3G7EA

Crystal structure of e. coli gyrase b co-complexed with prop-2-yn-1-yl {[5-(4-piperidin-1-yl-2-pyridin-3-yl-1,3-thiazol-5-yl)-1h-pyrazol-3-yl]methyl}carbamate inhibitor
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
203
structure length
203
Chain Sequence
b'GLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNSVSVQDDGRGIPTGIHPEEGVSAAEVIMTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSQKLELVIQREGKIHRQIYEHGVPQAPLAVTGETEKTGTMVRFWPSLETFTNVTEFEYEILAKRLRELSFLNSGVSIRLRDKRDGKEDHFH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA gyrase subunit B
publication title Discovery of pyrazolthiazoles as novel and potent inhibitors of bacterial gyrase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase/isomerase inhibitor
total genus 59
structure length 203
sequence length 203
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3g7eA00
4KSGA 2BU7A 3CWVA 2Q8FA 1QZRA 3ZXOA 2XD6A 2XK2A 1YC4A 5GGZA 2UWDA 3T10A 4QPKA 5IN9A 4HXZA 4LWGA 3T0ZA 2YEHA 3WHAA 3T1KA 3O6OA 2XJXA 2O1VA 1UYFA 2WI1A 4FMTA 4UROA 1YSZA 3H4LA 1UYCA 4L93A 4AS9A 1YERA 3RLPA 4HY1A 4MP2A 2CCTA 4EFUA 4O09A 2Q8GA 3Q5JA 4FPPA 2O1WA 4JASA 4MB9A 2QG2A 2WI2A 2YJWA 1UYEA 1YT1A 3QDDA 4I5SA 1UY9A 1AH8A 1Z59A 4GT8A 4L94A 2XHTA 4HXWA 1BKNA 4BIUA 1JM6A 4AWPA 5CTWA 2BSMA 3U2KA 4DUHA 3R4PA 2QG0A 1YETA 4FCRA 2XDUA 3A0TA 1ZW9A 2BU8A 4MPEA 3HHUA 2VCJA 3BMYA 4EFTA 3CRKA 3U2DA 4PU9A 3EHFA 2C2AA 5FNDA 4BIZA 1Z5CA 5F3KA 4XDMA 3TZ5A 1UYIA 4GGLA 5BODA 2YKCA 4XKOA 4I3HA 1B3QA 2GQPA 1I5AA 3INWA 2Q8HA 4KSHA 2ZDYA 4V26A 3ZKBA 2Q2EB 5M4KA 4B6CA 5J6AA 4B7PA 2CH4A 4XCLA 5IDMA 1TIDA 2YKIA 4HZ5A 1GKXA 2IWUA 4EGKA 1AJ6A 2HKJA 2JKIA 4YKTA 2QF6A 3PEHA 4CE3A 1Y8NA 3Q5LA 4O04A 5FNFA 1UY7A 3HYZA 1Y8PA 2XX5A 2IORA 4HY6A 5D7DA 3B26A 5D6PA 