3G7BA

Staphylococcus aureus gyrase b co-complex with methyl ({5-[4-(4-hydroxypiperidin-1-yl)-2-phenyl-1,3-thiazol-5-yl]-1h-pyrazol-3-yl}methyl)carbamate inhibitor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
184
structure length
184
Chain Sequence
GLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of pyrazolthiazoles as novel and potent inhibitors of bacterial gyrase.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase/isomerase inhibitor
molecule keywords DNA gyrase subunit B
total genus 54
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3g7bA00
2YKIA 3HYZA 2YI7A 3HYYA 4CE3A 1GKXA 4KP4A 4H81A 4YKYA 5FNFA 1I58A 5CTYA 3T1KA 2ZBKB 5CF0A 2YGFA 4CE2A 4YKWA 2YE5A 3H80A 4EM7A 2BSMA 2YEEA 2O1VA 3C0EA 2BYIA 4GCZA 4CWQA 4KQVA 2WEQA 5L3JA 5FWKA 5F3KA 4EEHA 1YS3A 1JM6A 2WI2A 2BREA 2H8MA 2CGFA 3A0TA 2CH4A 4MBCA 3DGEA 2QFOA 4DZYA 1TH8A 3OPDA 3VHDA 3GIGB 1OSFA 2UWDA 2XDUA 4ASAA 4ASGA 4PL9A 4XC0A 3K60A 1TIDA 4I5SA 2Q8HA 3INWA 2XDLA 3R91A 3Q5JA 2BT0A 2YI5A 3OWBA 3B24A 4YKXA 4WUBA 4HXZA 2WI5A 5IDJA 1UY9A 4B6CA 1UY6A 2BU6A 4DUHA 2YE4A 5M4KA 2FXSA 1YSRA 4URNA 2XX2A 2YEFA 2XHRA 4EGHA 1Z59A 4XIRA 3T0HA 4ZVIA 4MB9A 3GIFA 1YC1A 4LWEA 3A0RA 3ZXOA 2XCMA 4XKOA 1Y8NA 2BZ5A 2O1WA 1AM1A 3OW6A 5D6QA 4HYPA 4P8OA 4AWPA 2IWSA 5BOCA 2YEDA 3BMYA 4PU9A 2XDSA 2XJGA 2CCSA 1Z5BA 2YE6A 5M4HA 3GIGA 4XITA 1QZRA 1AMWA 1Y8PA 4O07A 4O04A 1Y4SA 5D6PA 2HKJA 1UYDA 3OMUA 3R4OA 1PVGA 5IDMA 1R62A 3VHAA 4WUCA 3U2DA 1TILA 2ZKJA 1S14A 2YKJA 4HZ0A 4BIUA 2YI6A 2YKEA 3INXA 1QYEA 4ZKIA 3O0IA 3EHGA 2XJXA 4E00A 2YE2A 3O6OA 4L8ZA 5D7DA 1TC0A 2HG1A 1YT2A 3OWDA 3IEDA 2YEIA 4BQGA 4H7QA 4MPEA 3ZKBA 1ZXNA 3VADA 2QG0A 4MOTA 5D7RA 2WERA 2YECA 5CTWA 3TTZA 2CG9A 2FWYA 3K99A 2YE3A 5F5RA 4E01A 3TZ5A 2QF6A 2JKIA 3CRLA 2CCUA 1U2OA 3MNRP 3QDDA 2WI6A 3D0BA 4L93A 2JJCA 4GQTA 4L90A 2AKPA 4Q20A 2XDXA 4JAVA 3EHFA 1KZNA 3BM9A 1UYMA 1Z5AA 1ID0A 4EGIA 5M4MA 3NMQA 1TBWA 1UY8A 2YK9A 4ASFA 4WUDA 3G7EA 4X9LA 3B25A 5CPHA 4EFTA 2YE7A 2IOPA 2FYPA 3R92A 4HZ5A 3O2FA 3A0XA 3FT8A 4KSGA 2XHXA 4YKTA 1Y8OA 2PNRA 4U7NA 4EGKA 1AH8A 2IOQA 2BTZA 3B28A 4O09A 4E02A 4PRXA 1ZW9A 4HXWA 2XX4A 1MX0A 4W7TA 1B3QA 1TC6A 4XIQA 3CGYA 4CWFA 1AJ6A 3KE6A 3CWVA 4R3MA 1H7SA 1KIJA 1NHHA 2BU7A 2BYHA 3D2RA 4YKQA 3A0ZA 4JQLA 4PRVA 3ZM7A 2YGAA 4FCPA 2YGEA 3R4MA 4V25A 4AS9A 1L0OA 2ZDXA 1I5BA 1YESA 2GQPA 4HYMA 4R3AA 4CWOA 3EKOA 1YETA 4GFNA 1UYHA 4GT8A 2EXLA 3FT5A 4HY6A 1QY8A 1I5CA 1UYEA 4V26A 1NHJA 2O1UA 4XD8A 1BYQA 1UY7A 5M4PA 3EKRA 1MU5A 2HCHA 3RLRA 3RLQA 4MPCA 2XD6A 5FNDA 4LPBA 4NH9A 3GIEA 2XABA 2WI1A 2ESAA 4BXIA 3PEHA 4XIPA 4CWPA 1I5DA 1BKNA 3K97A 4BAEA 1UYIA 3B27A 4GEEA 1ZXMA 1EA6A 3EHJA 1GJVA 2BU2A 4LWIA 3LNUA 2IWXA 3TZ0A 5IN9A 2WI3A 3D36A 4LP0A 1UYFA 4FPPA 4XE2A 2Q8FA 3ZXQA 3R4PA 1ZWHA 1B63A 5J71A 2YEBA 2WI7A 4BQJA 2XJJA 1GKZA 2K5BA 4AWOA 2Q8IA 1UYKA 2BU8A 5CTUA 1Z5CA 4URLA 2XHTA 3CRKA 3Q5KA 4NH8A 2YKCA 4K4OA 3K98A 5M4EA 4FMTA 2BU5A 4KFGA 2GFDA 4BIZA 1UYLA 4L91A 4URMA 1Y4UA 4LWHA 4KSHA 3TZ4A 3U67A 3HZ1A 4XCLA 3WHAA 4AWQA 3H4LA 1A4HA 4O05A 4CWTA 4KTNA 3T10A 5BODA 1YERA 4L94A 2Q2EB 5M4NA 2YEHA 2IWUA 4XTJA 3SL2A 2ZDYA 1U0ZA 3TZ2A 2VCIA 2YJWA 4QPJA 1US7A 1YT0A 3T2SA 2WEPA 4CWRA 2XK2A 2VCJA 1B62A 