3G7BA

Staphylococcus aureus gyrase b co-complex with methyl ({5-[4-(4-hydroxypiperidin-1-yl)-2-phenyl-1,3-thiazol-5-yl]-1h-pyrazol-3-yl}methyl)carbamate inhibitor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
184
structure length
184
Chain Sequence
GLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA gyrase subunit B
publication title Discovery of pyrazolthiazoles as novel and potent inhibitors of bacterial gyrase.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase/isomerase inhibitor
total genus 54
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3g7bA00
3O2FA 2BYIA 3A0RA 2YEGA 3HYYA 3FT5A 2YK9A 2XDUA 4BIZA 1QZRA 4HY1A 4PU9A 1YSRA 3PEHA 4PRVA 4MPCA 1I5DA 5BOCA 4HZ5A 1AMWA 1UY8A 5IDJA 4HXZA 3NMQA 2YKCA 5D7DA 1B63A 5FNFA 2XK2A 2WI6A 4DUHA 1UY9A 3R4PA 4BQGA 1S14A 1TILA 3A0XA 3EHFA 3SL2A 3GIGA 4R1FA 3BMYA 1GKXA 2XJJA 2WI4A 4CWTA 4JAVA 3GIGB 3R4MA 2ZDYA 2H8MA 4EMVA 1JM6A 2YGFA 2QG2A 1I5AA 2Q8FA 4EGKA 4CWQA 3TUHA 3TZ4A 1L0OA 4LWEA 2O1WA 2BREA 2BTZA 2YKJA 2AKPA 1KZNA 2BRCA 3R4NA 3K98A 4KFGA 2WEPA 3B27A 4U7NA 2YI0A 2YE6A 1YETA 2WI7A 4B7PA 2YE9A 1TH8A 4AWPA 1U2OA 1UYLA 1S16A 5CTUA 4O07A 1QY8A 4XTJA 4ZVIA 4EGHA 2YJXA 3ZM7A 4AS9A 3RLPA 3TZ2A 2FXSA 3O6OA 1Y8NA 2BU6A 3B28A 3INWA 4KQVA 4ASAA 1UY7A 4CWSA 5J6AA 4NH8A 1AH6A 4R3AA 2YEIA 4PRXA 4KTNA 1B3QA 4CE1A 1GKZA 2O1VA 4KSHA 4ASBA 4XDMA 4KSGA 4FCRA 4O04A 3O0IA 1Y8PA 3FV5A 2XX2A 5CPHA 4BIUA 5FWKA 1BGQA 1YESA 3HZ1A 3CRLA 3G7EA 2YEHA 3DGEA 4NH7A 2Q2EB 1I58A 4XCLA 2VW5A 4YKTA 3EHJA 4H7QA 4MP7A 3OMUA 2ZKJA 2YGEA 2BT0A 4GCZA 3D36A 4CWPA 2YECA 4LWFA 3A0ZA 1GJVA 2Q8HA 1UYMA 4CE3A 2YI5A 4O05A 3Q5LA 1QYEA 1ZXMA 4I5SA 4AWOA 2HG1A 4FPPA 3T1KA 2EXLA 5FNDA 2YEJA 4KP4A 4MOTA 2PNRA 4GT8A 5D6QA 2YE3A 4WUDA 4JQLA 4YKZA 2CGFA 3VHAA 3OPDA 3TZ0A 5IN9A 2YEEA 2YJWA 1NHIA 3ZXQA 2E0AA 2CCUA 1R62A 4R3MA 3CGYA 4H81A 3A0YA 2XHXA 1UY6A 2BYHA 1YC4A 2YE8A 4LWGA 4ASGA 4URLA 2YEAA 1BXDA 5C93A 4CWFA 3EHHA 5D6PA 3R92A 4BXIA 3K99A 2YI7A 3R4OA 2CH4A 1UYFA 2YI6A 5M4EA 4PL9A 3A0WA 4GEEA 1ID0A 1PVGA 3GIEA 3PEJA 2YGAA 4HXWA 3JZ3A 4L91A 1YC3A 2WEQA 1BKNA 4LPBA 1NHHA 2ZBKB 3QTFA 2YEBA 1UYKA 4EFUA 3D2RA 1MU5A 3QDDA 4FCQA 3ZXOA 1UYCA 1UYDA 3LPSA 4DZYA 2XHTA 5J71A 2WI2A 2K5BA 4XC0A 5L3JA 2BU7A 1TBWA 3G75A 2YEFA 4YKQA 5CTXA 4E02A 1YC1A 1THNA 3FT8A 5FNCA 4MPNA 2XX4A 5CTYA 2XJGA 2ZDXA 4GQTA 1TIDA 3B25A 2C2AA 4HZ0A 3GIFA 2ESAA 2H55A 4CWRA 4I3HA 1YT1A 1AM1A 5D7CA 4URNA 1ZWHA 1TC0A 3TZ5A 1KIJA 1MX0A 3K60A 2IWXA 2XABA 4XKAA 2XDSA 1I5CA 4YKXA 1US7A 2JKIA 4EFTA 3R91A 2IOQA 4EEHA 2BU8A 1BYQA 3RLRA 5CF0A 3CRKA 1I5BA 1YERA 2XD6A 3EKRA 3IEDA 1YSZA 4UROA 3HHUA 3U2DA 2QF6A 4AWQA 4K4OA 2WI5A 3ZKDA 2GFDA 3B24A 2CCTA 5GGZA 4ZKIA 5IDMA 3ZKBA 2YE4A 3INXA 2YKIA 4P8OA 2YKBA 3C11A 4QPJA 2BSMA 5M4KA 2CG9A 2FWZA 2YE2A 3K97A 1Z5BA 4V26A 2YKEA 1NHJA 4GFNA 4L94A 2IWSA 2Q8GA 3TTZA 3OWDA 2Q8IA 3BM9A 5CTWA 4XIQA 3T2SA 1UYIA 3D0BA 1H7UA 2IWUA 4EM7A 4XCJA 4QPKA 4URMA 1B62A 3EKOA 4W7TA 4YKWA 4U93A 2XX5A 4YKUA 4JASA 1Y4SA 3B26A 3G7BA 4X9LA 1YT0A 3C0EA 1A4HA 3CGZA 5M4PA 2HCHA 3CWVA 2HKJA 3RLQA 4CWOA 3MNRP 3T10A 4B6CA 2YE5A 4Q20A 4HYMA 4MPEA 4LWHA 2VCJA 1TC6A 2VCIA 1YT2A 4CE2A 4V25A 5F5RA 2XCMA 4YKYA 4BQJA 3EHGA 4ASFA 2IORA 