3VHDA 2VW5A 2H8MA 1UYGA 1NHHA 3A0XA 2WI6A 1A4HA 2XDXA 2YE5A 3C11A 4XCJA 1B63A 5M4NA 2IOPA 4WUBA 4YKYA 1H7UA 2XJJA 5CTXA 3GIGA 2FWZA 4YKRA 1UY6A 2HCHA 3B24A 1U0ZA 1YT2A 4ASGA 4YKWA 5FNCA 4E02A 4X9LA 4ZKIA 2WERA 2YE2A 3K98A 4MBCA 3T0HA 4V25A 4R3AA 3EKRA 1BXDA 2XHXA 2FXSA 3A0ZA 3RLRA 1I5BA 1L0OA 1TBWA 4XE2A 2CCSA 2AKPA 4CWQA 3EHGA 3FT5A 4LP0A 2YEBA 4NH9A 4U7OA 2XCMA 2HG1A 3TUHA 5L3JA 3C0EA 1AMWA 1B62A 1TC6A 3B28A 2YE6A 4WUCA 3VADA 1QYEA 1PVGA 4KFGA 1NHIA 1BYQA 4LWFA 3B25A 4CWOA 2YKEA 3BM9A 3R4NA 4CE2A 2YI5A 2BU5A 3A0RA 2WI5A 4JAVA 2YI0A 5FWKA 3GIEA 1US7A 2WI3A 3D36A 2BZ5A 1YESA 4ZVIA 2XDSA 1BGQA 4H7QA 5IDJA 3LPSA 4XITA 4YKXA 2ZKJA 2XX4A 4HYMA 3ZXQA 4CWFA 2WI4A 4CWSA 4MOTA 3OPDA 3R91A 2BYIA 4XKKA 2PNRA 1ZXMA 2CG9A 2YE7A 2YEJA 2BRCA 5M4EA 4U93A 2GFDA 3TTZA 3OW6A 4YKQA 4L8ZA 3OWBA 3VHAA 4HYPA 5D7CA 4XIQA 2WEQA 3K97A 1AM1A 4CWTA 2XHRA 2YEGA 4LPBA 1R62A 1TH8A 3FT8A 1U2OA 1Z5BA 3O0IA 4XTJA 4FCQA 1UYLA 3R4MA 2YE9A 2BT0A 1I58A 4JQLA 1KIJA 2YECA 4LWEA 4MPNA 4JAUA 3D0BA 3PEJA 4YKZA 3G7BA 4LWHA 3K99A 4GEEA 2IWXA 3EKOA 4XIPA 4U7NA 2IOQA 3A0YA 2YK9A 4BXIA 1UYKA 2YEIA 4H85A 1UYHA 1GJVA 3TZ2A 1I59A 2QFOA 2ZDXA 4BQJA 2K5BA 2YE4A 2XX2A 4CWPA 2BTZA 2YEEA 4URLA 3RLQA 1GKZA 2WEPA 1YS3A 4LWIA 4URNA 1S14A 1Y4UA 1YC1A 4KQVA 1I5CA 4H81A 1MX0A 2YGFA 2FWYA 4NH7A 5M4HA 4NH8A 1UYDA 3R92A 3G7EA 2Q8IA 2YI7A 4CE1A 2CCUA 1UYMA 2XABA 1ZWHA 3NMQA 2H55A 3T2SA 1S16A 3Q5KA 4WUDA 4ASBA 3OMUA 1YSRA 3WQ9A 5CPHA 4AWQA 5BOCA 4K4OA 3CGYA 3INXA 4BAEA 3GIGB 4QPJA 1Y4SA 4KTNA 3QTFA 4EM7A 3G75A 4FCPA 1KZNA 3FV5A 1NHJA 3ZM7A 1QY8A 2YEFA 3LNUA 4P8OA 4XD8A 4L90A 2VCIA 1UY8A 1TC0A 2XJGA 2YEDA 2EXLA 2WI7A 4EGIA 3EHJA 5CTUA 2YKJA 2BYHA 4CWNA 1MU5A 1TILA 1EA6A 3TZ4A 5C93A 3HZ1A 2ESAA 4ASAA 4XKAA 4YKUA 3VHCA 1EI1A 2CGFA 4W7TA 1Y8OA 1ID0A 