3G7BA

Staphylococcus aureus gyrase b co-complex with methyl ({5-[4-(4-hydroxypiperidin-1-yl)-2-phenyl-1,3-thiazol-5-yl]-1h-pyrazol-3-yl}methyl)carbamate inhibitor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
184
structure length
184
Chain Sequence
GLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of pyrazolthiazoles as novel and potent inhibitors of bacterial gyrase.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase/isomerase inhibitor
molecule keywords DNA gyrase subunit B
total genus 54
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3g7bA00
2XDLA 2FYPA 2XDKA 3BMYA 3VADA 4CWRA 3HZ5A 3EHGA 1EI1A 1BGQA 2BZ5A 4WUDA 2XJXA 2WI4A 3TZ0A 2QF6A 1B62A 4KTNA 1ZWHA 1Y8PA 4HZ0A 4EMVA 3Q5LA 2YKIA 3R92A 4CWQA 3KE6A 3OPDA 4HXZA 4PRXA 4EFUA 2WI7A 2YE5A 4JQLA 2XHTA 1Y4SA 3CWVA 4JASA 2ESAA 2YE4A 3G7BA 2JKIA 2Q8GA 1UY7A 3T10A 2YGAA 3TTZA 5M4EA 4CE3A 1GKXA 4MBCA 3CRLA 3FV5A 4K4OA 2YJWA 2YE2A 2YE9A 2YEDA 2XDXA 2BSMA 4KP4A 4P8OA 4JAVA 4BIZA 4L94A 5J71A 3OMUA 2WERA 2YEBA 2YE8A 2IWSA 4H85A 2QG2A 4EM7A 1KIJA 4XIPA 1UY9A 1MX0A 4KQVA 1Y4UA 1YC1A 2YKJA 2ZKJA 3R91A 5D7DA 2HCHA 4MOTA 4FCQA 3T1KA 2IWUA 5BODA 4HYPA 2PNRA 4HYMA 2YI5A 2YE6A 2XDUA 3D0BA 4O05A 1YT1A 2VW5A 2BYHA 4FPPA 4QPJA 2CGFA 4FMTA 3FT5A 4L93A 2WI3A 4H81A 1AJ6A 2XDSA 4URMA 3EKRA 3RLRA 4XIQA 4CWSA 4KSHA 4O07A 4GT8A 1TC0A 1UYCA 4GFNA 3TZ4A 2XJGA 3OWBA 2BTZA 1OSFA 3K99A 5M4MA 4ASAA 4XCJA 2EXLA 2YKEA 4LWFA 2QFOA 1QZRA 4Q20A 4CWFA 4CWPA 2C2AA 1UYMA 5FNCA 4U7NA 3R4MA 4GEEA 2XX4A 4EGHA 3PEJA 4U93A 4PRVA 3T0HA 4GQTA 2ZDXA 3Q5KA 3R4NA 4AWPA 4NH7A 3HHUA 1MU5A 3JZ3A 2HG1A 2WEQA 1ZXNA 5GGZA 5C93A 1TC6A 5IN9A 3ZKBA 4BXIA 3ZM7A 5D7CA 4YKTA 2FWZA 3ZXQA 1UY6A 4BQJA 3ZXOA 5CPHA 4O04A 4B7PA 3G75A 1I5DA 4O09A 4P7AA 5CTXA 3WQ9A 2H55A 4ZKIA 1B63A 5CTYA 2YKCA 4HZ5A 1US7A 1ZXMA 3K98A 2FXSA 3HZ1A 4ZVIA 2Q8IA 3CRKA 3O2FA 3CGZA 1UYKA 2CCUA 4XTJA 4XDMA 3GIGB 4ASFA 1H7SA 4WUCA 2BU5A 1S14A 4I5SA 1YC4A 2YJXA 3VHCA 3T2SA 4DZYA 2VCJA 1Z5AA 2Q2EB 4EFTA 3H80A 3OWDA 2YGEA 1BKNA 4LP0A 1NHHA 1YT0A 3K97A 5D6PA 4XC0A 2WI6A 3MNRP 4HY6A 3T0ZA 3B27A 4UROA 3B24A 4E01A 4XKAA 1I5AA 1YC3A 1EA6A 4V25A 1QY8A 1UYLA 4XCLA 1Z5BA 3A0YA 3D36A 2YEEA 1L0OA 1UYHA 1S16A 3INWA 4FCRA 4KFGA 4XD8A 2ZBKB 3QTFA 1PVGA 2XD6A 2Q8HA 5BOCA 3TZ2A 2IOPA 1Z5CA 2YI0A 2BU2A 4BAEA 2YEIA 1ZW9A 5IDJA 2XHRA 3G7EA 3HYZA 4L8ZA 3RLQA 5CTWA 1NHJA 1YETA 4LWGA 4B6CA 4YKXA 4YKQA 1TH8A 3DGEA 2VCIA 3RLPA 4CE2A 1JM6A 4KSGA 4LWEA 4URLA 3INXA 2XCMA 2BU8A 1I58A 1Y8OA 2YK2A 1U2OA 2BU6A 1THNA 3CGYA 4YKRA 4MB9A 2Q8FA 4I3HA 1YSZA 2YECA 2O1UA 3RKZA 5M4KA 2BT0A 4MP7A 4PL9A 4CWTA 4E00A 3A0RA 3VHAA 4YKUA 4ASGA 4NH9A 2HKJA 4R3MA 1UYEA 4NH8A 2XX5A 2XK2A 4R1FA 2WI2A 2E0AA 3O6OA 1H7UA 1YT2A 1AM1A 4HY1A 2ZDYA 2K5BA 3EHFA 3VHDA 3U2KA 1AMWA 3A0XA 1UYFA 2VWCA 3GIGA 1AH8A 4L90A 3Q5JA 4MPNA 4O0BA 2BU7A 2UWDA 2CCSA 2H8MA 3R4PA 1YESA 1B3QA 4WUBA 4YKYA 3O0IA 2CH4A 2FWYA 4LPBA 3PEHA 3QDDA 1GKZA 1KZNA 5FWKA 2JJCA 1A4HA 1QYEA 2YEAA 2WI1A 1NHIA 2YE7A 2BRCA 2YEHA 3U67A 3FT8A 1UY8A 5CF0A 3EKOA 3EHHA 4GCZA 2WEPA 4V26A 3GIFA 4H7QA 1I5CA 2XABA 3IEDA 3GIEA 5M4NA 2GFDA 3B26A 2O1WA 1I5BA 4AWQA 4YKZA 3EHJA 3SL2A 2CG9A 3R4OA 1R62A 1UYGA 1YS3A 1YSRA 3K60A 4MPCA 