1I5AA 5D7CA 2YKBA 4XKAA 3LPSA 4MP2A 3VHCA 3G7BA 3A0YA 2VW5A 3RLPA 4GGLA 4XDMA 2YI0A 4QPKA 2E0AA 4LWFA 4JASA 1I59A 4MPNA 4YKUA 5GGZA 2C2AA 2YK2A 1YC3A 3HHUA 3U2KA 5C93A 3R4NA 4NH7A 3EHHA 5CTXA 3QTFA 4JAUA 4HY1A 4MP7A 4UROA 2YE9A 3G75A 4H85A 2FWZA 3WQ9A 2YEJA 4LWGA 4B7PA 3A0WA 3FV5A 2YEGA 3TUHA 1UYCA 4EMVA 1YC4A 2WI4A 5J6AA 2YE8A 1UYGA 4I3HA 1S16A 2Q8GA 1THNA 4FCQA 3ZKDA 4R1FA 3C11A 3RKZA 4P7AA 2XX5A 4YKZA 3HEKA 2BRCA 2QG2A 3HZ5A 4XKKA 1YSZA 4CWSA 4U7OA 1EI1A 4U93A 4CE1A 2XDKA 3B26A 2YEAA 4FCRA 5FNCA 1NHIA 2IORA 1BGQA 2YJXA 3CGZA 4YKRA 3PEJA 2CCTA 1YT1A 2VWCA 3Q5LA 1AH6A 1BXDA 1H7UA 4XCJA 4EFUA 2H55A 4O0BA 4CWNA 4ASBA 3JZ3A 3T0ZA
chains in the Genus database with same CATH superfamily
2YKIA 3HYZA 2YI7A 1IXMA 3HYYA 4CE3A 1GKXA 4KP4A 4H81A 4YKYA 5FNFA 1I58A 5CTYA 3T1KA 2ZBKB 5CF0A 3S5TA 2YGFA 4CE2A 4YKWA 2YE5A 3H80A 4EM7A 2BSMA 2YEEA 2O1VA 3C0EA 2BYIA 4GCZA 4CWQA 4KQVA 2WEQA 5L3JA 5FWKA 5F3KA 2C1GA 4EEHA 1YS3A 1JM6A 2WI2A 2BREA 2H8MA 2CGFA 3A0TA 2CH4A 4MBCA 3DGEA 2QFOA 4DZYA 1TH8A 3OPDA 3VHDA 3GIGB 1OSFA 2UWDA 2XDUA 4ASAA 4ASGA 4PL9A 4XC0A 3K60A 1TIDA 4I5SA 2Q8HA 3INWA 1F51A 2XDLA 3R91A 3Q5JA 2BT0A 2YI5A 3OWBA 3B24A 4YKXA 4WUBA 4HXZA 2WI5A 5IDJA 1UY9A 4B6CA 1UY6A 2HHIA 2BU6A 4DUHA 2YE4A 5M4KA 2FXSA 1YSRA 4URNA 2XX2A 2YEFA 2XHRA 4EGHA 1Z59A 4XIRA 3T0HA 4ZVIA 4MB9A 3GIFA 1YC1A 4LWEA 3A0RA 3ZXOA 2XCMA 4XKOA 1Y8NA 2BZ5A 2O1WA 1AM1A 3OW6A 5D6QA 4HYPA 4P8OA 4AWPA 2IWSA 5BOCA 2YEDA 3BMYA 4PU9A 2XDSA 2XJGA 2CCSA 1Z5BA 2YE6A 5M4HA 3GIGA 4XITA 1QZRA 1AMWA 1Y8PA 4O07A 4O04A 1Y4SA 5D6PA 2HKJA 1UYDA 3CYGA 3OMUA 3R4OA 1PVGA 5IDMA 1R62A 3VHAA 4WUCA 3U2DA 1TILA 4E72A 2ZKJA 1S14A 2YKJA 4HZ0A 4BIUA 2YI6A 2YKEA 3INXA 1QYEA 4ZKIA 3O0IA 3EHGA 2XJXA 4E00A 2YE2A 3O6OA 4L8ZA 5D7DA 1TC0A 2HG1A 1YT2A 3OWDA 3IEDA 2YEIA 4BQGA 4H7QA 4MPEA 3ZKBA 1ZXNA 3VADA 2QG0A 2FTKA 4MOTA 5D7RA 2WERA 2YECA 5CTWA 3TTZA 2CG9A 2FWYA 3K99A 2YE3A 5F5RA 4E01A 3TZ5A 2QF6A 2JKIA 3CRLA 2CCUA 1U2OA 3MNRP 3QDDA 2WI6A 3D0BA 4L93A 2JJCA 4GQTA 4L90A 2AKPA 4Q20A 2XDXA 4JAVA 3EHFA 1KZNA 3BM9A 1UYMA 1Z5AA 1ID0A 4EGIA 5M4MA 3NMQA 1TBWA 1UY8A 2YK9A 4ASFA 4WUDA 3G7EA 4X9LA 3B25A 5CPHA 4EFTA 2YE7A 2IOPA 2FYPA 3R92A 4HZ5A 3O2FA 3A0XA 3FT8A 4KSGA 2XHXA 4YKTA 1Y8OA 2PNRA 4U7NA 4EGKA 1AH8A 2IOQA 2BTZA 3B28A 4O09A 4E02A 4PRXA 1ZW9A 4HXWA 2XX4A 1MX0A 4W7TA 1B3QA 1TC6A 4XIQA 3CGYA 4CWFA 1AJ6A 3KE6A 3CWVA 4R3MA 1H7SA 1KIJA 1NHHA 2BU7A 2BYHA 3D2RA 4YKQA 3A0ZA 4JQLA 4PRVA 3ZM7A 2YGAA 4FCPA 2YGEA 3R4MA 4V25A 4AS9A 1L0OA 2ZDXA 1I5BA 1YESA 2GQPA 4HYMA 4R3AA 4CWOA 3EKOA 1YETA 4GFNA 1UYHA 4GT8A 2EXLA 4HY6A 3FT5A 1QY8A 3LMMA 1I5CA 1UYEA 4V26A 1NHJA 2O1UA 4XD8A 1BYQA 1UY7A 5M4PA 3EKRA 1MU5A 2HCHA 3RLRA 3RLQA 4MPCA 2XD6A 5FNDA 4LPBA 4NH9A 3GIEA 2XABA 2WI1A 2ESAA 4BXIA 3PEHA 4XIPA 4CWPA 1I5DA 1BKNA 3K97A 4BAEA 1UYIA 3B27A 4GEEA 1ZXMA 1EA6A 3EHJA 1GJVA 2BU2A 4LWIA 3LNUA 2IWXA 3TZ0A 5IN9A 2WI3A 3D36A 4LP0A 1UYFA 4FPPA 4XE2A 2Q8FA 3ZXQA 3R4PA 1ZWHA 1B63A 5J71A 2YEBA 2WI7A 4BQJA 2XJJA 1GKZA 2K5BA 4AWOA 2Q8IA 1UYKA 2BU8A 5CTUA 1Z5CA 4URLA 2XHTA 3CRKA 3Q5KA 4NH8A 2YKCA 4K4OA 3K98A 5M4EA 4FMTA 2BU5A 4KFGA 2GFDA 4BIZA 1UYLA 4L91A 4URMA 1Y4UA 4LWHA 4KSHA 3TZ4A 3U67A 3HZ1A 4XCLA 3WHAA 4AWQA 