4EEHA 3CGZA 2XDLA 4O05A 3U67A 2XDKA 4R1FA 5CF0A 1OSFA 1H7SA 4E00A 3EHHA 5CTYA 5D7RA 4ASFA 4O07A 3JZ3A 3H80A 5F5RA 2YEAA 2YK2A 4GCZA 3A0WA 1YT0A 2YGEA 4PL9A 1ZXNA 1Z5AA 4GFNA 4EMVA 2E0AA 3TZ0A 2YI6A 3K60A 2YE8A 4AWOA 5D6QA 3DGEA 3KE6A 4CWRA 2FYPA 3B27A 4KP4A 3ZKDA 4E01A 5M4MA 2O1UA 4MP7A 4XIRA 3HEKA 3RKZA 1YC3A 1I5DA 2YGAA 4P7AA 2JJCA 5J71A 3MNRP 4GQTA 2BREA 3OWDA 4HZ0A 4XC0A 2IWSA 4PRXA 4DZYA 2YJXA 2BU6A 3R4OA 4BQGA 3D2RA 3SL2A 4L91A 1AH6A 3HZ5A 2VWCA 3GIFA 3O2FA 4URMA 4PRVA 4R3MA 4MPCA 2YE3A 1THNA 3HYYA 4EGHA 3CRLA 2ZBKB 2BU2A 2YKBA 4Q20A 3IEDA 5M4PA 4O0BA
chains in the Genus database with same CATH superfamily
4KSGA 2BU7A 3CWVA 2Q8FA 1QZRA 3ZXOA 2XD6A 2XK2A 1YC4A 5GGZA 2UWDA 3T10A 4QPKA 5IN9A 4HXZA 4E72A 4LWGA 3T0ZA 2YEHA 3WHAA 3T1KA 3O6OA 2XJXA 2O1VA 1UYFA 2WI1A 4FMTA 4UROA 1YSZA 3H4LA 1UYCA 4L93A 4AS9A 1YERA 3RLPA 4HY1A 4MP2A 2CCTA 4EFUA 4O09A 2Q8GA 3Q5JA 4FPPA 2O1WA 4JASA 4MB9A 2QG2A 1F51A 2WI2A 2YJWA 1UYEA 1YT1A 3QDDA 4I5SA 1UY9A 1AH8A 1Z59A 4GT8A 4L94A 2XHTA 4HXWA 1BKNA 4BIUA 1JM6A 4AWPA 5CTWA 2BSMA 3U2KA 4DUHA 3R4PA 2QG0A 1YETA 4FCRA 2XDUA 3A0TA 1ZW9A 2BU8A 4MPEA 3HHUA 2VCJA 3BMYA 4EFTA 3CRKA 3U2DA 4PU9A 3EHFA 2C2AA 5FNDA 4BIZA 1Z5CA 5F3KA 4XDMA 3TZ5A 1UYIA 4GGLA 5BODA 2YKCA 4XKOA 4I3HA 1B3QA 2GQPA 1I5AA 3INWA 2Q8HA 4KSHA 2ZDYA 4V26A 3ZKBA 2Q2EB 5M4KA 4B6CA 5J6AA 4B7PA 2CH4A 4XCLA 5IDMA 1TIDA 2YKIA 4HZ5A 1GKXA 2IWUA 4EGKA 1AJ6A 2HKJA 2JKIA 4YKTA 2QF6A 3PEHA 4CE3A 1Y8NA 3Q5LA 4O04A 5FNFA 1UY7A 3HYZA 1Y8PA 2XX5A 2IORA 4HY6A 5D7DA 3B26A 5D6PA 3VHDA 2VW5A 2H8MA 1UYGA 1NHHA 3A0XA 2WI6A 1A4HA 2XDXA 2YE5A 3C11A 4XCJA 1B63A 5M4NA 2IOPA 4WUBA 4YKYA 1H7UA 2XJJA 5CTXA 3GIGA 2FWZA 4YKRA 1UY6A 2HCHA 3B24A 1U0ZA 1YT2A 4ASGA 4YKWA 5FNCA 4E02A 4X9LA 4ZKIA 2WERA 2YE2A 3K98A 4MBCA 3T0HA 