4QPKA 4BIUA 3ZKDA 3LPSA 4GGLA 3B28A 2YK9A 1ID0A 1TILA 4BQGA 5FNDA 2YI6A 3D2RA 5L3JA 1Y8NA 4MP2A 3H4LA 4LWHA 1AH6A 3A0WA 4YKWA 1TBWA 2WI5A 4XKKA 5FNFA 3C11A 1U0ZA 1UYDA 4W7TA 2YEFA 3C0EA 1TIDA 3U2DA 3OW6A 4EGIA 2AKPA 5M4PA 5F3KA 4XITA 2YGFA 1I59A 3A0ZA 4LWIA 4ASBA 2CCTA 3HYYA 2BYIA 4URNA 4CE1A 4AS9A 1BXDA 2YI7A 4PU9A 4U7OA 5M4HA 5D6QA 2IWXA 5F5RA 2IORA 3LNUA 4EGKA 1BYQA 4HXWA 2XHXA 4XE2A 2YKBA 5IDMA 2BREA 3BM9A 5D7RA 2IOQA 2QG0A 3HEKA 4EEHA 5CTUA 3B25A 2XX2A 4MPEA 2YE3A 1GJVA 4L91A 3WHAA 3TUHA 4R3AA 4XIRA 4AWOA 2GQPA 3TZ5A 1YERA 4XKOA 5J6AA 2YEGA 4JAUA 4X9LA 3A0TA 4FCPA 4CWOA 2YEJA 4CWNA 1Z59A 2XJJA 3NMQA 4DUHA 1UYIA 4E02A 2O1VA
chains in the Genus database with same CATH superfamily
2XDLA 2FYPA 2XDKA 3BMYA 3VADA 4CWRA 3HZ5A 3EHGA 1EI1A 1BGQA 2BZ5A 4WUDA 2XJXA 2WI4A 3TZ0A 2QF6A 1B62A 4KTNA 1ZWHA 1Y8PA 4HZ0A 4EMVA 3Q5LA 2YKIA 3R92A 4CWQA 3KE6A 3OPDA 4HXZA 4PRXA 4EFUA 2WI7A 2YE5A 4JQLA 2XHTA 1Y4SA 3CWVA 4JASA 2ESAA 2YE4A 3G7BA 2JKIA 2Q8GA 1UY7A 3T10A 2YGAA 3TTZA 5M4EA 4CE3A 1GKXA 4MBCA 3CRLA 3FV5A 4K4OA 2YJWA 2YE2A 2YE9A 2YEDA 2XDXA 2BSMA 4KP4A 4P8OA 4JAVA 4BIZA 4L94A 5J71A 3OMUA 2WERA 2YEBA 2YE8A 2IWSA 4H85A 2QG2A 4EM7A 1KIJA 4XIPA 1UY9A 1MX0A 4KQVA 1Y4UA 1YC1A 2YKJA 2ZKJA 3R91A 5D7DA 2HCHA 4MOTA 1IXMA 4FCQA 3T1KA 2IWUA 2HHIA 5BODA 4HYPA 2PNRA 4HYMA 2YI5A 2YE6A 2XDUA 3D0BA 4O05A 1YT1A 2VW5A 2BYHA 4FPPA 4QPJA 2CGFA 4FMTA 3FT5A 4L93A 2WI3A 4H81A 1AJ6A 2XDSA 4URMA 3EKRA 3RLRA 4XIQA 4CWSA 4KSHA 4O07A 4GT8A 1TC0A 1UYCA 4GFNA 3TZ4A 2XJGA 3OWBA 2BTZA 1OSFA 3K99A 5M4MA 4ASAA 4XCJA 2EXLA 2YKEA 4LWFA 2QFOA 1QZRA 4Q20A 4CWFA 4CWPA 2C2AA 1UYMA 5FNCA 4U7NA 3R4MA 4GEEA 2XX4A 4EGHA 3PEJA 4U93A 4PRVA 3T0HA 4GQTA 2ZDXA 3Q5KA 3R4NA 4AWPA 4NH7A 3HHUA 1MU5A 3JZ3A 2HG1A 2WEQA 1ZXNA 5GGZA 5C93A 1TC6A 5IN9A 3ZKBA 4BXIA 3ZM7A 5D7CA 4YKTA 2FWZA 3ZXQA 1UY6A 4BQJA 3ZXOA 5CPHA 4O04A 4B7PA 3G75A 3LMMA 1I5DA 4O09A 4P7AA 5CTXA 3WQ9A 2H55A 4ZKIA 1B63A 5CTYA 2YKCA 2FTKA 4HZ5A 1US7A 1ZXMA 3K98A 4E72A 2FXSA 3HZ1A 4ZVIA 2Q8IA 3CRKA 3O2FA 3CGZA 1UYKA 2CCUA 4XTJA 4XDMA 3GIGB 4ASFA 1H7SA 4WUCA 2BU5A 1S14A 4I5SA 2C1IA 1YC4A 2YJXA 3VHCA 3T2SA 4DZYA 2VCJA 1Z5AA 2Q2EB 4EFTA 3H80A 3OWDA 2YGEA 1BKNA 4LP0A 1NHHA 1YT0A 3K97A 5D6PA 4XC0A 2WI6A 3MNRP 4HY6A 3T0ZA 3B27A 4UROA 3B24A 4E01A 4XKAA 1I5AA 1YC3A 1EA6A 4V25A 1QY8A 1UYLA 4XCLA 1Z5BA 3A0YA 3D36A 2YEEA 1L0OA 1UYHA 1S16A 3INWA 4FCRA 4KFGA 4XD8A 2ZBKB 3QTFA 1PVGA 2XD6A 2Q8HA 5BOCA 3TZ2A 2IOPA 1Z5CA 2YI0A 2BU2A 4BAEA 2YEIA 1ZW9A 5IDJA 2XHRA 3G7EA 3HYZA 4L8ZA 3RLQA 5CTWA 1NHJA 1YETA 4LWGA 4B6CA 4YKXA 4YKQA 1TH8A 3DGEA 2VCIA 3RLPA 4CE2A 1JM6A 4KSGA 4LWEA 4URLA 3INXA 2XCMA 1F51A 2BU8A 1I58A 1Y8OA 2YK2A 1U2OA 2BU6A 1THNA 3CGYA 4YKRA 4MB9A 2Q8FA 4I3HA 1YSZA 2YECA 2O1UA 3RKZA 5M4KA 2BT0A 4MP7A 4PL9A 4CWTA 4E00A 3A0RA 3VHAA 4YKUA 4ASGA 4NH9A 2HKJA 4R3MA 1UYEA 4NH8A 2XX5A 2XK2A 4R1FA 2WI2A 2E0AA 3O6OA 1H7UA 1YT2A 1AM1A 4HY1A 2ZDYA 2K5BA 3EHFA 3VHDA 3U2KA 5JENA 1AMWA 3A0XA 1UYFA 2VWCA 3GIGA 1AH8A 4L90A 3Q5JA 4MPNA 4O0BA 2BU7A 2UWDA 2CCSA 2H8MA 3R4PA 1YESA 1B3QA 4WUBA 4YKYA 3O0IA 2CH4A 2FWYA 4LPBA 3PEHA 3QDDA 1GKZA 1KZNA 5FWKA 2JJCA 1A4HA 1QYEA 2YEAA 2WI1A 1NHIA 2YE7A 2BRCA 2YEHA 3U67A 3FT8A 1UY8A 5CF0A 