A;  3C18 A;  2PG4 A;  5ICG A;  1RIO H;  1ZAR A;  1SMY F;  4NQW A;  1V3F A;  3KCC A;  3I0T A;  5DCF A;  3EYI A;  3KEQ A;  1L0O C;  2HR3 A;  4IVN A;  4AIJ A;  3P9K A;  3KET A;  2PFB A;  3ERE D;  5LHI A;  4CGZ A;  4L9T A;  4CHU A;  4ZYG A;  5D5U B;  1J9I A;  4WX9 A;  3QOP A;  2FA5 A;  3R0J A;  1Z6R A;  3C3W A;  2H94 A;  3HSR A;  2JTV A;  4KIF A;  4IRG A;  2B0L A;  1ONV A;  4U7B A;  4KIC A;  3BJO A;  2PJP A;  2V1U A;  1G3S A;  3L00 A;  1XD7 A;  3BDD A;  2ZME A;  4LB5 A;  2F5F A;  3VEP A;  2O3F A;  1TW2 A;  4G94 A;  3W6K B;  1AOY A;  2BBY A;  2YU3 A;  2VBZ A;  2F5C A;  2W25 A;  3DKW A;  4PGH A;  3F6V A;  2OZ6 A;  2XKO A;  3KZY A;  1FSE A;  2XV4 S;  2J5O A;  3BJ6 A;  1MGT A;  3DP7 A;  1B59 A;  2ZME B;  4XSX F;  1I1G A;  4LLG F;  2EWN A;  1BM9 A;  1LEA A;  4KA4 A;  3HRU A;  1CGP A;  2FBH A;  2DK8 A;  4OIQ F;  5CVU A;  3R0A A;  1KQ8 A;  1FY7 A;  4ZYH A;  2CSO A;  2PMU A;  2OAZ A;  4ESJ A;  4CO8 A;  2XVC A;  5E18 F;  2DI3 A;  4ESF A;  5A2Q K;  4M72 A;  2HTJ A;  3WTX C;  3M8E A;  2IP2 A;  5KVR A;  1KU2 A;  3N4M A;  1OYY A;  3FM3 A;  1Q1H A;  3QP6 A;  4IJA A;  4A6D A;  1W5T A;  4ENN A;  1ZH5 A;  1JE8 A;  3MCZ A;  2QEN A;  1DDN A;  2Q2E A;  1CF7 B;  1LQ1 A;  2DPD A;  1GXP A;  3B73 A;  2EFW A;  1QQI A;  2ZNZ A;  2XAH A;  4M9X A;  3WTY C;  2OU2 A;  2D1V A;  4EQQ A;  4U0Y A;  3HHG A;  5E1W A;  4EGY A;  1J0R A;  3VFZ A;  2XRN A;  2VT2 A;  2DLL A;  2HOE A;  2XAQ A;  1G3W A;  1ON2 A;  3K1M A;  1J2X A;  4L5I A;  5ICC A;  1H0M A;  2JT1 A;  3BZ6 A;  3LWF A;  2CWE A;  2D2W A;  1YO5 C;  3L7W A;  5DUK A;  4JK1 X;  2QZ8 A;  2PN6 A;  3WTS C;  2V9V A;  2A6E F;  1BN5 A;  2A3S A;  3LST A;  2VC0 A;  3WOD F;  2BE5 F;  3JTG A;  1UHW A;  1R22 A;  3V7S A;  3V7R A;  1S29 A;  1MD0 A;  3H92 A;  2MC3 A;  4HX7 A;  4IHT A;  1D5V A;  1YG2 A;  1IUY A;  4IRH A;  4G7H F;  3ZMT A;  2HDC A;  3T0Y A;  1HBX G;  4G7Z F;  4AD9 A;  1Z6T A;  1ZGA A;  1YLF A;  3CJN A;  3FM5 A;  3ZN0 A;  1OYW A;  5ICF A;  1P4X A;  1PUE E;  3ZMS A;  4FT8 A;  4BHC A;  2FMY A;  5D8L B;  3KP7 A;  1QNT A;  3E6C C;  1IZ1 A;  1TQI A;  1PP7 U;  4B8X A;  1XGM