3G73A

Structure of the foxm1 dna binding
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
90
structure length
90
Chain Sequence
SVSERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Forkhead box protein M1
publication title Structure of the FoxM1 DNA-recognition domain bound to a promoter sequence
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 18
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3g73A00
4ESBA 4NB5A 1YQAA 2VBYA 3I59A 3WE2A 3T8RA 1TW2A 1IRFA 3ABUA 4KMUX 2J5OA 1PP8F 5L3FA 1RUOA 5H6QA 2Q0OA 4NQWA 5DCMB 4AVPA 2P4WA 1UHMA 2QBYA 3HSFA 2OBPA 1S29A 2P5VA 2A07F 5L3BA 1I1GA 3NQOA 3RKXA 2DT5A 3MWMA 2VT2A 2ZBKA 4CICA 3V4GA 2IJLA 1S7OA 1SD4A 3L2CA 4KUMA 2EV6A 1LDKB 1OYWA 1MJ9A 6PAXA 5F1RA 1W7PB 2ESHA 1H0MA 2M30A 1WI9A 4YFNF 1TLHB 5IT9Z 4RB0A 1FWZA 3RTRA 4EM0B 4L9NA 3E5XA 1Z1DA 2IP2A 2DQRA 4EJOA 3ZN0A 4LLNA 1S3JA 2V1UA 3CO7C 1XDUA 2A69F 5HDGA 1W5TA 3ISPA 4BHPA 4ZYDA 3FMSA 2PJPA 1IN6A 3TDZC 1LVAA 1S6LA 1J75A 5TJJA 4CGZA 5JHUA 3SZPA 4HOBA 4EV0A 5LRSA 4G7OF 1FOKA 4RB1A 3K1NA 1K7AA 1ZHFA 3HRTA 4RB3C 3DF8A 4HX7A 3KP2A 3I54A 3KP3A 1IXCA 1FT9A 1TQMA 4UV9A 1XDSA 5E1ZB 1F4KA 2EFWA 4ENJA 1B9NA 2HFHA 3JTGA 3IKTA 1SMYF 1QZZA 3HSRA 2QYOA 3E5QA 5HVQC 1P4XA 4A6EA 2QUFA 3GFJA 2DFIA 2W85A 2DTRA 1AWCA 3M1EA 1HQCA 3K1PA 4HW0A 4MTDA 3DFGA 4KYWA 4GGGA 4R1HA 3FM5A 3DPLC 2JSCA 2CW0F 3W6KB 1JHHA 4I0AA 2XUBA 1FSEA 3JW4A 3ECHA 2CYYA 3WU0A 3RKYA 1ZYRF 1DUXC 2JPBA 3LAJA 2MLGA 1SD5A 3L7WA 4OU0A 4KA4A 5DV5A 1L0OC 1B4AA 1KYWA 2RQPA 2ZNYA 3R61A 3B02A 1ZREA 2O61A 4N0BA 1LJ9A 1SFEA 5DYMA 3HTSB 1HBXG 1T98A 1RNLA 4OINF 1LDJA 2VC0A 3F8BA 3SXYA 3J81K 3T1BA 5HS9A 3WGHA 5F6FA 5ED4A 3Q5FA 4M6XA 1Q1HA 1YLFA 1IRGA 1J9IA 2DPDA 5E8GA 4MTEA 5E1XA 2P7CB 2WTEA 1U2WA 2LKPA 3T8TA 3BPXA 1ZGAA 1CF7B 2FBKA 2P8TA 2TDXA 3JTHA 2V6CA 3MFKA 3ZMSA 2VODA 2FF4A 2X0LA 3RYPA 3I64A 1KGSA 4IRGA 4UV8A 3BJOA 1W7PA 4JQFA 4A12A 3GFIA 3K1MA 1MGTA 2YR2A 4L9TA 4ETSA 4UNOA 2D1VA 1ZARA 2EA2A 5AIQA 1ZLJA 1R1TA 1ULYA 3F8FA 4I02A 2Q8KA 3C7JA 2YX7A 3O3KA 4I09A 1Z6TA 4XLPF 3SHFA 5HLHA 4WCGA 3RI4A 3IC7A 3E6MA 2R7FA 1R7JA 2LDUA 2OZ6A 2PG4A 2V1XA 3I59B 4LMYA 2STWA 1FPQA 2GA1A 2FOKA 5L3DA 3DP7A 2OU2A 5A2QK 5IT3A 4HX4A 1HKSA 1K79A 4WXCA 3J80Z 1MJAA 5D4SA 1IXSB 3TOBA 4DQ2A 4L5IA 4A6DA 1F5TA 2QBYB 2F2EA 1FLIA 3WTWC 2M8EA 3H92A 1F9NA 1IN8A 1UB9A 4H0EA 5LEKA 2RN7A 2K02A 4P96A 2YPRA 2JTVA 4U7DA 3L09A 2ZKZA 2Z99A 5CVUA 4GO1A 1R00A 4HA8A 3P9IA 4I01A 3IRQA 2HWVA 4CO8A 4L18B 1BBYA 3TQNA 2PN6A 1JXSA 2W25A 5K5QA 1ZRFA 5DDGA 3ABTA 3RYRA 5HOOA 1H9TA 5K1YA 5ILSA 1QO0D 4LJZF 4P9FA 4ZYGA 3CLOA 3RJPA 3ZMVA 1XMAA 1LEAA 4A0YA 1S7AA 3RPUA 2LF7A 1U5TC 3TOAA 5LBQA 1Y0UA 5ILUA 4LFUA 5LEJA 2EJRA 1EV7A 1L3LA 1OR7A 1R5GA 4L9JA 1MKMA 4GYGA 4HLYA 4CXFA 3CTAA 3I71A 1BI0A 2L01A 2XAJA 3DXJF 1FX7A 1O7LA 3F23A 1XN7A 2ZCWA 2BBYA 3KEQA 4MNUA 1TQPA 2Z3YA 3KCCA 3E6BA 3PFIA 2CQKA 2VBXA 3LQRA 4WWCA 2L54A 2GQQA 1U5TA 2DI3A 2WV0A 3IKVA 4B09A 2VBWA 1OPCA 3W6JB 3REOA 1J7KA 1CF7A 2HTSA 2R3SA 3S2WA 1D5VA 1Z05A 3LAPA 1YW7A 1YW8A 4OIRF 3IRRA 2A68F 4AWXB 4L5JA 3K69A 3QPHA 2PEXA 1FSHA 5BS6A 2MLKA 2YX4A 2DK5A 4GYIA 1H9GA 1NHAA 3AAFA 1FC3A 1KU2A 2M45A 3F8MA 4IJAA 2FMYA 2K7LA 2H6BA 4BHCA 4OMYA 1EH7A 4G94A 3I58A 2Y0MA 4UUVA 2K86A 5ILVA 3FXUA 2AXLA 4A0ZA 4HYEA 3HSEA 4L0ZB 1W7PD 3C3WA 5ERIA 3ELKA 4HLXA 4KFCA 3DEUA 4HQEA 2WC2A 2FEZA 1VTNC 3RIRA 1I27A 3GFLA 5DD8A 1R22A 4I2OA 1BI3A 3C1DA 2Z9OA 3JSPA 3F21A 3F72A 5LHGA 1J5YA 4LB5A 5F64A 5J8FA 2FQ3A 4IRHA 3M9AA 1D8JA 4HX8A 4RAYA 4A5NA 3QAHA 1XB4A 1YW9A 2HOEA 2P5LC 3TO9A 3LWFA 1O3QA 1U8RA 2JZYA 3EYYA 2DW4A 2VE8A 1XGNA 3MZYA 2XAGA 3KP5A 4M74A 1ZLKA 2K4BA 4ASNA 1PUEE 5LRRA 2JPCA 4MHGA 4XSZF 3GO5A 5ICEA 3C18A 3BOQA 4Y13A 1TBXA 5LHHA 3KEOA 4HF1A 4Q48A 3WE3A 2GWRA 3MEXA 3BWGA 1UCRA 3HOTA 1SD6A 4EJWA 3WTYC 1KYZA 4Q47A 1T2KA 1U3EM 1O3RA 1G3SA 5DUKA 2KIFA 3VOEA 4ESFA 3B73A 3R0JA 3VEPA 5L3EA 4QWQA 3QRFF 1QGPA 2HZTA 4CDGA 3IWFA 1HKQA 1WKMA 4LG0A 4OMZA 3HHHA 3LA7A 2NNYA 4M9XA 2GXBA 1REPC 4ZYHA 4G7HF 1F1ZA 4JBAA 3KZYA 3TO6A 5E20A 2FMLA 3H3UA 3R60A 3IL2A 2UXNA 3GVAA 2D1HA 5LGTA 3FF5A 4I0BA 2QWWA 4OIOF 1HKTA 2W84A 1SD7A 3QP5A 1I5ZA 3HOSA 5CJ9A 1IN5A 4ZYEA 1MZBA 4R79A 5DEQA 5AIPA 2VXZA 2MH2A 4EJTA 4YIFA 5D8LB 2D45A 4HV6A 2EFNA 3FWEA 1IZ1A 4ZZLA 2RVCA 4O5VA 2RDPA 4XSXF 2Y48A 3EUHA 2RKHA 2P5KA 4A5MA 1OMIA 1MDMB 2UZKA 5DCFA 5D5WB 1V3FA 1IN4A 4BAYA 1V4RA 1SFUA 3I53A 2NAZA 3BJAA 1B6AA 2KRFA 4YIIA 3LSTA 3KZZA 1USSA 1MD0A 5KVRA 4UVCA 1ONVA 2MA3A 3BDDA 2CO5A 5HS7A 2IW5A 3ZMZA 2ETHA 5BMZA 3KFWX 3IWZA 5JI6A 2VC1A 3RDIA 1ZN2A 2DQLA 3SFZA 1FBSA 1U5TB 4RGSA 2HS5A 2CSOA 2FRHA 4BXUA 2EB7A 4I7HA 1SFXA 3QOPA 3L00A 2H09A 1X3UA 2G9WA 5CVVA 4EM2A 2KKOA 3P7NA 2ESNA 2NNNA 1J59A 1GXPA 1RI7A 3F8NA 3V8KA 3BY6A 1IW7F 2P6SA 4UHTA 2V79A 3T5XA 4EVIA 2XAHA 5ICFA 1LNWA 1U78A 3M7GA 4M6YA 3ERED 4PGGA 4EQQA 4UVAA 3GLXA 4LK1F 2VN2A 1QZYA 2IA0A 5BQTA 3SZTA 5HDNA 3K9TA 3QU6A 5FB2A 4OIPF 3ZP5A 4G6DA 3FZVA 4PZJA 2B0LA 3T0YA 2EV5A 4HQMA 2XGXA 1BC8C 1TTYA 5CVIA 1O57A 2XKPA 1P4WA 2L4AA 2G7HA 4WXDA 2EA4A 4U0VA 2QLZA 3NEUA 4IHSA 4KN4X 1XGSA 2HTJA 2V1DA 3MCZA 2STTA 4EM1A 1QPMA 4HDUA 1YS7A 1MJBA 2PQ8A 1ZG5A 2PMUA 4Y15A 2W24A 1I1SA 1R1VA 5CYVA 2DPUA 2DK8A 3WTXC 2HQNA 1HSJA 2W57A 4N9HA 2FA5A 4KIGA 5ICGA 5FFXA 2YSRA 1YYVA 4WF2A 1TQIA 1XGMA 2C6YA 4G8XA 4O6JA 4EJUA 4P9UA 2IPQX 3HHGA 3ECOA 1XCVA 4BYYA 2A61A 1R5HA 1IUYA 3WGIA 4M73A 3HTUA 5HLGA 2QZ8A 3KE2A 2BV6A 3E97A 2XAFA 4ZZDA 5J8CA 4ENMA 2IRFG 1K78A 3TO7A 1HSTA 1KA8A 1FBQA 2ISZA 5HS8A 2ZJ2A 5K5RA 2M87A 3PQJA 3LA2A 3J80K 4FX4A 2EV0A 5HLIA 2YU3A 2ISYA 1MDMA 2GZWA 3I0TA 2PLYA 2X4HA 2A3SA 2GXGA 1K6OA 1WSUA 2VOOA 3LA3A 1ZAOA 3VFZA 1TNSA 4NHJA 1ZG3A 4HF0A 2O3FA 2Z5UA 3BZ6A 3KETA 4E70A 2XAQA 3F3XA 2R7DA 1RZ4A 4KNYA 3R4KA 3SQNA 2OA4A 3DPTA 4LG0B 4P55A 4HF2A 5L3CA 4YFKF 5LHIA 2ZFWA 4RB2C 2J5PA 1IXRC 3MQ0A 3N97A 4G9YA 4FHTA 4RS8A 2FE3A 2K27A 4EGYA 1USTA 5J6XA 5FGMA 3ZMTA 3NRVA 1HXDA 2RV8A 1LQ1A 3K0LA 2LNBA 2FNPA 2A6EF 3KP4A 4JK1X 1BM9A 4PCQA 5BPDA 4BH9A 1BI1A 1UHWA 4M9ZA 4AIKA 4LK0F 5FD6A 4BHBA 2KIUA 2MC3A 2MD5A 2ZMEA 1BI2A 2D2WA 1GVJA 4HV5A 3WTTC 3KP7A 3HYIA 5K5OA 3HRUA 1R23A 3ZQ7A 4Z2YA 1T6SA 5FD5A 4Q5SF 4FX0A 2DLLA 5D6FA 3WODF 1ZH5A 3I5UA 2PBIA 4WXHA 2DU9A 1WWXA 2FSWA 4KMFA 4MEYF 3RPQA 1ZGJA 1JGSA 3DV8A 2HR3A 4BQAA 2QM3A 1WQ2A 1IAWA 4IRIA 1BJAA 3P9KA 2O03A 3N4MA 1C0WA 2XV4S 3JAMK 2FNAA 1ZRDA 1IN7A 2DO7A 1KQ9A 1WRJA 3V8JA 1O3SA 1STZA 1OYIA 2E1NA 1T38A 2E1CA 4CYDA 4M9SA 1B1BA 2QENA 3M8EA 2EFOA 4MGRA 1GXQA 1RIOH 2VONA 5DD4A 5FLXK 3GYHX 5D5XB 1PP7U 4HAMA 1R58A 1YIOA 5AONA 2HDCA 3IHUA 2HEOA 2CFXA 3E6CC 3KP6A 4OOIA 2GIVA 5DUIA 1KU3A 2VE9A 3TKYA 1QNTA 1UFMA 3D0SA 1YS6A 3O6BB 4HDVA 1IF1A 4UVBA 4U88A 2O6GE 3K2ZA 3H3ZA 4ENNA 3ZMUA 4O3MA 1JE8A 1W5SA 3CJNA 3FHZA 1D3YA 4IF4A 2FBHA 4RGRA 1RUNA 1G4DA 1P4AA 2HKXA 3V7CA 1P92A 5E18F 3V7SA 1S8NA 3MAJA 2IA1A 1XGOA 5D5UB 3FMQA 3HRSA 4WK8F 5EEHA 3KLOA 2BYVE 2IVMA 3CO6C 5IT9K 2FU4A 2MBFA 1Z9CA 1Z91A 4RGUA 5KK1A 3F8CA 4AIHA 3J81Z 2OD5A 1FYLA 4XBFA 3GZ6A 2XHKA 1ON2A 2F5CA 4YFXF 2RC4A 2V9VA 1FP1D 1DPRA 2KIMA 2LSOA 1J0RA 2QQAA 2MH9A 3WTUC 3BPVA 4QLCU 1G3YA 1K78B 1XMKA 1FBUA 2M5WA 1R36A 2DBBA 1FYKA 2ACJA 1D8KA 2HGCA 1FP2A 2Y75A 1AOYA 2HYFA 1R1UA 4OIQF 2ZNZA 4PDKA 4R8HA 5L3GA 1J2XA 2EFQA 1HW1A 4CZZA 1U6GA 2JRTA 4MEXF 5CVJA 3D5LA 5D4RA 1XCBA 4M72A 5HDKA 1PDNC 5D5VB 3ZN1A 3U9GA 2ZO4A 1YFHA 2BEOA 2XIGA 3F6VA 1TW3A 4HBLA 2UXXA 2COMA 4XLNF 5JR3A 1LDDA 3WGGA 2XROA 4LB6B 1O7FA 2IA2A 3L9FA 3ZMDA 3ML6A 3O2PE 1Z7UA 2NYXA 3V8LA 3QP6A 3WU1B 2FXAA 5EEGA 2CWEA 1ZRCA 3QU3A 3EYIA 3FM3A 3F6OA 2ZXJA 4D0PA 3VB2A 1XSVA 5TRDA 5DCMA 5A2QZ 1BN5A 3M8FA 4FT8A 5D6EA 1JHFA 4S04A 3WTSC 1G3WA 3I4PA 3GF2A 4L0YB 5FFZA 4MQVA 4EMSA 2P6TA 2ZMEB 5JFRA 1ODDA 2CG4A 2QVOA 3V7RA 5H6RA 1QBJA 1BC7C 3ROUA 1DP7P 3CUQB 2HKOA 4PGHA 4TV7A 2NS0A 1XD7A 3VODA 1FY7A 2P7VB 2F5FA 1FZPB 4WX9A 3LFKA 5LGUA 2BE5F 3FXRA 4ON0A 1XSXA 4P5OA 3WG9A 3HRMA 4LGWA 2A6HF 2NRAC 4G7ZF 1EH6A 1TNTA 5D8KB 4LLGF 4BNCA 2JT1A 3PQKA 2AS5F 1B59A 1P2FA 3GX4X 1KQ0A 3WTZA 1ZG1A 2F5DA 3ULQB 4XRFA 3G3ZA 3OV8A 2QQ9A 3FX3A 3Q9SA 3LQQA 2GA2A 4MQ9F 2A5YB 2XVCA 4ZH4F 3JSOA 1SMTA 1YTYA 3TDUC 1E2XA 4EGZA 2CGPA 2L4MA 3DKWA 1OYYA 3EETA 3R6SA 5BPIA 2KJCA 4I98B 5LGNA 1QQIA 1FNNA 3Q9VA 1SAXA 3E6DA 1KU9A 3E5UA 1ON1A 4KN7X 4F7ZA 1YO5C 4K2EA 1HW5A 1FYMA 2VT3A 3GFMA 2FBIA 1O3TA 2VOPA 4KDPA 3GUDA 3U1DA 4Q4ZF 3COAC 4GXOA 3HUGA 1LEBA 1T39A 1BOAA 2IT0A 2UWMA 2WWYA 5E8IA 3P9CA 2Q2EA 3RKWA 3J7AO 1OKRA 4LD5A 3BROA 3CUOA 1BIBA 3OOPA 1DDNA 1E17A 1CGPA 2O8XA 2L3DA 2L02A 1I6XA 2E7XA 2OAZA 3EDPA 4DNCA 2ELHA 4U7BA 4IPAA 4YG2F 4B8XA 3E3VA 2ADUA 3GZ5A 4KT5C 4UXNA 5LLQA 2LF8A 2RNJA 1T0FA 3ZPLA 5BOXA 3BJ6A 2XASA 3U2RA 4ENKA 3DQVC 1P6RA 2OQGA 2H27A 2M1BA 5E1WA 4KICA 1HW2A 3MZHA 1G6NA 2EWNA 2HQRA 1KU7A 3FXQA 4A0XA 2G7UA 1G3TA 4AD9A 4ESJA 1DPUA 3WTVC 1B9MA 1BIAA 1A04A 4RAZA 1YG2A 2XRNA 4RGXA 3CUQC 2EFPA 3F22A 4U0WA 5CVRA 2VBZA 4M71A 3QPTA 4KIFA 3HIFA 3GWZA 5H20A 4Y17A 3FMRA 3CDHA 2XKOA 3EQLF 4S05A 3KLNA 4EJVA 1XSDA 2K4JA 3JAMZ 2E7WA 5JVTA 2RGVA 1GHCA 1Z6RA 2O0YA 5CLSA 4HZFA 2PFBA 4A2UA 4GCVA 1EH8A 5E17F 3TGNA 2Z33A 1LB2A 2PI0A 2BGCA 2HYGD 4U0YA 2OQRA 4IXAA 4IVNA 4IHTA 2EK5A 3G73A 2DAOA 3CUQA 2PMHA 2H94A 3GW2A 4LLLA 4G6QA 2OZUA 5FLXZ 4CHUA 4KIBA 3GEZA 2QQBA 2H6CA 1W4MA 4AIJA 4N9IA 3BP8A 2GAUA 1KQ8A 4L9VA 5FO5A 2F5EA 2KJBA 3GXOA 5ICCA 3R0AA
chains in the Genus database with same CATH superfamily
4MFEA 3WHBA 3U21A 4ESBA 4U87A 4M3DA 2ECBA 4J01A 3K70C 1V5GA 4NB5A 1YQAA 4PUSA 2VBYA 3I59A 3CCSI 4ZYAA 1QHGA 3WE2A 3T8RA 1TW2A 2JJ7A 3QOEA 1IRFA 5EYRA 3ABUA 2CUJA 4QTRA 4KMUX 1IRZA 2J5OA 2FOWA 2ZJPF 5L3FA 1PP8F 1RUOA 5H6QA 2K40A 1G2HA 1VF9A 1R5ID 2Q0OA 4NQWA 2AXTC 5DCMB 4AVPA 2X51A 3L2RA 2EBIA 2P4WA 4IZZA 1UHMA 2QBYA 3Q0WA 3HSFA 4IHYA 2OBPA 1S29A 2P5VA 2A07F 5L3BA 1I1GA 3NQOA 3RKXA 4ANJA 2DOAA 3H5AA 1VQ6I 2DT5A 3MWMA 1V5FA 2IGNA 1QVTA 2V26A 2VT2A 4B4CA 4C3HJ 2ZBKA 4CICA 2HOSA 3V4GA 1SC7A 2IJLA 2DXIA 1S7OA 4XQFA 3S15J 1SD4A 3L2CA 3RZDJ 1OCRH 4KUMA 2EV6A 1LDKB 1OYWA 1MJ9A 6PAXA 5F1RA 1W7PB 2ESHA 2YS9A 1H0MA 1JTXA 2M30A 1VZ0A 1MMGA 1WI9A 3ONQA 4YFNF 5EG0A 3MVPA 3OIOA 1TLHB 5IT9Z 4PSXA 4RB0A 5DM6F 1FWZA 2CW8A 2BVMA 3RTRA 1Y1WJ 2VB6A 4A3DJ 3HGYA 1TL8A 4XKVA 4EM0B 1K4TA 4L9NA 3E5XA 1V5EA 1Z1DA 5EGOA 3M1CA 2IP2A 3QYFA 2DQRA 3PIPF 4EJOA 4HEA2 3ZN0A 4LLNA 1S3JA 2PX9A 4CA0A 2V1UA 2ZSHB 3CO7C 1XDUA 3TP0A 2CV2A 2A69F 5HDGA 2HNHA 1FMVA 1MBKA 1W5TA 3ISPA 4BHPA 4BL0B 4EATA 4ZYDA 3FMSA 2PJPA 4FE4A 1IN6A 3TDZC 1LVAA 5EF6A 1S6LA 2LH9A 2A6TA 1J75A 5TJJA 3BR1A 3AL0C 4CGZA 1Y6IA 2E71A 2BVLA 5JHUA 2NVYJ 3SZPA 4HOBA 4EV0A 5LRSA 4G7OF 2KFDA 1FOKA 3WU2C 2DA6A 2EIMH 4RB1A 2Y30A 3K1NA 4AVZA 1N77A 1K7AA 1ZHFA 2BHZA 3HRTA 3HB9A 4RB3C 2L0KA 1TT0A 3DF8A 1JUPA 2R7RA 4HX7A 4FE7A 3KP2A 4XORA 3JRHA 1XS9A 3I54A 3ABLH 3KP3A 1IXCA 4X0GA 4KITB 1FT9A 5JLWA 1TQMA 4UV9A 1XDSA 1W1WE 2DCEA 5E1ZB 1MMAA 3SFIA 4M6VA 2ZXHA 3VYSB 1F4KA 1SEUA 2EFWA 4ENJA 1B9NA 2IS4A 2HFHA 3JTGA 3IKTA 1SMYF 2XGEA 1QZZA 5IOZA 2VPLA 2LD5A 4CCOA 3HSRA 2QA4I 4AC0A 3H36A 2DMNA 2QYOA 2LTPA 3E5QA 2K85A 3KYCB 5HVQC 1YI2I 3M4OJ 1P4XA 4A6EA 4A3EJ 2VJJA 3IH3A 2QUFA 1Y0NA 2W00A 3VYTB 3GFJA 1VFCA 3CCQI 3HUGB 2DFIA 2W85A 4A93J 5M5YJ 2DTRA 2E19A 4II3A 1Z7LA 1AWCA 3M1EA 1HQCA 3M07A 1BR4A 3DBLB 2VPRA 2MABA 1F36A 3K1PA 2PJRB 2DFFA 4HW0A 5J4YA 5J1RA 1VQ7I 4MTDA 1U9NA 3DFGA 4KYWA 4GGGA 4R1HA 2W48A 2DODA 3FM5A 3G6EI 1ETOA 3DPLC 3MZ8A 2JSCA 2LLKA 1GV5A 2CW0F 1LFUP 2LVSA 3W6KB 2HOAA 1JHHA 4XRSA 3L2QA 4I0AA 3HL2A 2E2JJ 4IHWA 4P1WA 4AYBA 2XUBA 1FSEA 1A6IA 1OLTA 1TP4A 3JW4A 3PNTA 3VSKA 4GDFA 3ECHA 5E3LA 5FLVA 1IUFA 2CYYA 2OUMA 3DU5A 3RKYA 3WU0A 3BR0A 5IYBJ 1AKHB 