3EKOA 3EHHA 4GCZA 2WEPA 4V26A 3GIFA 4H7QA 1I5CA 2XABA 3IEDA 3GIEA 5M4NA 2GFDA 3B26A 2O1WA 1I5BA 4AWQA 4YKZA 3EHJA 3SL2A 2CG9A 3R4OA 1R62A 1UYGA 1YS3A 1YSRA 3K60A 2C1GA 4MPCA 4QPKA 4BIUA 3ZKDA 3LPSA 4GGLA 3B28A 2YK9A 1ID0A 1TILA 4BQGA 5FNDA 2YI6A 3D2RA 5L3JA 1Y8NA 4MP2A 3H4LA 4LWHA 1AH6A 3A0WA 4YKWA 1TBWA 2WI5A 4XKKA 3CYGA 3C11A 5FNFA 1U0ZA 1UYDA 4W7TA 2YEFA 3C0EA 1TIDA 3U2DA 3OW6A 4EGIA 2AKPA 5M4PA 5F3KA 4XITA 2YGFA 1I59A 3A0ZA 4LWIA 4ASBA 2CCTA 3HYYA 2BYIA 4URNA 4CE1A 4AS9A 1BXDA 2YI7A 4PU9A 4U7OA 5M4HA 5D6QA 2IWXA 5F5RA 2IORA 3LNUA 4EGKA 1BYQA 4HXWA 2XHXA 4XE2A 2YKBA 5IDMA 2BREA 3BM9A 3S5TA 5D7RA 2IOQA 2QG0A 3HEKA 4EEHA 5CTUA 3B25A 2XX2A 4MPEA 2YE3A 1GJVA 4L91A 3WHAA 3TUHA 4R3AA 4XIRA 4AWOA 2GQPA 3TZ5A 1YERA 4XKOA 5J6AA 2YEGA 4JAUA 4X9LA 3A0TA 4FCPA 4CWOA 2YEJA 4CWNA 1Z59A 2XJJA 3NMQA 4DUHA 1UYIA 4E02A 2O1VA
chains in the Genus database with same CATH topology
2XDLA 2FYPA 2XDKA 3BMYA 3VADA 4CWRA 3HZ5A 3EHGA 1EI1A 1BGQA 2BZ5A 4WUDA 2XJXA 2WI4A 3TZ0A 2QF6A 1B62A 4KTNA 1ZWHA 1Y8PA 4HZ0A 4EMVA 3Q5LA 2YKIA 3R92A 4CWQA 3KE6A 3OPDA 4HXZA 4PRXA 4EFUA 2WI7A 2YE5A 4JQLA 2XHTA 1Y4SA 3CWVA 4JASA 2ESAA 2YE4A 3G7BA 2JKIA 2Q8GA 1UY7A 3T10A 2YGAA 3TTZA 5M4EA 4CE3A 1GKXA 4MBCA 3CRLA 3FV5A 4K4OA 2YJWA 2YE2A 2YE9A 2YEDA 2XDXA 2BSMA 4KP4A 4P8OA 4JAVA 4BIZA 4L94A 5J71A 3OMUA 2WERA 2YEBA 2YE8A 2IWSA 4H85A 2QG2A 4EM7A 1KIJA 4XIPA 1UY9A 1MX0A 4KQVA 1Y4UA 1YC1A 2YKJA 2ZKJA 3R91A 5D7DA 2HCHA 4MOTA 4FCQA 3T1KA 2IWUA 5BODA 4HYPA 2PNRA 4HYMA 2YI5A 2YE6A 2XDUA 3D0BA 4O05A 1YT1A 2VW5A 2BYHA 4FPPA 4QPJA 2CGFA 4FMTA 3FT5A 4L93A 2WI3A 4H81A 1AJ6A 2XDSA 4URMA 3EKRA 3RLRA 4XIQA 4CWSA 4KSHA 4O07A 4GT8A 1TC0A 1UYCA 4GFNA 3TZ4A 2XJGA 3OWBA 2BTZA 1OSFA 3K99A 5M4MA 4ASAA 4XCJA 2EXLA 2YKEA 4LWFA 2QFOA 1QZRA 4Q20A 4CWFA 4CWPA 2C2AA 1UYMA 5FNCA 4U7NA 3R4MA 4GEEA 2XX4A 4EGHA 3PEJA 4U93A 4PRVA 3T0HA 4GQTA 2ZDXA 3Q5KA 3R4NA 4AWPA 4NH7A 3HHUA 1MU5A 3JZ3A 2HG1A 2WEQA 1ZXNA 5GGZA 5C93A 1TC6A 5IN9A 3ZKBA 4BXIA 3ZM7A 5D7CA 4YKTA 2FWZA 3ZXQA 1UY6A 4BQJA 3ZXOA 5CPHA 4O04A 4B7PA 3G75A 1I5DA 4O09A 4P7AA 5CTXA 3WQ9A 2H55A 4ZKIA 1B63A 5CTYA 2YKCA 4HZ5A 1US7A 1ZXMA 3K98A 2FXSA 3HZ1A 4ZVIA 2Q8IA 3CRKA 3O2FA 3CGZA 1UYKA 2CCUA 4XTJA 4XDMA 3GIGB 4ASFA 1H7SA 4WUCA 2BU5A 1S14A 4I5SA 1YC4A 2YJXA 3VHCA 3T2SA 4DZYA 2VCJA 1Z5AA 2Q2EB 4EFTA 3H80A 3OWDA 2YGEA 1BKNA 4LP0A 1NHHA 1YT0A 3K97A 5D6PA 4XC0A 2WI6A 3MNRP 4HY6A 3T0ZA 3B27A 4UROA 3B24A 4E01A 4XKAA 1I5AA 1YC3A 1EA6A 4V25A 1QY8A 1UYLA 4XCLA 1Z5BA 3A0YA 3D36A 2YEEA 1L0OA 1UYHA 1S16A 3INWA 4FCRA 4KFGA 4XD8A 2ZBKB 3QTFA 1PVGA 2XD6A 2Q8HA 5BOCA 3TZ2A 2IOPA 1Z5CA 2YI0A 2BU2A 4BAEA 2YEIA 1ZW9A 5IDJA 2XHRA 3G7EA 3HYZA 4L8ZA 3RLQA 5CTWA 1NHJA 1YETA 4LWGA 4B6CA 4YKXA 4YKQA 1TH8A 3DGEA 2VCIA 3RLPA 4CE2A 1JM6A 4KSGA 4LWEA 4URLA 3INXA 2XCMA 2BU8A 1I58A 1Y8OA 2YK2A 1U2OA 2BU6A 1THNA 3CGYA 4YKRA 4MB9A 2Q8FA 4I3HA 1YSZA 2YECA 2O1UA 3RKZA 5M4KA 2BT0A 4MP7A 4PL9A 4CWTA 4E00A 3A0RA 3VHAA 4YKUA 4ASGA 4NH9A 2HKJA 4R3MA 1UYEA 4NH8A 2XX5A 2XK2A 4R1FA 2WI2A 2E0AA 3O6OA 1H7UA 1YT2A 1AM1A 4HY1A 2ZDYA 2K5BA 3EHFA 3VHDA 3U2KA 1AMWA 3A0XA 1UYFA 2VWCA 3GIGA 1AH8A 4L90A 3Q5JA 4MPNA 4O0BA 2BU7A 2UWDA 2CCSA 2H8MA 3R4PA 1YESA 1B3QA 4WUBA 4YKYA 