A;  5CVR A;  2L01 A;  5CVJ A;  5K5O A;  1J7K A;  2AXL A;  3PFI A;  5D5X B;  2FQ3 A;  4ON0 A;  4OIO F;  2BEO A;  2EA2 A;  4GGG A;  2ESH A;  1KYW A;  2JPB A;  4I0A A;  5KK1 A;  1Y0U A;  5FD5 A;  5BMZ A;  2P7V B;  2RV8 A;  1K78 A;  2RNJ A;  3GO5 A;  2ZFW A;  3BWG A;  1RZ4 A;  4EMS A;  4RB3 C;  4MEX F;  2GAU A;  4U0W A;  3C7J A;  3GVA A;  3QP5 A;  5TJJ A;  2OQG A;  2HYG D;  1YS6 A;  2NNN A;  3I59 B;  1WQ2 A;  4HX4 A;  5ILS A;  2HS5 A;  1R36 A;  2FXA A;  1QO0 D;  4UVB A;  2QQA A;  2KRF A;  1G3Y A;  2P6T A;  2EFO A;  3R4K A;  3LAJ A;  1B4A A;  4HV6 A;  4I7H A;  3BY6 A;  4P96 A;  2MH2 A;  3CUQ C;  3RKW A;  5ILV A;  5JHU A;  3CDH A;  1W7P D;  5AON A;  5AIQ A;  3WE2 A;  2IA1 A;  4N9I A;  2LSO A;  4MGR A;  2ESN A;  1G6N A;  3ECH A;  4E70 A;  2VN2 A;  2Q8K A;  5LLQ A;  2MLK A;  3TQN A;  3ULQ B;  2UWM A;  5HLH A;  3IKV A;  2A6H F;  4EM2 A;  4MEY F;  1BI0 A;  3ABU A;  3QPH A;  4KIG A;  1I27 A;  4ENJ A;  2ACJ A;  1REP C;  4YFN F;  4EM0 B;  4LLN A;  5ICE A;  2KIM A;  3V8J A;  2L4A A;  4DNC A;  2A5Y B;  2NRA C;  4BYY A;  4O3M A;  2Z5U A;  1G3T A;  1Z91 A;  3J81 Z;  2OD5 A;  3EUH A;  2QLZ A;  4IPA A;  3ISP A;  2GXB A;  4XBF A;  4Z2Y A;  4HAM A;  4LK1 F;  2CQK A;  4WK8 F;  5F1R A;  5ED4 A;  3KE2 A;  1FYL A;  1XSV A;  4ESB A;  3GZ6 A;  3W6J B;  3KFW X;  2EB7 A;  3JW4 A;  1U2W A;  1SMT A;  1TTY A;  1QZZ A;  4U0V A;  5E1Z B;  2D45 A;  2NYX A;  4TV7 A;  3I58 A;  4RB0 A;  2HZT A;  1IN8 A;  3IRQ A;  4P9F A;  4GYG A;  5F64 A;  1D8K A;  1VTN C;  3BPV A;  3D0S A;  5AIP A;  4XSZ F;  3WGH A;  1DPR A;  1IN7 A;  2DT5 A;  4HZF A;  4L5J A;  5HOO A;  2KJB A;  1QZY A;  1HQC A;  2CO5 A;  4IHS A;  3QPT A;  5LEJ A;  1XMK A;  1O57 A;  1FZP B;  4HOB A;  2FBI A;  3R6S A;  4ZYE A;  3SZT A;  3E6B A;  3IWZ A;  5ILU A;  4EJU A;  2E1C A;  4KUM A;  2HWV A;  5FFZ A;  2QUF A;  3ZPL A;  1R23 A;  3SHF A;  3CO7 C;  4EJV A;  1LVA A;  4BQA A;  1MJA A;  3U2R A;  1BIA A;  1KU7 A;  3FX3 A;  4I01 A;  3FMS A;  4HX8 A;  3U1D A;  3L09 A;  3HUG A;  1FBS A;  1HW1 A;  2LF7 A;  2A61 A;  4RS8 A;  3MQ0 A;  1BI1 A;  3EQL F;  3KP5 A;  1RUO A;  4EV0 A;  