4V25A 4R3AA 3EKRA 1BXDA 2XHXA 2FXSA 3A0ZA 3RLRA 1I5BA 1L0OA 1TBWA 4XE2A 2CCSA 2AKPA 4CWQA 3EHGA 3FT5A 4LP0A 2YEBA 4NH9A 4U7OA 2XCMA 2HG1A 3TUHA 5L3JA 3C0EA 1AMWA 1B62A 1TC6A 3B28A 2YE6A 4WUCA 3VADA 1QYEA 1PVGA 2C1IA 4KFGA 1NHIA 1BYQA 4LWFA 3B25A 4CWOA 2YKEA 3BM9A 3R4NA 4CE2A 2YI5A 2BU5A 3A0RA 2WI5A 4JAVA 2YI0A 5FWKA 3GIEA 1US7A 2WI3A 3D36A 2BZ5A 1YESA 4ZVIA 2XDSA 1BGQA 4H7QA 5IDJA 3LPSA 4XITA 4YKXA 2ZKJA 2XX4A 4HYMA 3ZXQA 4CWFA 2WI4A 4CWSA 4MOTA 3OPDA 3R91A 2BYIA 4XKKA 2PNRA 1ZXMA 2CG9A 2YE7A 2YEJA 2BRCA 5M4EA 4U93A 2GFDA 3TTZA 3OW6A 4YKQA 4L8ZA 2FTKA 3OWBA 3VHAA 4HYPA 5D7CA 4XIQA 2WEQA 3K97A 1AM1A 4CWTA 2XHRA 2YEGA 4LPBA 1R62A 1TH8A 3FT8A 1U2OA 1Z5BA 3O0IA 4XTJA 4FCQA 1UYLA 3R4MA 2YE9A 2BT0A 1IXMA 1I58A 4JQLA 1KIJA 2YECA 4LWEA 4MPNA 4JAUA 3D0BA 3PEJA 4YKZA 3G7BA 4LWHA 3K99A 4GEEA 2IWXA 3EKOA 4XIPA 2HHIA 4U7NA 2IOQA 3A0YA 2YK9A 4BXIA 1UYKA 2YEIA 4H85A 1UYHA 1GJVA 3TZ2A 1I59A 2QFOA 2ZDXA 4BQJA 2K5BA 2YE4A 2XX2A 4CWPA 2BTZA 2YEEA 4URLA 3RLQA 1GKZA 2WEPA 1YS3A 4LWIA 4URNA 1S14A 1Y4UA 1YC1A 4KQVA 1I5CA 4H81A 1MX0A 2YGFA 2FWYA 4NH7A 5M4HA 4NH8A 1UYDA 3R92A 3G7EA 2Q8IA 2YI7A 4CE1A 2CCUA 1UYMA 2XABA 1ZWHA 3NMQA 2H55A 3T2SA 1S16A 3Q5KA 4WUDA 4ASBA 3OMUA 1YSRA 3WQ9A 5CPHA 4AWQA 5BOCA 4K4OA 3CGYA 3INXA 4BAEA 3GIGB 4QPJA 1Y4SA 4KTNA 3QTFA 4EM7A 3G75A 4FCPA 3CYGA 1KZNA 3FV5A 1NHJA 3ZM7A 1QY8A 2YEFA 3LNUA 4P8OA 4XD8A 4L90A 2VCIA 1UY8A 1TC0A 2XJGA 2YEDA 2EXLA 2WI7A 4EGIA 3EHJA 5CTUA 2YKJA 2BYHA 4CWNA 1MU5A 1TILA 1EA6A 3TZ4A 5C93A 3HZ1A 2ESAA 4ASAA 4XKAA 4YKUA 3VHCA 1EI1A 2CGFA 4W7TA 1Y8OA 1ID0A 4EEHA 3CGZA 2XDLA 4O05A 3U67A 2XDKA 4R1FA 5CF0A 1OSFA 1H7SA 4E00A 3EHHA 5CTYA 3S5TA 5D7RA 4ASFA 4O07A 3JZ3A 3H80A 5F5RA 2YEAA 2YK2A 4GCZA 3A0WA 1YT0A 2YGEA 4PL9A 1ZXNA 1Z5AA 4GFNA 4EMVA 5JENA 2E0AA 