2QG0A 3T0ZA 4O09A 4CWNA 2BU2A 2XDLA 3T0HA 4FCPA 4LWIA 5M4HA 4XE2A 4FMTA 1YS3A 3LNUA 4JAUA 4L90A 5M4MA 3Q5KA 1Z59A 4E01A 2BU5A 2O1UA 3WQ9A 4NH9A 3A0TA 4WUCA 5D7RA 4E00A 1Y4UA 3H80A 4MP2A 4XKKA 2UWDA 2GQPA 3OW6A 4U7OA 4GGLA 5F3KA 4YKRA 4XKOA 1AH8A 2FYPA 4EGIA 3Q5JA 3VHDA 4MB9A 4H85A 1OSFA 3OWBA 2BZ5A 2VWCA 1ZW9A 2JJCA 3KE6A 3VADA 1UYHA 2XHRA 4WUBA 3HZ5A 2XDXA 4L8ZA 1I59A 5M4NA 4HYPA 5BODA 2WI3A 3HYZA 1U0ZA 4XIRA 4BAEA 3RKZA 1Z5CA 3H4LA 1EI1A 2XJXA 4XITA 1UYGA 4LP0A 4XIPA 1H7SA 2FWYA 3HEKA 3U2KA 3U67A 2IOPA 2CCSA 4P7AA 1AJ6A 4O0BA 1ZXNA 4XD8A 2WI1A 3WHAA 2WERA 2YK2A 4HY6A 4L93A 2QFOA 1UYEA 2YEDA 4MBCA 3VHCA 1Y8OA 2YE7A 1EA6A 2XDKA 1Z5AA
chains in the Genus database with same CATH superfamily
3O2FA 2BYIA 3A0RA 2YEGA 3HYYA 3FT5A 2YK9A 2XDUA 4BIZA 1QZRA 4HY1A 4PU9A 1YSRA 3PEHA 4PRVA 4MPCA 1I5DA 5BOCA 4HZ5A 1AMWA 1UY8A 5IDJA 4HXZA 3NMQA 2YKCA 5D7DA 1B63A 5FNFA 2XK2A 2WI6A 4DUHA 1UY9A 3R4PA 4BQGA 1S14A 1TILA 3A0XA 4E72A 3EHFA 3SL2A 3GIGA 4R1FA 3BMYA 1GKXA 2XJJA 2WI4A 4CWTA 4JAVA 3GIGB 3R4MA 2ZDYA 2H8MA 4EMVA 1JM6A 2YGFA 2QG2A 1I5AA 2Q8FA 4EGKA 4CWQA 3TUHA 3TZ4A 1L0OA 4LWEA 2O1WA 2BREA 2BTZA 2YKJA 2AKPA 1KZNA 2BRCA 3R4NA 3K98A 4KFGA 2WEPA 3B27A 4U7NA 2YI0A 2YE6A 1YETA 2WI7A 4B7PA 2YE9A 1TH8A 4AWPA 1U2OA 1UYLA 1S16A 5CTUA 4O07A 1QY8A 4XTJA 4ZVIA 4EGHA 2YJXA 3ZM7A 4AS9A 3RLPA 3TZ2A 2FXSA 3O6OA 1Y8NA 2BU6A 3B28A 3INWA 4KQVA 4ASAA 1UY7A 4CWSA 5J6AA 4NH8A 1AH6A 4R3AA 2YEIA 4PRXA 4KTNA 1B3QA 4CE1A 1GKZA 2O1VA 4KSHA 4ASBA 4XDMA 4KSGA 4FCRA 4O04A 3O0IA 1Y8PA 3FV5A 2XX2A 5CPHA 4BIUA 5FWKA 1BGQA 1YESA 3HZ1A 3CRLA 3G7EA 2YEHA 3DGEA 4NH7A 2Q2EB 1I58A 4XCLA 2VW5A 4YKTA 3EHJA 4H7QA 4MP7A 3OMUA 2ZKJA 2YGEA 2BT0A 4GCZA 3D36A 4CWPA 2YECA 4LWFA 3A0ZA 1GJVA 2Q8HA 1UYMA 4CE3A 2YI5A 4O05A 3Q5LA 1QYEA 1ZXMA 4I5SA 4AWOA 2HG1A 2C1IA 4FPPA 2EXLA 3T1KA 5FNDA 2YEJA 4KP4A 4MOTA 2PNRA 4GT8A 5D6QA 2YE3A 4WUDA 4JQLA 4YKZA 2CGFA 3VHAA 3OPDA 3TZ0A 5IN9A 2YEEA 2YJWA 1NHIA 3ZXQA 2E0AA 2CCUA 1R62A 4R3MA 3CGYA 4H81A 3A0YA 2XHXA 1UY6A 2BYHA 1YC4A 2YE8A 4LWGA 4ASGA 4URLA 2YEAA 1BXDA 5C93A 4CWFA 3EHHA 5D6PA 3R92A 4BXIA 3K99A 2YI7A 3R4OA 2CH4A 1UYFA 2YI6A 5M4EA 4PL9A 3A0WA 4GEEA 1ID0A 1PVGA 3GIEA 3PEJA 2YGAA 4HXWA 3JZ3A 4L91A 1YC3A 2WEQA 1BKNA 4LPBA 1NHHA 2ZBKB 3QTFA 2YEBA 1UYKA 4EFUA 3D2RA 1MU5A 3QDDA 4FCQA 3ZXOA 1UYCA 1UYDA 3LPSA 4DZYA 2XHTA 5J71A 2WI2A 2K5BA 4XC0A 5L3JA 2BU7A 1TBWA 3G75A 2YEFA 4YKQA 5CTXA 4E02A 1YC1A 1THNA 3FT8A 5FNCA 4MPNA 2XX4A 5CTYA 2XJGA 2ZDXA 4GQTA 1TIDA 3B25A 2C2AA 4HZ0A 3GIFA 2ESAA 2H55A 4CWRA 4I3HA 1YT1A 1AM1A 5D7CA 4URNA 1ZWHA 1TC0A 3TZ5A 1KIJA 1MX0A 3K60A 3LMMA 2IWXA 2XABA 4XKAA 2XDSA 1I5CA 4YKXA 1US7A 2JKIA 4EFTA 3R91A 2IOQA 4EEHA 2BU8A 1BYQA 3RLRA 5CF0A 3CRKA 1I5BA 1YERA 2XD6A 3EKRA 3IEDA 1YSZA 4UROA 3HHUA 3U2DA 2QF6A 4AWQA 4K4OA 2WI5A 3ZKDA 2GFDA 3B24A 2CCTA 2FTKA 5GGZA 4ZKIA 5IDMA 3ZKBA 2YE4A 3INXA 2YKIA 4P8OA 5JENA 2YKBA 3C11A 4QPJA 2BSMA 5M4KA 2CG9A 2FWZA 2YE2A 3K97A 1Z5BA 4V26A 2YKEA 1NHJA 4GFNA 4L94A 2IWSA 2Q8GA 3TTZA 3OWDA 2Q8IA 3BM9A 5CTWA 4XIQA 3T2SA 1UYIA 3D0BA 1H7UA 2IWUA 4EM7A 4XCJA 4QPKA 4URMA 1IXMA 1B62A 3EKOA 4W7TA 4YKWA 4U93A 2XX5A 4YKUA 4JASA 1Y4SA 3B26A 3CYGA 3G7BA 4X9LA 1YT0A 3C0EA 1A4HA 3CGZA 