1ZAO A;  2Z9O A;  2PMH A;  4ASN A;  1MDM A;  4KN4 X;  5LEK A;  5DYM A;  4CYD A;  2VBW A;  4M6Y A;  1U3E M;  5F6F A;  3OV8 A;  1ZG5 A;  4G6D A;  4I98 B;  4Y17 A;  1OR7 A;  3P9C A;  4XLP F;  1ZRF A;  3V8K A;  3KLN A;  2BV6 A;  2CGP A;  1O7F A;  1HKT A;  5D4R A;  2ELH A;  4EGZ A;  1FSH A;  5HDK A;  2UXX A;  3RTR A;  3I54 A;  4Q5S F;  3F8M A;  5LGT A;  1ZRE A;  4I02 A;  4A5M A;  2O8X A;  3LA3 A;  2MBF A;  2ZJ2 A;  2E7X A;  1USS A;  5E8I A;  2COM A;  2XUB A;  3E6M A;  2EFQ A;  4A0Z A;  1S7A A;  4MQV A;  4WCG A;  3RYP A;  3ZMD A;  1V4R A;  3IHU A;  3NRV A;  1TBX A;  4HF1 A;  1H9T A;  1X3U A;  4AIK A;  4BH9 A;  1S7O A;  3TO9 A;  2QQB A;  2STT A;  4M71 A;  2IRF G;  3GEZ A;  4HF2 A;  3RPQ A;  2XAJ A;  1FWZ A;  1R1U A;  3K2Z A;  1WSU A;  1DPU A;  4HQM A;  2EFP A;  1ULY A;  3CTA A;  3I71 A;  1AWC A;  5ERI A;  3TGN A;  1R1V A;  3E3V A;  2VE9 A;  1QBJ A;  2GWR A;  4OIN F;  3WTV C;  2QBY B;  4UUV A;  1TNT A;  4RAZ A;  4HV5 A;  3WU1 B;  1PDN C;  1R58 A;  4U7D A;  2MA3 A;  2P7C B;  1XMA A;  1ON1 A;  2ADU A;  1IN6 A;  4Q47 A;  5DCM A;  1OYI A;  4RGR A;  5E17 F;  3GFI A;  2R3S A;  5CYV A;  4G7O F;  2RGV A;  1MJ9 A;  2VOD A;  5D5W B;  4M9S A;  2DPU A;  3WTW C;  3MFK A;  4UNO A;  3WU0 A;  1UFM A;  2HGC A;  3D5L A;  3JSO A;  1YW8 A;  1F5T A;  2CFX A;  4IF4 A;  3KLO A;  1U6G A;  2QBY A;  2FRH A;  1JGS A;  1ZLJ A;  1XDS A;  4JBA A;  4LGW A;  4UVC A;  1FYK A;  3WTZ A;  3K1N A;  2ZO4 A;  2IA2 A;  5DCM B;  3V8L A;  2EK5 A;  2NS0 A;  1WRJ A;  4NB5 A;  5HLG A;  1YQA A;  4ENM A;  1BI2 A;  4AIH A;  2P6S A;  1T39 A;  2VOO A;  4L9J A;  5DDG A;  2RC4 A;  5FLX K;  1SD4 A;  2CYY A;  3IL2 A;  3DV8 A;  2A68 F;  3GFL A;  3MWM A;  4N9H A;  2VOP A;  4FX4 A;  3G73 A;  3DPL C;  3F8F A;  4KYW A;  1BI3 A;  2H27 A;  1I6X A;  3E97 A;  1HKQ A;  2X0L A;  5H6R A;  2UXN A;  4RGS A;  4LB6 B;  4UV8 A;  4BHP A;  2VON A;  4UXN A;  1FP1 D;  1ZLK A;  1A04 A;  1BC7 C;  3SFZ A;  3BRO A;  3GFJ A;  1BBY A;  4M73 A;  1XDU A;  4CXF A;  4AWX B;  3WTT C;  3HOS A;  2YX4 A;  5LGU A;  2HKO A;  3F8B A;  2P4W A;  3GW2 A;  2NNY A;  1U78 A;  2FML A;  