3TZ0A 2YI6A 3K60A 2YE8A 4AWOA 5D6QA 3DGEA 3KE6A 4CWRA 2FYPA 3B27A 4KP4A 3ZKDA 4E01A 5M4MA 2O1UA 4MP7A 4XIRA 3HEKA 3LMMA 3RKZA 1YC3A 1I5DA 2YGAA 4P7AA 2JJCA 5J71A 3MNRP 4GQTA 2BREA 3OWDA 4HZ0A 4XC0A 2IWSA 4PRXA 4DZYA 2YJXA 2BU6A 3R4OA 4BQGA 3D2RA 3SL2A 4L91A 1AH6A 3HZ5A 2VWCA 3GIFA 3O2FA 2C1GA 4URMA 4PRVA 4R3MA 4MPCA 2YE3A 1THNA 3HYYA 4EGHA 3CRLA 2ZBKB 2BU2A 2YKBA 4Q20A 3IEDA 5M4PA 4O0BA
chains in the Genus database with same CATH topology
4KSGA 2BU7A 3CWVA 2Q8FA 1QZRA 3ZXOA 2XD6A 2XK2A 1YC4A 5GGZA 2UWDA 3T10A 4QPKA 5IN9A 4HXZA 4LWGA 3T0ZA 2YEHA 3WHAA 3T1KA 3O6OA 2XJXA 2O1VA 1UYFA 2WI1A 4FMTA 4UROA 1YSZA 3H4LA 1UYCA 4L93A 4AS9A 1YERA 3RLPA 4HY1A 4MP2A 2CCTA 4EFUA 4O09A 2Q8GA 3Q5JA 4FPPA 2O1WA 4JASA 4MB9A 2QG2A 2WI2A 2YJWA 1UYEA 1YT1A 3QDDA 4I5SA 1UY9A 1AH8A 1Z59A 4GT8A 4L94A 2XHTA 4HXWA 1BKNA 4BIUA 1JM6A 4AWPA 5CTWA 2BSMA 3U2KA 4DUHA 3R4PA 2QG0A 1YETA 4FCRA 2XDUA 3A0TA 1ZW9A 2BU8A 4MPEA 3HHUA 2VCJA 3BMYA 4EFTA 3CRKA 3U2DA 4PU9A 3EHFA 2C2AA 5FNDA 4BIZA 1Z5CA 5F3KA 4XDMA 3TZ5A 1UYIA 4GGLA 5BODA 2YKCA 4XKOA 4I3HA 1B3QA 2GQPA 1I5AA 3INWA 2Q8HA 4KSHA 2ZDYA 4V26A 3ZKBA 2Q2EB 5M4KA 4B6CA 5J6AA 4B7PA 2CH4A 4XCLA 5IDMA 1TIDA 2YKIA 4HZ5A 1GKXA 2IWUA 4EGKA 1AJ6A 2HKJA 2JKIA 4YKTA 2QF6A 3PEHA 4CE3A 1Y8NA 3Q5LA 4O04A 5FNFA 1UY7A 3HYZA 1Y8PA 2XX5A 2IORA 4HY6A 5D7DA 3B26A 5D6PA 3VHDA 2VW5A 2H8MA 1UYGA 1NHHA 3A0XA 2WI6A 1A4HA 2XDXA 2YE5A 3C11A 4XCJA 1B63A 5M4NA 2IOPA 4WUBA 4YKYA 1H7UA 2XJJA 5CTXA 3GIGA 2FWZA 4YKRA 1UY6A 2HCHA 3B24A 1U0ZA 1YT2A 4ASGA 4YKWA 5FNCA 4E02A 4X9LA 4ZKIA 2WERA 2YE2A 3K98A 4MBCA 3T0HA 4V25A 4R3AA 3EKRA 1BXDA 2XHXA 2FXSA 3A0ZA 3RLRA 1I5BA 1L0OA 1TBWA 4XE2A 2CCSA 2AKPA 4CWQA 3EHGA 3FT5A 4LP0A 2YEBA 4NH9A 4U7OA 2XCMA 2HG1A 3TUHA 5L3JA 3C0EA 1AMWA 1B62A 1TC6A 3B28A 2YE6A 4WUCA 