3H4LA 1A4HA 4O05A 4CWTA 4KTNA 3T10A 5BODA 1YERA 4L94A 2Q2EB 5M4NA 2YEHA 2IWUA 4XTJA 3SL2A 2ZDYA 1U0ZA 3TZ2A 2VCIA 2YJWA 4QPJA 1US7A 1YT0A 3T2SA 2WEPA 4CWRA 2XK2A 2VCJA 1B62A 1I5AA 5D7CA 2YKBA 4XKAA 3LPSA 4MP2A 3VHCA 3G7BA 3A0YA 2VW5A 3RLPA 4GGLA 4XDMA 2YI0A 4QPKA 2E0AA 4LWFA 4JASA 1I59A 4MPNA 4YKUA 5GGZA 2C2AA 2YK2A 1YC3A 3HHUA 3U2KA 5C93A 3R4NA 4NH7A 3EHHA 5CTXA 3QTFA 4JAUA 4HY1A 4MP7A 4UROA 2YE9A 3G75A 4H85A 2FWZA 3WQ9A 2YEJA 4LWGA 4B7PA 3A0WA 3FV5A 2YEGA 3TUHA 1UYCA 4EMVA 1YC4A 2WI4A 5J6AA 2YE8A 1UYGA 4I3HA 1S16A 2Q8GA 1THNA 4FCQA 3ZKDA 4R1FA 3C11A 3RKZA 4P7AA 5JENA 2XX5A 4YKZA 3HEKA 2BRCA 2QG2A 3HZ5A 4XKKA 1YSZA 4CWSA 4U7OA 1EI1A 4U93A 4CE1A 2XDKA 3B26A 2YEAA 4FCRA 5FNCA 1NHIA 2IORA 2C1IA 1BGQA 2YJXA 3CGZA 4YKRA 3PEJA 2CCTA 1YT1A 2VWCA 3Q5LA 1AH6A 1BXDA 1H7UA 4XCJA 4EFUA 2H55A 4O0BA 4CWNA 4ASBA 3JZ3A 3T0ZA
chains in the Genus database with same CATH topology
2YKIA 3HYZA 2YI7A 3HYYA 4CE3A 1GKXA 4KP4A 4H81A 4YKYA 5FNFA 1I58A 5CTYA 3T1KA 2ZBKB 5CF0A 2YGFA 4CE2A 4YKWA 2YE5A 3H80A 4EM7A 2BSMA 2YEEA 2O1VA 3C0EA 2BYIA 4GCZA 4CWQA 4KQVA 2WEQA 5L3JA 5FWKA 5F3KA 4EEHA 1YS3A 1JM6A 2WI2A 2BREA 2H8MA 2CGFA 3A0TA 2CH4A 4MBCA 3DGEA 2QFOA 4DZYA 1TH8A 3OPDA 3VHDA 3GIGB 1OSFA 2UWDA 2XDUA 4ASAA 4ASGA 4PL9A 4XC0A 3K60A 1TIDA 4I5SA 2Q8HA 3INWA 2XDLA 3R91A 3Q5JA 2BT0A 2YI5A 3OWBA 3B24A 4YKXA 4WUBA 4HXZA 2WI5A 5IDJA 1UY9A 4B6CA 1UY6A 2BU6A 4DUHA 2YE4A 5M4KA 2FXSA 1YSRA 4URNA 2XX2A 2YEFA 2XHRA 4EGHA 1Z59A 4XIRA 3T0HA 4ZVIA 4MB9A 3GIFA 1YC1A 4LWEA 3A0RA 3ZXOA 2XCMA 4XKOA 1Y8NA 2BZ5A 2O1WA 1AM1A 3OW6A 5D6QA 4HYPA 4P8OA 4AWPA 2IWSA 5BOCA 2YEDA 3BMYA 4PU9A 2XDSA 2XJGA 2CCSA 1Z5BA 2YE6A 5M4HA 3GIGA 4XITA 1QZRA 1AMWA 1Y8PA 4O07A 4O04A 1Y4SA 5D6PA 2HKJA 1UYDA 3OMUA 3R4OA 1PVGA 5IDMA 1R62A 3VHAA 4WUCA 3U2DA 1TILA 2ZKJA 1S14A 2YKJA 4HZ0A 4BIUA 2YI6A 2YKEA 3INXA 1QYEA 4ZKIA 3O0IA 3EHGA 2XJXA 4E00A 2YE2A 3O6OA 4L8ZA 5D7DA 1TC0A 2HG1A 1YT2A 3OWDA 3IEDA 2YEIA 4BQGA 4H7QA 4MPEA 3ZKBA 1ZXNA 3VADA 2QG0A 4MOTA 5D7RA 2WERA 2YECA 5CTWA 3TTZA 2CG9A 2FWYA 3K99A 2YE3A 5F5RA 4E01A 3TZ5A 2QF6A 2JKIA 3CRLA 2CCUA 1U2OA 3MNRP 3QDDA 2WI6A 3D0BA 4L93A 2JJCA 4GQTA 4L90A 2AKPA 4Q20A 2XDXA 4JAVA 3EHFA 1KZNA 3BM9A 1UYMA 1Z5AA 1ID0A 4EGIA 5M4MA 3NMQA 1TBWA 1UY8A 2YK9A 4ASFA 4WUDA 3G7EA 4X9LA 3B25A 5CPHA 4EFTA 2YE7A 2IOPA 2FYPA 3R92A 4HZ5A 3O2FA 3A0XA 3FT8A 4KSGA 2XHXA 4YKTA 1Y8OA 2PNRA 4U7NA 4EGKA 1AH8A 2IOQA 2BTZA 3B28A 4O09A 4E02A 4PRXA 1ZW9A 4HXWA 2XX4A 1MX0A 4W7TA 1B3QA 1TC6A 4XIQA 3CGYA 4CWFA 1AJ6A 3KE6A 3CWVA 4R3MA 1H7SA 1KIJA 1NHHA 2BU7A 2BYHA 3D2RA 4YKQA 3A0ZA 4JQLA 4PRVA 3ZM7A 2YGAA 4FCPA 2YGEA 3R4MA 4V25A 4AS9A 1L0OA 2ZDXA 1I5BA 1YESA 2GQPA 4HYMA 4R3AA 4CWOA 3EKOA 1YETA 4GFNA 1UYHA 4GT8A 2EXLA 3FT5A 4HY6A 1QY8A 1I5CA 1UYEA 4V26A 1NHJA 2O1UA 4XD8A 1BYQA 1UY7A 5M4PA 3EKRA 1MU5A 2HCHA 3RLRA 3RLQA 4MPCA 2XD6A 5FNDA 4LPBA 4NH9A 3GIEA 2XABA 2WI1A 2ESAA 4BXIA 3PEHA 4XIPA 4CWPA 1I5DA 1BKNA 3K97A 4BAEA 1UYIA 3B27A 4GEEA 1ZXMA 1EA6A 3EHJA 1GJVA 2BU2A 4LWIA 3LNUA 2IWXA 3TZ0A 5IN9A 2WI3A 3D36A 4LP0A 1UYFA 4FPPA 4XE2A 2Q8FA 3ZXQA 3R4PA 1ZWHA 1B63A 5J71A 2YEBA 2WI7A 4BQJA 2XJJA 1GKZA 2K5BA 4AWOA 2Q8IA 1UYKA 2BU8A 5CTUA 1Z5CA 4URLA 2XHTA 3CRKA 3Q5KA 4NH8A 