1ZYRF 1DUXC 5E3NA 2JPBA 3LAJA 5IY5H 2MLGA 1MH4A 1SD5A 1B72B 3L7WA 4OU0A 4KA4A 5DV5A 1L0OC 1B4AA 1KYWA 2DJIA 3AKZA 3PJRA 4BY1J 3W2WA 2RQPA 2ZNYA 3R61A 3B02A 1VNDA 3S32A 4PK4A 1ZREA 2O61A 4N0BA 4BGDA 3DCFA 1WJCA 3OR2C 3A01A 2ID6A 1LJ9A 1SFEA 5DYMA 3HTSB 3MKYB 1HBXG 1T98A 4A3FJ 1RNLA 4OINF 2XSJC 1LDJA 2VC0A 2XGCA 3F8BA 3SXYA 3J81K 1H8AC 4C30A 3T1BA 5HS9A 1X2MA 5EZGA 3WGHA 3HG9A 5F6FA 1O4XA 5ED4A 3HOVJ 1SFKA 3Q5FA 4M6XA 1MBEA 3H9QA 1Q1HA 4BBRJ 1YLFA 1IRGA 1X19A 3F9KA 4A3JJ 3J7AY 1J9IA 1POGA 2P0WA 2VKVA 3LMMA 4XLCA 2TCTA 3C2BA 1MSFC 4D1QA 3CQZJ 1ETXA 2B9SA 2Y0SA 2DPDA 3ESWB 2XPUA 5E8GA 3DTEA 2HOTA 4MTEA 5E1XA 4JX4A 2P7CB 2NVTJ 1JUMA 4E6KG 3H3VK 1ETYA 3W2VA 4LIUA 2DA2A 2WTEA 1U2WA 2LKPA 3T8TA 1Z67A 3BPXA 2KMUA 1ZGAA 2BW3B 3SYTA 1YJNI 1CF7B 2LKSA 2FBKA 4AYBN 2P8TA 2TDXA 2XC7A 3JTHA 1SVMA 2V6CA 3MFKA 3ZMSA 2VODA 2FF4A 2X0LA 4HNUA 3RYPA 1IRXA 1VQ4I 3I64A 3D5SC 1BOBA 2VQGA 1KONA 3HOWJ 1KGSA 3G71I 1SFOJ 4IRGA 1JT6A 3GZNB 4UV8A 3BJOA 4DJAA 1W7PA 1AU7A 3LSHA 4JQFA 4A12A 3H1CA 2WAEA 3GFIA 3K1MA 4E7JA 5LD2C 1QZEA 1MGTA 2KT0A 2YR2A 4L9TA 4ETSA 3AFHA 3JCUC 2KZGA 2TRTA 4UNOA 2R0QC 2D1VA 1ZARA 3CF2A 3HDDA 2EA2A 4XIDA 5AIQA 5CKTA 1ZLJA 3S3NA 2IS1A 1R1TA 3PM1A 1ULYA 3F8FA 4I02A 2JSPA 2ID3A 3CDLA 2Q8KA 3C7JA 3PUBA 2YX7A 2R92J 3O3KA 4I09A 3ERMA 3LSIA 1Z6TA 4DIQA 3LNQA 3RSNA 2KL4A 2ZC2A 4XLPF 1IG7A 3SHFA 3OSFA 2R5YB 5HLHA 4WCGA 3RI4A 1Z3XA 3IC7A 3E6MA 2R7FA 2Y0SN 1R7JA 5EJCA 3ZRGA 2NVQJ 3UNGC 2LDUA 2OZ6A 2PG4A 1YIJI 1OCOH 4XKWA 2ELKA 3K70D 2V1XA 1FEXA 3I59B 4LMYA 2STWA 5IP6A 1FPQA 1DGWY 3HOUJ 2FD5A 2GA1A 2FOKA 2V4JC 2EILH 4ITVA 5L3DA 3DP7A 4F55A 2OU2A 1UMQA 1Z77A 3BCAA 5EEAA 3BZKA 5A2QK 5IT3A 3BT9A 1HKSA 4HX4A 5JHFA 2ZB9A 1K79A 3QYEA 1N75A 4WXCA 3J80Z 4W1UA 1MJAA 1OCTC 5D4SA 4NQWB 1IXSB 3TOBA 4DQ2A 2M0CA 4L5IA 4NDLA 4A6DA 1F5TA 2F2EA 3FXKA 2IGKA 3PUFA 2QBYB 1FLIA 2VQCA 3WTWC 2M8EA 3SEQA 3VWBA 5JLXA 3H92A 2WADA 1MBHA 1F9NA 3OYFA 4JX5A 1AHDP 4XKBA 1YX3A 1IN8A 1UB9A 4H0EA 5LEKA 2RN7A 2K02A 4P96A 2YPRA 4I99C 4BDYA 3HEFA 2JTVA 1TWHJ 1TWCJ 4U7DA 4M3FA 3ZOBA 3L09A 2ZKZA 2Z99A 1NH3A 1N25A 3D5RC 5CVUA 2K3PA 4GO1A 1J09A 5E3MA 1VQLI 3ZGKA 3DPUA 4L5EA 2HVRA 1R00A 4HA8A 3P9IA 1A5JA 4I01A 2V6EA 3CCEI 3TEDA 2L7ZA 2QQ8A 3IRQA 2HWVA 2KZVA 2E36A 2XB0X 4A3CJ 4CO8A 1ZELA 2PJRA 2YUSA 4L18B 1BBYA 3TQNA 2PN6A 3M8JA 1JXSA 3IH4A 1OR7C 2W25A 5K5QA 4RM3A 5EGOB 1ZRFA 5GAHJ 5DDGA 4IHXA 3GTKJ 3DBHB 3ABTA 3RYRA 5HOOA 1H9TA 2JQ7A 3CLQA 5K1YA 5ILSA 3RQIA 2L9VA 1VQKI 1QO0D 4LJZF 2XF5A 2WV1A 1VI0A 4XR6A 1RRJA 3I4MJ 4P9FA 3PNYA 4ZYGA 3CLOA 3ZR8X 3CP2A 2DMUA 2DDBA 4PJLA 3RJPA 3ZMVA 1XMAA 2KLOA 1Y39A 5FROA 1E0EA 1LEAA 1VQPI 4A0YA 4XRSG 1S7AA 2K9QA 2F5VA 3CD6I 2K3FA 4X6AJ 2LBFB 3TMOA 4BQOA 4DOZA 2CJJA 3RPUA 4CH7A 2LF7A 3BC8A 2RQQA 3H9JA 3HXLA 2H8WA 2MW8A 1U5TC 2LR8A 3TOAA 5LBQA 1YJ9I 3B6AA 2JVGA 2NS7A 3S2DJ 1Y0UA 1ETVA 1FIAA 3S8PA 5ILUA 4CCMA 4LFUA 2HXOA 3LSGA 3GMEA 2A05A 5LEJA 2EJRA 2K9MA 1EV7A 1L3LA 4XK4A 1OR7A 1BA5A 1R5GA 4XNFA 4L9JA 1MKMA 3CJRB 4GYGA 4HLYA 3DTKA 3I56I 4CXFA 3CTAA 3I71A 2X6XA 2RREA 2WAFA 1I39A 1YHQI 1BI0A 2L01A 2XAJA 3DXJF 4NNJA 1FX7A 1O7LA 3F23A 1XN7A 2JK3A 2ZCWA 2BBYA 1FMWA 1QA6A 3KEQA 4FASD 4MNUA 1ETWA 3FBIB 1TQPA 2X6WA 1WJBA 4EEFG 2Z3YA 3KCCA 3E6BA 3PFIA 2CQKA 1YX5A 2VBXA 3LQRA 2M4GA 1WJDA 4WWCA 2L54A 4E7HA 3AL0B 2RNGA 1R4MB 5IYCJ 2GQQA 1U5TA 2DI3A 2HQ5A 2WV0A 3IKVA 4B09A 2VBWA 1OPCA 3W6JB 4UB6C 3REOA 1J7KA 1CF7A 9ANTA 4II2A 3X2QH 2HTSA 1I3AA 2R3SA 3RQ4A 4LG3A 1XPXA 3S2WA 4DYCA 3E0JB 1D5VA 2HQAA 1Z05A 3LAPA 4BACA 1YW7A 2W4SA 3UKGA 5M3FJ 3JRCA 4OWRB 3JRBA 1YW8A 3NWTA 1GDTA 4OIRF 5F0FA 3IRRA 2A68F 4BXFA 1MBJA 4XRMA 2HU9A 4AWXB 4UB8C 1OCCH 5M5XJ 1JKOC 5GTIC 1SVLA 4BE1A 1R71A 4L5JA 3K69A 1W36C 3QPHA 2PEXA 2OJED 1EA3A 1FSHA 5FRMA 5BS6A 2MLKA 2YX4A 2X6OA 3MN2A 2DK5A 4GYIA 2DA3A 1UZCA 1H9GA 1NHAA 3AAFA 3G1MA 4A3IJ 1FC3A 3EUKL 2E1MC 3FBNB 3OYBA 1KU2A 2M45A 3SDGA 3JRDA 3F8MA 4IJAA 3A01B 5KAFC 2FMYA 2K7LA 1ETKA 2Y69H 4IKFA 2H6BA 2DA7A 4BHCA 1MMSA 2MSYA 1RKTA 1A36A 4OMYA 1EH7A 4G94A 2E2HJ 3I58A 2Y0MA 4UUVA 2K86A 5ILVA 2XSDC 3FXUA 4QSHA 2DFHA 2EIKH 2X1DA 2AXLA 3QWLA 4A0ZA 4CSWA 4HYEA 3HSEA 4G6TB 4L0ZB 5F08A 1E3PA 1W7PD 5CQGA 3D1NI 2R7ZJ 2QKMB 2Z16A 4IQJA 4AU7A 5KAIC 1H89C 1QRYA 3EPZA 3C3WA 4ZDOA 5ERIA 3ELKA 4HLXA 2L5QA 4KFCA 3DEUA 5GPCA 4HQEA 1OCPA 2WC2A 2FEZA 1VTNC 2LG4A 3H0GJ 3RIRA 1D5YA 3KX2A 3BG5A 1I27A 3GFLA 5DD8A 3DLAA 1R22A 2X48A 1BI3A 3C1DA 4I2OA 4HRIA 5C4XJ 1Y1VJ 1SAUA 3GTOJ 4UUSA 2Z9OA 4A3GJ 4E7ZA 2LMDA 2JUGA 3JSPA 3SJMA 3Q0UA 3F21A 1MMDA 3F72A 5LHGA 1J5YA 4LB5A 2G0EA 3L2UA 2WY7Q 3G4SI 5F64A 5J8FA 1A6QA 2FQ3A 5DS9A 4V19K 4IRHA 3CC4I 3FIWA 4RBOA 3ABKH 4CCNA 2LREA 3M9AA 1D8JA 4HX8A 4RAYA 5BNGA 3QYBA 3QAHA 4A5NA 1XB4A 3CF5F 1YW9A 5M3MJ 1HC8A 3JR9A 2HOEA 5K7FA 2P5LC 3BG3A 3TO9A 3UR3C 3J7YJ 2HDWA 4XLHA 3LWFA 1O3QA 2BXYA 1U8RA 4XONA 2JZYA 3EYYA 2DW4A 3B6CA 1CQTA 2CV1A 1F43A 2VE8A 1XGNA 2VJ4A 3CCRI 4DYRA 3MZYA 2XAGA 3L1PA 4PSWA 3KP5A 5GPAA 3GLLA 4M74A 2KIQA 1QVUA 1ZLKA 2K4BA 4ASNA 2ZXIA 4V2GA 1PUEE 5LRRA 1EKEA 2JPCA 4ZDPA 2LK2A 1OISA 1JGGA 4MHGA 1U8BA 4XSZF 3GO5A 5IPAA 3ZQCA 3DBRB 5J4VA 3ZCOA 5ICEA 4OAYA 3C18A 3IV5A 4BS9A 1R4NB 2KRCA 3BOQA 4Y13A 1TBXA 3HBLA 4C3JJ 5LHHA 3KEOA 2LBFA 4HF1A 3KZIC 4PFOA 2CH0A 4Q48A 3WE3A 3LSRA 5F0CA 2ME6A 3KEYA 2W7NA 3S1QJ 2GWRA 2IGOA 2WB1A 3MEXA 4S0HB 1NTCA 2R5ZA 4C3IJ 3BWGA 2XPWA 1UCRA 3HOTA 5GADJ 1YE9A 3H0DA 1SD6A 4EJWA 2WAQA 3WTYC 3OS0A 4X1EA 1KYZA 2MD0A 2HZDA 4Q47A 2EH3A 1T2KA 3PO2J 1U3EM 1O3RA 3BG7A 5E3OA 4N4NB 1G3SA 3K4MA 3JRAA 2X1EA 1VQ9I 5DUKA 3MD2A 2KIFA 3VOEA 4E7IA 4ESFA 5B1AH 3B73A 3R0JA 3VEPA 5L3EA 2LY2A 4QWQA 1IJWC 3QRFF 4HSRA 1QGPA 2HZTA 1MBFA 3ZXSA 4CDGA 3IWFA 1HKQA 1XG1A 1WKMA 3LSJA 4LG0A 2M3AA 3HHHA 4OMZA 2OV7A 1N78A 4LIVA 3LA7A 2NNYA 4M9XA 1Q1VA 3O8GA 3RPUD 2GXBA 4JX6A 2IS6A 4B48A 2AO9A 3A4CA 3EUHC 1MIJA 1REPC 3WHCA 4ZYHA 2R7VA 4G7HF 1SVOA 3A0BC 1F1ZA 3OYJA 4JBAA 3KZYA 3TO6A 5E20A 1B8IA 2FMLA 4F93B 3HOXJ 3H3UA 4CCLA 2LRDA 3R60A 3IL2A 2UXNA 3GVAA 2D1HA 3W2AA 5LGTA 4PJMA 4BJ5C 3FF5A 4IQ4A 5JVGF 2F6CA 2QWWA 4I0BA 4RDUA 3QQAA 4OIOF 2DA1A 1HKTA 2W84A 2W82A 4B1RA 1SD7A 3QP5A 4KISA 2XPVA 3C2HA 2XRLA 1I5ZA 3K10A 3JRGA 5CJ9A 3HOSA 1BW5A 1IN5A 3K4NA 3W3CA 4ZYEA 1FOWA 2WB1N 2WBMA 4CZCA 1MZBA 3BTLA 3S93A 1IGNA 2CS3A 4R79A 5DEQA 5AIPA 2VXZA 2MH2A 4BBSJ 2WAQN 4EJTA 4MLOA 5HNFA 4YIFA 4RM2A 5D8LB 2D45A 4HV6A 3AG3H 2EFNA 3FWEA 1IZ1A 4ZZLA 2RVCA 4O5VA 2RDPA 1S72I 4XSXF 2Y48A 3EUHA 4RLFA 2HVQA 2RKHA 3CMAI 2P5KA 1I3QJ 4A5MA 1OMIA 1MDMB 2UZKA 5DCFA 5D5WB 4C2UA 1V3FA 2MYSA 1IN4A 5GP9A 4BAYA 1V4RA 1SFUA 3I53A 2NAZA 3BJAA 3RCOA 2JA8J 4E7KA 1B6AA 2QKLB 1WI3A 2KRFA 4YIIA 1TZLA 1WCMJ 3LSTA 3KZZA 1USSA 3SEZA 1MD0A 5KVRA 3FHNA 2JA2A 4UVCA 1R49A 1ONVA 5KCMA 1PUFA 2MA3A 3BDDA 1W0UA 5M5WJ 2CO5A 2E1OA 4FQGA 4NC7A 5HS7A 2IW5A 3ZMZA 2ETHA 5J47A 5BMZA 2VL8A 1Y8RB 3KFWX 1FOYA 4B44A 3IWZA 5JI6A 4CUGA 3H35A 2B7EA 2I8DA 2VC1A 4JYKA 3BLYA 4XMYA 3RDIA 1ZN2A 2DQLA 3S17J 3SFZA 1FBSA 4BJTA 1UG0A 4IOAF 1U5TB 2EQRA 4RGSA 5GTHC 3ASNH 2LY9A 2VKEA 3OYLA 2HS5A 2R7QA 1TT5B 2CSOA 2FRHA 4BXUA 1LE8A 5FKMA 2F4MB 3TW6A 4C9YA 1FTZA 2CUZA 2EB7A 2KPMA 4A69C 1BR2A 4JP0A 2GIZA 4I7HA 1SFXA 4C2MJ 1Z21A 3QOPA 3L00A 2H09A 1W0TA 1X3UA 4IOCF 1XMXA 2G9WA 3IUOA 1TWFJ 4HNTA 5CVVA 4BEHA 2WY8Q 4EM2A 4MO7A 2KISA 2KKOA 3P7NA 2ESNA 1X3ZB 4KJZA 2NNNA 2AQFA 1J59A 1GXPA 1ZK8A 1RI7A 3CJQB 1X1PA 3F8NA 3TP3A 3V8KA 3BY6A 5GAEJ 3K2AA 4J19A 1IW7F 5B66C 2P6SA 4UHTA 2V79A 3T5XA 4EVIA 4BXXJ 2M4KA 4E4HA 2XAHA 3P5JA 1LNWA 5ICFA 1U78A 3M7GA 4NC8A 3GCMA 3VYRB 1RKWA 2I5UA 4M6YA 1FOXA 2Z2SB 3ERED 4PGGA 2ICWG 4EQQA 3PNVA 4UVAA 1NG6A 3GLXA 2L9SA 2JVHA 4LK1F 4A3LJ 2VN2A 1DP3A 1ORKA 1QZYA 1HDPA 3QPSA 5TISC 2IA0A 5BQTA 3G1OA 4I76A 3K9TA 3QU6A 3SZTA 5HDNA 3BG6A 5FB2A 2CQNA 2O9LA 4OIPF 3ZP5A 2OTLI 1ZGWA 4G6DA 5DM7F 3ASOH 3FZVA 4PZJA 2BY1A 3NARA 2B0LA 3T0YA 2EV5A 2L7MP 4XLEA 2R7SA 1MMNA 4HQMA 2XGXA 1BC8C 1SANA 3MKWB 2M0MA 1TTYA 1YOVB 3BG9A 2E35A 4HSTA 1O57A 1RESA 3DEEA 5CVIA 2XKPA 3CC7I 1XTAA 1P4WA 2L4AA 2G7HA 4WXDA 3PIOF 3BR3A 4DGWB 4BDZA 2EA4A 4U0VA 2QLZA 3NEUA 3M3YJ 3OYCA 4C2TA 4IHSA 4KN4X 1XGSA 2HTJA 2V1DA 3MCZA 2STTA 4UUSB 4EM1A 1QPMA 4HDUA 2E1MB 1PYVA 1MJBA 1YS7A 3I55I 4GFBA 2PQ8A 1ZTRA 1ZG5A 2HI3A 2LY1A 2PMUA 4Y15A 3JREA 4PFPA 2W24A 5KHDA 4OAZA 1I1SA 1R1VA 5CYVA 2DPUA 2DK8A 2CUEA 2HQNA 5TGTA 3WTXC 5IYDJ 1HSJA 2W57A 2NVXJ 4N9HA 1GT0C 4CYCA 2IS2A 3ZQFA 2FA5A 4KIGA 4B43A 5ICGA 5FFXA 3OYHA 2YSRA 1YYVA 4WF2A 1TQIA 1XGMA 4DYQA 2VKHA 2C6YA 1LVKA 4G8XA 2X6YA 1T56A 2VLAA 4O6JA 4EJUA 1X3WB 4P9UA 1OFCX 2IPQX 3HHGA 3ECOA 1XCVA 4BYYA 2A61A 4BU2A 3CCLI 1R5HA 1IUYA 1OCZH 3WGIA 5DTDA 4M73A 3HTUA 3A2KA 5HLGA 2QZ8A 5FKOA 4IL6C 2AQEA 2BV6A 3KE2A 4RLQA 3HGGA 3E97A 2XAFA 1DU0A 1ZQ3P 1RC9A 1Z0XA 4ZZDA 5J8CA 2DT7B 4ENMA 2IRFG 4NC6A 1K78A 3K4LA 2Y9ZA 3TO7A 1HSTA 1MSEC 3CCVI 4IO9F 5IOYA 1ERDA 4M3EA 1KA8A 1FBQA 2ISZA 3DU6A 4MIMA 3OOUA 3OMYA 5HS8A 1WH5A 4D5FA 2ZJ2A 4B3AA 5K5RA 1RR8C 2M87A 3PQJA 3LA2A 2R5ZB 1NG7A 3J80K 1MNDA 2JA5J 4FX4A 2EV0A 1MW7A 1JKRC 5HLIA 2YU3A 2ZJRF 2ISYA 1MDMA 1I50J 2F4OB 2DDAA 2GZWA 3K4KA 3FISA 3I0TA 2PLYA 2X4HA 2A3SA 2GXGA 4LOCA 1TWAJ 1X58A 1K6OA 1WSUA 2D5VA 2VOOA 3LA3A 1ZAOA 2XB5A 4XOTA 2CQXA 1VQMI 3VFZA 1DU6A 1TNSA 4NHJA 1ZG3A 4HF0A 3V42A 2O3FA 2Z5UA 2DOEA 4Y7NJ 3BZ6A 1LPQA 1JJ6C 5B1BH 3HJEA 2KQRA 2LP0A 3KETA 2CMPA 4E70A 2XAQA 3F3XA 2M7BA 2R7DA 1RZ4A 4KNYA 3R4KA 5F1JA 3SQNA 2ZMEC 2OA4A 2ZSIB 3DPTA 3CCJI 4LG0B 3I9V2 4P55A 4B47A 4HF2A 5L3CA 2ZJQF 4YFKF 5LHIA 1WJAA 2ZFWA 4RB2C 4NUBA 4XKCA 2J5PA 1IXRC 3CCUI 3MQ0A 1WPKA 3N97A 4G9YA 4FISA 4FHTA 4RS8A 3DKXA 2FE3A 1KZHA 2K27A 2DMTA 4EGYA 1B8IB 1USTA 5J6XA 2JA6J 2NS8A 5FGMA 2V7FA 2QSGX 3ZMTA 3NRVA 1HXDA 5FJ8J 2RV8A 3GTLJ 1LQ1A 2MGQA 2BXZA 1JT0A 3K0LA 2QCOA 1YJWI 3LSPA 4F91B 1M1EB 1EJ9A 2LNBA 2FNPA 2DT6A 2A6EF 3KP4A 4JK1X 1BM9A 1IO2A 2IXSA 4PCQA 5BPDA 4BH9A 1BI1A 1UHWA 4M9ZA 3PL8A 4AIKA 4LK0F 5FD6A 4BHBA 2KIUA 3DTIA 2HVSA 4ZC3A 3LSMA 2MC3A 2M2EA 2MD5A 2ZMEA 3HKZA 1BI2A 3OIPA 1YRNA 1X2NA 2D2WA 2Y31A 1GVJA 4HV5A 4BJ6C 3IH2A 3WTTC 3KP7A 3HYIA 4BUPA 5K5OA 3OSGA 3HRUA 1FIPA 3ABMH 1MH3A 3S3OA 1R23A 1WFXA 2LC2A 3SZGA 1JTYA 3ZQ7A 1HA8A 1PJRA 2JUCA 1T6SA 5FD5A 4Z2YA 2GM4A 1A31A 4FX0A 4Q5SF 2DLLA 5D6FA 3WODF 1ZH5A 3I5UA 1XX5A 2PBIA 4WXHA 2DU9A 1WWXA 2FSWA 3TL4X 4KMFA 1U0JA 3FXOA 5CPRB 4MEYF 3RPQA 1ZGJA 1JGSA 3DV8A 4F92B 1T95A 3AG2H 2HR3A 2NOGA 4BQAA 3OS2A 2QM3A 1WQ2A 1IAWA 4IRIA 1BJAA 3OYAA 1RETA 1PUFB 3E1SA 3P9KA 2O03A 2ZFUA 5F04A 3BQYA 3N4MA 1C0WA 2XV4S 2E5NA 3DWLE 2E2IJ 5E79C 3JAMK 4D7MA 3BZCA 2JMWA 2GLOA 2FNAA 3GTMJ 3KYDB 1JUSA 2QF7A 1WJ5A 3H5NA 1ZRDA 1IN7A 1LKXA 2DO7A 1KQ9A 1WRJA 2LOOA 3V8JA 1O3SA 1STZA 1OYIA 4M3GA 2E1NA 1T38A 2E1CA 3O8HA 4CYDA 1LE8B 4M9SA 1B1BA 1GV2A 2QENA 2EIJH 3GTJJ 3M8EA 2COBA 2EFOA 2JRMA 4MGRA 1TC3C 5C4JJ 1GXQA 2L9RA 5C3EJ 4UUTA 3CMYA 1MBGA 3HKZN 5IP7J 2E5ZA 1RIOH 1HF0A 2VONA 5DD4A 3HZJA 2XF6A 2X9DA 2L9NA 3LSKA 5FLXK 2GBYA 4BEHB 3GYHX 1FTTA 3PSFA 5D5XB 1PP7U 2VUMJ 4HAMA 4F52A 2ECCA 4A3KJ 2H1KA 1R58A 2QSHX 1ACIA 1YIOA 1ZKGA 3S2HJ 2M34A 5AONA 2HDCA 3IHUA 2HEOA 3VPRA 4LITA 2W1OA 4QPQA 3JRIA 2CFXA 3E6CC 3KP6A 2LKXA 4RA2A 4BY7J 2M9HA 4OOIA 2FQ4A 1LFPA 2GIVA 1EF4A 5DUIA 1KU3A 2VE9A 2KP6A 3TKYA 2JA7J 1QNTA 3BR6A 1NK2P 2VI6A 3H9GA 1UFMA 3RZOJ 2E60A 1DQUA 3D0SA 4D5CA 1YS6A 1X1CA 3O6BB 4HDVA 3RKQA 1UELB 3KYLA 3PO3J 4Y52J 4G12A 1IF1A 4CCJA 4E7SA 4UVBA 4U88A 2O6GE 3K2ZA 3H3ZA 3SDBA 4ENNA 3ZMUA 2YU9J 4O3MA 1JE8A 1W5SA 4XLFA 2JWTA 3CJNA 3FHZA 1D3YA 4IF4A 1D0ZA 3GTPJ 2FBHA 2N8GA 3K6GA 4RGRA 1QU3A 3OYIA 1RUNA 1G4DA 1BW6A 1P4AA 2HKXA 3V7CA 1P92A 4V2FA 3OYDA 2CV0A 3N05A 1HDDC 2EINH 2HXIA 5E18F 2X85A 1JJ8C 3KPHA 3V7SA 1S8NA 