4F7Z A;  5LHH A;  1Z7U A;  3J80 K;  2AS5 F;  3GF2 A;  2XAF A;  3U9G A;  4P55 A;  2PI0 A;  1LEB A;  4A6E A;  3Q9S A;  2H09 A;  4EJO A;  3WGI A;  1KYZ A;  2XAS A;  2M87 A;  1IXC A;  2R7D A;  4LMY A;  1B6A A;  3SQN A;  1HW5 A;  3M1E A;  3JTH A;  4WXD A;  2LKP A;  4WXC A;  2VT3 A;  1R5H A;  3QAH A;  1U5T C;  1TW3 A;  3K9T A;  4Q4Z F;  1SD6 A;  4BHB A;  4Y13 A;  1C0W A;  2DAO A;  1YIO A;  4IRI A;  3WTU C;  5H6Q A;  1FLI A;  2Y48 A;  4ENK A;  2WTE A;  4H0E A;  1B9M A;  2W57 A;  1NHA A;  3CUQ B;  1W4M A;  5BPD A;  2P5L C;  3RKY A;  3T5X A;  3QRF F;  2ZXJ A;  2P8T A;  2ZNY A;  3HOT A;  1ODD A;  1TQP A;  2H6B A;  3TOA A;  3DFG A;  1JHH A;  3WGG A;  2HYF A;  2MD5 A;  1SD7 A;  2UZK A;  4L0Z B;  3FXU A;  1JHF A;  5CLS A;  2M5W A;  2C6Y A;  5BOX A;  1KQ0 A;  1FC3 A;  3P7N A;  3BPX A;  1LJ9 A;  1KU3 A;  1R1T A;  1MKM A;  2ETH A;  1ZG1 A;  1HXD A;  5D5V B;  1HKS A;  1U5T A;  4B09 A;  3RJP A;  4OU0 A;  4OMZ A;  5LRS A;  2D1H A;  1GXQ A;  3HSE A;  4GXO A;  4HBL A;  2R7F A;  3F8C A;  3ML6 A;  3EYY A;  2PBI A;  4ZH4 F;  1EH6 A;  3B02 A;  3WE3 A;  2OZU A;  2VBY A;  1P2F A;  2Q0O A;  3FF5 A;  3HIF A;  2TDX A;  1YYV A;  1J59 A;  5D8K B;  1FP2 A;  2L54 A;  3FXQ A;  5L3G A;  1EH7 A;  4HW0 A;  4YFX F;  4OIR F;  2K4B A;  1FX7 A;  3ROU A;  5JI6 A;  1B9N A;  5DUI A;  4HDU A;  2RQP A;  1ZG3 A;  4R79 A;  4KMU X;  4K2E A;  2XAG A;  2P5V A;  3KP6 A;  4KFC A;  3HYI A;  5D6F A;  1S6L A;  3I64 A;  3R60 A;  4L9V A;  3DEU A;  3OOP A;  1XGO A;  3T8T A;  2DBB A;  2K7L A;  3O6B B;  1Z05 A;  1ZRC A;  5FB2 A;  5HS8 A;  2XKP A;  4LD5 A;  3HRS A;  3IWF A;  2GXG A;  1MJB A;  4M74 A;  3NEU A;  1XGN A;  1P4W A;  2KIU A;  3BOQ A;  3WG9 A;  3KP2 A;  3GYH X;  2FNP A;  3PQK A;  4EJT A;  4HDV A;  3FHZ A;  5E20 A;  2HKX A;  2IW5 A;  1LDJ A;  4L9N A;  4L18 B;  1EH8 A;  1XCV A;  4LLL A;  4A0Y A;  3IRR A;  1IAW A;  3KZZ A;  1BOA A;  2JRT A;  3ZMV A;  1LDK B;  4DQ2 A;  1IN4 A;  3H3U A;  1HW2 A;  5L3B A;  1P6R A;  4U88 A;  5LHG A;  1D3Y A;  2J5P A;  4RB1 A;  3LA7 A;  3GZ5 A;  5L3E A;  3ZN1 A;  3Q5F A;  4KMF A;  3J7A O;  5EEH A;  1W5S A;  2LDU