3O0IA 2CH4A 2FWYA 4LPBA 3PEHA 3QDDA 1GKZA 1KZNA 5FWKA 2JJCA 1A4HA 1QYEA 2YEAA 2WI1A 1NHIA 2YE7A 2BRCA 2YEHA 3U67A 3FT8A 1UY8A 5CF0A 3EKOA 3EHHA 4GCZA 2WEPA 4V26A 3GIFA 4H7QA 1I5CA 2XABA 3IEDA 3GIEA 5M4NA 2GFDA 3B26A 2O1WA 1I5BA 4AWQA 4YKZA 3EHJA 3SL2A 2CG9A 3R4OA 1R62A 1UYGA 1YS3A 1YSRA 3K60A 4MPCA 4QPKA 4BIUA 3ZKDA 3LPSA 4GGLA 3B28A 2YK9A 1ID0A 1TILA 4BQGA 5FNDA 2YI6A 3D2RA 5L3JA 1Y8NA 4MP2A 3H4LA 4LWHA 1AH6A 3A0WA 4YKWA 1TBWA 2WI5A 4XKKA 5FNFA 3C11A 1U0ZA 1UYDA 4W7TA 2YEFA 3C0EA 1TIDA 3U2DA 3OW6A 4EGIA 2AKPA 5M4PA 5F3KA 4XITA 2YGFA 1I59A 3A0ZA 4LWIA 4ASBA 2CCTA 3HYYA 2BYIA 4URNA 4CE1A 4AS9A 1BXDA 2YI7A 4PU9A 4U7OA 5M4HA 5D6QA 2IWXA 5F5RA 2IORA 3LNUA 4EGKA 1BYQA 4HXWA 2XHXA 4XE2A 2YKBA 5IDMA 2BREA 3BM9A 5D7RA 2IOQA 2QG0A 3HEKA 4EEHA 5CTUA 3B25A 2XX2A 4MPEA 2YE3A 1GJVA 4L91A 3WHAA 3TUHA 4R3AA 4XIRA 4AWOA 2GQPA 3TZ5A 1YERA 4XKOA 5J6AA 2YEGA 4JAUA 4X9LA 3A0TA 4FCPA 4CWOA 2YEJA 4CWNA 1Z59A 2XJJA 3NMQA 4DUHA 1UYIA 4E02A 2O1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XDL A;  2FYP A;  2XDK A;  3BMY A;  3VAD A;  4CWR A;  3HZ5 A;  3EHG A;  1EI1 A;  1BGQ A;  2BZ5 A;  4WUD A;  2XJX A;  2WI4 A;  3TZ0 A;  2QF6 A;  1B62 A;  4KTN A;  1ZWH A;  1Y8P A;  4HZ0 A;  4EMV A;  3Q5L A;  2YKI A;  3R92 A;  4CWQ A;  3KE6 A;  3OPD A;  4HXZ A;  4PRX A;  4EFU A;  2WI7 A;  2YE5 A;  4JQL A;  2XHT A;  1Y4S A;  3CWV A;  4JAS A;  2ESA A;  2YE4 A;  3G7B A;  2JKI A;  2Q8G A;  1UY7 A;  3T10 A;  2YGA A;  3TTZ A;  5M4E A;  4CE3 A;  1GKX A;  4MBC A;  3CRL A;  3FV5 A;  4K4O A;  2YJW A;  2YE2 A;  2YE9 A;  2YED A;  2XDX A;  2BSM A;  4KP4 A;  4P8O A;  4JAV A;  4BIZ A;  4L94 A;  5J71 A;  3OMU A;  2WER A;  2YEB A;  2YE8 A;  2IWS A;  4H85 A;  2QG2 A;  4EM7 A;  1KIJ A;  4XIP A;  1UY9 A;  1MX0 A;  4KQV A;  1Y4U A;  1YC1 A;  2YKJ A;  2ZKJ A;  3R91 A;  5D7D A;  2HCH A;  4MOT A;  4FCQ A;  3T1K A;  2IWU A;  5BOD A;  4HYP A;  2PNR A;  4HYM A;  2YI5 A;  2YE6 A;  2XDU A;  3D0B A;  4O05 A;  1YT1 A;  2VW5 A;  2BYH A;  4FPP A;  4QPJ A;  2CGF A;  4FMT A;  3FT5 A;  4L93 A;  2WI3 A;  4H81 A;  1AJ6 A;  2XDS A;  4URM A;  3EKR A;  3RLR A;  4XIQ A;  4CWS A;  4KSH A;  4O07 A;  4GT8 A;  1TC0 A;  1UYC A;  4GFN A;  3TZ4 A;  2XJG A;  3OWB A;  2BTZ A;  1OSF A;  3K99 A;  5M4M A;  4ASA A;  4XCJ A;  2EXL A;  2YKE A;  4LWF A;  2QFO A;  1QZR A;  4Q20 A;  4CWF A;  4CWP A;  2C2A A;  1UYM A;  5FNC A;  4U7N A;  3R4M A;  4GEE A;  2XX4 A;  4EGH A;  3PEJ A;  4U93 A;  4PRV A;  3T0H A;  4GQT A;  2ZDX A;  3Q5K A;  3R4N A;  4AWP A;  4NH7 A;  3HHU A;  1MU5 A;  3JZ3 A;  2HG1 A;  2WEQ A;  1ZXN A;  5GGZ A;  5C93 A;  1TC6 A;  5IN9 A;  3ZKB A;  4BXI A;  3ZM7 A;  5D7C A;  4YKT A;  2FWZ A;  3ZXQ A;  1UY6 A;  4BQJ A;  3ZXO A;  5CPH A;  4O04 A;  4B7P A;  3G75 A;  1I5D A;  4O09 A;  4P7A A;  5CTX A;  3WQ9 A;  2H55 A;  4ZKI A;  1B63 A;  5CTY A;  2YKC A;  4HZ5 A;  1US7 A;  1ZXM A;  3K98 A;  2FXS A;  3HZ1 A;  4ZVI A;  2Q8I A;  3CRK A;  3O2F A;  3CGZ A;  1UYK A;  2CCU A;  4XTJ A;  4XDM A;  3GIG B;  4ASF A;  1H7S A;  4WUC A;  2BU5 A;  1S14 A;  4I5S A;  1YC4 A;  2YJX A;  3VHC A;  3T2S A;  4DZY A;  2VCJ A;  1Z5A A;  2Q2E B;  4EFT A;  3H80 A;  3OWD A;  2YGE A;  1BKN A;  4LP0 A;  1NHH A;  1YT0 