2YKCA 4K4OA 3K98A 5M4EA 4FMTA 2BU5A 4KFGA 2GFDA 4BIZA 1UYLA 4L91A 4URMA 1Y4UA 4LWHA 4KSHA 3TZ4A 3U67A 3HZ1A 4XCLA 3WHAA 4AWQA 3H4LA 1A4HA 4O05A 4CWTA 4KTNA 3T10A 5BODA 1YERA 4L94A 2Q2EB 5M4NA 2YEHA 2IWUA 4XTJA 3SL2A 2ZDYA 1U0ZA 3TZ2A 2VCIA 2YJWA 4QPJA 1US7A 1YT0A 3T2SA 2WEPA 4CWRA 2XK2A 2VCJA 1B62A 1I5AA 5D7CA 2YKBA 4XKAA 3LPSA 4MP2A 3VHCA 3G7BA 3A0YA 2VW5A 3RLPA 4GGLA 4XDMA 2YI0A 4QPKA 2E0AA 4LWFA 4JASA 1I59A 4MPNA 4YKUA 5GGZA 2C2AA 2YK2A 1YC3A 3HHUA 3U2KA 5C93A 3R4NA 4NH7A 3EHHA 5CTXA 3QTFA 4JAUA 4HY1A 4MP7A 4UROA 2YE9A 3G75A 4H85A 2FWZA 3WQ9A 2YEJA 4LWGA 4B7PA 3A0WA 3FV5A 2YEGA 3TUHA 1UYCA 4EMVA 1YC4A 2WI4A 5J6AA 2YE8A 1UYGA 4I3HA 1S16A 2Q8GA 1THNA 4FCQA 3ZKDA 4R1FA 3C11A 3RKZA 4P7AA 2XX5A 4YKZA 3HEKA 2BRCA 2QG2A 3HZ5A 4XKKA 1YSZA 4CWSA 4U7OA 1EI1A 4U93A 4CE1A 2XDKA 3B26A 2YEAA 4FCRA 5FNCA 1NHIA 2IORA 1BGQA 2YJXA 3CGZA 4YKRA 3PEJA 2CCTA 1YT1A 2VWCA 3Q5LA 1AH6A 1BXDA 1H7UA 4XCJA 4EFUA 2H55A 4O0BA 4CWNA 4ASBA 3JZ3A 3T0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YKI A;  3HYZ A;  2YI7 A;  3HYY A;  4CE3 A;  1GKX A;  4KP4 A;  4H81 A;  4YKY A;  5FNF A;  1I58 A;  5CTY A;  3T1K A;  2ZBK B;  5CF0 A;  2YGF A;  4CE2 A;  4YKW A;  2YE5 A;  3H80 A;  4EM7 A;  2BSM A;  2YEE A;  2O1V A;  3C0E A;  2BYI A;  4GCZ A;  4CWQ A;  4KQV A;  2WEQ A;  5L3J A;  5FWK A;  5F3K A;  4EEH A;  1YS3 A;  1JM6 A;  2WI2 A;  2BRE A;  2H8M A;  2CGF A;  3A0T A;  2CH4 A;  4MBC A;  3DGE A;  2QFO A;  4DZY A;  1TH8 A;  3OPD A;  3VHD A;  3GIG B;  1OSF A;  2UWD A;  2XDU A;  4ASA A;  4ASG A;  4PL9 A;  4XC0 A;  3K60 A;  1TID A;  4I5S A;  2Q8H A;  3INW A;  2XDL A;  3R91 A;  3Q5J A;  2BT0 A;  2YI5 A;  3OWB A;  3B24 A;  4YKX A;  4WUB A;  4HXZ A;  2WI5 A;  5IDJ A;  1UY9 A;  4B6C A;  1UY6 A;  2BU6 A;  4DUH A;  2YE4 A;  5M4K A;  2FXS A;  1YSR A;  4URN A;  2XX2 A;  2YEF A;  2XHR A;  4EGH A;  1Z59 A;  4XIR A;  3T0H A;  4ZVI A;  4MB9 A;  3GIF A;  1YC1 A;  4LWE A;  3A0R A;  3ZXO A;  2XCM A;  4XKO A;  1Y8N A;  2BZ5 A;  2O1W A;  1AM1 A;  3OW6 A;  5D6Q A;  4HYP A;  4P8O A;  4AWP A;  2IWS A;  5BOC A;  2YED A;  3BMY A;  4PU9 A;  2XDS A;  2XJG A;  2CCS A;  1Z5B A;  2YE6 A;  5M4H A;  3GIG A;  4XIT A;  1QZR A;  1AMW A;  1Y8P A;  4O07 A;  4O04 A;  1Y4S A;  5D6P A;  2HKJ A;  1UYD A;  3OMU A;  3R4O A;  1PVG A;  5IDM A;  1R62 A;  3VHA A;  4WUC A;  3U2D A;  1TIL A;  2ZKJ A;  1S14 A;  2YKJ A;  4HZ0 A;  4BIU A;  2YI6 A;  2YKE A;  3INX A;  1QYE A;  4ZKI A;  3O0I A;  3EHG A;  2XJX A;  4E00 A;  2YE2 A;  3O6O A;  4L8Z A;  5D7D A;  1TC0 A;  2HG1 A;  1YT2 A;  3OWD A;  3IED A;  2YEI A;  4BQG A;  4H7Q A;  4MPE A;  3ZKB A;  1ZXN A;  3VAD A;  2QG0 A;  4MOT A;  5D7R A;  2WER A;  2YEC A;  5CTW A;  3TTZ A;  2CG9 A;  2FWY A;  3K99 A;  2YE3 A;  5F5R A;  4E01 A;  3TZ5 A;  2QF6 A;  2JKI A;  3CRL A;  2CCU A;  1U2O A;  3MNR P;  3QDD A;  2WI6 A;  3D0B A;  4L93 A;  2JJC A;  4GQT A;  4L90 A;  2AKP A;  4Q20 A;  2XDX A;  4JAV A;  3EHF A;  1KZN A;  3BM9 A;  1UYM A;  1Z5A A;  1ID0 A;  4EGI A;  5M4M A;  3NMQ A;  1TBW A;  1UY8 A;  2YK9 A;  4ASF A;  4WUD A;  3G7E A;  4X9L A;  3B25 A;  5CPH A;  4EFT A;  2YE7 A;  2IOP A;  2FYP A;  3R92 A;  4HZ5 A;  3O2F A;  3A0X A;  3FT8 A;  4KSG A;  2XHX