5M4PA 1F51A 2HCHA 3CWVA 2HKJA 3RLQA 4CWOA 3MNRP 3T10A 4B6CA 2YE5A 4Q20A 4HYMA 4MPEA 4LWHA 2VCJA 2C1GA 1TC6A 2VCIA 1YT2A 4CE2A 4V25A 5F5RA 2XCMA 4YKYA 4BQJA 3EHGA 4ASFA 2IORA 2QG0A 2HHIA 3T0ZA 4O09A 4CWNA 2BU2A 2XDLA 3T0HA 4FCPA 4LWIA 5M4HA 4XE2A 4FMTA 1YS3A 3LNUA 4JAUA 4L90A 5M4MA 3Q5KA 1Z59A 4E01A 2BU5A 2O1UA 3WQ9A 4NH9A 3A0TA 4WUCA 5D7RA 4E00A 1Y4UA 3H80A 4MP2A 4XKKA 2UWDA 2GQPA 3OW6A 4U7OA 4GGLA 5F3KA 4YKRA 4XKOA 1AH8A 2FYPA 4EGIA 3Q5JA 3VHDA 4MB9A 4H85A 1OSFA 3OWBA 2BZ5A 2VWCA 1ZW9A 2JJCA 3KE6A 3VADA 1UYHA 2XHRA 4WUBA 3HZ5A 2XDXA 4L8ZA 1I59A 5M4NA 4HYPA 5BODA 2WI3A 3HYZA 1U0ZA 4XIRA 4BAEA 3RKZA 1Z5CA 3H4LA 1EI1A 2XJXA 4XITA 1UYGA 4LP0A 4XIPA 1H7SA 2FWYA 3HEKA 3U2KA 3U67A 2IOPA 2CCSA 4P7AA 1AJ6A 4O0BA 1ZXNA 4XD8A 2WI1A 3WHAA 2WERA 2YK2A 4HY6A 4L93A 3S5TA 2QFOA 1UYEA 2YEDA 4MBCA 3VHCA 1Y8OA 2YE7A 1EA6A 2XDKA 1Z5AA
chains in the Genus database with same CATH topology
3O2FA 2BYIA 3A0RA 2YEGA 3HYYA 3FT5A 2YK9A 2XDUA 4BIZA 1QZRA 4HY1A 4PU9A 1YSRA 3PEHA 4PRVA 4MPCA 1I5DA 5BOCA 4HZ5A 1AMWA 1UY8A 5IDJA 4HXZA 3NMQA 2YKCA 5D7DA 1B63A 5FNFA 2XK2A 2WI6A 4DUHA 1UY9A 3R4PA 4BQGA 1S14A 1TILA 3A0XA 3EHFA 3SL2A 3GIGA 4R1FA 3BMYA 1GKXA 2XJJA 2WI4A 4CWTA 4JAVA 3GIGB 3R4MA 2ZDYA 2H8MA 4EMVA 1JM6A 2YGFA 2QG2A 1I5AA 2Q8FA 4EGKA 4CWQA 3TUHA 3TZ4A 1L0OA 4LWEA 2O1WA 2BREA 2BTZA 2YKJA 2AKPA 1KZNA 2BRCA 3R4NA 3K98A 4KFGA 2WEPA 3B27A 4U7NA 2YI0A 2YE6A 1YETA 2WI7A 4B7PA 2YE9A 1TH8A 4AWPA 1U2OA 1UYLA 1S16A 5CTUA 4O07A 1QY8A 4XTJA 4ZVIA 4EGHA 2YJXA 3ZM7A 4AS9A 3RLPA 3TZ2A 2FXSA 3O6OA 1Y8NA 2BU6A 3B28A 3INWA 4KQVA 4ASAA 1UY7A 4CWSA 5J6AA 4NH8A 1AH6A 4R3AA 2YEIA 4PRXA 4KTNA 1B3QA 4CE1A 1GKZA 2O1VA 4KSHA 4ASBA 4XDMA 4KSGA 4FCRA 4O04A 3O0IA 1Y8PA 3FV5A 2XX2A 5CPHA 4BIUA 5FWKA 1BGQA 1YESA 3HZ1A 3CRLA 3G7EA 2YEHA 3DGEA 4NH7A 2Q2EB 1I58A 4XCLA 2VW5A 4YKTA 3EHJA 4H7QA 4MP7A 3OMUA 2ZKJA 2YGEA 2BT0A 4GCZA 3D36A 4CWPA 2YECA 4LWFA 3A0ZA 1GJVA 2Q8HA 1UYMA 4CE3A 2YI5A 4O05A 3Q5LA 1QYEA 1ZXMA 4I5SA 4AWOA 2HG1A 4FPPA 3T1KA 2EXLA 5FNDA 2YEJA 4KP4A 4MOTA 2PNRA 4GT8A 5D6QA 2YE3A 4WUDA 4JQLA 4YKZA 2CGFA 3VHAA 3OPDA 3TZ0A 5IN9A 2YEEA 2YJWA 1NHIA 3ZXQA 2E0AA 2CCUA 1R62A 4R3MA 3CGYA 4H81A 3A0YA 2XHXA 1UY6A 2BYHA 1YC4A 2YE8A 4LWGA 4ASGA 4URLA 2YEAA 1BXDA 5C93A 4CWFA 3EHHA 5D6PA 3R92A 4BXIA 3K99A 2YI7A 3R4OA 2CH4A 1UYFA 2YI6A 5M4EA 4PL9A 3A0WA 4GEEA 1ID0A 1PVGA 3GIEA 3PEJA 2YGAA 4HXWA 3JZ3A 4L91A 1YC3A 2WEQA 1BKNA 4LPBA 1NHHA 2ZBKB 3QTFA 2YEBA 1UYKA 4EFUA 3D2RA 1MU5A 3QDDA 4FCQA 3ZXOA 1UYCA 1UYDA 3LPSA 4DZYA 2XHTA 5J71A 2WI2A 2K5BA 4XC0A 5L3JA 2BU7A 1TBWA 3G75A 2YEFA 4YKQA 5CTXA 4E02A 1YC1A 1THNA 3FT8A 5FNCA 4MPNA 2XX4A 5CTYA 2XJGA 2ZDXA 4GQTA 1TIDA 3B25A 2C2AA 4HZ0A 3GIFA 2ESAA 2H55A 4CWRA 4I3HA 1YT1A 1AM1A 5D7CA 4URNA 1ZWHA 1TC0A 3TZ5A 1KIJA 1MX0A 3K60A 2IWXA 2XABA 4XKAA 2XDSA 1I5CA 4YKXA 1US7A 2JKIA 4EFTA 3R91A 2IOQA 4EEHA 2BU8A 1BYQA 3RLRA 5CF0A 3CRKA 1I5BA 1YERA 2XD6A 3EKRA 3IEDA 1YSZA 4UROA 3HHUA 3U2DA 2QF6A 4AWQA 4K4OA 2WI5A 3ZKDA 2GFDA 3B24A 2CCTA 5GGZA 4ZKIA 5IDMA 3ZKBA 2YE4A 3INXA 2YKIA 4P8OA 2YKBA 3C11A 4QPJA 2BSMA 5M4KA 2CG9A 2FWZA 2YE2A 3K97A 1Z5BA 4V26A 2YKEA 1NHJA 4GFNA 4L94A 2IWSA 2Q8GA 3TTZA 3OWDA 2Q8IA 3BM9A 5CTWA 4XIQA 3T2SA 1UYIA 