A;  3K97 A;  5D6P A;  4XC0 A;  2WI6 A;  3MNR P;  4HY6 A;  3T0Z A;  3B27 A;  4URO A;  3B24 A;  4E01 A;  4XKA A;  1I5A A;  1YC3 A;  1EA6 A;  4V25 A;  1QY8 A;  1UYL A;  4XCL A;  1Z5B A;  3A0Y A;  3D36 A;  2YEE A;  1L0O A;  1UYH A;  1S16 A;  3INW A;  4FCR A;  4KFG A;  4XD8 A;  2ZBK B;  3QTF A;  1PVG A;  2XD6 A;  2Q8H A;  5BOC A;  3TZ2 A;  2IOP A;  1Z5C A;  2YI0 A;  2BU2 A;  4BAE A;  2YEI A;  1ZW9 A;  5IDJ A;  2XHR A;  3G7E A;  3HYZ A;  4L8Z A;  3RLQ A;  5CTW A;  1NHJ A;  1YET A;  4LWG A;  4B6C A;  4YKX A;  4YKQ A;  1TH8 A;  3DGE A;  2VCI A;  3RLP A;  4CE2 A;  1JM6 A;  4KSG A;  4LWE A;  4URL A;  3INX A;  2XCM A;  2BU8 A;  1I58 A;  1Y8O A;  2YK2 A;  1U2O A;  2BU6 A;  1THN A;  3CGY A;  4YKR A;  4MB9 A;  2Q8F A;  4I3H A;  1YSZ A;  2YEC A;  2O1U A;  3RKZ A;  5M4K A;  2BT0 A;  4MP7 A;  4PL9 A;  4CWT A;  4E00 A;  3A0R A;  3VHA A;  4YKU A;  4ASG A;  4NH9 A;  2HKJ A;  4R3M A;  1UYE A;  4NH8 A;  2XX5 A;  2XK2 A;  4R1F A;  2WI2 A;  2E0A A;  3O6O A;  1H7U A;  1YT2 A;  1AM1 A;  4HY1 A;  2ZDY A;  2K5B A;  3EHF A;  3VHD A;  3U2K A;  1AMW A;  3A0X A;  1UYF A;  2VWC A;  3GIG A;  1AH8 A;  4L90 A;  3Q5J A;  4MPN A;  4O0B A;  2BU7 A;  2UWD A;  2CCS A;  2H8M A;  3R4P A;  1YES A;  1B3Q A;  4WUB A;  4YKY A;  3O0I A;  2CH4 A;  2FWY A;  4LPB A;  3PEH A;  3QDD A;  1GKZ A;  1KZN A;  5FWK A;  2JJC A;  1A4H A;  1QYE A;  2YEA A;  2WI1 A;  1NHI A;  2YE7 A;  2BRC A;  2YEH A;  3U67 A;  3FT8 A;  1UY8 A;  5CF0 A;  3EKO A;  3EHH A;  4GCZ A;  2WEP A;  4V26 A;  3GIF A;  4H7Q A;  1I5C A;  2XAB A;  3IED A;  3GIE A;  5M4N A;  2GFD A;  3B26 A;  2O1W A;  1I5B A;  4AWQ A;  4YKZ A;  3EHJ A;  3SL2 A;  2CG9 A;  3R4O A;  1R62 A;  1UYG A;  1YS3 A;  1YSR A;  3K60 A;  4MPC A;  4QPK A;  4BIU A;  3ZKD A;  3LPS A;  4GGL A;  3B28 A;  2YK9 A;  1ID0 A;  1TIL A;  4BQG A;  5FND A;  2YI6 A;  3D2R A;  5L3J A;  1Y8N A;  4MP2 A;  3H4L A;  4LWH A;  1AH6 A;  3A0W A;  4YKW A;  1TBW A;  2WI5 A;  4XKK A;  5FNF A;  3C11 A;  1U0Z A;  1UYD A;  4W7T A;  2YEF A;  3C0E A;  1TID A;  3U2D A;  3OW6 A;  4EGI A;  2AKP A;  5M4P A;  5F3K A;  4XIT A;  2YGF A;  1I59 A;  3A0Z A;  4LWI A;  4ASB A;  2CCT A;  3HYY A;  2BYI A;  4URN A;  4CE1 A;  4AS9 A;  1BXD A;  2YI7 A;  4PU9 A;  4U7O A;  5M4H A;  5D6Q A;  2IWX A;  5F5R A;  2IOR A;  3LNU A;  4EGK A;  1BYQ A;  4HXW A;  2XHX A;  4XE2 A;  2YKB A;  5IDM A;  2BRE A;  3BM9 A;  5D7R A;  2IOQ A;  2QG0 A;  3HEK A;  4EEH A;  5CTU A;  3B25 A;  2XX2 A;  4MPE A;  2YE3 A;  1GJV A;  4L91 A;  3WHA A;  3TUH A;  4R3A A;  4XIR A;  4AWO A;  2GQP A;  3TZ5 A;  1YER A;  4XKO A;  5J6A A;  2YEG A;  4JAU A;  4X9L A;  3A0T A;  4FCP A;  4CWO A;  2YEJ A;  4CWN A;  1Z59 A;  2XJJ A;  3NMQ A;  4DUH A;  1UYI A;  4E02 A;  2O1V A; 
#chains in the Genus database with same CATH topology