A;  4YKT A;  1Y8O A;  2PNR A;  4U7N A;  4EGK A;  1AH8 A;  2IOQ A;  2BTZ A;  3B28 A;  4O09 A;  4E02 A;  4PRX A;  1ZW9 A;  4HXW A;  2XX4 A;  1MX0 A;  4W7T A;  1B3Q A;  1TC6 A;  4XIQ A;  3CGY A;  4CWF A;  1AJ6 A;  3KE6 A;  3CWV A;  4R3M A;  1H7S A;  1KIJ A;  1NHH A;  2BU7 A;  2BYH A;  3D2R A;  4YKQ A;  3A0Z A;  4JQL A;  4PRV A;  3ZM7 A;  2YGA A;  4FCP A;  2YGE A;  3R4M A;  4V25 A;  4AS9 A;  1L0O A;  2ZDX A;  1I5B A;  1YES A;  2GQP A;  4HYM A;  4R3A A;  4CWO A;  3EKO A;  1YET A;  4GFN A;  1UYH A;  4GT8 A;  2EXL A;  3FT5 A;  4HY6 A;  1QY8 A;  1I5C A;  1UYE A;  4V26 A;  1NHJ A;  2O1U A;  4XD8 A;  1BYQ A;  1UY7 A;  5M4P A;  3EKR A;  1MU5 A;  2HCH A;  3RLR A;  3RLQ A;  4MPC A;  2XD6 A;  5FND A;  4LPB A;  4NH9 A;  3GIE A;  2XAB A;  2WI1 A;  2ESA A;  4BXI A;  3PEH A;  4XIP A;  4CWP A;  1I5D A;  1BKN A;  3K97 A;  4BAE A;  1UYI A;  3B27 A;  4GEE A;  1ZXM A;  1EA6 A;  3EHJ A;  1GJV A;  2BU2 A;  4LWI A;  3LNU A;  2IWX A;  3TZ0 A;  5IN9 A;  2WI3 A;  3D36 A;  4LP0 A;  1UYF A;  4FPP A;  4XE2 A;  2Q8F A;  3ZXQ A;  3R4P A;  1ZWH A;  1B63 A;  5J71 A;  2YEB A;  2WI7 A;  4BQJ A;  2XJJ A;  1GKZ A;  2K5B A;  4AWO A;  2Q8I A;  1UYK A;  2BU8 A;  5CTU A;  1Z5C A;  4URL A;  2XHT A;  3CRK A;  3Q5K A;  4NH8 A;  2YKC A;  4K4O A;  3K98 A;  5M4E A;  4FMT A;  2BU5 A;  4KFG A;  2GFD A;  4BIZ A;  1UYL A;  4L91 A;  4URM A;  1Y4U A;  4LWH A;  4KSH A;  3TZ4 A;  3U67 A;  3HZ1 A;  4XCL A;  3WHA A;  4AWQ A;  3H4L A;  1A4H A;  4O05 A;  4CWT A;  4KTN A;  3T10 A;  5BOD A;  1YER A;  4L94 A;  2Q2E B;  5M4N A;  2YEH A;  2IWU A;  4XTJ A;  3SL2 A;  2ZDY A;  1U0Z A;  3TZ2 A;  2VCI A;  2YJW A;  4QPJ A;  1US7 A;  1YT0 A;  3T2S A;  2WEP A;  4CWR A;  2XK2 A;  2VCJ A;  1B62 A;  1I5A A;  5D7C A;  2YKB A;  4XKA A;  3LPS A;  4MP2 A;  3VHC A;  3G7B A;  3A0Y A;  2VW5 A;  3RLP A;  4GGL A;  4XDM A;  2YI0 A;  4QPK A;  2E0A A;  4LWF A;  4JAS A;  1I59 A;  4MPN A;  4YKU A;  5GGZ A;  2C2A A;  2YK2 A;  1YC3 A;  3HHU A;  3U2K A;  5C93 A;  3R4N A;  4NH7 A;  3EHH A;  5CTX A;  3QTF A;  4JAU A;  4HY1 A;  4MP7 A;  4URO A;  2YE9 A;  3G75 A;  4H85 A;  2FWZ A;  3WQ9 A;  2YEJ A;  4LWG A;  4B7P A;  3A0W A;  3FV5 A;  2YEG A;  3TUH A;  1UYC A;  4EMV A;  1YC4 A;  2WI4 A;  5J6A A;  2YE8 A;  1UYG A;  4I3H A;  1S16 A;  2Q8G A;  1THN A;  4FCQ A;  3ZKD A;  4R1F A;  3C11 A;  3RKZ A;  4P7A A;  2XX5 A;  4YKZ A;  3HEK A;  2BRC A;  2QG2 A;  3HZ5 A;  4XKK A;  1YSZ A;  4CWS A;  4U7O A;  1EI1 A;  4U93 A;  4CE1 A;  2XDK A;  3B26 A;  2YEA A;  4FCR A;  5FNC A;  1NHI A;  2IOR A;  1BGQ A;  2YJX A;  3CGZ A;  4YKR A;  3PEJ A;  2CCT A;  1YT1 A;  2VWC A;  3Q5L A;  1AH6 A;  1BXD A;  1H7U A;  4XCJ A;  4EFU A;  2H55 A;  4O0B A;  4CWN A;  4ASB A;  3JZ3 A;  3T0Z A; 
#chains in the Genus database with same CATH topology