3D0BA 1H7UA 2IWUA 4EM7A 4XCJA 4QPKA 4URMA 1B62A 3EKOA 4W7TA 4YKWA 4U93A 2XX5A 4YKUA 4JASA 1Y4SA 3B26A 3G7BA 4X9LA 1YT0A 3C0EA 1A4HA 3CGZA 5M4PA 2HCHA 3CWVA 2HKJA 3RLQA 4CWOA 3MNRP 3T10A 4B6CA 2YE5A 4Q20A 4HYMA 4MPEA 4LWHA 2VCJA 1TC6A 2VCIA 1YT2A 4CE2A 4V25A 5F5RA 2XCMA 4YKYA 4BQJA 3EHGA 4ASFA 2IORA 2QG0A 3T0ZA 4O09A 4CWNA 2BU2A 2XDLA 3T0HA 4FCPA 4LWIA 5M4HA 4XE2A 4FMTA 1YS3A 3LNUA 4JAUA 4L90A 5M4MA 3Q5KA 1Z59A 4E01A 2BU5A 2O1UA 3WQ9A 4NH9A 3A0TA 4WUCA 5D7RA 4E00A 1Y4UA 3H80A 4MP2A 4XKKA 2UWDA 2GQPA 3OW6A 4U7OA 4GGLA 5F3KA 4YKRA 4XKOA 1AH8A 2FYPA 4EGIA 3Q5JA 3VHDA 4MB9A 4H85A 1OSFA 3OWBA 2BZ5A 2VWCA 1ZW9A 2JJCA 3KE6A 3VADA 1UYHA 2XHRA 4WUBA 3HZ5A 2XDXA 4L8ZA 1I59A 5M4NA 4HYPA 5BODA 2WI3A 3HYZA 1U0ZA 4XIRA 4BAEA 3RKZA 1Z5CA 3H4LA 1EI1A 2XJXA 4XITA 1UYGA 4LP0A 4XIPA 1H7SA 2FWYA 3HEKA 3U2KA 3U67A 2IOPA 2CCSA 4P7AA 1AJ6A 4O0BA 1ZXNA 4XD8A 2WI1A 3WHAA 2WERA 2YK2A 4HY6A 4L93A 2QFOA 1UYEA 2YEDA 4MBCA 3VHCA 1Y8OA 2YE7A 1EA6A 2XDKA 1Z5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O2F A;  2BYI A;  3A0R A;  2YEG A;  3HYY A;  3FT5 A;  2YK9 A;  2XDU A;  4BIZ A;  1QZR A;  4HY1 A;  4PU9 A;  1YSR A;  3PEH A;  4PRV A;  4MPC A;  1I5D A;  5BOC A;  4HZ5 A;  1AMW A;  1UY8 A;  5IDJ A;  4HXZ A;  3NMQ A;  2YKC A;  5D7D A;  1B63 A;  5FNF A;  2XK2 A;  2WI6 A;  4DUH A;  1UY9 A;  3R4P A;  4BQG A;  1S14 A;  1TIL A;  3A0X A;  3EHF A;  3SL2 A;  3GIG A;  4R1F A;  3BMY A;  1GKX A;  2XJJ A;  2WI4 A;  4CWT A;  4JAV A;  3GIG B;  3R4M A;  2ZDY A;  2H8M A;  4EMV A;  1JM6 A;  2YGF A;  2QG2 A;  1I5A A;  2Q8F A;  4EGK A;  4CWQ A;  3TUH A;  3TZ4 A;  1L0O A;  4LWE A;  2O1W A;  2BRE A;  2BTZ A;  2YKJ A;  2AKP A;  1KZN A;  2BRC A;  3R4N A;  3K98 A;  4KFG A;  2WEP A;  3B27 A;  4U7N A;  2YI0 A;  2YE6 A;  1YET A;  2WI7 A;  4B7P A;  2YE9 A;  1TH8 A;  4AWP A;  1U2O A;  1UYL A;  1S16 A;  5CTU A;  4O07 A;  1QY8 A;  4XTJ A;  4ZVI A;  4EGH A;  2YJX A;  3ZM7 A;  4AS9 A;  3RLP A;  3TZ2 A;  2FXS A;  3O6O A;  1Y8N A;  2BU6 A;  3B28 A;  3INW A;  4KQV A;  4ASA A;  1UY7 A;  4CWS A;  5J6A A;  4NH8 A;  1AH6 A;  4R3A A;  2YEI A;  4PRX A;  4KTN A;  1B3Q A;  4CE1 A;  1GKZ A;  2O1V A;  4KSH A;  4ASB A;  4XDM A;  4KSG A;  4FCR A;  4O04 A;  3O0I A;  1Y8P A;  3FV5 A;  2XX2 A;  5CPH A;  4BIU A;  5FWK A;  1BGQ A;  1YES A;  3HZ1 A;  3CRL A;  3G7E A;  2YEH A;  3DGE A;  4NH7 A;  2Q2E B;  1I58 A;  4XCL A;  2VW5 A;  4YKT A;  3EHJ A;  4H7Q A;  4MP7 A;  3OMU A;  2ZKJ A;  2YGE A;  2BT0 A;  4GCZ A;  3D36 A;  4CWP A;  2YEC A;  4LWF A;  3A0Z A;  1GJV A;  2Q8H A;  1UYM A;  4CE3 A;  2YI5 A;  4O05 A;  3Q5L A;  1QYE A;  1ZXM A;  4I5S A;  4AWO A;  2HG1 A;  4FPP A;  3T1K A;  2EXL A;  5FND A;  2YEJ A;  4KP4 A;  4MOT A;  2PNR A;  4GT8 A;  5D6Q A;  2YE3 A;  4WUD A;  4JQL A;  4YKZ A;  2CGF A;  3VHA A;  3OPD A;  3TZ0 A;  5IN9 A;  2YEE A;  2YJW A;  1NHI A;  3ZXQ A;  2E0A A;  2CCU A;  1R62 A;  4R3M A;  3CGY A;  4H81 A;  3A0Y A;  2XHX A;  1UY6 A;  2BYH A;  1YC4 A;  2YE8 A;  4LWG A;  4ASG A;  4URL A;  2YEA A;  1BXD A;  5C93 A;  4CWF A;  3EHH A;  5D6P A;  3R92 A;  4BXI A;  3K99 A;  2YI7 A;  3R4O A;  2CH4 A;  1UYF A;  2YI6 A;  5M4E A;  4PL9 A;  3A0W A;  4GEE A;  1ID0 A;  1PVG A;  3GIE A;  