3MAJA 1VQ5I 2IA1A 1XGOA 3CJTB 4XOPA 3GTQJ 5D5UB 2XAUA 3CESA 4HPQA 5LFAA 3FMQA 3HRSA 5J1YA 3OYGA 4WK8F 5EEHA 3KLOA 2BYVE 3F0CA 4CYCB 4HG2A 3U1KA 4XL9A 2IVMA 2MG4A 2BHYA 3CO6C 5IT9K 2FU4A 5HODA 2MBFA 1Z9CA 5CQEA 3VDXA 1Z91A 4RGUA 3CDIA 2GOXB 2BY0A 5KK1A 3LFUA 3OL4A 3F8CA 4AIHA 2A5WA 1U9OA 1K6YA 3J81Z 2OD5A 3BR5A 1FYLA 4XBFA 4N4OB 3GZ6A 2XHKA 1FJLA 1ON2A 1VQ8I 2F5CA 2Y2ZA 5GAGJ 4YFXF 2KHMA 2BY2A 2DN0A 2RC4A 2V9VA 4XICA 1FP1D 4PJ0C 1DPRA 2B63J 1IV8A 1Y56A 2KIMA 2LSOA 3A1YA 1J0RA 2QQAA 2MH9A 3WTUC 3BPVA 5HLTA 5FLMJ 5EDNA 1QHHD 4QLCU 1G3YA 2KDOA 1K78B 2Q2EB 2GOMA 5J40A 1XMKA 1IDZA 1FBUA 2M5WA 1R36A 2DBBA 1FYKA 2MFZA 2ACJA 1D8KA 3HPHA 3DEWA 2HGCA 1FP2A 1BL0A 2Y75A 2CQQA 3E7LA 4PJNA 3K4CA 2R7XA 3ZQQA 1AOYA 2HYFA 1R1UA 2Z1DA 4OIQF 2ZNZA 4PDKA 4R8HA 5L3GA 2VKDA 1J2XA 2EFQA 3OWTA 1HW1A 4CZZA 1T8IA 1U6GA 2JRTA 3HM5A 2OCEA 4MEXF 3DKYA 1WH7A 5CVJA 3D5LA 5D4RA 3IAS2 1X1DA 2EZKA 5FKNA 2ZXWH 3OY9A 3AG1H 2NVUB 4ABZA 1GVDA 5H2FC 1XCBA 4M72A 5HDKA 5IP9J 1PDNC 4J00A 1G59A 2IGMA 5D5VB 3ZN1A 3CC2I 3U9GA 2EZIA 2ZO4A 2RAEA 5B5EC 1YFHA 1ITYA 4A3BJ 2BEOA 3AG4H 2XIGA 3F6VA 1TW3A 4Y33A 4HBLA 2UXXA 2COMA 1RR7A 4XLNF 5JR3A 3DLLF 1X4PA 1LDDA 3WGGA 4IHVA 4DZPA 3ZQLA 2XROA 3TBIA 2OC6A 1T08B 2EPFA 1WZ2A 5F27A 4LB6B 2VIXA 1QPIA 1O7FA 4YEJA 2R7OA 2IA2A 3L9FA 3ZMDA 3ML6A 3O2PE 1Z7UA 3BTJA 5J3LA 4YIRX 2KRHA 1JKQC 2NYXA 3V8LA 1K4SA 3QP6A 3WU1B 2FXAA 5EEGA 2CWEA 4RMNA 3QU3A 5J1UA 1ZRCA 4FTHA 3CP8A 3BTCA 3EYIA 3CMEI 3EUAA 3FM3A 2DYSH 4M3BA 4XLAA 5B3SH 1HLVA 3S1RJ 3OYMA 1IDYA 1ENHA 3F6OA 2V9KA 2ZXJA 4D0PA 3VB2A 1XSVA 1X4OA 3I3LA 2AHQA 5TRDA 3OYEA 5DCMA 5A2QZ 3C2GA 2HDDA 2O8KA 1BN5A 1Y8QB 2QGUA 3M8FA 3VSLA 2VASA 4FT8A 3A02A 3S1MJ 5D6EA 1IV6A 1WGXA 4NBQA 2OCCH 1BJZA 1JHFA 4S04A 3WTSC 2R7TA 1UAAA 1G3WA 1G8XA 3I4PA 1JI8A 1ZR4A 5FRNA 3GF2A 4L0YB 5FFZA 4YRVA 2UV1A 4MQVA 4EMSA 2P6TA 2ZMEB 2IEKA 5JFRA 1YRNB 2FUG2 1ODDA 2CG4A 2QVOA 3HPGA 1W36D 2VQHA 3V7RA 3L2VA 5K7HA 4W97A 1HCRA 3LL7A 5H6RA 2CFOA 2Y9YA 3OIQA 3HOZJ 3GBGA 1WHUA 1QBJA 1X1AA 1BC7C 2BY3A 3ROUA 3CUQB 1DP7P 2HKOA 3BQZA 3I4NJ 3CMMA 4PGHA 4TV7A 4CCKA 2NS0A 4FETA 1XD7A 3PFYA 3VODA 1FY7A 1Z3YA 2XDVA 2P7VB 2PMZA 2F5FA 1FZPB 3S1NJ 3G1LA 2HPMA 3IP4B 4DZJA 2OPTA 4WX9A 3LFKA 5LGUA 2BE5F 3FXRA 4AIDA 4ON0A 1WJEA 1XSXA 4P5OA 1V54H 3WG9A 5HNHA 2O5RA 3HRMA 5EZHA 3S16J 4LGWA 1VQNI 2A6HF 2H1LA 3ZQHA 2NRAC 4G7ZF 1EH6A 1TNTA 4JOMA 3GTGJ 2JN6A 1S5LC 5D8KB 3Q3SA 5FKKA 2FX0A 4LLGF 4BNCA 1D1AA 2JT1A 3PQKA 2L7FP 2UUZA 4BQQA 5FKLA 2AS5F 1B59A 1P2FA 3GX4X 1KQ0A 3BCBA 3WTZA 1ZG1A 4H4KC 2F5DA 2LYCA 3ULQB 4XRFA 5C44J 3G3ZA 3WG7H 3CCYA 3OV8A 2QQ9A 1P7IA 1A35A 3FX3A 3Q9SA 3LQQA 2GA2A 1UG2A 4DBQA 4KT6A 1PVEA 4MQ9F 2A5YB 2XVCA 4ZH4F 4D7NA 3JSOA 1P7JA 1HOMA 4XM3A 1SMTA 1YTYA 1MNEA 3TDUC 1E2XA 2L7KA 3FXLA 3BR2A 4EGZA 1JKPC 2NOJB 2CGPA 2KDZA 2L4MA 4QIWN 1WJFA 3DKWA 4XN0A 1D1BA 2M8GX 2MC4A 1OYYA 3EETA 3R6SA 3TW7A 4Z6YA 5BPIA 1UHSA 2KJCA 4I98B 2OF7A 1QQIA 5LGNA 4A3MJ 5F0HA 2K9LA 3HOYJ 1FNNA 1R6RA 3Q9VA 4ZTJA 1SAXA 1UJ8A 3OR1C 2DOFA 3E6DA 1KU9A 4I6ZA 3FK7A 1AA7A 1ON1A 3E5UA 4KN7X 4F7ZA 1YO5C 2K5CA 2IBDA 4K2EA 2Q1ZB 1HW5A 1FYMA 4RAFA 2VT3A 1E3HA 3GFMA 1T0FC 2FBIA 2PMZN 2R7UA 4BE0A 1O3TA 4Y4RA 1APLC 4DW6A 4B3XA 2VOPA 3OS1A 4KDPA 3GUDA 3U1DA 4Q4ZF 2LFBA 3COAC 4GXOA 3HUGA 2R7WA 1T39A 1LEBA 1BOAA 2IT0A 2UWMA 2DTZA 5EG0B 2WWYA 2I10A 1K61A 5E8IA 2DYRH 2DA4A 3P9CA 2Q2EA 1YITI 4IX7A 3BTIA 1VQOI 2QSFX 3RKWA 4Y3OA 4XN3A 3J7AO 3Q0VA 2VJIA 3ZQGA 1OKRA 4E7LA 2CW7A 4LD5A 3LOCA 3H5RA 1I6HJ 3BROA 3CUOA 1BIBA 3OOPA 1DDNA 1E17A 1V55H 1CGPA 2O8XA 2L3DA 2L02A 3MKZA 1I6XA 2E7XA 1GLNA 2OAZA 3EDPA 4GRIA 4YELA 4DNCA 5KNLA 1P9QC 3J7ZI 2ELHA 4U7BA 3A03A 2WA0A 3OYNA 4IPAA 1RPWA 1LFBA 2R4GA 3ZQIA 1T33A 2XF7A 4YG2F 3K7AJ 3KIOA 4B8XA 4IEJA 3E3VA 1S9HA 2DFEA 3IAM2 1AKHA 2ADUA 2L2OA 3GZ5A 4KT5C 4UXNA 5LLQA 2LF8A 2K9NA 2RNJA 3G2BA 2VQLA 3JRFA 1T0FA 3ZPLA 1B72A 2NXNB 5BOXA 4ZJZA 3BJ6A 2BZTA 2XASA 2V1NA 3U2RA 4ENKA 3HC7A 3DQVC 3K4BA 4RAGA 1P6RA 2OQGA 2OTJI 2H27A 2M1BA 2ME0A 2H8RA 3MMYB 1K83J 5E1WA 1W5CC 3CCMI 3A0HC 4KICA 1HW2A 3S3MA 4BQNA 2DMQA 2HPIA 4F3QA 3MZHA 1IC8A 1G6NA 2EWNA 2HQRA 3FKIJ 3PSIA 4MFDA 1KU7A 3FXQA 4A0XA 2IAIA 2G7UA 1G3TA 4AD9A 4ESJA 1H88C 1DPUA 2ELJA 3K4JA 3WTVC 1B9MA 1A04A 1BIAA 2E34A 2GXAA 2VJ5A 2V9PA 4RAZA 2CRGA 1YG2A 2XRNA 1WVRA 4RGXA 3CUQC 2EFPA 4BKXA 3F22A 4U0WA 2DA5A 5CVRA 1S7EA 2VBZA 4M71A 2P81A 2DJNA 2DMPA 1X1BA 2HYJA 3QPTA 3L2WA 4KIFA 3HIFA 3GWZA 4BE2A 1ETQA 1GUUA 5H20A 4Y17A 3FMRA 3CDHA 4AUXA 1XC5A 2XKOA 4HNVA 2CUFA 3FK6A 3EQLF 4S05A 2F4IA 3FDYA 3KLNA 4EJVA 1XSDA 2XGDA 2K4JA 3JAMZ 2E7WA 5JVTA 2RGVA 4D9JA 1GHCA 1TWGJ 1Z6RA 2BW3A 2O0YA 5CLSA 4HZFA 2PFBA 4PJJA 3W6VA 3VYUB 3MKLA 4A2UA 4GCVA 4AM3A 4DBRA 1EH8A 5E17F 3TGNA 1MNMC 2Z33A 2F48A 3FXJA 1LB2A 3OYKA 1E3OC 2PI0A 4QPOA 2BGCA 2HYGD 4U0YA 2OQRA 1D0XA 1NK3P 4IXAA 3NWSA 4IVNA 2VXDA 3CZ6A 4IHTA 1LUJB 2EK5A 3G73A 2DAOA 2K9SA 3CUQA 2PMHA 2CQ7A 2H94A 2O7OA 3GW2A 4LLLA 4FCYA 3NAUA 4ZDLA 4G6QA 2QEXI 1D0YA 2OZUA 2EZLA 2BOLA 2M7AA 5FLXZ 1ZR2A 2CU7A 4CHUA 4KIBA 3OL3A 3GEZA 4UY8I 1OJLA 3FKJA 2QQBA 1OQYA 2H6CA 3FXMA 4ZTFA 3S14J 1W4MA 4AIJA 3QPLA 4N9IA 3QODA 1D1CA 3BP8A 1R9TJ 1DGRM 5K7ZA 2GAUA 2X1CA 1KQ8A 2FJ1A 4L9VA 2F5EA 5FO5A 2R93J 2KJBA 1BR1A 3GXOA 5ICCA 2EZHA 3R0AA 2R5YA
chains in the Genus database with same CATH topology
4ESBA 4NB5A 1YQAA 2VBYA 3I59A 3WE2A 3T8RA 1TW2A 1IRFA 3ABUA 4KMUX 2J5OA 1PP8F 5L3FA 1RUOA 5H6QA 2Q0OA 4NQWA 5DCMB 4AVPA 2P4WA 1UHMA 2QBYA 3HSFA 2OBPA 1S29A 2P5VA 2A07F 5L3BA 1I1GA 3NQOA 3RKXA 2DT5A 3MWMA 2VT2A 2ZBKA 4CICA 3V4GA 2IJLA 1S7OA 1SD4A 3L2CA 4KUMA 2EV6A 1LDKB 1OYWA 1MJ9A 6PAXA 5F1RA 1W7PB 2ESHA 1H0MA 2M30A 1WI9A 4YFNF 1TLHB 5IT9Z 4RB0A 1FWZA 3RTRA 4EM0B 4L9NA 3E5XA 1Z1DA 2IP2A 2DQRA 4EJOA 3ZN0A 4LLNA 1S3JA 2V1UA 3CO7C 1XDUA 2A69F 5HDGA 1W5TA 3ISPA 4BHPA 4ZYDA 3FMSA 2PJPA 1IN6A 3TDZC 1LVAA 1S6LA 1J75A 5TJJA 4CGZA 5JHUA 3SZPA 4HOBA 4EV0A 5LRSA 4G7OF 1FOKA 4RB1A 3K1NA 1K7AA 1ZHFA 3HRTA 4RB3C 3DF8A 4HX7A 3KP2A 3I54A 3KP3A 1IXCA 1FT9A 1TQMA 4UV9A 1XDSA 5E1ZB 1F4KA 2EFWA 4ENJA 1B9NA 2HFHA 3JTGA 3IKTA 1SMYF 1QZZA 3HSRA 2QYOA 3E5QA 5HVQC 1P4XA 4A6EA 2QUFA 3GFJA 2DFIA 2W85A 2DTRA 1AWCA 3M1EA 1HQCA 3K1PA 4HW0A 4MTDA 3DFGA 4KYWA 4GGGA 4R1HA 3FM5A 3DPLC 2JSCA 2CW0F 3W6KB 1JHHA 4I0AA 2XUBA 1FSEA 3JW4A 3ECHA 2CYYA 3WU0A 3RKYA 1ZYRF 1DUXC 2JPBA 3LAJA 2MLGA 1SD5A 3L7WA 4OU0A 4KA4A 5DV5A 1L0OC 1B4AA 1KYWA 2RQPA 2ZNYA 3R61A 3B02A 1ZREA 2O61A 4N0BA 1LJ9A 1SFEA 5DYMA 3HTSB 1HBXG 1T98A 1RNLA 4OINF 1LDJA 2VC0A 3F8BA 3SXYA 3J81K 3T1BA 5HS9A 3WGHA 5F6FA 5ED4A 3Q5FA 4M6XA 1Q1HA 1YLFA 1IRGA 1J9IA 2DPDA 5E8GA 4MTEA 5E1XA 2P7CB 2WTEA 1U2WA 2LKPA 3T8TA 3BPXA 1ZGAA 1CF7B 2FBKA 2P8TA 2TDXA 3JTHA 2V6CA 3MFKA 3ZMSA 2VODA 2FF4A 2X0LA 3RYPA 3I64A 1KGSA 4IRGA 4UV8A 3BJOA 1W7PA 4JQFA 4A12A 3GFIA 3K1MA 1MGTA 2YR2A 4L9TA 4ETSA 4UNOA 2D1VA 1ZARA 2EA2A 5AIQA 1ZLJA 1R1TA 1ULYA 3F8FA 4I02A 2Q8KA 3C7JA 2YX7A 3O3KA 4I09A 1Z6TA 4XLPF 3SHFA 5HLHA 4WCGA 3RI4A 3IC7A 3E6MA 2R7FA 1R7JA 2LDUA 2OZ6A 2PG4A 2V1XA 3I59B 4LMYA 2STWA 1FPQA 2GA1A 2FOKA 5L3DA 3DP7A 2OU2A 5A2QK 5IT3A 4HX4A 1HKSA 1K79A 4WXCA 3J80Z 1MJAA 5D4SA 1IXSB 3TOBA 4DQ2A 4L5IA 4A6DA 1F5TA 2QBYB 2F2EA 1FLIA 3WTWC 2M8EA 3H92A 1F9NA 1IN8A 1UB9A 4H0EA 5LEKA 2RN7A 2K02A 4P96A 2YPRA 2JTVA 4U7DA 3L09A 2ZKZA 2Z99A 5CVUA 4GO1A 1R00A 4HA8A 3P9IA 4I01A 3IRQA 2HWVA 4CO8A 4L18B 1BBYA 3TQNA 2PN6A 1JXSA 2W25A 5K5QA 1ZRFA 5DDGA 3ABTA 3RYRA 5HOOA 1H9TA 5K1YA 5ILSA 1QO0D 4LJZF 4P9FA 4ZYGA 3CLOA 3RJPA 3ZMVA 1XMAA 1LEAA 4A0YA 1S7AA 3RPUA 2LF7A 1U5TC 3TOAA 5LBQA 1Y0UA 5ILUA 4LFUA 5LEJA 2EJRA 1EV7A 1L3LA 1OR7A 1R5GA 4L9JA 1MKMA 4GYGA 4HLYA 4CXFA 3CTAA 3I71A 1BI0A 2L01A 2XAJA 3DXJF 1FX7A 1O7LA 3F23A 1XN7A 2ZCWA 2BBYA 3KEQA 4MNUA 1TQPA 2Z3YA 3KCCA 3E6BA 3PFIA 2CQKA 2VBXA 3LQRA 4WWCA 2L54A 2GQQA 1U5TA 2DI3A 2WV0A 3IKVA 4B09A 2VBWA 1OPCA 3W6JB 3REOA 1J7KA 1CF7A 2HTSA 2R3SA 3S2WA 1D5VA 1Z05A 3LAPA 1YW7A 1YW8A 4OIRF 3IRRA 2A68F 4AWXB 4L5JA 3K69A 3QPHA 2PEXA 1FSHA 5BS6A 2MLKA 2YX4A 2DK5A 4GYIA 1H9GA 1NHAA 3AAFA 1FC3A 1KU2A 2M45A 3F8MA 4IJAA 2FMYA 2K7LA 2H6BA 4BHCA 4OMYA 1EH7A 4G94A 3I58A 2Y0MA 4UUVA 2K86A 5ILVA 3FXUA 2AXLA 4A0ZA 4HYEA 3HSEA 4L0ZB 1W7PD 3C3WA 5ERIA 3ELKA 4HLXA 4KFCA 3DEUA 4HQEA 2WC2A 2FEZA 1VTNC 3RIRA 1I27A 3GFLA 5DD8A 1R22A 4I2OA 1BI3A 3C1DA 2Z9OA 3JSPA 3F21A 3F72A 5LHGA 1J5YA 4LB5A 5F64A 5J8FA 2FQ3A 4IRHA 3M9AA 1D8JA 4HX8A 4RAYA 4A5NA 3QAHA 1XB4A 1YW9A 2HOEA 2P5LC 3TO9A 3LWFA 1O3QA 1U8RA 2JZYA 3EYYA 2DW4A 2VE8A 1XGNA 3MZYA 2XAGA 3KP5A 4M74A 1ZLKA 2K4BA 4ASNA 1PUEE 5LRRA 2JPCA 4MHGA 4XSZF 3GO5A 5ICEA 3C18A 3BOQA 4Y13A 1TBXA 5LHHA 3KEOA 4HF1A 4Q48A 3WE3A 2GWRA 3MEXA 3BWGA 1UCRA 3HOTA 1SD6A 4EJWA 3WTYC 1KYZA 4Q47A 1T2KA 1U3EM 1O3RA 1G3SA 5DUKA 2KIFA 3VOEA 4ESFA 3B73A 3R0JA 3VEPA 5L3EA 4QWQA 3QRFF 1QGPA 2HZTA 4CDGA 3IWFA 1HKQA 1WKMA 4LG0A 4OMZA 3HHHA 3LA7A 2NNYA 4M9XA 2GXBA 1REPC 4ZYHA 4G7HF 1F1ZA 4JBAA 3KZYA 3TO6A 5E20A 2FMLA 3H3UA 3R60A 3IL2A 2UXNA 3GVAA 2D1HA 5LGTA 3FF5A 4I0BA 2QWWA 4OIOF 1HKTA 2W84A 1SD7A 3QP5A 1I5ZA 3HOSA 5CJ9A 1IN5A 4ZYEA 1MZBA 4R79A 5DEQA 5AIPA 2VXZA 2MH2A 4EJTA 4YIFA 5D8LB 2D45A 4HV6A 2EFNA 3FWEA 1IZ1A 4ZZLA 2RVCA 4O5VA 2RDPA 4XSXF 2Y48A 3EUHA 2RKHA 2P5KA 4A5MA 1OMIA 1MDMB 2UZKA 5DCFA 5D5WB 1V3FA 1IN4A 4BAYA 1V4RA 1SFUA 3I53A 2NAZA 3BJAA 1B6AA 2KRFA 4YIIA 3LSTA 3KZZA 1USSA 1MD0A 5KVRA 4UVCA 1ONVA 2MA3A 3BDDA 2CO5A 5HS7A 2IW5A 3ZMZA 2ETHA 5BMZA 3KFWX 3IWZA 5JI6A 2VC1A 3RDIA 1ZN2A 2DQLA 3SFZA 1FBSA 1U5TB 4RGSA 2HS5A 2CSOA 2FRHA 4BXUA 2EB7A 4I7HA 1SFXA 3QOPA 3L00A 2H09A 1X3UA 2G9WA 5CVVA 4EM2A 2KKOA 3P7NA 2ESNA 2NNNA 1J59A 1GXPA 1RI7A 3F8NA 3V8KA 3BY6A 1IW7F 2P6SA 4UHTA 2V79A 3T5XA 4EVIA 2XAHA 5ICFA 1LNWA 1U78A 3M7GA 4M6YA 3ERED 4PGGA 4EQQA 4UVAA 3GLXA 4LK1F 2VN2A 1QZYA 2IA0A 5BQTA 3SZTA 5HDNA 3K9TA 3QU6A 5FB2A 4OIPF 3ZP5A 4G6DA 3FZVA 4PZJA 2B0LA 3T0YA 2EV5A 4HQMA 2XGXA 1BC8C 1TTYA 5CVIA 1O57A 2XKPA 1P4WA 2L4AA 2G7HA 4WXDA 2EA4A 4U0VA 2QLZA 3NEUA 4IHSA 4KN4X 1XGSA 2HTJA 2V1DA 3MCZA 2STTA 4EM1A 1QPMA 4HDUA 1YS7A 1MJBA 2PQ8A 1ZG5A 2PMUA 4Y15A 2W24A 1I1SA 1R1VA 5CYVA 2DPUA 2DK8A 3WTXC 2HQNA 1HSJA 2W57A 4N9HA 2FA5A 4KIGA 5ICGA 5FFXA 2YSRA 1YYVA 4WF2A 1TQIA 1XGMA 2C6YA 4G8XA 4O6JA 4EJUA 4P9UA 2IPQX 3HHGA 3ECOA 1XCVA 4BYYA 2A61A 1R5HA 1IUYA 3WGIA 4M73A 3HTUA 5HLGA 2QZ8A 3KE2A 2BV6A 3E97A 2XAFA 4ZZDA 5J8CA 4ENMA 2IRFG 1K78A 3TO7A 1HSTA 1KA8A 1FBQA 2ISZA 5HS8A 2ZJ2A 5K5RA 2M87A 3PQJA 3LA2A 3J80K 4FX4A 2EV0A 5HLIA 2YU3A 2ISYA 1MDMA 2GZWA 3I0TA 2PLYA 2X4HA 2A3SA 2GXGA 1K6OA 1WSUA 2VOOA 3LA3A 1ZAOA 3VFZA 1TNSA 4NHJA 1ZG3A 4HF0A 2O3FA 2Z5UA 3BZ6A 3KETA 4E70A 2XAQA 3F3XA 2R7DA 1RZ4A 4KNYA 3R4KA 3SQNA 2OA4A 3DPTA 4LG0B 4P55A 4HF2A 5L3CA 4YFKF 5LHIA 2ZFWA 4RB2C 2J5PA 1IXRC 3MQ0A 3N97A 4G9YA 4FHTA 4RS8A 2FE3A 2K27A 4EGYA 1USTA 5J6XA 5FGMA 3ZMTA 3NRVA 1HXDA 2RV8A 1LQ1A 3K0LA 2LNBA 2FNPA 2A6EF 3KP4A 4JK1X 1BM9A 4PCQA 5BPDA 4BH9A 1BI1A 1UHWA 4M9ZA 4AIKA 4LK0F 5FD6A 4BHBA 2KIUA 2MC3A 2MD5A 2ZMEA 1BI2A 2D2WA 1GVJA 4HV5A 3WTTC 3KP7A 3HYIA 5K5OA 3HRUA 1R23A 3ZQ7A 4Z2YA 1T6SA 5FD5A 4Q5SF 4FX0A 2DLLA 5D6FA 3WODF 1ZH5A 3I5UA 2PBIA 4WXHA 2DU9A 1WWXA 2FSWA 4KMFA 4MEYF 3RPQA 1ZGJA 1JGSA 3DV8A 2HR3A 4BQAA 2QM3A 1WQ2A 1IAWA 4IRIA 1BJAA 3P9KA 2O03A 3N4MA 1C0WA 2XV4S 3JAMK 2FNAA 1ZRDA 1IN7A 2DO7A 1KQ9A 1WRJA 3V8JA 1O3SA 1STZA 1OYIA 2E1NA 1T38A 2E1CA 4CYDA 4M9SA 1B1BA 2QENA 3M8EA 2EFOA 4MGRA 1GXQA 1RIOH 2VONA 5DD4A 5FLXK 3GYHX 5D5XB 1PP7U 4HAMA 1R58A 1YIOA 5AONA 2HDCA 3IHUA 2HEOA 2CFXA 3E6CC 3KP6A 4OOIA 2GIVA 5DUIA 1KU3A 2VE9A 3TKYA 1QNTA 1UFMA 3D0SA 1YS6A 3O6BB 4HDVA 1IF1A 4UVBA 4U88A 2O6GE 3K2ZA 3H3ZA 4ENNA 3ZMUA 4O3MA 1JE8A 1W5SA 3CJNA 3FHZA 1D3YA 