 2YKI A;  3HYZ A;  2YI7 A;  1IXM A;  3HYY A;  4CE3 A;  1GKX A;  4KP4 A;  4H81 A;  4YKY A;  5FNF A;  1I58 A;  5CTY A;  3T1K A;  2ZBK B;  5CF0 A;  3S5T A;  2YGF A;  4CE2 A;  4YKW A;  2YE5 A;  3H80 A;  4EM7 A;  2BSM A;  2YEE A;  2O1V A;  3C0E A;  2BYI A;  4GCZ A;  4CWQ A;  4KQV A;  2WEQ A;  5L3J A;  5FWK A;  5F3K A;  2C1G A;  4EEH A;  1YS3 A;  1JM6 A;  2WI2 A;  2BRE A;  2H8M A;  2CGF A;  3A0T A;  2CH4 A;  4MBC A;  3DGE A;  2QFO A;  4DZY A;  1TH8 A;  3OPD A;  3VHD A;  3GIG B;  1OSF A;  2UWD A;  2XDU A;  4ASA A;  4ASG A;  4PL9 A;  4XC0 A;  3K60 A;  1TID A;  4I5S A;  2Q8H A;  3INW A;  1F51 A;  2XDL A;  3R91 A;  3Q5J A;  2BT0 A;  2YI5 A;  3OWB A;  3B24 A;  4YKX A;  4WUB A;  4HXZ A;  2WI5 A;  5IDJ A;  1UY9 A;  4B6C A;  1UY6 A;  2HHI A;  2BU6 A;  4DUH A;  2YE4 A;  5M4K A;  2FXS A;  1YSR A;  4URN A;  2XX2 A;  2YEF A;  2XHR A;  4EGH A;  1Z59 A;  4XIR A;  3T0H A;  4ZVI A;  4MB9 A;  3GIF A;  1YC1 A;  4LWE A;  3A0R A;  3ZXO A;  2XCM A;  4XKO A;  1Y8N A;  2BZ5 A;  2O1W A;  1AM1 A;  3OW6 A;  5D6Q A;  4HYP A;  4P8O A;  4AWP A;  2IWS A;  5BOC A;  2YED A;  3BMY A;  4PU9 A;  2XDS A;  2XJG A;  2CCS A;  1Z5B A;  2YE6 A;  5M4H A;  3GIG A;  4XIT A;  1QZR A;  1AMW A;  1Y8P A;  4O07 A;  4O04 A;  1Y4S A;  5D6P A;  2HKJ A;  1UYD A;  3CYG A;  3OMU A;  3R4O A;  1PVG A;  5IDM A;  1R62 A;  3VHA A;  4WUC A;  3U2D A;  1TIL A;  4E72 A;  2ZKJ A;  1S14 A;  2YKJ A;  4HZ0 A;  4BIU A;  2YI6 A;  2YKE A;  3INX A;  1QYE A;  4ZKI A;  3O0I A;  3EHG A;  2XJX A;  4E00 A;  2YE2 A;  3O6O A;  4L8Z A;  5D7D A;  1TC0 A;  2HG1 A;  1YT2 A;  3OWD A;  3IED A;  2YEI A;  4BQG A;  4H7Q A;  4MPE A;  3ZKB A;  1ZXN A;  3VAD A;  2QG0 A;  2FTK A;  4MOT A;  5D7R A;  2WER A;  2YEC A;  5CTW A;  3TTZ A;  2CG9 A;  2FWY A;  3K99 A;  2YE3 A;  5F5R A;  4E01 A;  3TZ5 A;  2QF6 A;  2JKI A;  3CRL A;  2CCU A;  1U2O A;  3MNR P;  3QDD A;  2WI6 A;  3D0B A;  4L93 A;  2JJC A;  4GQT A;  4L90 A;  2AKP A;  4Q20 A;  2XDX A;  4JAV A;  3EHF A;  1KZN A;  3BM9 A;  1UYM A;  1Z5A A;  1ID0 A;  4EGI A;  5M4M A;  3NMQ A;  1TBW A;  1UY8 A;  2YK9 A;  4ASF A;  4WUD A;  3G7E A;  4X9L A;  3B25 A;  5CPH A;  4EFT A;  2YE7 A;  2IOP A;  2FYP A;  3R92 A;  4HZ5 A;  3O2F A;  3A0X A;  3FT8 A;  4KSG A;  2XHX A;  4YKT A;  1Y8O A;  2PNR A;  4U7N A;  4EGK A;  1AH8 A;  2IOQ A;  2BTZ A;  3B28 A;  4O09 A;  4E02 A;  4PRX A;  1ZW9 A;  4HXW A;  2XX4 A;  1MX0 A;  4W7T A;  1B3Q A;  1TC6 A;  4XIQ A;  3CGY A;  4CWF A;  1AJ6 A;  3KE6 A;  3CWV A;  4R3M A;  1H7S A;  1KIJ A;  1NHH A;  2BU7 A;  2BYH A;  3D2R A;  4YKQ A;  3A0Z A;  4JQL A;  4PRV A;  3ZM7 A;  2YGA A;  4FCP A;  2YGE A;  3R4M A;  4V25 A;  4AS9 A;  1L0O A;  2ZDX A;  1I5B A;  1YES A;  2GQP A;  4HYM A;  4R3A A;  4CWO A;  3EKO A;  1YET A;  4GFN A;  1UYH A;  4GT8 A;  2EXL A;  4HY6 A;  3FT5 A;  1QY8 A;  3LMM A;  1I5C A;  1UYE A;  4V26 A;  1NHJ A;  2O1U A;  4XD8 A;  1BYQ A;  1UY7 A;  5M4P A;  3EKR A;  1MU5 A;  2HCH A;  3RLR A;  3RLQ A;  4MPC A;  2XD6 A;  5FND A;  4LPB A;  4NH9 A;  3GIE A;  2XAB A;  2WI1 A;  2ESA A;  4BXI A;  3PEH A;  4XIP A;  4CWP A;  1I5D A;  1BKN A;  3K97 A;  4BAE A;  1UYI A;  3B27 A;  4GEE A;  1ZXM A;  1EA6 A;  3EHJ A;  1GJV A;  2BU2 A;  4LWI A;  3LNU A;  2IWX A;  3TZ0 A;  5IN9 A;  2WI3 A;  3D36 A;  4LP0 A;  1UYF A;  4FPP A;  4XE2 A;  2Q8F A;  3ZXQ A;  3R4P A;  1ZWH A;  1B63 A;  5J71 A;  2YEB A;  2WI7 A;  4BQJ A;  2XJJ A;  1GKZ A;  2K5B A;  4AWO A;  2Q8I A;  1UYK A;  2BU8 A;  5CTU A;  1Z5C A;  4URL A;  2XHT A;  3CRK A;  3Q5K A;  4NH8 A;  2YKC A;  4K4O A;  3K98 A;  5M4E A;  4FMT A;  2BU5 A;  4KFG A;  2GFD A;  4BIZ A;  1UYL A;  4L91 