3PEJ A;  2YGA A;  4HXW A;  3JZ3 A;  4L91 A;  1YC3 A;  2WEQ A;  1BKN A;  4LPB A;  1NHH A;  2ZBK B;  3QTF A;  2YEB A;  1UYK A;  4EFU A;  3D2R A;  1MU5 A;  3QDD A;  4FCQ A;  3ZXO A;  1UYC A;  1UYD A;  3LPS A;  4DZY A;  2XHT A;  5J71 A;  2WI2 A;  2K5B A;  4XC0 A;  5L3J A;  2BU7 A;  1TBW A;  3G75 A;  2YEF A;  4YKQ A;  5CTX A;  4E02 A;  1YC1 A;  1THN A;  3FT8 A;  5FNC A;  4MPN A;  2XX4 A;  5CTY A;  2XJG A;  2ZDX A;  4GQT A;  1TID A;  3B25 A;  2C2A A;  4HZ0 A;  3GIF A;  2ESA A;  2H55 A;  4CWR A;  4I3H A;  1YT1 A;  1AM1 A;  5D7C A;  4URN A;  1ZWH A;  1TC0 A;  3TZ5 A;  1KIJ A;  1MX0 A;  3K60 A;  2IWX A;  2XAB A;  4XKA A;  2XDS A;  1I5C A;  4YKX A;  1US7 A;  2JKI A;  4EFT A;  3R91 A;  2IOQ A;  4EEH A;  2BU8 A;  1BYQ A;  3RLR A;  5CF0 A;  3CRK A;  1I5B A;  1YER A;  2XD6 A;  3EKR A;  3IED A;  1YSZ A;  4URO A;  3HHU A;  3U2D A;  2QF6 A;  4AWQ A;  4K4O A;  2WI5 A;  3ZKD A;  2GFD A;  3B24 A;  2CCT A;  5GGZ A;  4ZKI A;  5IDM A;  3ZKB A;  2YE4 A;  3INX A;  2YKI A;  4P8O A;  2YKB A;  3C11 A;  4QPJ A;  2BSM A;  5M4K A;  2CG9 A;  2FWZ A;  2YE2 A;  3K97 A;  1Z5B A;  4V26 A;  2YKE A;  1NHJ A;  4GFN A;  4L94 A;  2IWS A;  2Q8G A;  3TTZ A;  3OWD A;  2Q8I A;  3BM9 A;  5CTW A;  4XIQ A;  3T2S A;  1UYI A;  3D0B A;  1H7U A;  2IWU A;  4EM7 A;  4XCJ A;  4QPK A;  4URM A;  1B62 A;  3EKO A;  4W7T A;  4YKW A;  4U93 A;  2XX5 A;  4YKU A;  4JAS A;  1Y4S A;  3B26 A;  3G7B A;  4X9L A;  1YT0 A;  3C0E A;  1A4H A;  3CGZ A;  5M4P A;  2HCH A;  3CWV A;  2HKJ A;  3RLQ A;  4CWO A;  3MNR P;  3T10 A;  4B6C A;  2YE5 A;  4Q20 A;  4HYM A;  4MPE A;  4LWH A;  2VCJ A;  1TC6 A;  2VCI A;  1YT2 A;  4CE2 A;  4V25 A;  5F5R A;  2XCM A;  4YKY A;  4BQJ A;  3EHG A;  4ASF A;  2IOR A;  2QG0 A;  3T0Z A;  4O09 A;  4CWN A;  2BU2 A;  2XDL A;  3T0H A;  4FCP A;  4LWI A;  5M4H A;  4XE2 A;  4FMT A;  1YS3 A;  3LNU A;  4JAU A;  4L90 A;  5M4M A;  3Q5K A;  1Z59 A;  4E01 A;  2BU5 A;  2O1U A;  3WQ9 A;  4NH9 A;  3A0T A;  4WUC A;  5D7R A;  4E00 A;  1Y4U A;  3H80 A;  4MP2 A;  4XKK A;  2UWD A;  2GQP A;  3OW6 A;  4U7O A;  4GGL A;  5F3K A;  4YKR A;  4XKO A;  1AH8 A;  2FYP A;  4EGI A;  3Q5J A;  3VHD A;  4MB9 A;  4H85 A;  1OSF A;  3OWB A;  2BZ5 A;  2VWC A;  1ZW9 A;  2JJC A;  3KE6 A;  3VAD A;  1UYH A;  2XHR A;  4WUB A;  3HZ5 A;  2XDX A;  4L8Z A;  1I59 A;  5M4N A;  4HYP A;  5BOD A;  2WI3 A;  3HYZ A;  1U0Z A;  4XIR A;  4BAE A;  3RKZ A;  1Z5C A;  3H4L A;  1EI1 A;  2XJX A;  4XIT A;  1UYG A;  4LP0 A;  4XIP A;  1H7S A;  2FWY A;  3HEK A;  3U2K A;  3U67 A;  2IOP A;  2CCS A;  4P7A A;  1AJ6 A;  4O0B A;  1ZXN A;  4XD8 A;  2WI1 A;  3WHA A;  2WER A;  2YK2 A;  4HY6 A;  4L93 A;  2QFO A;  1UYE A;  2YED A;  4MBC A;  3VHC A;  1Y8O A;  2YE7 A;  1EA6 A;  2XDK A;  1Z5A A; 
#chains in the Genus database with same CATH topology