4IF4A 2FBHA 4RGRA 1RUNA 1G4DA 1P4AA 2HKXA 3V7CA 1P92A 5E18F 3V7SA 1S8NA 3MAJA 2IA1A 1XGOA 5D5UB 3FMQA 3HRSA 4WK8F 5EEHA 3KLOA 2BYVE 2IVMA 3CO6C 5IT9K 2FU4A 2MBFA 1Z9CA 1Z91A 4RGUA 5KK1A 3F8CA 4AIHA 3J81Z 2OD5A 1FYLA 4XBFA 3GZ6A 2XHKA 1ON2A 2F5CA 4YFXF 2RC4A 2V9VA 1FP1D 1DPRA 2KIMA 2LSOA 1J0RA 2QQAA 2MH9A 3WTUC 3BPVA 4QLCU 1G3YA 1K78B 1XMKA 1FBUA 2M5WA 1R36A 2DBBA 1FYKA 2ACJA 1D8KA 2HGCA 1FP2A 2Y75A 1AOYA 2HYFA 1R1UA 4OIQF 2ZNZA 4PDKA 4R8HA 5L3GA 1J2XA 2EFQA 1HW1A 4CZZA 1U6GA 2JRTA 4MEXF 5CVJA 3D5LA 5D4RA 1XCBA 4M72A 5HDKA 1PDNC 5D5VB 3ZN1A 3U9GA 2ZO4A 1YFHA 2BEOA 2XIGA 3F6VA 1TW3A 4HBLA 2UXXA 2COMA 4XLNF 5JR3A 1LDDA 3WGGA 2XROA 4LB6B 1O7FA 2IA2A 3L9FA 3ZMDA 3ML6A 3O2PE 1Z7UA 2NYXA 3V8LA 3QP6A 3WU1B 2FXAA 5EEGA 2CWEA 1ZRCA 3QU3A 3EYIA 3FM3A 3F6OA 2ZXJA 4D0PA 3VB2A 1XSVA 5TRDA 5DCMA 5A2QZ 1BN5A 3M8FA 4FT8A 5D6EA 1JHFA 4S04A 3WTSC 1G3WA 3I4PA 3GF2A 4L0YB 5FFZA 4MQVA 4EMSA 2P6TA 2ZMEB 5JFRA 1ODDA 2CG4A 2QVOA 3V7RA 5H6RA 1QBJA 1BC7C 3ROUA 1DP7P 3CUQB 2HKOA 4PGHA 4TV7A 2NS0A 1XD7A 3VODA 1FY7A 2P7VB 2F5FA 1FZPB 4WX9A 3LFKA 5LGUA 2BE5F 3FXRA 4ON0A 1XSXA 4P5OA 3WG9A 3HRMA 4LGWA 2A6HF 2NRAC 4G7ZF 1EH6A 1TNTA 5D8KB 4LLGF 4BNCA 2JT1A 3PQKA 2AS5F 1B59A 1P2FA 3GX4X 1KQ0A 3WTZA 1ZG1A 2F5DA 3ULQB 4XRFA 3G3ZA 3OV8A 2QQ9A 3FX3A 3Q9SA 3LQQA 2GA2A 4MQ9F 2A5YB 2XVCA 4ZH4F 3JSOA 1SMTA 1YTYA 3TDUC 1E2XA 4EGZA 2CGPA 2L4MA 3DKWA 1OYYA 3EETA 3R6SA 5BPIA 2KJCA 4I98B 5LGNA 1QQIA 1FNNA 3Q9VA 1SAXA 3E6DA 1KU9A 3E5UA 1ON1A 4KN7X 4F7ZA 1YO5C 4K2EA 1HW5A 1FYMA 2VT3A 3GFMA 2FBIA 1O3TA 2VOPA 4KDPA 3GUDA 3U1DA 4Q4ZF 3COAC 4GXOA 3HUGA 1LEBA 1T39A 1BOAA 2IT0A 2UWMA 2WWYA 5E8IA 3P9CA 2Q2EA 3RKWA 3J7AO 1OKRA 4LD5A 3BROA 3CUOA 1BIBA 3OOPA 1DDNA 1E17A 1CGPA 2O8XA 2L3DA 2L02A 1I6XA 2E7XA 2OAZA 3EDPA 4DNCA 2ELHA 4U7BA 4IPAA 4YG2F 4B8XA 3E3VA 2ADUA 3GZ5A 4KT5C 4UXNA 5LLQA 2LF8A 2RNJA 1T0FA 3ZPLA 5BOXA 3BJ6A 2XASA 3U2RA 4ENKA 3DQVC 1P6RA 2OQGA 2H27A 2M1BA 5E1WA 4KICA 1HW2A 3MZHA 1G6NA 2EWNA 2HQRA 1KU7A 3FXQA 4A0XA 2G7UA 1G3TA 4AD9A 4ESJA 1DPUA 3WTVC 1B9MA 1BIAA 1A04A 4RAZA 1YG2A 2XRNA 4RGXA 3CUQC 2EFPA 3F22A 4U0WA 5CVRA 2VBZA 4M71A 3QPTA 4KIFA 3HIFA 3GWZA 5H20A 4Y17A 3FMRA 3CDHA 2XKOA 3EQLF 4S05A 3KLNA 4EJVA 1XSDA 2K4JA 3JAMZ 2E7WA 5JVTA 2RGVA 1GHCA 1Z6RA 2O0YA 5CLSA 4HZFA 2PFBA 4A2UA 4GCVA 1EH8A 5E17F 3TGNA 2Z33A 1LB2A 2PI0A 2BGCA 2HYGD 4U0YA 2OQRA 4IXAA 4IVNA 4IHTA 2EK5A 3G73A 2DAOA 3CUQA 2PMHA 2H94A 3GW2A 4LLLA 4G6QA 2OZUA 5FLXZ 4CHUA 4KIBA 3GEZA 2QQBA 2H6CA 1W4MA 4AIJA 4N9IA 3BP8A 2GAUA 1KQ8A 4L9VA 5FO5A 2F5EA 2KJBA 3GXOA 5ICCA 3R0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ESB A;  4NB5 A;  1YQA A;  2VBY A;  3I59 A;  3WE2 A;  3T8R A;  1TW2 A;  1IRF A;  3ABU A;  4KMU X;  2J5O A;  1PP8 F;  5L3F A;  1RUO A;  5H6Q A;  2Q0O A;  4NQW A;  5DCM B;  4AVP A;  2P4W A;  1UHM A;  2QBY A;  3HSF A;  2OBP A;  1S29 A;  2P5V A;  2A07 F;  5L3B A;  1I1G A;  3NQO A;  3RKX A;  2DT5 A;  3MWM A;  2VT2 A;  2ZBK A;  4CIC A;  3V4G A;  2IJL A;  1S7O A;  1SD4 A;  3L2C A;  4KUM A;  2EV6 A;  1LDK B;  1OYW A;  1MJ9 A;  6PAX A;  5F1R A;  1W7P B;  2ESH A;  1H0M A;  2M30 A;  1WI9 A;  4YFN F;  1TLH B;  5IT9 Z;  4RB0 A;  1FWZ A;  3RTR A;  4EM0 B;  4L9N A;  3E5X A;  1Z1D A;  2IP2 A;  2DQR A;  4EJO A;  3ZN0 A;  4LLN A;  1S3J A;  2V1U A;  3CO7 C;  1XDU A;  2A69 F;  5HDG A;  1W5T A;  3ISP A;  4BHP A;  4ZYD A;  3FMS A;  2PJP A;  1IN6 A;  3TDZ C;  1LVA A;  1S6L A;  1J75 A;  5TJJ A;  4CGZ A;  5JHU A;  3SZP A;  4HOB A;  4EV0 A;  5LRS A;  4G7O F;  1FOK A;  4RB1 A;  3K1N A;  1K7A A;  1ZHF A;  3HRT A;  4RB3 C;  3DF8 A;  4HX7 A;  3KP2 A;  3I54 A;  3KP3 A;  1IXC A;  1FT9 A;  1TQM A;  4UV9 A;  1XDS A;  5E1Z B;  1F4K A;  2EFW A;  4ENJ A;  1B9N A;  2HFH A;  3JTG A;  3IKT A;  1SMY F;  1QZZ A;  3HSR A;  2QYO A;  3E5Q A;  5HVQ C;  1P4X A;  4A6E A;  2QUF A;  3GFJ A;  2DFI A;  2W85 A;  2DTR A;  1AWC A;  3M1E A;  1HQC A;  3K1P A;  4HW0 A;  4MTD A;  3DFG A;  4KYW A;  4GGG A;  4R1H A;  3FM5 A;  3DPL C;  2JSC A;  2CW0 F;  3W6K B;  1JHH A;  4I0A A;  2XUB A;  1FSE A;  3JW4 A;  3ECH A;  2CYY A;  3WU0 A;  3RKY A;  1ZYR F;  1DUX C;  2JPB A;  3LAJ A;  2MLG A;  1SD5 A;  3L7W A;  4OU0 A;  4KA4 A;  5DV5 A;  1L0O C;  1B4A A;  1KYW A;  2RQP A;  2ZNY A;  3R61 A;  3B02 A;  1ZRE A;  2O61 A;  4N0B A;  1LJ9 A;  1SFE A;  5DYM A;  3HTS B;  1HBX G;  1T98 A;  1RNL A;  4OIN F;  1LDJ A;  2VC0 A;  3F8B A;  3SXY A;  3J81 K;  3T1B A;  5HS9 A;  3WGH A;  5F6F A;  5ED4 A;  3Q5F A;  4M6X A;  1Q1H A;  1YLF A;  1IRG A;  1J9I A;  2DPD A;  5E8G A;  4MTE A;  5E1X A;  2P7C B;  2WTE A;  1U2W A;  2LKP A;  3T8T A;  3BPX A;  1ZGA A;  1CF7 B;  2FBK A;  2P8T A;  2TDX A;  3JTH A;  2V6C A;  3MFK A;  3ZMS A;  2VOD A;  2FF4 A;  2X0L A;  3RYP A;  3I64 A;  1KGS A;  4IRG A;  4UV8 A;  3BJO A;  1W7P A;  4JQF A;  4A12 A;  3GFI A;  3K1M A;  1MGT A;  2YR2 A;  4L9T A;  4ETS A;  4UNO A;  2D1V A;  1ZAR A;  2EA2 A;  5AIQ A;  1ZLJ A;  1R1T A;  1ULY A;  3F8F A;  4I02 A;  2Q8K A;  3C7J A;  2YX7 A;  3O3K A;  4I09 A;  1Z6T A;  4XLP F;  3SHF A;  5HLH A;  4WCG A;  3RI4 A;  3IC7 A;  3E6M A;  2R7F A;  1R7J A;  2LDU A;  2OZ6 A;  2PG4 A;  2V1X A;  3I59 B;  4LMY A;  2STW A;  1FPQ A;  2GA1 A;  2FOK A;  5L3D A;  3DP7 A;  2OU2 A;  5A2Q K;  5IT3 A;  4HX4 A;  1HKS A;  1K79 A;  4WXC A;  3J80 Z;  1MJA A;  5D4S A;  1IXS B;  3TOB A;  4DQ2 A;  4L5I A;  4A6D A;  1F5T A;  2QBY B;  2F2E A;  1FLI A;  3WTW C;  2M8E A;  3H92 A;  1F9N A;  1IN8 A;  1UB9 A;  4H0E A;  5LEK A;  2RN7 A;  2K02 A;  4P96 A;  2YPR A;  2JTV A;  4U7D A;  3L09 A;  2ZKZ A;  2Z99 A;  5CVU A;  4GO1 A;  1R00 A;  4HA8 A;  3P9I A;  4I01 A;  3IRQ A;  2HWV A;  4CO8 A;  4L18 B;  1BBY A;  3TQN A;  2PN6 A;  1JXS A;  2W25 A;  5K5Q A;  1ZRF A;  5DDG A;  3ABT A;  3RYR A;  5HOO A;  1H9T A;  5K1Y A;  5ILS A;  1QO0 D;  4LJZ F;  4P9F A;  4ZYG A;  3CLO A;  3RJP A;  3ZMV A;  1XMA A;  1LEA A;  4A0Y A;  1S7A A;  3RPU A;  2LF7 A;  1U5T C;  3TOA A;  5LBQ A;  1Y0U A;  5ILU A;  4LFU A;  5LEJ A;  2EJR A;  1EV7 A;  1L3L A;  1OR7 A;  1R5G A;  4L9J A;  1MKM A;  4GYG A;  4HLY A;  4CXF A;  3CTA A;  3I71 A;  1BI0 A;  2L01 A;  2XAJ A;  3DXJ F;  1FX7 A;  1O7L A;  3F23 A;  1XN7 A;  2ZCW A;  2BBY A;  3KEQ A;  4MNU A;  1TQP A;  2Z3Y A;  3KCC A;  3E6B A;  3PFI A;  2CQK A;  2VBX A;  3LQR A;  4WWC A;  2L54 A;  2GQQ A;  1U5T A;  2DI3 A;  2WV0 A;  3IKV A;  4B09 A;  2VBW A;  1OPC A;  3W6J B;  3REO A;  1J7K A;  1CF7 A;  2HTS A;  2R3S A;  3S2W A;  1D5V A;  1Z05 A;  3LAP A;  1YW7 A;  1YW8 A;  4OIR F;  3IRR A;  2A68 F;  4AWX B;  4L5J A;  3K69 A;  3QPH A;  2PEX A;  1FSH A;  5BS6 A;  2MLK A;  2YX4 A;  2DK5 A;  4GYI A;  1H9G A;  1NHA A;  3AAF A;  1FC3 A;  1KU2 A;  2M45 A;  3F8M A;  4IJA A;  2FMY A;  2K7L A;  2H6B A;  4BHC A;  4OMY A;  1EH7 A;  4G94 A;  3I58 A;  2Y0M A;  4UUV A;  2K86 A;  5ILV A;  3FXU A;  2AXL A;  4A0Z A;  4HYE A;  3HSE A;  4L0Z B;  1W7P D;  3C3W A;  5ERI A;  3ELK A;  4HLX A;  4KFC A;  3DEU A;  4HQE A;  2WC2 A;  2FEZ A;  1VTN C;  3RIR A;  1I27 A;  3GFL A;  5DD8 A;  1R22 A;  4I2O A;  1BI3 A;  3C1D A;  2Z9O A;  3JSP A;  3F21 A;  3F72 A;  5LHG A;  1J5Y A;  4LB5 A;  5F64 A;  5J8F A;  2FQ3 A;  4IRH A;  3M9A A;  1D8J A;  4HX8 A;  4RAY A;  4A5N A;  3QAH A;  1XB4 A;  1YW9 A;  2HOE A;  2P5L C;  3TO9 A;  3LWF A;  1O3Q A;  1U8R A;  2JZY A;  3EYY A;  2DW4 A;  2VE8 A;  1XGN A;  3MZY A;  2XAG A;  3KP5 A;  4M74 A;  1ZLK A;  2K4B A;  4ASN A;  1PUE E;  5LRR A;  2JPC A;  4MHG A;  4XSZ F;  3GO5 A;  5ICE A;  3C18 A;  3BOQ A;  4Y13 A;  1TBX A;  5LHH A;  3KEO A;  4HF1 A;  4Q48 A;  3WE3 A;  2GWR A;  3MEX A;  3BWG A;  1UCR A;  3HOT A;  1SD6 A;  4EJW A;  3WTY C;  1KYZ A;  4Q47 A;  1T2K A;  1U3E M;  1O3R A;  1G3S A;  5DUK A;  2KIF A;  3VOE A;  4ESF A;  3B73 A;  3R0J A;  3VEP A;  5L3E A;  4QWQ A;  3QRF F;  1QGP A;  2HZT A;  4CDG A;  3IWF A;  1HKQ A;  1WKM A;  4LG0 A;  4OMZ A;  3HHH A;  3LA7 A;  2NNY A;  4M9X A;  2GXB A;  1REP C;  4ZYH A;  4G7H F;  1F1Z A;  4JBA A;  3KZY A;  3TO6 A;  5E20 A;  2FML A;  3H3U A;  3R60 A;  3IL2 A;  2UXN A;  3GVA A;  2D1H A;  5LGT A;  3FF5 A;  4I0B A;  2QWW A;  4OIO F;  1HKT A;  2W84 A;  1SD7 A;  3QP5 A;  1I5Z A;  3HOS A;  5CJ9 A;  1IN5 A;  4ZYE A;  1MZB A;  4R79 A;  5DEQ A;  5AIP A;  2VXZ A;  2MH2 A;  4EJT A;  4YIF A;  5D8L B;  2D45 A;  4HV6 A;  2EFN A;  3FWE A;  1IZ1 A;  4ZZL A;  2RVC A;  4O5V A;  2RDP A;  4XSX F;  2Y48 A;  3EUH A;  2RKH A;  2P5K A;  4A5M A;  1OMI A;  1MDM B;  2UZK A;  5DCF A;  5D5W B;  1V3F A;  1IN4 A;  4BAY A;  1V4R A;  1SFU A;  3I53 A;  2NAZ A;  3BJA A;  1B6A A;  2KRF A;  4YII A;  3LST A;  3KZZ A;  1USS A;  1MD0 A;  5KVR A;  4UVC A;  1ONV A;  2MA3 A;  3BDD A;  2CO5 A;  5HS7 A;  2IW5 A;  3ZMZ A;  2ETH A;  5BMZ A;  3KFW X;  3IWZ A;  5JI6 A;  2VC1 A;  3RDI A;  1ZN2 A;  2DQL A;  3SFZ A;  1FBS A;  1U5T B;  4RGS A;  2HS5 A;  2CSO A;  2FRH A;  4BXU A;  2EB7 A;  4I7H A;  1SFX A;  3QOP A;  3L00 A;  2H09 A;  1X3U A;  2G9W A;  5CVV A;  4EM2 A;  2KKO A;  3P7N A;  2ESN A;  2NNN A;  1J59 A;  1GXP A;  1RI7 A;  3F8N A;  3V8K A;  3BY6 A;  1IW7 F;  2P6S A;  4UHT A;  2V79 A;  3T5X A;  4EVI A;  2XAH A;  5ICF A;  1LNW A;  1U78 A;  3M7G A;  4M6Y A;  3ERE D;  4PGG A;  4EQQ A;  4UVA A;  3GLX A;  4LK1 F;  2VN2 A;  1QZY A;  2IA0 A;  5BQT A;  3SZT A;  5HDN A;  3K9T A;  3QU6 A;  5FB2 A;  4OIP F;  3ZP5 A;  4G6D A;  3FZV A;  4PZJ A;  2B0L A;  3T0Y A;  2EV5 A;  4HQM A;  2XGX A;  1BC8 C;  1TTY A;  5CVI A;  1O57 A;  2XKP A;  1P4W A;  2L4A A;  2G7H A;  4WXD A;  2EA4 A;  4U0V A;  2QLZ A;  3NEU A;  4IHS A;  4KN4 X;  1XGS A;  2HTJ A;  2V1D A;  3MCZ A;  2STT A;  4EM1 A;  1QPM A;  4HDU A;  1YS7 A;  1MJB A;  2PQ8 A;  1ZG5 A;  2PMU A;  4Y15 A;  2W24 A;  1I1S A;  1R1V A;  5CYV A;  2DPU A;  2DK8 A;  3WTX C;  2HQN A;  1HSJ A;  2W57 A;  4N9H A;  2FA5 A;  4KIG A;  5ICG A;  5FFX A;  2YSR A;  1YYV A;  4WF2 A;  1TQI A;  1XGM A;  2C6Y A;  4G8X A;  4O6J A;  4EJU A;  4P9U A;  2IPQ X;  3HHG A;  3ECO A;  1XCV A;  4BYY A;  2A61 A;  1R5H A;  1IUY A;  3WGI A;  4M73 A;  3HTU A;  5HLG A;  2QZ8 A;  3KE2 A;  2BV6 A;  3E97 A;  2XAF A;  4ZZD A;  5J8C A;  4ENM A;  2IRF G;  1K78 A;  3TO7 A;  1HST A;  1KA8 A;  1FBQ A;  2ISZ A;  5HS8 A;  2ZJ2 A;  5K5R A;  2M87 A;  3PQJ A;  3LA2 A;  3J80 K;  4FX4 A;  2EV0 A;  5HLI A;  2YU3 A;  2ISY A;  1MDM A;  2GZW A;  3I0T A;  2PLY A;  2X4H A;  2A3S A;  2GXG A;  1K6O A;  1WSU A;  2VOO A;  3LA3 A;  1ZAO A;  3VFZ A;  1TNS A;  4NHJ A;  1ZG3 A;  4HF0 A;  2O3F A;  2Z5U A;  3BZ6 A;  3KET A;  4E70 A;  2XAQ A;  3F3X A;  2R7D A;  1RZ4 A;  4KNY A;  3R4K A;  3SQN A;  2OA4 A;  3DPT A;  4LG0 B;  4P55 A;  4HF2 A;  5L3C A;  4YFK F;  5LHI A;  2ZFW A;  4RB2 C;  2J5P A;  1IXR C;  3MQ0 A;  3N97 A;  4G9Y A;  4FHT A;  4RS8 A;  2FE3 A;  2K27 A;  4EGY A;  1UST A;  5J6X A;  5FGM A;  3ZMT A;  3NRV A;  1HXD A;  2RV8 A;  1LQ1 A;  3K0L A;  2LNB A;  2FNP A;  2A6E F;  3KP4 A;  4JK1 X;  1BM9 A;  4PCQ A;  5BPD A;  4BH9 A;  1BI1 A;  1UHW A;  4M9Z A;  4AIK A;  4LK0 F;  5FD6 A;  4BHB A;  2KIU A;  2MC3 A;  2MD5 A;  2ZME A;  1BI2 A;  2D2W A;  1GVJ A;  4HV5 A;  3WTT C;  3KP7 A;  3HYI A;  5K5O A;  3HRU A;  1R23 A;  3ZQ7 A;  4Z2Y A;  1T6S A;  5FD5 A;  4Q5S F;  4FX0 A;  2DLL A;  5D6F A;  3WOD F;  1ZH5 A;  3I5U A;  2PBI A;  4WXH A;  2DU9 A;  1WWX A;  2FSW A;  4KMF A;  4MEY F;  3RPQ A;  1ZGJ A;  1JGS A;  3DV8 A;  2HR3 A;  4BQA A;  2QM3 A;  1WQ2 A;  1IAW A;  4IRI A;  1BJA A;  3P9K A;  2O03 A;  3N4M A;  1C0W A;  2XV4 S;  3JAM K;  2FNA A;  1ZRD A;  1IN7 A;  2DO7 A;  1KQ9 A;  1WRJ A;  3V8J A;  1O3S A;  1STZ A;  1OYI A;  2E1N A;  1T38 A;  2E1C A;  4CYD A;  4M9S A;  