 2XDL A;  2FYP A;  2XDK A;  3BMY A;  3VAD A;  4CWR A;  3HZ5 A;  3EHG A;  1EI1 A;  1BGQ A;  2BZ5 A;  4WUD A;  2XJX A;  2WI4 A;  3TZ0 A;  2QF6 A;  1B62 A;  4KTN A;  1ZWH A;  1Y8P A;  4HZ0 A;  4EMV A;  3Q5L A;  2YKI A;  3R92 A;  4CWQ A;  3KE6 A;  3OPD A;  4HXZ A;  4PRX A;  4EFU A;  2WI7 A;  2YE5 A;  4JQL A;  2XHT A;  1Y4S A;  3CWV A;  4JAS A;  2ESA A;  2YE4 A;  3G7B A;  2JKI A;  2Q8G A;  1UY7 A;  3T10 A;  2YGA A;  3TTZ A;  5M4E A;  4CE3 A;  1GKX A;  4MBC A;  3CRL A;  3FV5 A;  4K4O A;  2YJW A;  2YE2 A;  2YE9 A;  2YED A;  2XDX A;  2BSM A;  4KP4 A;  4P8O A;  4JAV A;  4BIZ A;  4L94 A;  5J71 A;  3OMU A;  2WER A;  2YEB A;  2YE8 A;  2IWS A;  4H85 A;  2QG2 A;  4EM7 A;  1KIJ A;  4XIP A;  1UY9 A;  1MX0 A;  4KQV A;  1Y4U A;  1YC1 A;  2YKJ A;  2ZKJ A;  3R91 A;  5D7D A;  2HCH A;  4MOT A;  1IXM A;  4FCQ A;  3T1K A;  2IWU A;  2HHI A;  5BOD A;  4HYP A;  2PNR A;  4HYM A;  2YI5 A;  2YE6 A;  2XDU A;  3D0B A;  4O05 A;  1YT1 A;  2VW5 A;  2BYH A;  4FPP A;  4QPJ A;  2CGF A;  4FMT A;  3FT5 A;  4L93 A;  2WI3 A;  4H81 A;  1AJ6 A;  2XDS A;  4URM A;  3EKR A;  3RLR A;  4XIQ A;  4CWS A;  4KSH A;  4O07 A;  4GT8 A;  1TC0 A;  1UYC A;  4GFN A;  3TZ4 A;  2XJG A;  3OWB A;  2BTZ A;  1OSF A;  3K99 A;  5M4M A;  4ASA A;  4XCJ A;  2EXL A;  2YKE A;  4LWF A;  2QFO A;  1QZR A;  4Q20 A;  4CWF A;  4CWP A;  2C2A A;  1UYM A;  5FNC A;  4U7N A;  3R4M A;  4GEE A;  2XX4 A;  4EGH A;  3PEJ A;  4U93 A;  4PRV A;  3T0H A;  4GQT A;  2ZDX A;  3Q5K A;  3R4N A;  4AWP A;  4NH7 A;  3HHU A;  1MU5 A;  3JZ3 A;  2HG1 A;  2WEQ A;  1ZXN A;  5GGZ A;  5C93 A;  1TC6 A;  5IN9 A;  3ZKB A;  4BXI A;  3ZM7 A;  5D7C A;  4YKT A;  2FWZ A;  3ZXQ A;  1UY6 A;  4BQJ A;  3ZXO A;  5CPH A;  4O04 A;  4B7P A;  3G75 A;  3LMM A;  1I5D A;  4O09 A;  4P7A A;  5CTX A;  3WQ9 A;  2H55 A;  4ZKI A;  1B63 A;  5CTY A;  2YKC A;  2FTK A;  4HZ5 A;  1US7 A;  1ZXM A;  3K98 A;  4E72 A;  2FXS A;  3HZ1 A;  4ZVI A;  2Q8I A;  3CRK A;  3O2F A;  3CGZ A;  1UYK A;  2CCU A;  4XTJ A;  4XDM A;  3GIG B;  4ASF A;  1H7S A;  4WUC A;  2BU5 A;  1S14 A;  4I5S A;  2C1I A;  1YC4 A;  2YJX A;  3VHC A;  3T2S A;  4DZY A;  2VCJ A;  1Z5A A;  2Q2E B;  4EFT A;  3H80 A;  3OWD A;  2YGE A;  1BKN A;  4LP0 A;  1NHH A;  1YT0 A;  3K97 A;  5D6P A;  4XC0 A;  2WI6 A;  3MNR P;  4HY6 A;  3T0Z A;  3B27 A;  4URO A;  3B24 A;  4E01 A;  4XKA A;  1I5A A;  1YC3 A;  1EA6 A;  4V25 A;  1QY8 A;  1UYL A;  4XCL A;  1Z5B A;  3A0Y A;  3D36 A;  2YEE A;  1L0O A;  1UYH A;  1S16 A;  3INW A;  4FCR A;  4KFG A;  4XD8 A;  2ZBK B;  3QTF A;  1PVG A;  2XD6 A;  2Q8H A;  5BOC A;  3TZ2 A;  2IOP A;  1Z5C A;  2YI0 A;  2BU2 A;  4BAE A;  2YEI A;  1ZW9 A;  5IDJ A;  2XHR A;  3G7E A;  3HYZ A;  4L8Z A;  3RLQ A;  5CTW A;  1NHJ A;  1YET A;  4LWG A;  4B6C A;  4YKX A;  4YKQ A;  1TH8 A;  3DGE A;  2VCI A;  3RLP A;  4CE2 A;  1JM6 A;  4KSG A;  4LWE A;  4URL A;  3INX A;  2XCM A;  1F51 A;  2BU8 A;  1I58 A;  1Y8O A;  2YK2 A;  1U2O A;  2BU6 A;  1THN A;  3CGY A;  4YKR A;  4MB9 A;  2Q8F A;  4I3H A;  1YSZ A;  2YEC A;  2O1U A;  3RKZ A;  5M4K A;  2BT0 A;  4MP7 A;  4PL9 A;  4CWT A;  4E00 A;  3A0R A;  3VHA A;  4YKU A;  4ASG A;  4NH9 A;  2HKJ A;  4R3M A;  1UYE A;  4NH8 A;  2XX5 A;  2XK2 A;  4R1F A;  2WI2 A;  2E0A A;  3O6O A;  1H7U A;  1YT2 A;  1AM1 A;  4HY1 A;  2ZDY A;  2K5B A;  3EHF A;  3VHD A;  3U2K A;  5JEN A;  1AMW A;  3A0X A;  1UYF A;  2VWC A;  3GIG A;  1AH8 A;  4L90 A;  3Q5J A;  4MPN A;  4O0B A;  2BU7 A;  2UWD A;  2CCS A;  2H8M A;  3R4P A;  1YES A;  1B3Q A;  4WUB A;  4YKY A;  3O0I A;  2CH4 A;  2FWY A;  4LPB A;  3PEH A;  3QDD A;  1GKZ A;  1KZN A;  5FWK A;  2JJC A;  1A4H A;  1QYE