 3O2F A;  2BYI A;  3A0R A;  2YEG A;  3HYY A;  3FT5 A;  2YK9 A;  2XDU A;  4BIZ A;  1QZR A;  4HY1 A;  4PU9 A;  1YSR A;  3PEH A;  4PRV A;  4MPC A;  1I5D A;  5BOC A;  4HZ5 A;  1AMW A;  1UY8 A;  5IDJ A;  4HXZ A;  3NMQ A;  2YKC A;  5D7D A;  1B63 A;  5FNF A;  2XK2 A;  2WI6 A;  4DUH A;  1UY9 A;  3R4P A;  4BQG A;  1S14 A;  1TIL A;  3A0X A;  4E72 A;  3EHF A;  3SL2 A;  3GIG A;  4R1F A;  3BMY A;  1GKX A;  2XJJ A;  2WI4 A;  4CWT A;  4JAV A;  3GIG B;  3R4M A;  2ZDY A;  2H8M A;  4EMV A;  1JM6 A;  2YGF A;  2QG2 A;  1I5A A;  2Q8F A;  4EGK A;  4CWQ A;  3TUH A;  3TZ4 A;  1L0O A;  4LWE A;  2O1W A;  2BRE A;  2BTZ A;  2YKJ A;  2AKP A;  1KZN A;  2BRC A;  3R4N A;  3K98 A;  4KFG A;  2WEP A;  3B27 A;  4U7N A;  2YI0 A;  2YE6 A;  1YET A;  2WI7 A;  4B7P A;  2YE9 A;  1TH8 A;  4AWP A;  1U2O A;  1UYL A;  1S16 A;  5CTU A;  4O07 A;  1QY8 A;  4XTJ A;  4ZVI A;  4EGH A;  2YJX A;  3ZM7 A;  4AS9 A;  3RLP A;  3TZ2 A;  2FXS A;  3O6O A;  1Y8N A;  2BU6 A;  3B28 A;  3INW A;  4KQV A;  4ASA A;  1UY7 A;  4CWS A;  5J6A A;  4NH8 A;  1AH6 A;  4R3A A;  2YEI A;  4PRX A;  4KTN A;  1B3Q A;  4CE1 A;  1GKZ A;  2O1V A;  4KSH A;  4ASB A;  4XDM A;  4KSG A;  4FCR A;  4O04 A;  3O0I A;  1Y8P A;  3FV5 A;  2XX2 A;  5CPH A;  4BIU A;  5FWK A;  1BGQ A;  1YES A;  3HZ1 A;  3CRL A;  3G7E A;  2YEH A;  3DGE A;  4NH7 A;  2Q2E B;  1I58 A;  4XCL A;  2VW5 A;  4YKT A;  3EHJ A;  4H7Q A;  4MP7 A;  3OMU A;  2ZKJ A;  2YGE A;  2BT0 A;  4GCZ A;  3D36 A;  4CWP A;  2YEC A;  4LWF A;  3A0Z A;  1GJV A;  2Q8H A;  1UYM A;  4CE3 A;  2YI5 A;  4O05 A;  3Q5L A;  1QYE A;  1ZXM A;  4I5S A;  4AWO A;  2HG1 A;  2C1I A;  4FPP A;  2EXL A;  3T1K A;  5FND A;  2YEJ A;  4KP4 A;  4MOT A;  2PNR A;  4GT8 A;  5D6Q A;  2YE3 A;  4WUD A;  4JQL A;  4YKZ A;  2CGF A;  3VHA A;  3OPD A;  3TZ0 A;  5IN9 A;  2YEE A;  2YJW A;  1NHI A;  3ZXQ A;  2E0A A;  2CCU A;  1R62 A;  4R3M A;  3CGY A;  4H81 A;  3A0Y A;  2XHX A;  1UY6 A;  2BYH A;  1YC4 A;  2YE8 A;  4LWG A;  4ASG A;  4URL A;  2YEA A;  1BXD A;  5C93 A;  4CWF A;  3EHH A;  5D6P A;  3R92 A;  4BXI A;  3K99 A;  2YI7 A;  3R4O A;  2CH4 A;  1UYF A;  2YI6 A;  5M4E A;  4PL9 A;  3A0W A;  4GEE A;  1ID0 A;  1PVG A;  3GIE A;  3PEJ A;  2YGA A;  4HXW A;  3JZ3 A;  4L91 A;  1YC3 A;  2WEQ A;  1BKN A;  4LPB A;  1NHH A;  2ZBK B;  3QTF A;  2YEB A;  1UYK A;  4EFU A;  3D2R A;  1MU5 A;  3QDD A;  4FCQ A;  3ZXO A;  1UYC A;  1UYD A;  3LPS A;  4DZY A;  2XHT A;  5J71 A;  2WI2 A;  2K5B A;  4XC0 A;  5L3J A;  2BU7 A;  1TBW A;  3G75 A;  2YEF A;  4YKQ A;  5CTX A;  4E02 A;  1YC1 A;  1THN A;  3FT8 A;  5FNC A;  4MPN A;  2XX4 A;  5CTY A;  2XJG A;  2ZDX A;  4GQT A;  1TID A;  3B25 A;  2C2A A;  4HZ0 A;  3GIF A;  2ESA A;  2H55 A;  4CWR A;  4I3H A;  1YT1 A;  1AM1 A;  5D7C A;  4URN A;  1ZWH A;  1TC0 A;  3TZ5 A;  1KIJ A;  1MX0 A;  3K60 A;  3LMM A;  2IWX A;  2XAB A;  4XKA A;  2XDS A;  1I5C A;  4YKX A;  1US7 A;  2JKI A;  4EFT A;  3R91 A;  2IOQ A;  4EEH A;  2BU8 A;  1BYQ A;  3RLR A;  5CF0 A;  3CRK A;  1I5B A;  1YER A;  2XD6 A;  3EKR A;  3IED A;  1YSZ A;  4URO A;  3HHU A;  3U2D A;  2QF6 A;  4AWQ A;  4K4O A;  2WI5 A;  3ZKD A;  2GFD A;  3B24 A;  2CCT A;  2FTK A;  5GGZ A;  4ZKI A;  5IDM A;  3ZKB A;  2YE4 A;  3INX A;  2YKI A;  4P8O A;  5JEN A;  2YKB A;  3C11 A;  4QPJ A;  2BSM A;  5M4K A;  2CG9 A;  2FWZ A;  2YE2 A;  3K97 A;  1Z5B A;  4V26 A;  2YKE A;  1NHJ A;  4GFN A;  4L94 A;  2IWS A;  2Q8G A;  3TTZ A;  3OWD A;  2Q8I A;  3BM9 A;  5CTW A;  4XIQ A;  3T2S A;  1UYI A;  3D0B A;  1H7U A;  2IWU A;  4EM7 A;  4XCJ A;  4QPK A;  4URM A;  1IXM A;  1B62 A;  3EKO A;  4W7T A;  4YKW A;  4U93 A;  2XX5 A;  4YKU A;  4JAS