A;  3JAM K;  5D4S A;  4EM1 A;  3MEX A;  3REO A;  4OOI A;  1O3Q A;  3VOD A;  2L02 A;  4O6J A;  2RVC A;  1TQM A;  2QWW A;  2QVO A;  5J8C A;  2OQR A;  2VC1 A;  2WV0 A;  2IA0 A;  3VB2 A;  1JXS A;  3K1P A;  3TDU C;  5BS6 A;  2GZW A;  2FU4 A;  1HSJ A;  2V79 A;  1ZHF A;  1Z1D A;  1OMI A;  1R7J A;  2EV5 A;  3F23 A;  1LNW A;  4S04 A;  4YII A;  4YIF A;  1OPC A;  3CUO A;  3ABT A;  3LQR A;  5HS7 A;  2RN7 A;  2CW0 F;  1IXR C;  4YG2 F;  6PAX A;  3ECO A;  5JFR A;  1U8R A;  3IKT A;  3FWE A;  4RAY A;  4WWC A;  5JVT A;  5L3C A;  1SFU A;  2FOK A;  1T38 A;  2WWY A;  3HTU A;  3FMR A;  5J8F A;  2FEZ A;  2JPC A;  4HQE A;  3HHH A;  1XGS A;  1GHC A;  5IT9 Z;  3ZQ7 A;  4BNC A;  3HRT A;  5DD8 A;  1KU9 A;  5EEG A;  2FE3 A;  4L0Y B;  3VOE A;  2ZBK A;  4I2O A;  4KN7 X;  2XGX A;  4OIP F;  2QYO A;  3DF8 A;  1SFX A;  4KT5 C;  4LG0 A;  3SZP A;  1FYM A;  1K79 A;  1CF7 A;  2PEX A;  1O3T A;  3ELK A;  4S05 A;  1J75 A;  5FLX Z;  3KEO A;  2DW4 A;  2DFI A;  4QWQ A;  3JAM Z;  3HTS B;  3HRM A;  2HEO A;  4EVI A;  5J6X A;  2VBX A;  2G9W A;  5HDN A;  1P4A A;  4PCQ A;  4LG0 B;  1J5Y A;  2IVM A;  4KNY A;  2ZCW A;  4KDP A;  2O03 A;  1K6O A;  1QPM A;  3LAP A;  2L4M A;  1O3S A;  3RIR A;  3TO7 A;  2F5D A;  1XCB A;  1MZB A;  1D8J A;  2RKH A;  2MLG A;  1FBQ A;  4UVA A;  3O2P E;  5L3D A;  1T6S A;  5CVV A;  5DEQ A;  4ZZL A;  1F1Z A;  3TOB A;  1PP8 F;  2V6C A;  2Y0M A;  3F8N A;  1T2K A;  3TO6 A;  4N0B A;  1UST A;  5L3F A;  1XSD A;  3EET A;  3SXY A;  3ZMZ A;  1E2X A;  2Z3Y A;  2A69 F;  1O3R A;  3DPT A;  1TNS A;  2DTR A;  2JSC A;  3JSP A;  1FOK A;  3F22 A;  1UHM A;  3PQJ A;  4A0X A;  1G4D A;  1KGS A;  1BC8 C;  4IXA A;  4G6Q A;  2HQN A;  5HVQ C;  1IXS B;  1WWX A;  2E7W A;  5TRD A;  3GUD A;  2K86 A;  2XIG A;  4WF2 A;  3F6O A;  3LFK A;  3GXO A;  2ISZ A;  3KP3 A;  2PLY A;  2DU9 A;  1L3L A;  5CVI A;  5JR3 A;  4FHT A;  2OBP A;  3QU6 A;  3F21 A;  2V1D A;  4G8X A;  3MAJ A;  2YPR A;  1UB9 A;  1ZRD A;  3FMQ A;  3M7G A;  4XLN F;  1RUN A;  3V4G A;  2GIV A;  4XRF A;  5HDG A;  1YTY A;  1IW7 F;  1GVJ A;  3DQV C;  2DQL A;  1H9G A;  3F3X A;  1YS7 A;  4MHG