1B1B A;  2QEN A;  3M8E A;  2EFO A;  4MGR A;  1GXQ A;  1RIO H;  2VON A;  5DD4 A;  5FLX K;  3GYH X;  5D5X B;  1PP7 U;  4HAM A;  1R58 A;  1YIO A;  5AON A;  2HDC A;  3IHU A;  2HEO A;  2CFX A;  3E6C C;  3KP6 A;  4OOI A;  2GIV A;  5DUI A;  1KU3 A;  2VE9 A;  3TKY A;  1QNT A;  1UFM A;  3D0S A;  1YS6 A;  3O6B B;  4HDV A;  1IF1 A;  4UVB A;  4U88 A;  2O6G E;  3K2Z A;  3H3Z A;  4ENN A;  3ZMU A;  4O3M A;  1JE8 A;  1W5S A;  3CJN A;  3FHZ A;  1D3Y A;  4IF4 A;  2FBH A;  4RGR A;  1RUN A;  1G4D A;  1P4A A;  2HKX A;  3V7C A;  1P92 A;  5E18 F;  3V7S A;  1S8N A;  3MAJ A;  2IA1 A;  1XGO A;  5D5U B;  3FMQ A;  3HRS A;  4WK8 F;  5EEH A;  3KLO A;  2BYV E;  2IVM A;  3CO6 C;  5IT9 K;  2FU4 A;  2MBF A;  1Z9C A;  1Z91 A;  4RGU A;  5KK1 A;  3F8C A;  4AIH A;  3J81 Z;  2OD5 A;  1FYL A;  4XBF A;  3GZ6 A;  2XHK A;  1ON2 A;  2F5C A;  4YFX F;  2RC4 A;  2V9V A;  1FP1 D;  1DPR A;  2KIM A;  2LSO A;  1J0R A;  2QQA A;  2MH9 A;  3WTU C;  3BPV A;  4QLC U;  1G3Y A;  1K78 B;  1XMK A;  1FBU A;  2M5W A;  1R36 A;  2DBB A;  1FYK A;  2ACJ A;  1D8K A;  2HGC A;  1FP2 A;  2Y75 A;  1AOY A;  2HYF A;  1R1U A;  4OIQ F;  2ZNZ A;  4PDK A;  4R8H A;  5L3G A;  1J2X A;  2EFQ A;  1HW1 A;  4CZZ A;  1U6G A;  2JRT A;  4MEX F;  5CVJ A;  3D5L A;  5D4R A;  1XCB A;  4M72 A;  5HDK A;  1PDN C;  5D5V B;  3ZN1 A;  3U9G A;  2ZO4 A;  1YFH A;  2BEO A;  2XIG A;  3F6V A;  1TW3 A;  4HBL A;  2UXX A;  2COM A;  4XLN F;  5JR3 A;  1LDD A;  3WGG A;  2XRO A;  4LB6 B;  1O7F A;  2IA2 A;  3L9F A;  3ZMD A;  3ML6 A;  3O2P E;  1Z7U A;  2NYX A;  3V8L A;  3QP6 A;  3WU1 B;  2FXA A;  5EEG A;  2CWE A;  1ZRC A;  3QU3 A;  3EYI A;  3FM3 A;  3F6O A;  2ZXJ A;  4D0P A;  3VB2 A;  1XSV A;  5TRD A;  5DCM A;  5A2Q Z;  1BN5 A;  3M8F A;  4FT8 A;  5D6E A;  1JHF A;  4S04 A;  3WTS C;  1G3W A;  3I4P A;  3GF2 A;  4L0Y B;  5FFZ A;  4MQV A;  4EMS A;  2P6T A;  2ZME B;  5JFR A;  1ODD A;  2CG4 A;  2QVO A;  3V7R A;  5H6R A;  1QBJ A;  1BC7 C;  3ROU A;  1DP7 P;  3CUQ B;  2HKO A;  4PGH A;  4TV7 A;  2NS0 A;  1XD7 A;  3VOD A;  1FY7 A;  2P7V B;  2F5F A;  1FZP B;  4WX9 A;  3LFK A;  5LGU A;  2BE5 F;  3FXR A;  4ON0 A;  1XSX A;  4P5O A;  3WG9 A;  3HRM A;  4LGW A;  2A6H F;  2NRA C;  4G7Z F;  1EH6 A;  1TNT A;  5D8K B;  4LLG F;  4BNC A;  2JT1 A;  3PQK A;  2AS5 F;  1B59 A;  1P2F A;  3GX4 X;  1KQ0 A;  3WTZ A;  1ZG1 A;  2F5D A;  3ULQ B;  4XRF A;  3G3Z A;  3OV8 A;  2QQ9 A;  3FX3 A;  3Q9S A;  3LQQ A;  2GA2 A;  4MQ9 F;  2A5Y B;  2XVC A;  4ZH4 F;  3JSO A;  1SMT A;  1YTY A;  3TDU C;  1E2X A;  4EGZ A;  2CGP A;  2L4M A;  3DKW A;  1OYY A;  3EET A;  3R6S A;  5BPI A;  2KJC A;  4I98 B;  5LGN A;  1QQI A;  1FNN A;  3Q9V A;  1SAX A;  3E6D A;  1KU9 A;  3E5U A;  1ON1 A;  4KN7 X;  4F7Z A;  1YO5 C;  4K2E A;  1HW5 A;  1FYM A;  2VT3 A;  3GFM A;  2FBI A;  1O3T A;  2VOP A;  4KDP A;  3GUD A;  3U1D A;  4Q4Z F;  3COA C;  4GXO A;  3HUG A;  1LEB A;  1T39 A;  1BOA A;  2IT0 A;  2UWM A;  2WWY A;  5E8I A;  3P9C A;  2Q2E A;  3RKW A;  3J7A O;  1OKR A;  4LD5 A;  3BRO A;  3CUO A;  1BIB A;  3OOP A;  1DDN A;  1E17 A;  1CGP A;  2O8X A;  2L3D A;  2L02 A;  1I6X A;  2E7X A;  2OAZ A;  3EDP A;  4DNC A;  2ELH A;  4U7B A;  4IPA A;  4YG2 F;  4B8X A;  3E3V A;  2ADU A;  3GZ5 A;  4KT5 C;  4UXN A;  5LLQ A;  2LF8 A;  2RNJ A;  1T0F A;  3ZPL A;  5BOX A;  3BJ6 A;  2XAS A;  3U2R A;  4ENK A;  3DQV C;  1P6R A;  2OQG A;  2H27 A;  2M1B A;  5E1W A;  4KIC A;  1HW2 A;  3MZH A;  1G6N A;  2EWN A;  2HQR A;  1KU7 A;  3FXQ A;  4A0X A;  2G7U A;  1G3T A;  4AD9 A;  4ESJ A;  1DPU A;  3WTV C;  1B9M A;  1BIA A;  1A04 A;  4RAZ A;  1YG2 A;  2XRN A;  4RGX A;  3CUQ C;  2EFP A;  3F22 A;  4U0W A;  5CVR A;  2VBZ A;  4M71 A;  3QPT A;  4KIF A;  3HIF A;  3GWZ A;  5H20 A;  4Y17 A;  3FMR A;  3CDH A;  2XKO A;  3EQL F;  4S05 A;  3KLN A;  4EJV A;  1XSD A;  2K4J A;  3JAM Z;  2E7W A;  5JVT A;  2RGV A;  1GHC A;  1Z6R A;  2O0Y A;  5CLS A;  4HZF A;  2PFB A;  4A2U A;  4GCV A;  1EH8 A;  5E17 F;  3TGN A;  2Z33 A;  1LB2 A;  2PI0 A;  2BGC A;  2HYG D;  4U0Y A;  2OQR A;  4IXA A;  4IVN A;  4IHT A;  2EK5 A;  3G73 A;  2DAO A;  3CUQ A;  2PMH A;  2H94 A;  3GW2 A;  4LLL A;  4G6Q A;  2OZU A;  5FLX Z;  4CHU A;  4KIB A;  3GEZ A;  2QQB A;  2H6C A;  1W4M A;  4AIJ A;  4N9I A;  3BP8 A;  2GAU A;  1KQ8 A;  4L9V A;  5FO5 A;  2F5E A;  2KJB A;  3GXO A;  5ICC A;  3R0A A; 
#chains in the Genus database with same CATH topology
 4MFE A;  3WHB A;  3U21 A;  4ESB A;  4U87 A;  4M3D A;  2ECB A;  4J01 A;  3K70 C;  1V5G A;  4NB5 A;  1YQA A;  4PUS A;  2VBY A;  3I59 A;  3CCS I;  4ZYA A;  1QHG A;  3WE2 A;  3T8R A;  1TW2 A;  2JJ7 A;  3QOE A;  1IRF A;  5EYR A;  3ABU A;  2CUJ A;  4QTR A;  4KMU X;  1IRZ A;  2J5O A;  2FOW A;  2ZJP F;  5L3F A;  1PP8 F;  1RUO A;  5H6Q A;  2K40 A;  1G2H A;  1VF9 A;  1R5I D;  2Q0O A;  4NQW A;  2AXT C;  5DCM B;  4AVP A;  2X51 A;  3L2R A;  2EBI A;  2P4W A;  4IZZ A;  1UHM A;  2QBY A;  3Q0W A;  3HSF A;  4IHY A;  2OBP A;  1S29 A;  2P5V A;  2A07 F;  5L3B A;  1I1G A;  3NQO A;  3RKX A;  4ANJ A;  2DOA A;  3H5A A;  1VQ6 I;  2DT5 A;  3MWM A;  1V5F A;  2IGN A;  1QVT A;  2V26 A;  2VT2 A;  4B4C A;  4C3H J;  2ZBK A;  4CIC A;  2HOS A;  3V4G A;  1SC7 A;  2IJL A;  2DXI A;  1S7O A;  4XQF A;  3S15 J;  1SD4 A;  3L2C A;  3RZD J;  1OCR H;  4KUM A;  2EV6 A;  1LDK B;  1OYW A;  1MJ9 A;  6PAX A;  5F1R A;  1W7P B;  2ESH A;  2YS9 A;  1H0M A;  1JTX A;  2M30 A;  1VZ0 A;  1MMG A;  1WI9 A;  3ONQ A;  4YFN F;  5EG0 A;  3MVP A;  3OIO A;  1TLH B;  5IT9 Z;  4PSX A;  4RB0 A;  5DM6 F;  1FWZ A;  2CW8 A;  2BVM A;  3RTR A;  1Y1W J;  2VB6 A;  4A3D J;  3HGY A;  1TL8 A;  4XKV A;  4EM0 B;  1K4T A;  4L9N A;  3E5X A;  1V5E A;  1Z1D A;  5EGO A;  3M1C A;  2IP2 A;  3QYF A;  2DQR A;  3PIP F;  4EJO A;  4HEA 2;  3ZN0 A;  4LLN A;  1S3J A;  2PX9 A;  4CA0 A;  2V1U A;  2ZSH B;  3CO7 C;  1XDU A;  3TP0 A;  2CV2 A;  2A69 F;  5HDG A;  2HNH A;  1FMV A;  1MBK A;  1W5T A;  3ISP A;  4BHP A;  4BL0 B;  4EAT A;  4ZYD A;  3FMS A;  2PJP A;  4FE4 A;  1IN6 A;  3TDZ C;  1LVA A;  5EF6 A;  1S6L A;  2LH9 A;  2A6T A;  1J75 A;  5TJJ A;  3BR1 A;  3AL0 C;  4CGZ A;  1Y6I A;  2E71 A;  2BVL A;  5JHU A;  2NVY J;  3SZP A;  4HOB A;  4EV0 A;  5LRS A;  4G7O F;  2KFD A;  1FOK A;  3WU2 C;  2DA6 A;  2EIM H;  4RB1 A;  2Y30 A;  3K1N A;  4AVZ A;  1N77 A;  1K7A A;  1ZHF A;  2BHZ A;  3HRT A;  3HB9 A;  4RB3 C;  2L0K A;  1TT0 A;  3DF8 A;  1JUP A;  2R7R A;  4HX7 A;  4FE7 A;  3KP2 A;  4XOR A;  3JRH A;  1XS9 A;  3I54 A;  3ABL H;  3KP3 A;  1IXC A;  4X0G A;  4KIT B;  1FT9 A;  5JLW A;  1TQM A;  4UV9 A;  1XDS A;  1W1W E;  2DCE A;  5E1Z B;  1MMA A;  3SFI A;  4M6V A;  2ZXH A;  3VYS B;  1F4K A;  1SEU A;  2EFW A;  4ENJ A;  1B9N A;  2IS4 A;  2HFH A;  3JTG A;  3IKT A;  1SMY F;  2XGE A;  1QZZ A;  5IOZ A;  2VPL A;  2LD5 A;  4CCO A;  3HSR A;  2QA4 I;  4AC0 A;  3H36 A;  2DMN A;  2QYO A;  2LTP A;  3E5Q A;  2K85 A;  3KYC B;  5HVQ C;  1YI2 I;  3M4O J;  1P4X A;  4A6E A;  4A3E J;  2VJJ A;  3IH3 A;  2QUF A;  1Y0N A;  2W00 A;  3VYT B;  3GFJ A;  1VFC A;  3CCQ I;  3HUG B;  2DFI A;  2W85 A;  4A93 J;  5M5Y J;  2DTR A;  2E19 A;  4II3 A;  1Z7L A;  1AWC A;  3M1E A;  1HQC A;  3M07 A;  1BR4 A;  3DBL B;  2VPR A;  2MAB A;  1F36 A;  3K1P A;  2PJR B;  2DFF A;  4HW0 A;  5J4Y A;  5J1R A;  1VQ7 I;  4MTD A;  1U9N A;  3DFG A;  4KYW A;  4GGG A;  4R1H A;  2W48 A;  2DOD A;  3FM5 A;  3G6E I;  1ETO A;  3DPL C;  3MZ8 A;  2JSC A;  2LLK A;  1GV5 A;  2CW0 F;  1LFU P;  2LVS A;  3W6K B;  2HOA A;  1JHH A;  4XRS A;  3L2Q A;  4I0A A;  3HL2 A;  2E2J J;  4IHW A;  4P1W A;  4AYB A;  2XUB A;  1FSE A;  1A6I A;  1OLT A;  1TP4 A;  3JW4 A;  3PNT A;  3VSK A;  4GDF A;  3ECH A;  5E3L A;  5FLV A;  1IUF A;  2CYY A;  2OUM A;  3DU5 A;  3RKY A;  3WU0 A;  3BR0 A;  5IYB J;  1AKH B;  1ZYR F;  1DUX C;  5E3N A;  2JPB A;  3LAJ A;  5IY5 H;  2MLG A;  1MH4 A;  1SD5 A;  1B72 B;  3L7W A;  4OU0 A;  4KA4 A;  5DV5 A;  1L0O C;  1B4A A;  1KYW A;  2DJI A;  3AKZ A;  3PJR A;  4BY1 J;  3W2W A;  2RQP A;  2ZNY A;  3R61 A;  3B02 A;  1VND A;  3S32 A;  4PK4 A;  1ZRE A;  2O61 A;  4N0B A;  4BGD A;  3DCF A;  1WJC A;  3OR2 C;  3A01 A;  2ID6 A;  1LJ9 A;  1SFE A;  5DYM A;  3HTS B;  3MKY B;  1HBX G;  1T98 A;  4A3F J;  1RNL A;  4OIN F;  2XSJ C;  1LDJ A;  2VC0 A;  2XGC A;  3F8B A;  3SXY A;  3J81 K;  1H8A C;  4C30 A;  3T1B A;  5HS9 A;  1X2M A;  5EZG A;  3WGH A;  3HG9 A;  5F6F A;  1O4X A;  5ED4 A;  3HOV J;  1SFK A;  3Q5F A;  4M6X A;  1MBE A;  3H9Q A;  1Q1H A;  4BBR J;  1YLF A;  1IRG A;  1X19 A;  3F9K A;  4A3J J;  3J7A Y;  1J9I A;  1POG A;  2P0W A;  2VKV A;  3LMM A;  4XLC A;  2TCT A;  3C2B A;  1MSF C;  4D1Q A;  3CQZ J;  1ETX A;  2B9S A;  2Y0S A;  2DPD A;  3ESW B;  2XPU A;  5E8G A;  3DTE A;  2HOT A;  4MTE A;  5E1X A;  4JX4 A;  2P7C B;  2NVT J;  1JUM A;  4E6K G;  3H3V K;  1ETY A;  3W2V A;  4LIU A;  2DA2 A;  2WTE A;  1U2W A;  2LKP A;  3T8T A;  1Z67 A;  3BPX A;  2KMU A;  1ZGA A;  2BW3 B;  3SYT A;  1YJN I;  1CF7 B;  2LKS A;  2FBK A;  4AYB N;  2P8T A;  2TDX A;  2XC7 A;  3JTH A;  1SVM A;  2V6C A;  3MFK A;  3ZMS A;  2VOD A;  2FF4 A;  2X0L A;  4HNU A;  3RYP A;  1IRX A;  1VQ4 I;  3I64 A;  3D5S C;  1BOB A;  2VQG A;  1KON A;  3HOW J;  1KGS A;  3G71 I;  1SFO J;  4IRG A;  1JT6 A;  3GZN B;  4UV8 A;  3BJO A;  4DJA A;  1W7P A;  1AU7 A;  3LSH A;  4JQF A;  4A12 A;  3H1C A;  2WAE A;  3GFI A;  3K1M A;  4E7J A;  5LD2 C;  1QZE A;  1MGT A;  2KT0 A;  2YR2 A;  4L9T A;  4ETS A;  3AFH A;  3JCU C;  2KZG A;  2TRT A;  4UNO A;  2R0Q C;  2D1V A;  1ZAR A;  3CF2 A;  3HDD A;  2EA2 A;  4XID A;  5AIQ A;  5CKT A;  1ZLJ A;  3S3N A;  2IS1 A;  1R1T A;  3PM1 A;  1ULY A;  3F8F A;  4I02 A;  2JSP A;  2ID3 A;  3CDL A;  2Q8K A;  3C7J A;  3PUB A;  2YX7 A;  2R92 J;  3O3K A;  4I09 A;  3ERM A;  3LSI A;  1Z6T A;  4DIQ A;  3LNQ A;  3RSN A;  2KL4 A;  2ZC2 A;  4XLP F;  1IG7 A;  3SHF A;  3OSF A;  2R5Y B;  5HLH A;  4WCG A;  3RI4 A;  1Z3X A;  3IC7 A;  3E6M A;  2R7F A;  2Y0S N;  1R7J A;  5EJC A;  3ZRG A;  2NVQ J;  3UNG C;  2LDU A;  2OZ6 A;  2PG4 A;  1YIJ I;  1OCO H;  4XKW A;  2ELK A;  3K70 D;  2V1X A;  1FEX A;  3I59 B;  4LMY A;  2STW A;  5IP6 A;  1FPQ A;  1DGW Y;  3HOU J;  2FD5 A;  2GA1 A;  2FOK A;  2V4J C;  2EIL H;  4ITV A;  5L3D A;  3DP7 A;  4F55 A;  2OU2 A;  1UMQ A;  1Z77 A;  3BCA A;  5EEA A;  3BZK A;  5A2Q K;  5IT3 A;  3BT9 A;  1HKS A;  4HX4 A;  5JHF A;  2ZB9 A;  1K79 A;  3QYE A;  1N75 A;  4WXC A;  3J80 Z;  4W1U A;  1MJA A;  1OCT C;  5D4S A;  4NQW B;  1IXS B;  3TOB A;  4DQ2 A;  2M0C A;  4L5I A;  4NDL A;  4A6D A;  1F5T A;  2F2E A;  3FXK A;  2IGK A;  3PUF A;  2QBY B;  1FLI A;  2VQC A;  3WTW C;  2M8E A;  3SEQ A;  3VWB A;  5JLX A;  3H92 A;  2WAD A;  1MBH A;  1F9N A;  3OYF A;  4JX5 A;  1AHD P;  4XKB A;  1YX3 A;  1IN8 A;  1UB9 A;  4H0E A;  5LEK A;  2RN7 A;  2K02 A;  4P96 A;  2YPR A;  4I99 C;  4BDY A;  3HEF A;  2JTV A;  1TWH J;  1TWC J;  4U7D A;  4M3F A;  3ZOB A;  3L09 A;  2ZKZ A;  2Z99 A;  1NH3 A;  1N25 A;  3D5R C;  5CVU A;  2K3P A;  4GO1 A;  1J09 A;  5E3M A;  1VQL I;  3ZGK A;  3DPU A;  4L5E A;  2HVR A;  1R00 A;  4HA8 A;  3P9I A;  1A5J A;  4I01 A;  2V6E A;  3CCE I;  3TED A;  2L7Z A;  2QQ8 A;  3IRQ A;  2HWV A;  2KZV A;  2E36 A;  2XB0 X;  4A3C J;  4CO8 A;  1ZEL A;  2PJR A;  2YUS A;  4L18 B;  1BBY A;  3TQN A;  2PN6 A;  3M8J A;  1JXS A;  3IH4 A;  1OR7 C;  2W25 A;  5K5Q A;  4RM3 A;  5EGO B;  1ZRF A;  5GAH J;  5DDG A;  4IHX A;  3GTK J;  3DBH B;  3ABT A;  3RYR A;  5HOO A;  1H9T A;  2JQ7 A;  3CLQ A;  5K1Y A;  5ILS A;  3RQI A;  2L9V A;  1VQK I;  1QO0 D;  4LJZ F;  2XF5 A;  2WV1 A;  1VI0 A;  4XR6 A;  1RRJ A;  3I4M J;  4P9F A;  3PNY A;  4ZYG A;  3CLO A;  3ZR8 X;  3CP2 A;  2DMU A;  2DDB A;  