A;  1Y4S A;  3B26 A;  3CYG A;  3G7B A;  4X9L A;  1YT0 A;  3C0E A;  1A4H A;  3CGZ A;  5M4P A;  1F51 A;  2HCH A;  3CWV A;  2HKJ A;  3RLQ A;  4CWO A;  3MNR P;  3T10 A;  4B6C A;  2YE5 A;  4Q20 A;  4HYM A;  4MPE A;  4LWH A;  2VCJ A;  2C1G A;  1TC6 A;  2VCI A;  1YT2 A;  4CE2 A;  4V25 A;  5F5R A;  2XCM A;  4YKY A;  4BQJ A;  3EHG A;  4ASF A;  2IOR A;  2QG0 A;  2HHI A;  3T0Z A;  4O09 A;  4CWN A;  2BU2 A;  2XDL A;  3T0H A;  4FCP A;  4LWI A;  5M4H A;  4XE2 A;  4FMT A;  1YS3 A;  3LNU A;  4JAU A;  4L90 A;  5M4M A;  3Q5K A;  1Z59 A;  4E01 A;  2BU5 A;  2O1U A;  3WQ9 A;  4NH9 A;  3A0T A;  4WUC A;  5D7R A;  4E00 A;  1Y4U A;  3H80 A;  4MP2 A;  4XKK A;  2UWD A;  2GQP A;  3OW6 A;  4U7O A;  4GGL A;  5F3K A;  4YKR A;  4XKO A;  1AH8 A;  2FYP A;  4EGI A;  3Q5J A;  3VHD A;  4MB9 A;  4H85 A;  1OSF A;  3OWB A;  2BZ5 A;  2VWC A;  1ZW9 A;  2JJC A;  3KE6 A;  3VAD A;  1UYH A;  2XHR A;  4WUB A;  3HZ5 A;  2XDX A;  4L8Z A;  1I59 A;  5M4N A;  4HYP A;  5BOD A;  2WI3 A;  3HYZ A;  1U0Z A;  4XIR A;  4BAE A;  3RKZ A;  1Z5C A;  3H4L A;  1EI1 A;  2XJX A;  4XIT A;  1UYG A;  4LP0 A;  4XIP A;  1H7S A;  2FWY A;  3HEK A;  3U2K A;  3U67 A;  2IOP A;  2CCS A;  4P7A A;  1AJ6 A;  4O0B A;  1ZXN A;  4XD8 A;  2WI1 A;  3WHA A;  2WER A;  2YK2 A;  4HY6 A;  4L93 A;  3S5T A;  2QFO A;  1UYE A;  2YED A;  4MBC A;  3VHC A;  1Y8O A;  2YE7 A;  1EA6 A;  2XDK A;  1Z5A A; 
#chains in the Genus database with same CATH homology
 3O2F A;  2BYI A;  3A0R A;  2YEG A;  3HYY A;  3FT5 A;  2YK9 A;  2XDU A;  4BIZ A;  1QZR A;  4HY1 A;  4PU9 A;  1YSR A;  3PEH A;  4PRV A;  4MPC A;  1I5D A;  5BOC A;  4HZ5 A;  1AMW A;  1UY8 A;  5IDJ A;  4HXZ A;  3NMQ A;  2YKC A;  5D7D A;  1B63 A;  5FNF A;  2XK2 A;  2WI6 A;  4DUH A;  1UY9 A;  3R4P A;  4BQG A;  1S14 A;  1TIL A;  3A0X A;  3EHF A;  3SL2 A;  3GIG A;  4R1F A;  3BMY A;  1GKX A;  2XJJ A;  2WI4 A;  4CWT A;  4JAV A;  3GIG B;  3R4M A;  2ZDY A;  2H8M A;  4EMV A;  1JM6 A;  2YGF A;  2QG2 A;  1I5A A;  2Q8F A;  4EGK A;  4CWQ A;  3TUH A;  3TZ4 A;  1L0O A;  4LWE A;  2O1W A;  2BRE A;  2BTZ A;  2YKJ A;  2AKP A;  1KZN A;  2BRC A;  3R4N A;  3K98 A;  4KFG A;  2WEP A;  3B27 A;  4U7N A;  2YI0 A;  2YE6 A;  1YET A;  2WI7 A;  4B7P A;  2YE9 A;  1TH8 A;  4AWP A;  1U2O A;  1UYL A;  1S16 A;  5CTU A;  4O07 A;  1QY8 A;  4XTJ A;  4ZVI A;  4EGH A;  2YJX A;  3ZM7 A;  4AS9 A;  3RLP A;  3TZ2 A;  2FXS A;  3O6O A;  1Y8N A;  2BU6 A;  3B28 A;  3INW A;  4KQV A;  4ASA A;  1UY7 A;  4CWS A;  5J6A A;  4NH8 A;  1AH6 A;  4R3A A;  2YEI A;  4PRX A;  4KTN A;  1B3Q A;  4CE1 A;  1GKZ A;  2O1V A;  4KSH A;  4ASB A;  4XDM A;  4KSG A;  4FCR A;  4O04 A;  3O0I A;  1Y8P A;  3FV5 A;  2XX2 A;  5CPH A;  4BIU A;  5FWK A;  1BGQ A;  1YES A;  3HZ1 A;  3CRL A;  3G7E A;  2YEH A;  3DGE A;  4NH7 A;  2Q2E B;  1I58 A;  4XCL A;  2VW5 A;  4YKT A;  3EHJ A;  4H7Q A;  4MP7 A;  3OMU A;  2ZKJ A;  2YGE A;  2BT0 A;  4GCZ A;  3D36 A;  4CWP A;  2YEC A;  4LWF A;  3A0Z A;  1GJV A;  2Q8H A;  1UYM A;  4CE3 A;  2YI5 A;  4O05 A;  3Q5L A;  1QYE A;  1ZXM A;  4I5S A;  4AWO A;  2HG1 A;  4FPP A;  3T1K A;  2EXL A;  5FND A;  2YEJ A;  4KP4 A;  4MOT A;  2PNR A;  4GT8 A;  5D6Q A;  2YE3 A;  4WUD A;  4JQL A;  4YKZ A;  2CGF A;  3VHA