A;  1YW9 A;  2HFH A;  4BAY A;  4ZYD A;  4I0B A;  4A5N A;  4R8H A;  1XSX A;  2W84 A;  1K78 B;  4UHT A;  4CDG A;  4HA8 A;  4KIB A;  4P9U A;  2XHK A;  2O6G E;  4GO1 A;  5FGM A;  4CIC A;  3I59 A;  1HST A;  5LBQ A;  4D0P A;  3CLO A;  2GQQ A;  2V1X A;  3H3Z A;  1FNN A;  2STW A;  1F4K A;  4M9Z A;  2H6C A;  3T8R A;  3AAF A;  2M45 A;  2VE8 A;  1LB2 A;  1ZGJ A;  1TLH B;  4HLY A;  3EDP A;  2EA4 A;  2IT0 A;  1O7L A;  3BP8 A;  5D6E A;  1BIB A;  2X4H A;  3RI4 A;  5A2Q Z;  2QQ9 A;  2LF8 A;  2WC2 A;  3I5U A;  5K1Y A;  1B1B A;  3GLX A;  5LGN A;  2E1N A;  5DD4 A;  4MQ9 F;  5H20 A;  3RDI A;  1P92 A;  2Z33 A;  4RGX A;  2K27 A;  2JZY A;  3DXJ F;  1DUX C;  2F5E A;  2KJC A;  1IN5 A;  2G7U A;  3RYR A;  3MZY A;  2RDP A;  3RPU A;  1BJA A;  4LJZ F;  2DO7 A;  2L3D A;  2GA2 A;  5E8G A;  5BQT A;  4LFU A;  3COA C;  2CG4 A;  4MNU A;  3G3Z A;  3V7C A;  1T0F A;  1KA8 A;  2M1B A;  3F72 A;  3GX4 X;  1F9N A;  3M8F A;  1OKR A;  3S2W A;  2FF4 A;  2HTS A;  5HS9 A;  4P5O A;  4GCV A;  2EFN A;  1SAX A;  2PQ8 A;  2IJL A;  5BPI A;  2O0Y A;  1KQ9 A;  3P9I A;  4JQF A;  2FSW A;  1R00 A;  4UV9 A;  1W7P A;  4CZZ A;  2BGC A;  4OMY A;  2Y75 A;  1WKM A;  1S3J A;  4PGG A;  1EV7 A;  3Q9V A;  2BYV E;  1T98 A;  1IRF A;  3LA2 A;  3E5U A;  1QGP A;  2DQR A;  4HLX A;  1FBU A;  3C1D A;  2ZKZ A;  3GFM A;  2KIF A;  2FNA A;  3L2C A;  2EJR A;  5FO5 A;  2IPQ X;  1W7P B;  3E6D A;  1IRG A;  1UCR A;  2K4J A;  1FT9 A;  4MTE A;  4O5V A;  2EV0 A;  1XN7 A;  4MTD A;  5LRR A;  3IC7 A;  3FZV A;  2M30 A;  3CUQ A;  3T1B A;  3TKY A;  5K5R A;  1SFE A;  2W85 A;  1ZN2 A;  1RI7 A;  4HF0 A;  1I5Z A;  4WXH A;  1S8N A;  1DP7 P;  4M6X A;  3L9F A;  1ZYR F;  3ZP5 A;  1SD5 A;  1MDM B;  4PZJ A;  3MZH A;  1RNL A;  3CO6 C;  3ZMU A;  1E17 A;  2LNB A;  3NQO A;  3E5X A;  4QLC U;  4A12 A;  2NAZ A;  3LQQ A;  4YFK F;  1K7A A;  2OA4 A;  3TDZ C;  3N97 A;  3BJA A;  2KKO A;  1YW7 A;  5CJ9 A;  3M9A A;  2G7H A;  1U5T B;  3I53 A;  3KP4 A;  2VXZ A;  3I4P A;  1WI9 A;  4GYI A;  5HLI A;  2YSR A;  4R1H A;  4AVP A;  2XRO A;  2Z99 A;  5FD6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...