A;  2YEA A;  2WI1 A;  1NHI A;  2YE7 A;  2BRC A;  2YEH A;  3U67 A;  3FT8 A;  1UY8 A;  5CF0 A;  3EKO A;  3EHH A;  4GCZ A;  2WEP A;  4V26 A;  3GIF A;  4H7Q A;  1I5C A;  2XAB A;  3IED A;  3GIE A;  5M4N A;  2GFD A;  3B26 A;  2O1W A;  1I5B A;  4AWQ A;  4YKZ A;  3EHJ A;  3SL2 A;  2CG9 A;  3R4O A;  1R62 A;  1UYG A;  1YS3 A;  1YSR A;  3K60 A;  2C1G A;  4MPC A;  4QPK A;  4BIU A;  3ZKD A;  3LPS A;  4GGL A;  3B28 A;  2YK9 A;  1ID0 A;  1TIL A;  4BQG A;  5FND A;  2YI6 A;  3D2R A;  5L3J A;  1Y8N A;  4MP2 A;  3H4L A;  4LWH A;  1AH6 A;  3A0W A;  4YKW A;  1TBW A;  2WI5 A;  4XKK A;  3CYG A;  3C11 A;  5FNF A;  1U0Z A;  1UYD A;  4W7T A;  2YEF A;  3C0E A;  1TID A;  3U2D A;  3OW6 A;  4EGI A;  2AKP A;  5M4P A;  5F3K A;  4XIT A;  2YGF A;  1I59 A;  3A0Z A;  4LWI A;  4ASB A;  2CCT A;  3HYY A;  2BYI A;  4URN A;  4CE1 A;  4AS9 A;  1BXD A;  2YI7 A;  4PU9 A;  4U7O A;  5M4H A;  5D6Q A;  2IWX A;  5F5R A;  2IOR A;  3LNU A;  4EGK A;  1BYQ A;  4HXW A;  2XHX A;  4XE2 A;  2YKB A;  5IDM A;  2BRE A;  3BM9 A;  3S5T A;  5D7R A;  2IOQ A;  2QG0 A;  3HEK A;  4EEH A;  5CTU A;  3B25 A;  2XX2 A;  4MPE A;  2YE3 A;  1GJV A;  4L91 A;  3WHA A;  3TUH A;  4R3A A;  4XIR A;  4AWO A;  2GQP A;  3TZ5 A;  1YER A;  4XKO A;  5J6A A;  2YEG A;  4JAU A;  4X9L A;  3A0T A;  4FCP A;  4CWO A;  2YEJ A;  4CWN A;  1Z59 A;  2XJJ A;  3NMQ A;  4DUH A;  1UYI A;  4E02 A;  2O1V A; 
#chains in the Genus database with same CATH homology
 2XDL A;  2FYP A;  2XDK A;  3BMY A;  3VAD A;  4CWR A;  3HZ5 A;  3EHG A;  1EI1 A;  1BGQ A;  2BZ5 A;  4WUD A;  2XJX A;  2WI4 A;  3TZ0 A;  2QF6 A;  1B62 A;  4KTN A;  1ZWH A;  1Y8P A;  4HZ0 A;  4EMV A;  3Q5L A;  2YKI A;  3R92 A;  4CWQ A;  3KE6 A;  3OPD A;  4HXZ A;  4PRX A;  4EFU A;  2WI7 A;  2YE5 A;  4JQL A;  2XHT A;  1Y4S A;  3CWV A;  4JAS A;  2ESA A;  2YE4 A;  3G7B A;  2JKI A;  2Q8G A;  1UY7 A;  3T10 A;  2YGA A;  3TTZ A;  5M4E A;  4CE3 A;  1GKX A;  4MBC A;  3CRL A;  3FV5 A;  4K4O A;  2YJW A;  2YE2 A;  2YE9 A;  2YED A;  2XDX A;  2BSM A;  4KP4 A;  4P8O A;  4JAV A;  4BIZ A;  4L94 A;  5J71 A;  3OMU A;  2WER A;  2YEB A;  2YE8 A;  2IWS A;  4H85 A;  2QG2 A;  4EM7 A;  1KIJ A;  4XIP A;  1UY9 A;  1MX0 A;  4KQV A;  1Y4U A;  1YC1 A;  2YKJ A;  2ZKJ A;  3R91 A;  5D7D A;  2HCH A;  4MOT A;  4FCQ A;  3T1K A;  2IWU A;  5BOD A;  4HYP A;  2PNR A;  4HYM A;  2YI5 A;  2YE6 A;  2XDU A;  3D0B A;  4O05 A;  1YT1 A;  2VW5 A;  2BYH A;  4FPP A;  4QPJ A;  2CGF A;  4FMT A;  3FT5 A;  4L93 A;  2WI3 A;  4H81 A;  1AJ6 A;  2XDS A;  4URM A;  3EKR A;  3RLR A;  4XIQ A;  4CWS A;  4KSH A;  4O07 A;  4GT8 A;  1TC0 A;  1UYC A;  4GFN A;  3TZ4 A;  2XJG A;  3OWB A;  2BTZ A;  1OSF A;  3K99 A;  5M4M A;  4ASA A;  4XCJ A;  2EXL A;  2YKE A;  4LWF A;  2QFO A;  1QZR A;  4Q20 A;  4CWF A;  4CWP A;  2C2A A;  1UYM A;  5FNC A;  4U7N A;  3R4M A;  4GEE A;  2XX4 A;  4EGH A;  3PEJ A;  4U93 A;  4PRV A;  3T0H A;  4GQT A;  2ZDX A;  3Q5K A;  3R4N A;  4AWP A;  4NH7 A;  3HHU A;  1MU5 A;  3JZ3 A;  2HG1 A;  2WEQ A;  1ZXN A;  5GGZ A;  5C93 A;  1TC6 A;  5IN9 A;  3ZKB A;  4BXI A;  3ZM7 A;  5D7C A;  4YKT A;  2FWZ A;  3ZXQ A;  1UY6 A;  4BQJ A;  3ZXO A;  5CPH A;  4O04 A;  4B7P A;  3G75 A;  1I5D A;  4O09 A;  4P7A A;  5CTX