4PJL A;  3RJP A;  3ZMV A;  1XMA A;  2KLO A;  1Y39 A;  5FRO A;  1E0E A;  1LEA A;  1VQP I;  4A0Y A;  4XRS G;  1S7A A;  2K9Q A;  2F5V A;  3CD6 I;  2K3F A;  4X6A J;  2LBF B;  3TMO A;  4BQO A;  4DOZ A;  2CJJ A;  3RPU A;  4CH7 A;  2LF7 A;  3BC8 A;  2RQQ A;  3H9J A;  3HXL A;  2H8W A;  2MW8 A;  1U5T C;  2LR8 A;  3TOA A;  5LBQ A;  1YJ9 I;  3B6A A;  2JVG A;  2NS7 A;  3S2D J;  1Y0U A;  1ETV A;  1FIA A;  3S8P A;  5ILU A;  4CCM A;  4LFU A;  2HXO A;  3LSG A;  3GME A;  2A05 A;  5LEJ A;  2EJR A;  2K9M A;  1EV7 A;  1L3L A;  4XK4 A;  1OR7 A;  1BA5 A;  1R5G A;  4XNF A;  4L9J A;  1MKM A;  3CJR B;  4GYG A;  4HLY A;  3DTK A;  3I56 I;  4CXF A;  3CTA A;  3I71 A;  2X6X A;  2RRE A;  2WAF A;  1I39 A;  1YHQ I;  1BI0 A;  2L01 A;  2XAJ A;  3DXJ F;  4NNJ A;  1FX7 A;  1O7L A;  3F23 A;  1XN7 A;  2JK3 A;  2ZCW A;  2BBY A;  1FMW A;  1QA6 A;  3KEQ A;  4FAS D;  4MNU A;  1ETW A;  3FBI B;  1TQP A;  2X6W A;  1WJB A;  4EEF G;  2Z3Y A;  3KCC A;  3E6B A;  3PFI A;  2CQK A;  1YX5 A;  2VBX A;  3LQR A;  2M4G A;  1WJD A;  4WWC A;  2L54 A;  4E7H A;  3AL0 B;  2RNG A;  1R4M B;  5IYC J;  2GQQ A;  1U5T A;  2DI3 A;  2HQ5 A;  2WV0 A;  3IKV A;  4B09 A;  2VBW A;  1OPC A;  3W6J B;  4UB6 C;  3REO A;  1J7K A;  1CF7 A;  9ANT A;  4II2 A;  3X2Q H;  2HTS A;  1I3A A;  2R3S A;  3RQ4 A;  4LG3 A;  1XPX A;  3S2W A;  4DYC A;  3E0J B;  1D5V A;  2HQA A;  1Z05 A;  3LAP A;  4BAC A;  1YW7 A;  2W4S A;  3UKG A;  5M3F J;  3JRC A;  4OWR B;  3JRB A;  1YW8 A;  3NWT A;  1GDT A;  4OIR F;  5F0F A;  3IRR A;  2A68 F;  4BXF A;  1MBJ A;  4XRM A;  2HU9 A;  4AWX B;  4UB8 C;  1OCC H;  5M5X J;  1JKO C;  5GTI C;  1SVL A;  4BE1 A;  1R71 A;  4L5J A;  3K69 A;  1W36 C;  3QPH A;  2PEX A;  2OJE D;  1EA3 A;  1FSH A;  5FRM A;  5BS6 A;  2MLK A;  2YX4 A;  2X6O A;  3MN2 A;  2DK5 A;  4GYI A;  2DA3 A;  1UZC A;  1H9G A;  1NHA A;  3AAF A;  3G1M A;  4A3I J;  1FC3 A;  3EUK L;  2E1M C;  3FBN B;  3OYB A;  1KU2 A;  2M45 A;  3SDG A;  3JRD A;  3F8M A;  4IJA A;  3A01 B;  5KAF C;  2FMY A;  2K7L A;  1ETK A;  2Y69 H;  4IKF A;  2H6B A;  2DA7 A;  4BHC A;  1MMS A;  2MSY A;  1RKT A;  1A36 A;  4OMY A;  1EH7 A;  4G94 A;  2E2H J;  3I58 A;  2Y0M A;  4UUV A;  2K86 A;  5ILV A;  2XSD C;  3FXU A;  4QSH A;  2DFH A;  2EIK H;  2X1D A;  2AXL A;  3QWL A;  4A0Z A;  4CSW A;  4HYE A;  3HSE A;  4G6T B;  4L0Z B;  5F08 A;  1E3P A;  1W7P D;  5CQG A;  3D1N I;  2R7Z J;  2QKM B;  2Z16 A;  4IQJ A;  4AU7 A;  5KAI C;  1H89 C;  1QRY A;  3EPZ A;  3C3W A;  4ZDO A;  5ERI A;  3ELK A;  4HLX A;  2L5Q A;  4KFC A;  3DEU A;  5GPC A;  4HQE A;  1OCP A;  2WC2 A;  2FEZ A;  1VTN C;  2LG4 A;  3H0G J;  3RIR A;  1D5Y A;  3KX2 A;  3BG5 A;  1I27 A;  3GFL A;  5DD8 A;  3DLA A;  1R22 A;  2X48 A;  1BI3 A;  3C1D A;  4I2O A;  4HRI A;  5C4X J;  1Y1V J;  1SAU A;  3GTO J;  4UUS A;  2Z9O A;  4A3G J;  4E7Z A;  2LMD A;  2JUG A;  3JSP A;  3SJM A;  3Q0U A;  3F21 A;  1MMD A;  3F72 A;  5LHG A;  1J5Y A;  4LB5 A;  2G0E A;  3L2U A;  2WY7 Q;  3G4S I;  5F64 A;  5J8F A;  1A6Q A;  2FQ3 A;  5DS9 A;  4V19 K;  4IRH A;  3CC4 I;  3FIW A;  4RBO A;  3ABK H;  4CCN A;  2LRE A;  3M9A A;  1D8J A;  4HX8 A;  4RAY A;  5BNG A;  3QYB A;  3QAH A;  4A5N A;  1XB4 A;  3CF5 F;  1YW9 A;  5M3M J;  1HC8 A;  3JR9 A;  2HOE A;  5K7F A;  2P5L C;  3BG3 A;  3TO9 A;  3UR3 C;  3J7Y J;  2HDW A;  4XLH A;  3LWF A;  1O3Q A;  2BXY A;  1U8R A;  4XON A;  2JZY A;  3EYY A;  2DW4 A;  3B6C A;  1CQT A;  2CV1 A;  1F43 A;  2VE8 A;  1XGN A;  2VJ4 A;  3CCR I;  4DYR A;  3MZY A;  2XAG A;  3L1P A;  4PSW A;  3KP5 A;  5GPA A;  3GLL A;  4M74 A;  2KIQ A;  1QVU A;  1ZLK A;  2K4B A;  4ASN A;  2ZXI A;  4V2G A;  1PUE E;  5LRR A;  1EKE A;  2JPC A;  4ZDP A;  2LK2 A;  1OIS A;  1JGG A;  4MHG A;  1U8B A;  4XSZ F;  3GO5 A;  5IPA A;  3ZQC A;  3DBR B;  5J4V A;  3ZCO A;  5ICE A;  4OAY A;  3C18 A;  3IV5 A;  4BS9 A;  1R4N B;  2KRC A;  3BOQ A;  4Y13 A;  1TBX A;  3HBL A;  4C3J J;  5LHH A;  3KEO A;  2LBF A;  4HF1 A;  3KZI C;  4PFO A;  2CH0 A;  4Q48 A;  3WE3 A;  3LSR A;  5F0C A;  2ME6 A;  3KEY A;  2W7N A;  3S1Q J;  2GWR A;  2IGO A;  2WB1 A;  3MEX A;  4S0H B;  1NTC A;  2R5Z A;  4C3I J;  3BWG A;  2XPW A;  1UCR A;  3HOT A;  5GAD J;  1YE9 A;  3H0D A;  1SD6 A;  4EJW A;  2WAQ A;  3WTY C;  3OS0 A;  4X1E A;  1KYZ A;  2MD0 A;  2HZD A;  4Q47 A;  2EH3 A;  1T2K A;  3PO2 J;  1U3E M;  1O3R A;  3BG7 A;  5E3O A;  4N4N B;  1G3S A;  3K4M A;  3JRA A;  2X1E A;  1VQ9 I;  5DUK A;  3MD2 A;  2KIF A;  3VOE A;  4E7I A;  4ESF A;  5B1A H;  3B73 A;  3R0J A;  3VEP A;  5L3E A;  2LY2 A;  4QWQ A;  1IJW C;  3QRF F;  4HSR A;  1QGP A;  2HZT A;  1MBF A;  3ZXS A;  4CDG A;  3IWF A;  1HKQ A;  1XG1 A;  1WKM A;  3LSJ A;  4LG0 A;  2M3A A;  3HHH A;  4OMZ A;  2OV7 A;  1N78 A;  4LIV A;  3LA7 A;  2NNY A;  4M9X A;  1Q1V A;  3O8G A;  3RPU D;  2GXB A;  4JX6 A;  2IS6 A;  4B48 A;  2AO9 A;  3A4C A;  3EUH C;  1MIJ A;  1REP C;  3WHC A;  4ZYH A;  2R7V A;  4G7H F;  1SVO A;  3A0B C;  1F1Z A;  3OYJ A;  4JBA A;  3KZY A;  3TO6 A;  5E20 A;  1B8I A;  2FML A;  4F93 B;  3HOX J;  3H3U A;  4CCL A;  2LRD A;  3R60 A;  3IL2 A;  2UXN A;  3GVA A;  2D1H A;  3W2A A;  5LGT A;  4PJM A;  4BJ5 C;  3FF5 A;  4IQ4 A;  5JVG F;  2F6C A;  2QWW A;  4I0B A;  4RDU A;  3QQA A;  4OIO F;  2DA1 A;  1HKT A;  2W84 A;  2W82 A;  4B1R A;  1SD7 A;  3QP5 A;  4KIS A;  2XPV A;  3C2H A;  2XRL A;  1I5Z A;  3K10 A;  3JRG A;  5CJ9 A;  3HOS A;  1BW5 A;  1IN5 A;  3K4N A;  3W3C A;  4ZYE A;  1FOW A;  2WB1 N;  2WBM A;  4CZC A;  1MZB A;  3BTL A;  3S93 A;  1IGN A;  2CS3 A;  4R79 A;  5DEQ A;  5AIP A;  2VXZ A;  2MH2 A;  4BBS J;  2WAQ N;  4EJT A;  4MLO A;  5HNF A;  4YIF A;  4RM2 A;  5D8L B;  2D45 A;  4HV6 A;  3AG3 H;  2EFN A;  3FWE A;  1IZ1 A;  4ZZL A;  2RVC A;  4O5V A;  2RDP A;  1S72 I;  4XSX F;  2Y48 A;  3EUH A;  4RLF A;  2HVQ A;  2RKH A;  3CMA I;  2P5K A;  1I3Q J;  4A5M A;  1OMI A;  1MDM B;  2UZK A;  5DCF A;  5D5W B;  4C2U A;  1V3F A;  2MYS A;  1IN4 A;  5GP9 A;  4BAY A;  1V4R A;  1SFU A;  3I53 A;  2NAZ A;  3BJA A;  3RCO A;  2JA8 J;  4E7K A;  1B6A A;  2QKL B;  1WI3 A;  2KRF A;  4YII A;  1TZL A;  1WCM J;  3LST A;  3KZZ A;  1USS A;  3SEZ A;  1MD0 A;  5KVR A;  3FHN A;  2JA2 A;  4UVC A;  1R49 A;  1ONV A;  5KCM A;  1PUF A;  2MA3 A;  3BDD A;  1W0U A;  5M5W J;  2CO5 A;  2E1O A;  4FQG A;  4NC7 A;  5HS7 A;  2IW5 A;  3ZMZ A;  2ETH A;  5J47 A;  5BMZ A;  2VL8 A;  1Y8R B;  3KFW X;  1FOY A;  4B44 A;  3IWZ A;  5JI6 A;  4CUG A;  3H35 A;  2B7E A;  2I8D A;  2VC1 A;  4JYK A;  3BLY A;  4XMY A;  3RDI A;  1ZN2 A;  2DQL A;  3S17 J;  3SFZ A;  1FBS A;  4BJT A;  1UG0 A;  4IOA F;  1U5T B;  2EQR A;  4RGS A;  5GTH C;  3ASN H;  2LY9 A;  2VKE A;  3OYL A;  2HS5 A;  2R7Q A;  1TT5 B;  2CSO A;  2FRH A;  4BXU A;  1LE8 A;  5FKM A;  2F4M B;  3TW6 A;  4C9Y A;  1FTZ A;  2CUZ A;  2EB7 A;  2KPM A;  4A69 C;  1BR2 A;  4JP0 A;  2GIZ A;  4I7H A;  1SFX A;  4C2M J;  1Z21 A;  3QOP A;  3L00 A;  2H09 A;  1W0T A;  1X3U A;  4IOC F;  1XMX A;  2G9W A;  3IUO A;  1TWF J;  4HNT A;  5CVV A;  4BEH A;  2WY8 Q;  4EM2 A;  4MO7 A;  2KIS A;  2KKO A;  3P7N A;  2ESN A;  1X3Z B;  4KJZ A;  2NNN A;  2AQF A;  1J59 A;  1GXP A;  1ZK8 A;  1RI7 A;  3CJQ B;  1X1P A;  3F8N A;  3TP3 A;  3V8K A;  3BY6 A;  5GAE J;  3K2A A;  4J19 A;  1IW7 F;  5B66 C;  2P6S A;  4UHT A;  2V79 A;  3T5X A;  4EVI A;  4BXX J;  2M4K A;  4E4H A;  2XAH A;  3P5J A;  1LNW A;  5ICF A;  1U78 A;  3M7G A;  4NC8 A;  3GCM A;  3VYR B;  1RKW A;  2I5U A;  4M6Y A;  1FOX A;  2Z2S B;  3ERE D;  4PGG A;  2ICW G;  4EQQ A;  3PNV A;  4UVA A;  1NG6 A;  3GLX A;  2L9S A;  2JVH A;  4LK1 F;  4A3L J;  2VN2 A;  1DP3 A;  1ORK A;  1QZY A;  1HDP A;  3QPS A;  5TIS C;  2IA0 A;  5BQT A;  3G1O A;  4I76 A;  3K9T A;  3QU6 A;  3SZT A;  5HDN A;  3BG6 A;  5FB2 A;  2CQN A;  2O9L A;  4OIP F;  3ZP5 A;  2OTL I;  1ZGW A;  4G6D A;  5DM7 F;  3ASO H;  3FZV A;  4PZJ A;  2BY1 A;  3NAR A;  2B0L A;  3T0Y A;  2EV5 A;  2L7M P;  4XLE A;  2R7S A;  1MMN A;  4HQM A;  2XGX A;  1BC8 C;  1SAN A;  3MKW B;  2M0M A;  1TTY A;  1YOV B;  3BG9 A;  2E35 A;  4HST A;  1O57 A;  1RES A;  3DEE A;  5CVI A;  2XKP A;  3CC7 I;  1XTA A;  1P4W A;  2L4A A;  2G7H A;  4WXD A;  3PIO F;  3BR3 A;  4DGW B;  4BDZ A;  2EA4 A;  4U0V A;  2QLZ A;  3NEU A;  3M3Y J;  3OYC A;  4C2T A;  4IHS A;  4KN4 X;  1XGS A;  2HTJ A;  2V1D A;  3MCZ A;  2STT A;  4UUS B;  4EM1 A;  1QPM A;  4HDU A;  2E1M B;  1PYV A;  1MJB A;  1YS7 A;  3I55 I;  4GFB A;  2PQ8 A;  1ZTR A;  1ZG5 A;  2HI3 A;  2LY1 A;  2PMU A;  4Y15 A;  3JRE A;  4PFP A;  2W24 A;  5KHD A;  4OAZ A;  1I1S A;  1R1V A;  5CYV A;  2DPU A;  2DK8 A;  2CUE A;  2HQN A;  5TGT A;  3WTX C;  5IYD J;  1HSJ A;  2W57 A;  2NVX J;  4N9H A;  1GT0 C;  4CYC A;  2IS2 A;  3ZQF A;  2FA5 A;  4KIG A;  4B43 A;  5ICG A;  5FFX A;  3OYH A;  2YSR A;  1YYV A;  4WF2 A;  1TQI A;  1XGM A;  4DYQ A;  2VKH A;  2C6Y A;  1LVK A;  4G8X A;  2X6Y A;  1T56 A;  2VLA A;  4O6J A;  4EJU A;  1X3W B;  4P9U A;  1OFC X;  2IPQ X;  3HHG A;  3ECO A;  1XCV A;  4BYY A;  2A61 A;  4BU2 A;  3CCL I;  1R5H A;  1IUY A;  1OCZ H;  3WGI A;  5DTD A;  4M73 A;  3HTU A;  3A2K A;  5HLG A;  2QZ8 A;  5FKO A;  4IL6 C;  2AQE A;  2BV6 A;  3KE2 A;  4RLQ A;  3HGG A;  3E97 A;  2XAF A;  1DU0 A;  1ZQ3 P;  1RC9 A;  1Z0X A;  4ZZD A;  5J8C A;  2DT7 B;  4ENM A;  2IRF G;  4NC6 A;  1K78 A;  3K4L A;  2Y9Z A;  3TO7 A;  1HST A;  1MSE C;  3CCV I;  4IO9 F;  5IOY A;  1ERD A;  4M3E A;  1KA8 A;  1FBQ A;  2ISZ A;  3DU6 A;  4MIM A;  3OOU A;  3OMY A;  5HS8 A;  1WH5 A;  4D5F A;  2ZJ2 A;  4B3A A;  5K5R A;  1RR8 C;  2M87 A;  3PQJ A;  3LA2 A;  2R5Z B;  1NG7 A;  3J80 K;  1MND A;  2JA5 J;  4FX4 A;  2EV0 A;  1MW7 A;  1JKR C;  5HLI A;  2YU3 A;  2ZJR F;  2ISY A;  1MDM A;  1I50 J;  2F4O B;  2DDA A;  2GZW A;  3K4K A;  3FIS A;  3I0T A;  2PLY A;  2X4H A;  2A3S A;  2GXG A;  4LOC A;  1TWA J;  1X58 A;  1K6O A;  1WSU A;  2D5V A;  2VOO A;  3LA3 A;  1ZAO A;  2XB5 A;  4XOT A;  2CQX A;  1VQM I;  3VFZ A;  1DU6 A;  1TNS A;  4NHJ A;  1ZG3 A;  4HF0 A;  3V42 A;  2O3F A;  2Z5U A;  2DOE A;  4Y7N J;  3BZ6 A;  1LPQ A;  1JJ6 C;  5B1B H;  3HJE A;  2KQR A;  2LP0 A;  3KET A;  2CMP A;  4E70 A;  2XAQ A;  3F3X A;  2M7B A;  2R7D A;  1RZ4 A;  4KNY A;  3R4K A;  5F1J A;  3SQN A;  2ZME C;  2OA4 A;  2ZSI B;  3DPT A;  3CCJ I;  4LG0 B;  3I9V 2;  4P55 A;  4B47 A;  4HF2 A;  5L3C A;  2ZJQ F;  4YFK F;  5LHI A;  1WJA A;  2ZFW A;  4RB2 C;  4NUB A;  4XKC A;  2J5P A;  1IXR C;  3CCU I;  3MQ0 A;  1WPK A;  3N97 A;  4G9Y A;  4FIS A;  4FHT A;  4RS8 A;  3DKX A;  2FE3 A;  1KZH A;  2K27 A;  2DMT A;  4EGY A;  1B8I B;  1UST A;  5J6X A;  2JA6 J;  2NS8 A;  5FGM A;  2V7F A;  2QSG X;  3ZMT A;  3NRV A;  1HXD A;  5FJ8 J;  2RV8 A;  3GTL J;  1LQ1 A;  2MGQ A;  2BXZ A;  1JT0 A;  3K0L A;  2QCO A;  1YJW I;  3LSP A;  4F91 B;  1M1E B;  1EJ9 A;  2LNB A;  2FNP A;  2DT6 A;  2A6E F;  3KP4 A;  4JK1 X;  1BM9 A;  1IO2 A;  2IXS A;  4PCQ A;  5BPD A;  4BH9 A;  1BI1 A;  1UHW A;  4M9Z A;  3PL8 A;  4AIK A;  4LK0 F;  5FD6 A;  4BHB A;  2KIU A;  3DTI A;  2HVS A;  4ZC3 A;  3LSM A;  2MC3 A;  2M2E A;  2MD5 A;  2ZME A;  3HKZ A;  1BI2 A;  3OIP A;  1YRN A;  1X2N A;  2D2W A;  2Y31 A;  1GVJ A;  4HV5 A;  4BJ6 C;  3IH2 A;  3WTT C;  3KP7 A;  3HYI A;  4BUP A;  5K5O A;  3OSG A;  3HRU A;  1FIP A;  3ABM H;  1MH3 A;  3S3O A;  1R23 A;  1WFX A;  2LC2 A;  3SZG A;  1JTY A;  3ZQ7 A;  1HA8 A;  1PJR A;  2JUC A;  1T6S A;  5FD5 A;  4Z2Y A;  2GM4 A;  1A31 A;  4FX0 A;  4Q5S F;  2DLL A;  5D6F A;  3WOD F;  1ZH5 A;  3I5U A;  1XX5 A;  2PBI A;  4WXH A;  2DU9 A;  1WWX A;  2FSW A;  3TL4 X;  4KMF A;  1U0J A;  3FXO A;  5CPR B;  4MEY F;  3RPQ A;  1ZGJ A;  1JGS A;  3DV8 A;  4F92 B;  1T95 A;  3AG2 H;  2HR3 A;  2NOG A;  4BQA