A;  4URM A;  1Y4U A;  4LWH A;  4KSH A;  3TZ4 A;  3U67 A;  3HZ1 A;  4XCL A;  3WHA A;  4AWQ A;  3H4L A;  1A4H A;  4O05 A;  4CWT A;  4KTN A;  3T10 A;  5BOD A;  1YER A;  4L94 A;  2Q2E B;  5M4N A;  2YEH A;  2IWU A;  4XTJ A;  3SL2 A;  2ZDY A;  1U0Z A;  3TZ2 A;  2VCI A;  2YJW A;  4QPJ A;  1US7 A;  1YT0 A;  3T2S A;  2WEP A;  4CWR A;  2XK2 A;  2VCJ A;  1B62 A;  1I5A A;  5D7C A;  2YKB A;  4XKA A;  3LPS A;  4MP2 A;  3VHC A;  3G7B A;  3A0Y A;  2VW5 A;  3RLP A;  4GGL A;  4XDM A;  2YI0 A;  4QPK A;  2E0A A;  4LWF A;  4JAS A;  1I59 A;  4MPN A;  4YKU A;  5GGZ A;  2C2A A;  2YK2 A;  1YC3 A;  3HHU A;  3U2K A;  5C93 A;  3R4N A;  4NH7 A;  3EHH A;  5CTX A;  3QTF A;  4JAU A;  4HY1 A;  4MP7 A;  4URO A;  2YE9 A;  3G75 A;  4H85 A;  2FWZ A;  3WQ9 A;  2YEJ A;  4LWG A;  4B7P A;  3A0W A;  3FV5 A;  2YEG A;  3TUH A;  1UYC A;  4EMV A;  1YC4 A;  2WI4 A;  5J6A A;  2YE8 A;  1UYG A;  4I3H A;  1S16 A;  2Q8G A;  1THN A;  4FCQ A;  3ZKD A;  4R1F A;  3C11 A;  3RKZ A;  4P7A A;  5JEN A;  2XX5 A;  4YKZ A;  3HEK A;  2BRC A;  2QG2 A;  3HZ5 A;  4XKK A;  1YSZ A;  4CWS A;  4U7O A;  1EI1 A;  4U93 A;  4CE1 A;  2XDK A;  3B26 A;  2YEA A;  4FCR A;  5FNC A;  1NHI A;  2IOR A;  2C1I A;  1BGQ A;  2YJX A;  3CGZ A;  4YKR A;  3PEJ A;  2CCT A;  1YT1 A;  2VWC A;  3Q5L A;  1AH6 A;  1BXD A;  1H7U A;  4XCJ A;  4EFU A;  2H55 A;  4O0B A;  4CWN A;  4ASB A;  3JZ3 A;  3T0Z A; 
#chains in the Genus database with same CATH homology
 2YKI A;  3HYZ A;  2YI7 A;  3HYY A;  4CE3 A;  1GKX A;  4KP4 A;  4H81 A;  4YKY A;  5FNF A;  1I58 A;  5CTY A;  3T1K A;  2ZBK B;  5CF0 A;  2YGF A;  4CE2 A;  4YKW A;  2YE5 A;  3H80 A;  4EM7 A;  2BSM A;  2YEE A;  2O1V A;  3C0E A;  2BYI A;  4GCZ A;  4CWQ A;  4KQV A;  2WEQ A;  5L3J A;  5FWK A;  5F3K A;  4EEH A;  1YS3 A;  1JM6 A;  2WI2 A;  2BRE A;  2H8M A;  2CGF A;  3A0T A;  2CH4 A;  4MBC A;  3DGE A;  2QFO A;  4DZY A;  1TH8 A;  3OPD A;  3VHD A;  3GIG B;  1OSF A;  2UWD A;  2XDU A;  4ASA A;  4ASG A;  4PL9 A;  4XC0 A;  3K60 A;  1TID A;  4I5S A;  2Q8H A;  3INW A;  2XDL A;  3R91 A;  3Q5J A;  2BT0 A;  2YI5 A;  3OWB A;  3B24 A;  4YKX A;  4WUB A;  4HXZ A;  2WI5 A;  5IDJ A;  1UY9 A;  4B6C A;  1UY6 A;  2BU6 A;  4DUH A;  2YE4 A;  5M4K A;  2FXS A;  1YSR A;  4URN A;  2XX2 A;  2YEF A;  2XHR A;  4EGH A;  1Z59 A;  4XIR A;  3T0H A;  4ZVI A;  4MB9 A;  3GIF A;  1YC1 A;  4LWE A;  3A0R A;  3ZXO A;  2XCM A;  4XKO A;  1Y8N A;  2BZ5 A;  2O1W A;  1AM1 A;  3OW6 A;  5D6Q A;  4HYP A;  4P8O A;  4AWP A;  2IWS A;  5BOC A;  2YED A;  3BMY A;  4PU9 A;  2XDS A;  2XJG A;  2CCS A;  1Z5B A;  2YE6 A;  5M4H A;  3GIG A;  4XIT A;  1QZR A;  1AMW A;  1Y8P A;  4O07 A;  4O04 A;  1Y4S A;  5D6P A;  2HKJ A;  1UYD A;  3OMU A;  3R4O A;  1PVG A;  5IDM A;  1R62 A;  3VHA A;  4WUC A;  3U2D A;  1TIL A;  2ZKJ A;  1S14 A;  2YKJ A;  4HZ0 A;  4BIU A;  2YI6 A;  2YKE A;  3INX A;  1QYE A;  4ZKI A;  3O0I A;  3EHG A;  2XJX A;  4E00 A;  2YE2 A;  3O6O A;  4L8Z A;  5D7D A;  1TC0 A;  2HG1 A;  1YT2 A;  3OWD A;  3IED A;  2YEI A;  4BQG A;  4H7Q A;  4MPE A;  3ZKB A;  1ZXN A;  3VAD A;  2QG0 A;  4MOT A;  5D7R A;  2WER A;  2YEC A;  5CTW A;  3TTZ A;  2CG9 A;  2FWY A;  3K99 A;  2YE3 A;  5F5R A;  4E01 A;  3TZ5 A;  2QF6 A;  2JKI A;  3CRL A;  2CCU A;  1U2O A;  3MNR P;  3QDD A;  2WI6 A;  3D0B A;  4L93 A;  2JJC A;  4GQT A;  4L90 A;  2AKP A;  4Q20 A;  2XDX A;  4JAV A;  3EHF A;  1KZN A;  3BM9 A;  1UYM A;  1Z5A A;  1ID0 A;  4EGI A;  5M4M A;  3NMQ A;  1TBW A;  1UY8 A;  2YK9 A;  4ASF A;  4WUD A;  3G7E A;  4X9L A;  3B25 A;  5CPH A;  4EFT A;  2YE7 A;  2IOP A;  2FYP A;  3R92 A;  4HZ5 A;  3O2F A;  3A0X A;  3FT8 A;  4KSG A;  2XHX A;  4YKT A;  1Y8O A;  2PNR A;  4U7N A;  4EGK A;  1AH8 A;  2IOQ A;  2BTZ A;  3B28 A;  4O09 A;  4E02 A;  4PRX A;  1ZW9 A;  4HXW A;  2XX4 A;  1MX0 A;  4W7T A;  1B3Q A;  1TC6 A;  4XIQ A;  3CGY A;  4CWF A;  1AJ6 A;  3KE6 A;  3CWV A;  4R3M A;  1H7S A;  1KIJ A;  1NHH A;  2BU7 A;  2BYH A;  3D2R A;  4YKQ A;  3A0Z A;  4JQL A;  4PRV A;  3ZM7 A;  2YGA A;  4FCP A;  2YGE A;  3R4M A;  4V25 A;  4AS9 A;  1L0O A;  2ZDX A;  1I5B A;  1YES A;  2GQP A;  4HYM A;  4R3A A;  4CWO A;  3EKO A;  1YET A;  4GFN A;  1UYH A;  4GT8 A;  2EXL A;  3FT5 A;  4HY6 A;  1QY8 A;  1I5C A;  1UYE A;  4V26 A;  1NHJ A;  2O1U A;  4XD8 A;  1BYQ A;  1UY7 A;  5M4P A;  3EKR A;  1MU5 A;  2HCH A;  3RLR A;  3RLQ A;  4MPC A;  2XD6 A;  5FND A;  4LPB A;  4NH9 A;  3GIE A;  2XAB A;  2WI1 A;  2ESA A;  4BXI A;  3PEH A;  4XIP A;  4CWP A;  1I5D A;  1BKN A;  3K97 A;  4BAE A;  1UYI A;  3B27 A;  4GEE A;  1ZXM A;  1EA6 A;  3EHJ A;  1GJV A;  2BU2 A;  4LWI A;  3LNU A;  2IWX A;  3TZ0 A;  5IN9 A;  2WI3 A;  3D36 A;  4LP0 A;  1UYF A;  4FPP A;  4XE2 A;  2Q8F A;  3ZXQ A;  3R4P A;  1ZWH A;  1B63 A;  5J71 A;  2YEB A;  2WI7 A;  4BQJ A;  2XJJ A;  1GKZ A;  2K5B A;  4AWO A;  2Q8I A;  1UYK A;  2BU8 A;  5CTU A;  1Z5C A;  4URL A;  2XHT A;  3CRK A;  3Q5K A;  4NH8 A;  2YKC A;  4K4O A;  3K98 A;  5M4E A;  4FMT A;  2BU5 A;  4KFG A;  2GFD A;  4BIZ A;  1UYL A;  4L91 A;  4URM A;  1Y4U A;  4LWH A;  4KSH A;  3TZ4 A;  3U67 A;  3HZ1 A;  4XCL A;  3WHA A;  4AWQ A;  3H4L A;  1A4H A;  4O05 A;  4CWT A;  4KTN A;  3T10 A;  5BOD A;  1YER A;  4L94 A;  2Q2E B;  5M4N A;  2YEH A;  2IWU A;  4XTJ A;  3SL2 A;  2ZDY A;  1U0Z A;  3TZ2 A;  2VCI A;  2YJW A;  4QPJ A;  1US7 A;  1YT0 A;  3T2S A;  2WEP A;  4CWR A;  2XK2 A;  2VCJ A;  1B62 A;  1I5A A;  5D7C A;  2YKB A;  4XKA A;  3LPS A;  4MP2 A;  3VHC A;  3G7B A;  3A0Y A;  2VW5 A;  3RLP A;  4GGL A;  4XDM A;  2YI0 A;  4QPK A;  2E0A A;  4LWF A;  4JAS A;  1I59 A;  4MPN A;  4YKU A;  5GGZ A;  2C2A A;  2YK2 A;  1YC3 A;  3HHU A;  3U2K A;  5C93 A;  3R4N A;  4NH7 A;  3EHH A;  5CTX A;  3QTF A;  4JAU A;  4HY1 A;  4MP7 A;  4URO A;  2YE9 A;  3G75 A;  4H85 A;  2FWZ A;  3WQ9 A;  2YEJ A;  4LWG A;  4B7P A;  3A0W A;  3FV5 A;  2YEG A;  3TUH A;  1UYC A;  4EMV A;  1YC4 A;  2WI4 A;  5J6A A;  2YE8 A;  1UYG A;  4I3H A;  1S16 A;  2Q8G A;  1THN A;  4FCQ A;  3ZKD A;  4R1F A;  3C11 A;  3RKZ A;  4P7A A;  2XX5 A;  4YKZ A;  3HEK A;  2BRC A;  2QG2 A;  3HZ5 A;  4XKK A;  1YSZ A;  4CWS A;  4U7O A;  1EI1 A;  4U93 A;  4CE1 A;  2XDK A;  3B26 A;  2YEA A;  4FCR A;  5FNC A;  1NHI A;  2IOR A;  1BGQ A;  2YJX A;  3CGZ A;  4YKR A;  3PEJ A;  2CCT A;  1YT1 A;  2VWC A;  3Q5L A;  1AH6 A;  1BXD A;  1H7U A;  4XCJ A;  4EFU A;  2H55 A;  4O0B A;  4CWN A;  4ASB A;  3JZ3 A;  3T0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...