3VADA 1QYEA 1PVGA 4KFGA 1NHIA 1BYQA 4LWFA 3B25A 4CWOA 2YKEA 3BM9A 3R4NA 4CE2A 2YI5A 2BU5A 3A0RA 2WI5A 4JAVA 2YI0A 5FWKA 3GIEA 1US7A 2WI3A 3D36A 2BZ5A 1YESA 4ZVIA 2XDSA 1BGQA 4H7QA 5IDJA 3LPSA 4XITA 4YKXA 2ZKJA 2XX4A 4HYMA 3ZXQA 4CWFA 2WI4A 4CWSA 4MOTA 3OPDA 3R91A 2BYIA 4XKKA 2PNRA 1ZXMA 2CG9A 2YE7A 2YEJA 2BRCA 5M4EA 4U93A 2GFDA 3TTZA 3OW6A 4YKQA 4L8ZA 3OWBA 3VHAA 4HYPA 5D7CA 4XIQA 2WEQA 3K97A 1AM1A 4CWTA 2XHRA 2YEGA 4LPBA 1R62A 1TH8A 3FT8A 1U2OA 1Z5BA 3O0IA 4XTJA 4FCQA 1UYLA 3R4MA 2YE9A 2BT0A 1I58A 4JQLA 1KIJA 2YECA 4LWEA 4MPNA 4JAUA 3D0BA 3PEJA 4YKZA 3G7BA 4LWHA 3K99A 4GEEA 2IWXA 3EKOA 4XIPA 4U7NA 2IOQA 3A0YA 2YK9A 4BXIA 1UYKA 2YEIA 4H85A 1UYHA 1GJVA 3TZ2A 1I59A 2QFOA 2ZDXA 4BQJA 2K5BA 2YE4A 2XX2A 4CWPA 2BTZA 2YEEA 4URLA 3RLQA 1GKZA 2WEPA 1YS3A 4LWIA 4URNA 1S14A 1Y4UA 1YC1A 4KQVA 1I5CA 4H81A 1MX0A 2YGFA 2FWYA 4NH7A 5M4HA 4NH8A 1UYDA 3R92A 3G7EA 2Q8IA 2YI7A 4CE1A 2CCUA 1UYMA 2XABA 1ZWHA 3NMQA 2H55A 3T2SA 1S16A 3Q5KA 4WUDA 4ASBA 3OMUA 1YSRA 3WQ9A 5CPHA 4AWQA 5BOCA 4K4OA 3CGYA 3INXA 4BAEA 3GIGB 4QPJA 1Y4SA 4KTNA 3QTFA 4EM7A 3G75A 4FCPA 1KZNA 3FV5A 1NHJA 3ZM7A 1QY8A 2YEFA 3LNUA 4P8OA 4XD8A 4L90A 2VCIA 1UY8A 1TC0A 2XJGA 2YEDA 2EXLA 2WI7A 4EGIA 3EHJA 5CTUA 2YKJA 2BYHA 4CWNA 1MU5A 1TILA 1EA6A 3TZ4A 5C93A 3HZ1A 2ESAA 4ASAA 4XKAA 4YKUA 3VHCA 1EI1A 2CGFA 4W7TA 1Y8OA 1ID0A 4EEHA 3CGZA 2XDLA 4O05A 3U67A 2XDKA 4R1FA 5CF0A 1OSFA 1H7SA 4E00A 3EHHA 5CTYA 5D7RA 4ASFA 4O07A 3JZ3A 3H80A 5F5RA 2YEAA 2YK2A 4GCZA 3A0WA 1YT0A 2YGEA 4PL9A 1ZXNA 1Z5AA 4GFNA 4EMVA 2E0AA 3TZ0A 2YI6A 3K60A 2YE8A 4AWOA 5D6QA 3DGEA 3KE6A 4CWRA 2FYPA 3B27A 4KP4A 3ZKDA 4E01A 5M4MA 2O1UA 4MP7A 4XIRA 3HEKA 3RKZA 1YC3A 1I5DA 2YGAA 4P7AA 2JJCA 5J71A 3MNRP 4GQTA 2BREA 3OWDA 4HZ0A 4XC0A 2IWSA 4PRXA 4DZYA 2YJXA 2BU6A 3R4OA 4BQGA 