A;  3OPD A;  3TZ0 A;  5IN9 A;  2YEE A;  2YJW A;  1NHI A;  3ZXQ A;  2E0A A;  2CCU A;  1R62 A;  4R3M A;  3CGY A;  4H81 A;  3A0Y A;  2XHX A;  1UY6 A;  2BYH A;  1YC4 A;  2YE8 A;  4LWG A;  4ASG A;  4URL A;  2YEA A;  1BXD A;  5C93 A;  4CWF A;  3EHH A;  5D6P A;  3R92 A;  4BXI A;  3K99 A;  2YI7 A;  3R4O A;  2CH4 A;  1UYF A;  2YI6 A;  5M4E A;  4PL9 A;  3A0W A;  4GEE A;  1ID0 A;  1PVG A;  3GIE A;  3PEJ A;  2YGA A;  4HXW A;  3JZ3 A;  4L91 A;  1YC3 A;  2WEQ A;  1BKN A;  4LPB A;  1NHH A;  2ZBK B;  3QTF A;  2YEB A;  1UYK A;  4EFU A;  3D2R A;  1MU5 A;  3QDD A;  4FCQ A;  3ZXO A;  1UYC A;  1UYD A;  3LPS A;  4DZY A;  2XHT A;  5J71 A;  2WI2 A;  2K5B A;  4XC0 A;  5L3J A;  2BU7 A;  1TBW A;  3G75 A;  2YEF A;  4YKQ A;  5CTX A;  4E02 A;  1YC1 A;  1THN A;  3FT8 A;  5FNC A;  4MPN A;  2XX4 A;  5CTY A;  2XJG A;  2ZDX A;  4GQT A;  1TID A;  3B25 A;  2C2A A;  4HZ0 A;  3GIF A;  2ESA A;  2H55 A;  4CWR A;  4I3H A;  1YT1 A;  1AM1 A;  5D7C A;  4URN A;  1ZWH A;  1TC0 A;  3TZ5 A;  1KIJ A;  1MX0 A;  3K60 A;  2IWX A;  2XAB A;  4XKA A;  2XDS A;  1I5C A;  4YKX A;  1US7 A;  2JKI A;  4EFT A;  3R91 A;  2IOQ A;  4EEH A;  2BU8 A;  1BYQ A;  3RLR A;  5CF0 A;  3CRK A;  1I5B A;  1YER A;  2XD6 A;  3EKR A;  3IED A;  1YSZ A;  4URO A;  3HHU A;  3U2D A;  2QF6 A;  4AWQ A;  4K4O A;  2WI5 A;  3ZKD A;  2GFD A;  3B24 A;  2CCT A;  5GGZ A;  4ZKI A;  5IDM A;  3ZKB A;  2YE4 A;  3INX A;  2YKI A;  4P8O A;  2YKB A;  3C11 A;  4QPJ A;  2BSM A;  5M4K A;  2CG9 A;  2FWZ A;  2YE2 A;  3K97 A;  1Z5B A;  4V26 A;  2YKE A;  1NHJ A;  4GFN A;  4L94 A;  2IWS A;  2Q8G A;  3TTZ A;  3OWD A;  2Q8I A;  3BM9 A;  5CTW A;  4XIQ A;  3T2S A;  1UYI A;  3D0B A;  1H7U A;  2IWU A;  4EM7 A;  4XCJ A;  4QPK A;  4URM A;  1B62 A;  3EKO A;  4W7T A;  4YKW A;  4U93 A;  2XX5 A;  4YKU A;  4JAS A;  1Y4S A;  3B26 A;  3G7B A;  4X9L A;  1YT0 A;  3C0E A;  1A4H A;  3CGZ A;  5M4P A;  2HCH A;  3CWV A;  2HKJ A;  3RLQ A;  4CWO A;  3MNR P;  3T10 A;  4B6C A;  2YE5 A;  4Q20 A;  4HYM A;  4MPE A;  4LWH A;  2VCJ A;  1TC6 A;  2VCI A;  1YT2 A;  4CE2 A;  4V25 A;  5F5R A;  2XCM A;  4YKY A;  4BQJ A;  3EHG A;  4ASF A;  2IOR A;  2QG0 A;  3T0Z A;  4O09 A;  4CWN A;  2BU2 A;  2XDL A;  3T0H A;  4FCP A;  4LWI A;  5M4H A;  4XE2 A;  4FMT A;  1YS3 A;  3LNU A;  4JAU A;  4L90 A;  5M4M A;  3Q5K A;  1Z59 A;  4E01 A;  2BU5 A;  2O1U A;  3WQ9 A;  4NH9 A;  3A0T A;  4WUC A;  5D7R A;  4E00 A;  1Y4U A;  3H80 A;  4MP2 A;  4XKK A;  2UWD A;  2GQP A;  3OW6 A;  4U7O A;  4GGL A;  5F3K A;  4YKR A;  4XKO A;  1AH8 A;  2FYP A;  4EGI A;  3Q5J A;  3VHD A;  4MB9 A;  4H85 A;  1OSF A;  3OWB A;  2BZ5 A;  2VWC A;  1ZW9 A;  2JJC A;  3KE6 A;  3VAD A;  1UYH A;  2XHR A;  4WUB A;  3HZ5 A;  2XDX A;  4L8Z A;  1I59 A;  5M4N A;  4HYP A;  5BOD A;  2WI3 A;  3HYZ A;  1U0Z A;  4XIR A;  4BAE A;  3RKZ A;  1Z5C A;  3H4L A;  1EI1 A;  2XJX A;  4XIT A;  1UYG A;  4LP0 A;  4XIP A;  1H7S A;  2FWY A;  3HEK A;  3U2K A;  3U67 A;  2IOP A;  2CCS A;  4P7A A;  1AJ6 A;  4O0B A;  1ZXN A;  4XD8 A;  2WI1 A;  3WHA A;  2WER A;  2YK2 A;  4HY6 A;  4L93 A;  2QFO A;  1UYE A;  2YED A;  4MBC A;  3VHC A;  1Y8O A;  2YE7 A;  1EA6 A;  2XDK A;  1Z5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...