A;  3WQ9 A;  2H55 A;  4ZKI A;  1B63 A;  5CTY A;  2YKC A;  4HZ5 A;  1US7 A;  1ZXM A;  3K98 A;  2FXS A;  3HZ1 A;  4ZVI A;  2Q8I A;  3CRK A;  3O2F A;  3CGZ A;  1UYK A;  2CCU A;  4XTJ A;  4XDM A;  3GIG B;  4ASF A;  1H7S A;  4WUC A;  2BU5 A;  1S14 A;  4I5S A;  1YC4 A;  2YJX A;  3VHC A;  3T2S A;  4DZY A;  2VCJ A;  1Z5A A;  2Q2E B;  4EFT A;  3H80 A;  3OWD A;  2YGE A;  1BKN A;  4LP0 A;  1NHH A;  1YT0 A;  3K97 A;  5D6P A;  4XC0 A;  2WI6 A;  3MNR P;  4HY6 A;  3T0Z A;  3B27 A;  4URO A;  3B24 A;  4E01 A;  4XKA A;  1I5A A;  1YC3 A;  1EA6 A;  4V25 A;  1QY8 A;  1UYL A;  4XCL A;  1Z5B A;  3A0Y A;  3D36 A;  2YEE A;  1L0O A;  1UYH A;  1S16 A;  3INW A;  4FCR A;  4KFG A;  4XD8 A;  2ZBK B;  3QTF A;  1PVG A;  2XD6 A;  2Q8H A;  5BOC A;  3TZ2 A;  2IOP A;  1Z5C A;  2YI0 A;  2BU2 A;  4BAE A;  2YEI A;  1ZW9 A;  5IDJ A;  2XHR A;  3G7E A;  3HYZ A;  4L8Z A;  3RLQ A;  5CTW A;  1NHJ A;  1YET A;  4LWG A;  4B6C A;  4YKX A;  4YKQ A;  1TH8 A;  3DGE A;  2VCI A;  3RLP A;  4CE2 A;  1JM6 A;  4KSG A;  4LWE A;  4URL A;  3INX A;  2XCM A;  2BU8 A;  1I58 A;  1Y8O A;  2YK2 A;  1U2O A;  2BU6 A;  1THN A;  3CGY A;  4YKR A;  4MB9 A;  2Q8F A;  4I3H A;  1YSZ A;  2YEC A;  2O1U A;  3RKZ A;  5M4K A;  2BT0 A;  4MP7 A;  4PL9 A;  4CWT A;  4E00 A;  3A0R A;  3VHA A;  4YKU A;  4ASG A;  4NH9 A;  2HKJ A;  4R3M A;  1UYE A;  4NH8 A;  2XX5 A;  2XK2 A;  4R1F A;  2WI2 A;  2E0A A;  3O6O A;  1H7U A;  1YT2 A;  1AM1 A;  4HY1 A;  2ZDY A;  2K5B A;  3EHF A;  3VHD A;  3U2K A;  1AMW A;  3A0X A;  1UYF A;  2VWC A;  3GIG A;  1AH8 A;  4L90 A;  3Q5J A;  4MPN A;  4O0B A;  2BU7 A;  2UWD A;  2CCS A;  2H8M A;  3R4P A;  1YES A;  1B3Q A;  4WUB A;  4YKY A;  3O0I A;  2CH4 A;  2FWY A;  4LPB A;  3PEH A;  3QDD A;  1GKZ A;  1KZN A;  5FWK A;  2JJC A;  1A4H A;  1QYE A;  2YEA A;  2WI1 A;  1NHI A;  2YE7 A;  2BRC A;  2YEH A;  3U67 A;  3FT8 A;  1UY8 A;  5CF0 A;  3EKO A;  3EHH A;  4GCZ A;  2WEP A;  4V26 A;  3GIF A;  4H7Q A;  1I5C A;  2XAB A;  3IED A;  3GIE A;  5M4N A;  2GFD A;  3B26 A;  2O1W A;  1I5B A;  4AWQ A;  4YKZ A;  3EHJ A;  3SL2 A;  2CG9 A;  3R4O A;  1R62 A;  1UYG A;  1YS3 A;  1YSR A;  3K60 A;  4MPC A;  4QPK A;  4BIU A;  3ZKD A;  3LPS A;  4GGL A;  3B28 A;  2YK9 A;  1ID0 A;  1TIL A;  4BQG A;  5FND A;  2YI6 A;  3D2R A;  5L3J A;  1Y8N A;  4MP2 A;  3H4L A;  4LWH A;  1AH6 A;  3A0W A;  4YKW A;  1TBW A;  2WI5 A;  4XKK A;  5FNF A;  3C11 A;  1U0Z A;  1UYD A;  4W7T A;  2YEF A;  3C0E A;  1TID A;  3U2D A;  3OW6 A;  4EGI A;  2AKP A;  5M4P A;  5F3K A;  4XIT A;  2YGF A;  1I59 A;  3A0Z A;  4LWI A;  4ASB A;  2CCT A;  3HYY A;  2BYI A;  4URN A;  4CE1 A;  4AS9 A;  1BXD A;  2YI7 A;  4PU9 A;  4U7O A;  5M4H A;  5D6Q A;  2IWX A;  5F5R A;  2IOR A;  3LNU A;  4EGK A;  1BYQ A;  4HXW A;  2XHX A;  4XE2 A;  2YKB A;  5IDM A;  2BRE A;  3BM9 A;  5D7R A;  2IOQ A;  2QG0 A;  3HEK A;  4EEH A;  5CTU A;  3B25 A;  2XX2 A;  4MPE A;  2YE3 A;  1GJV A;  4L91 A;  3WHA A;  3TUH A;  4R3A A;  4XIR A;  4AWO A;  2GQP A;  3TZ5 A;  1YER A;  4XKO A;  5J6A A;  2YEG A;  4JAU A;  4X9L A;  3A0T A;  4FCP A;  4CWO A;  2YEJ A;  4CWN A;  1Z59 A;  2XJJ A;  3NMQ A;  4DUH A;  1UYI A;  4E02 A;  2O1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...