3D2RA 3SL2A 4L91A 1AH6A 3HZ5A 2VWCA 3GIFA 3O2FA 4URMA 4PRVA 4R3MA 4MPCA 2YE3A 1THNA 3HYYA 4EGHA 3CRLA 2ZBKB 2BU2A 2YKBA 4Q20A 3IEDA 5M4PA 4O0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KSG A;  2BU7 A;  3CWV A;  2Q8F A;  1QZR A;  3ZXO A;  2XD6 A;  2XK2 A;  1YC4 A;  5GGZ A;  2UWD A;  3T10 A;  4QPK A;  5IN9 A;  4HXZ A;  4LWG A;  3T0Z A;  2YEH A;  3WHA A;  3T1K A;  3O6O A;  2XJX A;  2O1V A;  1UYF A;  2WI1 A;  4FMT A;  4URO A;  1YSZ A;  3H4L A;  1UYC A;  4L93 A;  4AS9 A;  1YER A;  3RLP A;  4HY1 A;  4MP2 A;  2CCT A;  4EFU A;  4O09 A;  2Q8G A;  3Q5J A;  4FPP A;  2O1W A;  4JAS A;  4MB9 A;  2QG2 A;  2WI2 A;  2YJW A;  1UYE A;  1YT1 A;  3QDD A;  4I5S A;  1UY9 A;  1AH8 A;  1Z59 A;  4GT8 A;  4L94 A;  2XHT A;  4HXW A;  1BKN A;  4BIU A;  1JM6 A;  4AWP A;  5CTW A;  2BSM A;  3U2K A;  4DUH A;  3R4P A;  2QG0 A;  1YET A;  4FCR A;  2XDU A;  3A0T A;  1ZW9 A;  2BU8 A;  4MPE A;  3HHU A;  2VCJ A;  3BMY A;  4EFT A;  3CRK A;  3U2D A;  4PU9 A;  3EHF A;  2C2A A;  5FND A;  4BIZ A;  1Z5C A;  5F3K A;  4XDM A;  3TZ5 A;  1UYI A;  4GGL A;  5BOD A;  2YKC A;  4XKO A;  4I3H A;  1B3Q A;  2GQP A;  1I5A A;  3INW A;  2Q8H A;  4KSH A;  2ZDY A;  4V26 A;  3ZKB A;  2Q2E B;  5M4K A;  4B6C A;  5J6A A;  4B7P A;  2CH4 A;  4XCL A;  5IDM A;  1TID A;  2YKI A;  4HZ5 A;  1GKX A;  2IWU A;  4EGK A;  1AJ6 A;  2HKJ A;  2JKI A;  4YKT A;  2QF6 A;  3PEH A;  4CE3 A;  1Y8N A;  3Q5L A;  4O04 A;  5FNF A;  1UY7 A;  3HYZ A;  1Y8P A;  2XX5 A;  2IOR A;  4HY6 A;  5D7D A;  3B26 A;  5D6P A;  3VHD A;  2VW5 A;  2H8M A;  1UYG A;  1NHH A;  3A0X A;  2WI6 A;  1A4H A;  2XDX A;  2YE5 A;  3C11 A;  4XCJ A;  1B63 A;  5M4N A;  2IOP A;  4WUB A;  4YKY A;  1H7U A;  2XJJ A;  5CTX A;  3GIG A;  2FWZ A;  4YKR A;  1UY6 A;  2HCH A;  3B24 A;  1U0Z A;  1YT2 A;  4ASG