A;  3OS2 A;  2QM3 A;  1WQ2 A;  1IAW A;  4IRI A;  1BJA A;  3OYA A;  1RET A;  1PUF B;  3E1S A;  3P9K A;  2O03 A;  2ZFU A;  5F04 A;  3BQY A;  3N4M A;  1C0W A;  2XV4 S;  2E5N A;  3DWL E;  2E2I J;  5E79 C;  3JAM K;  4D7M A;  3BZC A;  2JMW A;  2GLO A;  2FNA A;  3GTM J;  3KYD B;  1JUS A;  2QF7 A;  1WJ5 A;  3H5N A;  1ZRD A;  1IN7 A;  1LKX A;  2DO7 A;  1KQ9 A;  1WRJ A;  2LOO A;  3V8J A;  1O3S A;  1STZ A;  1OYI A;  4M3G A;  2E1N A;  1T38 A;  2E1C A;  3O8H A;  4CYD A;  1LE8 B;  4M9S A;  1B1B A;  1GV2 A;  2QEN A;  2EIJ H;  3GTJ J;  3M8E A;  2COB A;  2EFO A;  2JRM A;  4MGR A;  1TC3 C;  5C4J J;  1GXQ A;  2L9R A;  5C3E J;  4UUT A;  3CMY A;  1MBG A;  3HKZ N;  5IP7 J;  2E5Z A;  1RIO H;  1HF0 A;  2VON A;  5DD4 A;  3HZJ A;  2XF6 A;  2X9D A;  2L9N A;  3LSK A;  5FLX K;  2GBY A;  4BEH B;  3GYH X;  1FTT A;  3PSF A;  5D5X B;  1PP7 U;  2VUM J;  4HAM A;  4F52 A;  2ECC A;  4A3K J;  2H1K A;  1R58 A;  2QSH X;  1ACI A;  1YIO A;  1ZKG A;  3S2H J;  2M34 A;  5AON A;  2HDC A;  3IHU A;  2HEO A;  3VPR A;  4LIT A;  2W1O A;  4QPQ A;  3JRI A;  2CFX A;  3E6C C;  3KP6 A;  2LKX A;  4RA2 A;  4BY7 J;  2M9H A;  4OOI A;  2FQ4 A;  1LFP A;  2GIV A;  1EF4 A;  5DUI A;  1KU3 A;  2VE9 A;  2KP6 A;  3TKY A;  2JA7 J;  1QNT A;  3BR6 A;  1NK2 P;  2VI6 A;  3H9G A;  1UFM A;  3RZO J;  2E60 A;  1DQU A;  3D0S A;  4D5C A;  1YS6 A;  1X1C A;  3O6B B;  4HDV A;  3RKQ A;  1UEL B;  3KYL A;  3PO3 J;  4Y52 J;  4G12 A;  1IF1 A;  4CCJ A;  4E7S A;  4UVB A;  4U88 A;  2O6G E;  3K2Z A;  3H3Z A;  3SDB A;  4ENN A;  3ZMU A;  2YU9 J;  4O3M A;  1JE8 A;  1W5S A;  4XLF A;  2JWT A;  3CJN A;  3FHZ A;  1D3Y A;  4IF4 A;  1D0Z A;  3GTP J;  2FBH A;  2N8G A;  3K6G A;  4RGR A;  1QU3 A;  3OYI A;  1RUN A;  1G4D A;  1BW6 A;  1P4A A;  2HKX A;  3V7C A;  1P92 A;  4V2F A;  3OYD A;  2CV0 A;  3N05 A;  1HDD C;  2EIN H;  2HXI A;  5E18 F;  2X85 A;  1JJ8 C;  3KPH A;  3V7S A;  1S8N A;  3MAJ A;  1VQ5 I;  2IA1 A;  1XGO A;  3CJT B;  4XOP A;  3GTQ J;  5D5U B;  2XAU A;  3CES A;  4HPQ A;  5LFA A;  3FMQ A;  3HRS A;  5J1Y A;  3OYG A;  4WK8 F;  5EEH A;  3KLO A;  2BYV E;  3F0C A;  4CYC B;  4HG2 A;  3U1K A;  4XL9 A;  2IVM A;  2MG4 A;  2BHY A;  3CO6 C;  5IT9 K;  2FU4 A;  5HOD A;  2MBF A;  1Z9C A;  5CQE A;  3VDX A;  1Z91 A;  4RGU A;  3CDI A;  2GOX B;  2BY0 A;  5KK1 A;  3LFU A;  3OL4 A;  3F8C A;  4AIH A;  2A5W A;  1U9O A;  1K6Y A;  3J81 Z;  2OD5 A;  3BR5 A;  1FYL A;  4XBF A;  4N4O B;  3GZ6 A;  2XHK A;  1FJL A;  1ON2 A;  1VQ8 I;  2F5C A;  2Y2Z A;  5GAG J;  4YFX F;  2KHM A;  2BY2 A;  2DN0 A;  2RC4 A;  2V9V A;  4XIC A;  1FP1 D;  4PJ0 C;  1DPR A;  2B63 J;  1IV8 A;  1Y56 A;  2KIM A;  2LSO A;  3A1Y A;  1J0R A;  2QQA A;  2MH9 A;  3WTU C;  3BPV A;  5HLT A;  5FLM J;  5EDN A;  1QHH D;  4QLC U;  1G3Y A;  2KDO A;  1K78 B;  2Q2E B;  2GOM A;  5J40 A;  1XMK A;  1IDZ A;  1FBU A;  2M5W A;  1R36 A;  2DBB A;  1FYK A;  2MFZ A;  2ACJ A;  1D8K A;  3HPH A;  3DEW A;  2HGC A;  1FP2 A;  1BL0 A;  2Y75 A;  2CQQ A;  3E7L A;  4PJN A;  3K4C A;  2R7X A;  3ZQQ A;  1AOY A;  2HYF A;  1R1U A;  2Z1D A;  4OIQ F;  2ZNZ A;  4PDK A;  4R8H A;  5L3G A;  2VKD A;  1J2X A;  2EFQ A;  3OWT A;  1HW1 A;  4CZZ A;  1T8I A;  1U6G A;  2JRT A;  3HM5 A;  2OCE A;  4MEX F;  3DKY A;  1WH7 A;  5CVJ A;  3D5L A;  5D4R A;  3IAS 2;  1X1D A;  2EZK A;  5FKN A;  2ZXW H;  3OY9 A;  3AG1 H;  2NVU B;  4ABZ A;  1GVD A;  5H2F C;  1XCB A;  4M72 A;  5HDK A;  5IP9 J;  1PDN C;  4J00 A;  1G59 A;  2IGM A;  5D5V B;  3ZN1 A;  3CC2 I;  3U9G A;  2EZI A;  2ZO4 A;  2RAE A;  5B5E C;  1YFH A;  1ITY A;  4A3B J;  2BEO A;  3AG4 H;  2XIG A;  3F6V A;  1TW3 A;  4Y33 A;  4HBL A;  2UXX A;  2COM A;  1RR7 A;  4XLN F;  5JR3 A;  3DLL F;  1X4P A;  1LDD A;  3WGG A;  4IHV A;  4DZP A;  3ZQL A;  2XRO A;  3TBI A;  2OC6 A;  1T08 B;  2EPF A;  1WZ2 A;  5F27 A;  4LB6 B;  2VIX A;  1QPI A;  1O7F A;  4YEJ A;  2R7O A;  2IA2 A;  3L9F A;  3ZMD A;  3ML6 A;  3O2P E;  1Z7U A;  3BTJ A;  5J3L A;  4YIR X;  2KRH A;  1JKQ C;  2NYX A;  3V8L A;  1K4S A;  3QP6 A;  3WU1 B;  2FXA A;  5EEG A;  2CWE A;  4RMN A;  3QU3 A;  5J1U A;  1ZRC A;  4FTH A;  3CP8 A;  3BTC A;  3EYI A;  3CME I;  3EUA A;  3FM3 A;  2DYS H;  4M3B A;  4XLA A;  5B3S H;  1HLV A;  3S1R J;  3OYM A;  1IDY A;  1ENH A;  3F6O A;  2V9K A;  2ZXJ A;  4D0P A;  3VB2 A;  1XSV A;  1X4O A;  3I3L A;  2AHQ A;  5TRD A;  3OYE A;  5DCM A;  5A2Q Z;  3C2G A;  2HDD A;  2O8K A;  1BN5 A;  1Y8Q B;  2QGU A;  3M8F A;  3VSL A;  2VAS A;  4FT8 A;  3A02 A;  3S1M J;  5D6E A;  1IV6 A;  1WGX A;  4NBQ A;  2OCC H;  1BJZ A;  1JHF A;  4S04 A;  3WTS C;  2R7T A;  1UAA A;  1G3W A;  1G8X A;  3I4P A;  1JI8 A;  1ZR4 A;  5FRN A;  3GF2 A;  4L0Y B;  5FFZ A;  4YRV A;  2UV1 A;  4MQV A;  4EMS A;  2P6T A;  2ZME B;  2IEK A;  5JFR A;  1YRN B;  2FUG 2;  1ODD A;  2CG4 A;  2QVO A;  3HPG A;  1W36 D;  2VQH A;  3V7R A;  3L2V A;  5K7H A;  4W97 A;  1HCR A;  3LL7 A;  5H6R A;  2CFO A;  2Y9Y A;  3OIQ A;  3HOZ J;  3GBG A;  1WHU A;  1QBJ A;  1X1A A;  1BC7 C;  2BY3 A;  3ROU A;  3CUQ B;  1DP7 P;  2HKO A;  3BQZ A;  3I4N J;  3CMM A;  4PGH A;  4TV7 A;  4CCK A;  2NS0 A;  4FET A;  1XD7 A;  3PFY A;  3VOD A;  1FY7 A;  1Z3Y A;  2XDV A;  2P7V B;  2PMZ A;  2F5F A;  1FZP B;  3S1N J;  3G1L A;  2HPM A;  3IP4 B;  4DZJ A;  2OPT A;  4WX9 A;  3LFK A;  5LGU A;  2BE5 F;  3FXR A;  4AID A;  4ON0 A;  1WJE A;  1XSX A;  4P5O A;  1V54 H;  3WG9 A;  5HNH A;  2O5R A;  3HRM A;  5EZH A;  3S16 J;  4LGW A;  1VQN I;  2A6H F;  2H1L A;  3ZQH A;  2NRA C;  4G7Z F;  1EH6 A;  1TNT A;  4JOM A;  3GTG J;  2JN6 A;  1S5L C;  5D8K B;  3Q3S A;  5FKK A;  2FX0 A;  4LLG F;  4BNC A;  1D1A A;  2JT1 A;  3PQK A;  2L7F P;  2UUZ A;  4BQQ A;  5FKL A;  2AS5 F;  1B59 A;  1P2F A;  3GX4 X;  1KQ0 A;  3BCB A;  3WTZ A;  1ZG1 A;  4H4K C;  2F5D A;  2LYC A;  3ULQ B;  4XRF A;  5C44 J;  3G3Z A;  3WG7 H;  3CCY A;  3OV8 A;  2QQ9 A;  1P7I A;  1A35 A;  3FX3 A;  3Q9S A;  3LQQ A;  2GA2 A;  1UG2 A;  4DBQ A;  4KT6 A;  1PVE A;  4MQ9 F;  2A5Y B;  2XVC A;  4ZH4 F;  4D7N A;  3JSO A;  1P7J A;  1HOM A;  4XM3 A;  1SMT A;  1YTY A;  1MNE A;  3TDU C;  1E2X A;  2L7K A;  3FXL A;  3BR2 A;  4EGZ A;  1JKP C;  2NOJ B;  2CGP A;  2KDZ A;  2L4M A;  4QIW N;  1WJF A;  3DKW A;  4XN0 A;  1D1B A;  2M8G X;  2MC4 A;  1OYY A;  3EET A;  3R6S A;  3TW7 A;  4Z6Y A;  5BPI A;  1UHS A;  2KJC A;  4I98 B;  2OF7 A;  1QQI A;  5LGN A;  4A3M J;  5F0H A;  2K9L A;  3HOY J;  1FNN A;  1R6R A;  3Q9V A;  4ZTJ A;  1SAX A;  1UJ8 A;  3OR1 C;  2DOF A;  3E6D A;  1KU9 A;  4I6Z A;  3FK7 A;  1AA7 A;  1ON1 A;  3E5U A;  4KN7 X;  4F7Z A;  1YO5 C;  2K5C A;  2IBD A;  4K2E A;  2Q1Z B;  1HW5 A;  1FYM A;  4RAF A;  2VT3 A;  1E3H A;  3GFM A;  1T0F C;  2FBI A;  2PMZ N;  2R7U A;  4BE0 A;  1O3T A;  4Y4R A;  1APL C;  4DW6 A;  4B3X A;  2VOP A;  3OS1 A;  4KDP A;  3GUD A;  3U1D A;  4Q4Z F;  2LFB A;  3COA C;  4GXO A;  3HUG A;  2R7W A;  1T39 A;  1LEB A;  1BOA A;  2IT0 A;  2UWM A;  2DTZ A;  5EG0 B;  2WWY A;  2I10 A;  1K61 A;  5E8I A;  2DYR H;  2DA4 A;  3P9C A;  2Q2E A;  1YIT I;  4IX7 A;  3BTI A;  1VQO I;  2QSF X;  3RKW A;  4Y3O A;  4XN3 A;  3J7A O;  3Q0V A;  2VJI A;  3ZQG A;  1OKR A;  4E7L A;  2CW7 A;  4LD5 A;  3LOC A;  3H5R A;  1I6H J;  3BRO A;  3CUO A;  1BIB A;  3OOP A;  1DDN A;  1E17 A;  1V55 H;  1CGP A;  2O8X A;  2L3D A;  2L02 A;  3MKZ A;  1I6X A;  2E7X A;  1GLN A;  2OAZ A;  3EDP A;  4GRI A;  4YEL A;  4DNC A;  5KNL A;  1P9Q C;  3J7Z I;  2ELH A;  4U7B A;  3A03 A;  2WA0 A;  3OYN A;  4IPA A;  1RPW A;  1LFB A;  2R4G A;  3ZQI A;  1T33 A;  2XF7 A;  4YG2 F;  3K7A J;  3KIO A;  4B8X A;  4IEJ A;  3E3V A;  1S9H A;  2DFE A;  3IAM 2;  1AKH A;  2ADU A;  2L2O A;  3GZ5 A;  4KT5 C;  4UXN A;  5LLQ A;  2LF8 A;  2K9N A;  2RNJ A;  3G2B A;  2VQL A;  3JRF A;  1T0F A;  3ZPL A;  1B72 A;  2NXN B;  5BOX A;  4ZJZ A;  3BJ6 A;  2BZT A;  2XAS A;  2V1N A;  3U2R A;  4ENK A;  3HC7 A;  3DQV C;  3K4B A;  4RAG A;  1P6R A;  2OQG A;  2OTJ I;  2H27 A;  2M1B A;  2ME0 A;  2H8R A;  3MMY B;  1K83 J;  5E1W A;  1W5C C;  3CCM I;  3A0H C;  4KIC A;  1HW2 A;  3S3M A;  4BQN A;  2DMQ A;  2HPI A;  4F3Q A;  3MZH A;  1IC8 A;  1G6N A;  2EWN A;  2HQR A;  3FKI J;  3PSI A;  4MFD A;  1KU7 A;  3FXQ A;  4A0X A;  2IAI A;  2G7U A;  1G3T A;  4AD9 A;  4ESJ A;  1H88 C;  1DPU A;  2ELJ A;  3K4J A;  3WTV C;  1B9M A;  1A04 A;  1BIA A;  2E34 A;  2GXA A;  2VJ5 A;  2V9P A;  4RAZ A;  2CRG A;  1YG2 A;  2XRN A;  1WVR A;  4RGX A;  3CUQ C;  2EFP A;  4BKX A;  3F22 A;  4U0W A;  2DA5 A;  5CVR A;  1S7E A;  2VBZ A;  4M71 A;  2P81 A;  2DJN A;  2DMP A;  1X1B A;  2HYJ A;  3QPT A;  3L2W A;  4KIF A;  3HIF A;  3GWZ A;  4BE2 A;  1ETQ A;  1GUU A;  5H20 A;  4Y17 A;  3FMR A;  3CDH A;  4AUX A;  1XC5 A;  2XKO A;  4HNV A;  2CUF A;  3FK6 A;  3EQL F;  4S05 A;  2F4I A;  3FDY A;  3KLN A;  4EJV A;  1XSD A;  2XGD A;  2K4J A;  3JAM Z;  2E7W A;  5JVT A;  2RGV A;  4D9J A;  1GHC A;  1TWG J;  1Z6R A;  2BW3 A;  2O0Y A;  5CLS A;  4HZF A;  2PFB A;  4PJJ A;  3W6V A;  3VYU B;  3MKL A;  4A2U A;  4GCV A;  4AM3 A;  4DBR A;  1EH8 A;  5E17 F;  3TGN A;  1MNM C;  2Z33 A;  2F48 A;  3FXJ A;  1LB2 A;  3OYK A;  1E3O C;  2PI0 A;  4QPO A;  2BGC A;  2HYG D;  4U0Y A;  2OQR A;  1D0X A;  1NK3 P;  4IXA A;  3NWS A;  4IVN A;  2VXD A;  3CZ6 A;  4IHT A;  1LUJ B;  2EK5 A;  3G73 A;  2DAO A;  2K9S A;  3CUQ A;  2PMH A;  2CQ7 A;  2H94 A;  2O7O A;  3GW2 A;  4LLL A;  4FCY A;  3NAU A;  4ZDL A;  4G6Q A;  2QEX I;  1D0Y A;  2OZU A;  2EZL A;  2BOL A;  2M7A A;  5FLX Z;  1ZR2 A;  2CU7 A;  4CHU A;  4KIB A;  3OL3 A;  3GEZ A;  4UY8 I;  1OJL A;  3FKJ A;  2QQB A;  1OQY A;  2H6C A;  3FXM A;  4ZTF A;  3S14 J;  1W4M A;  4AIJ A;  3QPL A;  4N9I A;  3QOD A;  1D1C A;  3BP8 A;  1R9T J;  1DGR M;  5K7Z A;  2GAU A;  2X1C A;  1KQ8 A;  2FJ1 A;  4L9V A;  2F5E A;  5FO5 A;  2R93 J;  2KJB A;  1BR1 A;  3GXO A;  5ICC A;  2EZH A;  3R0A A;  2R5Y A; 
#chains in the Genus database with same CATH homology
 4ESB A;  4NB5 A;  1YQA A;  2VBY A;  3I59 A;  3WE2 A;  3T8R A;  1TW2 A;  1IRF A;  3ABU A;  4KMU X;  2J5O A;  1PP8 F;  5L3F A;  1RUO A;  5H6Q A;  2Q0O A;  4NQW A;  5DCM B;  4AVP A;  2P4W A;  1UHM A;  2QBY A;  3HSF A;  2OBP A;  1S29 A;  2P5V A;  2A07 F;  5L3B A;  1I1G A;  3NQO A;  3RKX A;  2DT5 A;  3MWM A;  2VT2 A;  2ZBK A;  4CIC A;  3V4G A;  2IJL A;  1S7O A;  1SD4 A;  3L2C A;  4KUM A;  2EV6 A;  1LDK B;  1OYW A;  1MJ9 A;  6PAX A;  5F1R A;  1W7P B;  2ESH A;  1H0M A;  2M30 A;  1WI9 A;  4YFN F;  1TLH B;  5IT9 Z;  4RB0 A;  1FWZ A;  3RTR A;  4EM0 B;  4L9N A;  3E5X A;  1Z1D A;  2IP2 A;  2DQR A;  4EJO A;  3ZN0 A;  4LLN A;  1S3J A;  2V1U A;  3CO7 C;  1XDU A;  2A69 F;  5HDG A;  1W5T A;  3ISP A;  4BHP A;  4ZYD A;  3FMS A;  2PJP A;  1IN6 A;  3TDZ C;  1LVA A;  1S6L A;  1J75 A;  5TJJ A;  4CGZ A;  5JHU A;  3SZP A;  4HOB A;  4EV0 A;  5LRS A;  4G7O F;  1FOK A;  4RB1 A;  3K1N A;  1K7A A;  1ZHF A;  3HRT A;  4RB3 C;  3DF8 A;  4HX7 A;  3KP2 A;  3I54 A;  3KP3 A;  1IXC A;  1FT9 A;  1TQM A;  4UV9 A;  1XDS A;  5E1Z B;  1F4K A;  2EFW A;  4ENJ A;  1B9N A;  2HFH A;  3JTG A;  3IKT A;  1SMY F;  1QZZ A;  3HSR A;  2QYO A;  3E5Q A;  5HVQ C;  1P4X A;  4A6E A;  2QUF A;  3GFJ A;  2DFI A;  2W85 A;  2DTR A;  1AWC A;  3M1E A;  1HQC A;  3K1P A;  4HW0 A;  4MTD A;  3DFG A;  4KYW A;  4GGG A;  4R1H A;  3FM5 A;  3DPL C;  2JSC A;  2CW0 F;  3W6K B;  1JHH A;  4I0A A;  2XUB A;  1FSE A;  3JW4 A;  3ECH A;  2CYY A;  3WU0 A;  3RKY A;  1ZYR F;  1DUX C;  2JPB A;  3LAJ A;  2MLG A;  1SD5 A;  3L7W A;  4OU0 A;  4KA4 A;  5DV5 A;  1L0O C;  1B4A A;  1KYW A;  2RQP A;  2ZNY A;  3R61 A;  3B02 A;  1ZRE A;  2O61 A;  4N0B A;  1LJ9 A;  1SFE A;  5DYM A;  3HTS B;  1HBX G;  1T98 A;  1RNL A;  4OIN F;  1LDJ A;  2VC0 A;  3F8B A;  3SXY A;  3J81 K;  3T1B A;  5HS9 A;  3WGH A;  5F6F A;  5ED4 A;  3Q5F A;  4M6X A;  1Q1H A;  1YLF A;  1IRG A;  1J9I A;  2DPD A;  5E8G A;  4MTE A;  5E1X A;  2P7C B;  2WTE A;  1U2W A;  2LKP A;  3T8T A;  3BPX A;  1ZGA A;  1CF7 B;  2FBK A;  2P8T A;  2TDX A;  3JTH A;  2V6C A;  3MFK A;  3ZMS A;  2VOD A;  2FF4 A;  2X0L A;  3RYP A;  3I64 A;  1KGS A;  4IRG A;  4UV8 A;  3BJO A;  1W7P A;  4JQF A;  4A12 A;  3GFI A;  3K1M A;  1MGT A;  2YR2 A;  4L9T A;  4ETS A;  4UNO A;  2D1V A;  1ZAR A;  2EA2 A;  5AIQ A;  1ZLJ A;  1R1T A;  1ULY A;  3F8F A;  4I02 A;  2Q8K A;  3C7J A;  2YX7 A;  3O3K A;  4I09 A;  1Z6T A;  4XLP F;  3SHF A;  5HLH A;  4WCG A;  3RI4 A;  3IC7 A;  3E6M A;  2R7F A;  1R7J A;  2LDU A;  2OZ6 A;  2PG4 A;  2V1X A;  3I59 B;  4LMY A;  2STW A;  1FPQ A;  2GA1 A;  2FOK A;  5L3D A;  3DP7 A;  2OU2 A;  5A2Q K;  5IT3 A;  4HX4 A;  1HKS A;  1K79 A;  4WXC A;  3J80 Z;  1MJA A;  5D4S A;  1IXS B;  3TOB A;  4DQ2 A;  4L5I A;  4A6D A;  1F5T A;  2QBY B;  2F2E A;  1FLI A;  3WTW C;  2M8E A;  3H92 A;  1F9N A;  1IN8 A;  1UB9 A;  4H0E A;  5LEK A;  2RN7 A;  2K02 A;  4P96 A;  2YPR A;  2JTV A;  4U7D A;  3L09 A;  2ZKZ A;  2Z99 A;  5CVU A;  4GO1 A;  1R00 A;  4HA8 A;  3P9I A;  4I01 A;  3IRQ A;  2HWV A;  4CO8 A;  4L18 B;  1BBY A;  3TQN A;  2PN6 A;  1JXS A;  2W25 A;  5K5Q A;  1ZRF A;  5DDG A;  3ABT A;  3RYR A;  5HOO A;  1H9T A;  5K1Y A;  5ILS A;  1QO0 D;  4LJZ F;  4P9F A;  4ZYG A;  3CLO A;  3RJP A;  3ZMV A;  1XMA A;  1LEA A;  4A0Y A;  1S7A A;  3RPU A;  2LF7 A;  1U5T C;  3TOA A;  5LBQ A;  1Y0U A;  5ILU A;  4LFU A;  5LEJ A;  2EJR A;  1EV7 A;  1L3L A;  1OR7 A;  1R5G A;  4L9J A;  1MKM A;  4GYG A;  4HLY A;  4CXF A;  3CTA A;  3I71 A;  1BI0 A;  2L01 A;  2XAJ A;  3DXJ F;  1FX7 A;  1O7L A;  3F23 A;  1XN7 A;  2ZCW A;  2BBY A;  3KEQ A;  4MNU A;  1TQP A;  2Z3Y A;  3KCC A;  3E6B A;  3PFI A;  2CQK A;  2VBX A;  3LQR A;  4WWC A;  2L54 A;  2GQQ A;  1U5T A;  2DI3 A;  2WV0 A;  3IKV A;  4B09 A;  2VBW A;  1OPC A;  3W6J B;  3REO A;  1J7K A;  1CF7 A;  2HTS A;  2R3S A;  3S2W A;  1D5V A;  1Z05 A;  3LAP A;  1YW7 A;  1YW8 A;  4OIR F;  3IRR A;  2A68 F;  4AWX B;  4L5J A;  3K69 A;  3QPH A;  2PEX A;  1FSH A;  5BS6 A;  2MLK A;  2YX4 A;  2DK5 A;  4GYI A;  1H9G A;  1NHA A;  3AAF A;  1FC3 A;  1KU2 A;  2M45 A;  3F8M A;  4IJA A;  2FMY A;  2K7L A;  2H6B A;  4BHC A;  4OMY A;  1EH7 A;  4G94 A;  3I58 A;  2Y0M A;  4UUV A;  2K86 A;  5ILV A;  3FXU A;  2AXL A;  4A0Z A;  4HYE A;  3HSE A;  4L0Z B;  1W7P D;  3C3W A;  5ERI A;  3ELK A;  4HLX A;  4KFC A;  3DEU A;  4HQE A;  2WC2 A;  2FEZ A;  1VTN C;  3RIR A;  1I27 A;  3GFL A;  5DD8 A;  1R22 A;  4I2O A;  1BI3 A;  3C1D A;  2Z9O A;  3JSP A;  3F21 A;  3F72 A;  5LHG A;  1J5Y A;  4LB5 A;  5F64 A;  5J8F A;  2FQ3 A;  4IRH A;  3M9A A;  1D8J A;  4HX8 A;  4RAY A;  4A5N A;  3QAH A;  1XB4 A;  1YW9 A;  2HOE A;  2P5L C;  3TO9 A;  3LWF A;  1O3Q A;  1U8R A;  2JZY A;  3EYY A;  2DW4 A;  2VE8 A;  1XGN A;  3MZY A;  2XAG A;  3KP5 A;  4M74 A;  1ZLK A;  2K4B A;  4ASN A;  1PUE E;  5LRR A;  2JPC A;  4MHG A;  4XSZ F;  3GO5 A;  5ICE A;  3C18 A;  3BOQ A;  4Y13 A;  1TBX A;  5LHH A;  3KEO A;  4HF1 A;  4Q48 A;  3WE3 A;  2GWR A;  3MEX A;  3BWG A;  1UCR A;  3HOT A;  1SD6 A;  4EJW A;  3WTY C;  1KYZ A;  4Q47 A;  1T2K A;  1U3E M;  1O3R A;  1G3S A;  5DUK A;  2KIF A;  3VOE A;  4ESF A;  3B73 A;  3R0J A;  3VEP A;  5L3E A;  4QWQ A;  3QRF F;  1QGP A;  2HZT A;  4CDG A;  3IWF A;  1HKQ A;  1WKM A;  4LG0 A;  4OMZ A;  3HHH A;  3LA7 A;  2NNY A;  4M9X A;  2GXB A;  1REP C;  4ZYH A;  4G7H F;  1F1Z A;  4JBA A;  3KZY A;  3TO6 A;  5E20 A;  2FML A;  3H3U A;  3R60 A;  3IL2 A;  2UXN A;  3GVA A;  2D1H A;  5LGT A;  3FF5 A;  4I0B A;  2QWW A;  4OIO F;  1HKT A;  2W84 A;  1SD7 A;  3QP5 A;  1I5Z A;  3HOS A;  5CJ9 A;  1IN5 A;  4ZYE A;  1MZB A;  4R79 A;  5DEQ A;  5AIP A;  2VXZ A;  2MH2 A;  4EJT A;  4YIF A;  5D8L B;  2D45 A;  4HV6 A;  2EFN A;  3FWE A;  1IZ1 A;  4ZZL A;  2RVC A;  4O5V A;  2RDP A;  4XSX F;  2Y48 A;  3EUH A;  2RKH A;  2P5K A;  4A5M A;  1OMI A;  1MDM B;  2UZK A;  5DCF A;  5D5W B;  1V3F A;  1IN4 A;  4BAY A;  1V4R A;  1SFU A;  3I53 A;  2NAZ A;  3BJA A;  1B6A A;  2KRF A;  4YII A;  3LST A;  3KZZ A;  1USS A;  1MD0 A;  5KVR A;  4UVC A;  1ONV A;  2MA3 A;  3BDD A;  2CO5 A;  5HS7 A;  2IW5 A;  3ZMZ A;  2ETH A;  5BMZ A;  3KFW X;  3IWZ A;  5JI6 A;  2VC1 A;  3RDI A;  1ZN2 A;  2DQL A;  3SFZ A;  1FBS A;  1U5T B;  4RGS A;  2HS5 A;  2CSO A;  2FRH A;  4BXU A;  2EB7 A;  4I7H A;  1SFX A;  3QOP A;  3L00 A;  2H09 A;  1X3U A;  2G9W A;  5CVV A;  4EM2 A;  2KKO A;  3P7N A;  2ESN A;  2NNN A;  1J59 A;  1GXP A;  1RI7 A;  3F8N A;  3V8K A;  3BY6 A;  1IW7 F;  2P6S A;  4UHT A;  2V79 A;  3T5X A;  4EVI A;  2XAH A;  5ICF A;  1LNW A;  1U78 A;  3M7G A;  4M6Y A;  3ERE D;  4PGG A;  4EQQ A;  4UVA A;  3GLX A;  4LK1 F;  2VN2 A;  1QZY A;  2IA0 A;  5BQT A;  3SZT A;  5HDN A;  3K9T A;  3QU6 A;  5FB2 A;  4OIP F;  3ZP5 A;  4G6D A;  3FZV A;  4PZJ A;  2B0L A;  3T0Y A;  2EV5 A;  4HQM A;  2XGX A;  1BC8 C;  1TTY A;  5CVI A;  1O57 A;  2XKP A;  1P4W A;  2L4A A;  2G7H A;  4WXD A;  2EA4 A;  4U0V A;  2QLZ A;  3NEU A;  4IHS A;  4KN4 X;  1XGS A;  2HTJ A;  2V1D A;  3MCZ A;  2STT A;  4EM1 A;  1QPM A;  4HDU A;  1YS7 A;  1MJB A;  2PQ8 A;  1ZG5 A;  2PMU A;  4Y15 A;  2W24 A;  1I1S A;  1R1V A;  5CYV A;  2DPU A;  2DK8 A;  3WTX C;  2HQN A;  1HSJ A;  2W57 A;  4N9H A;  2FA5 A;  4KIG A;  5ICG A;  5FFX A;  2YSR A;  1YYV A;  4WF2 A;  1TQI A;  1XGM A;  2C6Y A;  4G8X A;  4O6J A;  4EJU A;  4P9U A;  2IPQ X;  3HHG A;  3ECO A;  1XCV A;  4BYY A;  2A61 A;  1R5H A;  1IUY A;  3WGI A;  4M73 A;  3HTU A;  5HLG A;  2QZ8 A;  3KE2 A;  2BV6 A;  3E97 A;  2XAF A;  4ZZD A;  5J8C A;  4ENM A;  2IRF G;  1K78 A;  3TO7 A;  1HST A;  1KA8 A;  1FBQ A;  2ISZ A;  5HS8 A;  2ZJ2 A;  5K5R A;  2M87 A;  3PQJ A;  3LA2 A;  3J80 K;  4FX4 A;  2EV0 A;  5HLI A;  2YU3 A;  2ISY A;  1MDM A;  2GZW A;  3I0T A;  2PLY A;  2X4H A;  2A3S A;  2GXG A;  1K6O A;  1WSU A;  2VOO A;  3LA3 A;  1ZAO A;  3VFZ A;  1TNS A;  4NHJ A;  1ZG3 A;  4HF0 A;  2O3F A;  2Z5U A;  3BZ6 A;  3KET A;  4E70 A;  2XAQ A;  3F3X A;  2R7D A;  1RZ4 A;  4KNY A;  3R4K A;  3SQN A;  2OA4 A;  3DPT A;  4LG0 B;  4P55 A;  4HF2 A;  5L3C A;  4YFK F;  5LHI A;  2ZFW A;  4RB2 C;  2J5P A;  1IXR C;  3MQ0 A;  3N97 A;  4G9Y A;  4FHT A;  4RS8 A;  2FE3 A;  2K27 A;  4EGY A;  1UST A;  5J6X A;  5FGM A;  3ZMT A;  3NRV A;  1HXD A;  2RV8 A;  1LQ1 A;  3K0L A;  2LNB A;  2FNP A;  2A6E F;  3KP4 A;  4JK1 X;  1BM9 A;  4PCQ A;  5BPD A;  4BH9 A;  1BI1 A;  1UHW A;  4M9Z A;  4AIK A;  4LK0 F;  5FD6 A;  4BHB A;  2KIU A;  2MC3 A;  2MD5 A;  2ZME A;  1BI2 A;  2D2W A;  1GVJ A;  4HV5 A;  3WTT C;  3KP7 A;  3HYI A;  5K5O A;  3HRU A;  1R23 A;  3ZQ7 A;  4Z2Y A;  1T6S A;  5FD5 A;  4Q5S F;  4FX0 A;  2DLL A;  5D6F A;  3WOD F;  1ZH5 A;  3I5U A;  2PBI A;  4WXH A;  2DU9 A;  1WWX A;  2FSW A;  4KMF A;  4MEY F;  3RPQ A;  1ZGJ A;  1JGS A;  3DV8 A;  2HR3 A;  4BQA A;  2QM3 A;  1WQ2 A;  1IAW A;  4IRI A;  1BJA A;  3P9K A;  2O03 A;  3N4M A;  1C0W A;  2XV4 S;  3JAM K;  2FNA A;  1ZRD A;  1IN7 A;  2DO7 A;  1KQ9 A;  1WRJ A;  3V8J A;  1O3S A;  1STZ A;  1OYI A;  2E1N A;  1T38 A;  2E1C A;  4CYD A;  4M9S A;  1B1B A;  2QEN A;  3M8E A;  2EFO A;  4MGR A;  1GXQ A;  1RIO H;  2VON A;  5DD4 A;  5FLX K;  3GYH X;  5D5X B;  1PP7 U;  4HAM A;  1R58 A;  1YIO A;  5AON A;  2HDC A;  3IHU A;  2HEO A;  2CFX A;  3E6C C;  3KP6 A;  4OOI A;  2GIV A;  5DUI A;  1KU3 A;  2VE9 A;  3TKY A;  1QNT A;  1UFM A;  3D0S A;  1YS6 A;  3O6B B;  4HDV A;  1IF1 A;  4UVB A;  4U88 A;  2O6G E;  3K2Z A;  3H3Z A;  4ENN A;  3ZMU A;  4O3M A;  1JE8 A;  1W5S A;  3CJN A;  3FHZ A;  1D3Y A;  4IF4 A;  2FBH A;  4RGR A;  1RUN A;  1G4D A;  1P4A A;  2HKX A;  3V7C A;  1P92 A;  5E18 F;  3V7S A;  1S8N A;  3MAJ A;  2IA1 A;  1XGO A;  5D5U B;  3FMQ A;  3HRS A;  4WK8 F;  5EEH A;  3KLO A;  2BYV E;  2IVM A;  3CO6 C;  5IT9 K;  2FU4 A;  2MBF A;  1Z9C A;  1Z91 A;  4RGU A;  5KK1 A;  3F8C A;  4AIH A;  3J81 Z;  2OD5 A;  1FYL A;  4XBF A;  3GZ6 A;  2XHK A;  1ON2 A;  2F5C A;  4YFX F;  2RC4 A;  2V9V A;  1FP1 D;  1DPR A;  2KIM A;  2LSO A;  1J0R A;  2QQA A;  2MH9 A;  3WTU C;  3BPV A;  4QLC U;  1G3Y A;  1K78 B;  1XMK A;  1FBU A;  2M5W A;  1R36 A;  2DBB A;  1FYK A;  2ACJ A;  1D8K A;  2HGC A;  1FP2 A;  2Y75 A;  1AOY A;  2HYF A;  1R1U A;  4OIQ F;  2ZNZ A;  4PDK A;  4R8H A;  5L3G A;  1J2X A;  2EFQ A;  1HW1 A;  4CZZ A;  1U6G A;  2JRT A;  4MEX F;  5CVJ A;  3D5L A;  5D4R A;  1XCB A;  4M72 A;  5HDK A;  1PDN C;  5D5V B;  3ZN1 A;  3U9G A;  2ZO4 A;  1YFH A;  2BEO A;  2XIG A;  3F6V A;  1TW3 A;  4HBL A;  2UXX A;  2COM A;  4XLN F;  5JR3 A;  1LDD A;  3WGG A;  2XRO A;  4LB6 B;  1O7F A;  2IA2 A;  3L9F A;  3ZMD A;  3ML6 A;  3O2P E;  1Z7U A;  2NYX A;  3V8L A;  3QP6 A;  3WU1 B;  2FXA A;  5EEG A;  2CWE A;  1ZRC A;  3QU3 A;  3EYI A;  3FM3 A;  3F6O A;  2ZXJ A;  4D0P A;  3VB2 A;  1XSV A;  5TRD A;  5DCM A;  5A2Q Z;  1BN5 A;  3M8F A;  4FT8 A;  5D6E A;  1JHF A;  4S04 A;  3WTS C;  1G3W A;  3I4P A;  3GF2 A;  4L0Y B;  5FFZ A;  4MQV A;  4EMS A;  2P6T A;  2ZME B;  5JFR A;  1ODD A;  2CG4 A;  2QVO A;  3V7R A;  5H6R A;  1QBJ A;  1BC7 C;  3ROU A;  1DP7 P;  3CUQ B;  2HKO A;  4PGH A;  4TV7 A;  2NS0 A;  1XD7 A;  3VOD A;  1FY7 A;  2P7V B;  2F5F A;  1FZP B;  4WX9 A;  3LFK A;  5LGU A;  2BE5 F;  3FXR A;  4ON0 A;  1XSX A;  4P5O A;  3WG9 A;  3HRM A;  4LGW A;  2A6H F;  2NRA C;  4G7Z F;  1EH6 A;  1TNT A;  5D8K B;  4LLG F;  4BNC A;  2JT1 A;  3PQK A;  2AS5 F;  1B59 A;  1P2F A;  3GX4 X;  1KQ0 A;  3WTZ A;  1ZG1 A;  2F5D A;  3ULQ B;  4XRF A;  3G3Z A;  3OV8 A;  2QQ9 A;  3FX3 A;  3Q9S A;  3LQQ A;  2GA2 A;  4MQ9 F;  2A5Y B;  2XVC A;  4ZH4 F;  3JSO A;  1SMT A;  1YTY A;  3TDU C;  1E2X A;  4EGZ A;  2CGP A;  2L4M A;  3DKW A;  1OYY A;  3EET A;  3R6S A;  5BPI A;  2KJC A;  4I98 B;  5LGN A;  1QQI A;  1FNN A;  3Q9V A;  1SAX A;  3E6D A;  1KU9 A;  3E5U A;  1ON1 A;  4KN7 X;  4F7Z A;  1YO5 C;  4K2E A;  1HW5 A;  1FYM A;  2VT3 A;  3GFM A;  2FBI A;  1O3T A;  2VOP A;  4KDP A;  3GUD A;  3U1D A;  4Q4Z F;  3COA C;  4GXO A;  3HUG A;  1LEB A;  1T39 A;  1BOA A;  2IT0 A;  2UWM A;  2WWY A;  5E8I A;  3P9C A;  2Q2E A;  3RKW A;  3J7A O;  1OKR A;  4LD5 A;  3BRO A;  3CUO A;  1BIB A;  3OOP A;  1DDN A;  1E17 A;  1CGP A;  2O8X A;  2L3D A;  2L02 A;  1I6X A;  2E7X A;  2OAZ A;  3EDP A;  4DNC A;  2ELH A;  4U7B A;  4IPA A;  4YG2 F;  4B8X A;  3E3V A;  2ADU A;  3GZ5 A;  4KT5 C;  4UXN A;  5LLQ A;  2LF8 A;  2RNJ A;  1T0F A;  3ZPL A;  5BOX A;  3BJ6 A;  2XAS A;  3U2R A;  4ENK A;  3DQV C;  1P6R A;  2OQG A;  2H27 A;  2M1B A;  5E1W A;  4KIC A;  1HW2 A;  3MZH A;  1G6N A;  2EWN A;  2HQR A;  1KU7 A;  3FXQ A;  4A0X A;  2G7U A;  1G3T A;  4AD9 A;  4ESJ A;  1DPU A;  3WTV C;  1B9M A;  1BIA A;  1A04 A;  4RAZ A;  1YG2 A;  2XRN A;  4RGX A;  3CUQ C;  2EFP A;  3F22 A;  4U0W A;  5CVR A;  2VBZ A;  4M71 A;  3QPT A;  4KIF A;  3HIF A;  3GWZ A;  5H20 A;  4Y17 A;  3FMR A;  3CDH A;  2XKO A;  3EQL F;  4S05 A;  3KLN A;  4EJV A;  1XSD A;  2K4J A;  3JAM Z;  2E7W A;  5JVT A;  2RGV A;  1GHC A;  1Z6R A;  2O0Y A;  5CLS A;  4HZF A;  2PFB A;  4A2U A;  4GCV A;  1EH8 A;  5E17 F;  3TGN A;  2Z33 A;  1LB2 A;  2PI0 A;  2BGC A;  2HYG D;  4U0Y A;  2OQR A;  4IXA A;  4IVN A;  4IHT A;  2EK5 A;  3G73 A;  2DAO A;  3CUQ A;  2PMH A;  2H94 A;  3GW2 A;  4LLL A;  4G6Q A;  2OZU A;  5FLX Z;  4CHU A;  4KIB A;  3GEZ A;  2QQB A;  2H6C A;  1W4M A;  4AIJ A;  4N9I A;  3BP8 A;  2GAU A;  1KQ8 A;  4L9V A;  5FO5 A;  2F5E A;  2KJB A;  3GXO A;  5ICC A;  3R0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...