A;  4YKW A;  5FNC A;  4E02 A;  4X9L A;  4ZKI A;  2WER A;  2YE2 A;  3K98 A;  4MBC A;  3T0H A;  4V25 A;  4R3A A;  3EKR A;  1BXD A;  2XHX A;  2FXS A;  3A0Z A;  3RLR A;  1I5B A;  1L0O A;  1TBW A;  4XE2 A;  2CCS A;  2AKP A;  4CWQ A;  3EHG A;  3FT5 A;  4LP0 A;  2YEB A;  4NH9 A;  4U7O A;  2XCM A;  2HG1 A;  3TUH A;  5L3J A;  3C0E A;  1AMW A;  1B62 A;  1TC6 A;  3B28 A;  2YE6 A;  4WUC A;  3VAD A;  1QYE A;  1PVG A;  4KFG A;  1NHI A;  1BYQ A;  4LWF A;  3B25 A;  4CWO A;  2YKE A;  3BM9 A;  3R4N A;  4CE2 A;  2YI5 A;  2BU5 A;  3A0R A;  2WI5 A;  4JAV A;  2YI0 A;  5FWK A;  3GIE A;  1US7 A;  2WI3 A;  3D36 A;  2BZ5 A;  1YES A;  4ZVI A;  2XDS A;  1BGQ A;  4H7Q A;  5IDJ A;  3LPS A;  4XIT A;  4YKX A;  2ZKJ A;  2XX4 A;  4HYM A;  3ZXQ A;  4CWF A;  2WI4 A;  4CWS A;  4MOT A;  3OPD A;  3R91 A;  2BYI A;  4XKK A;  2PNR A;  1ZXM A;  2CG9 A;  2YE7 A;  2YEJ A;  2BRC A;  5M4E A;  4U93 A;  2GFD A;  3TTZ A;  3OW6 A;  4YKQ A;  4L8Z A;  3OWB A;  3VHA A;  4HYP A;  5D7C A;  4XIQ A;  2WEQ A;  3K97 A;  1AM1 A;  4CWT A;  2XHR A;  2YEG A;  4LPB A;  1R62 A;  1TH8 A;  3FT8 A;  1U2O A;  1Z5B A;  3O0I A;  4XTJ A;  4FCQ A;  1UYL A;  3R4M A;  2YE9 A;  2BT0 A;  1I58 A;  4JQL A;  1KIJ A;  2YEC A;  4LWE A;  4MPN A;  4JAU A;  3D0B A;  3PEJ A;  4YKZ A;  3G7B A;  4LWH A;  3K99 A;  4GEE A;  2IWX A;  3EKO A;  4XIP A;  4U7N A;  2IOQ A;  3A0Y A;  2YK9 A;  4BXI A;  1UYK A;  2YEI A;  4H85 A;  1UYH A;  1GJV A;  3TZ2 A;  1I59 A;  2QFO A;  2ZDX A;  4BQJ A;  2K5B A;  2YE4 A;  2XX2 A;  4CWP A;  2BTZ A;  2YEE A;  4URL A;  3RLQ A;  1GKZ A;  2WEP A;  1YS3 A;  4LWI A;  4URN A;  1S14 A;  1Y4U A;  1YC1 A;  4KQV A;  1I5C A;  4H81 A;  1MX0 A;  2YGF A;  2FWY A;  4NH7 A;  5M4H A;  4NH8 A;  1UYD A;  3R92 A;  3G7E A;  2Q8I A;  2YI7 A;  4CE1 A;  2CCU A;  1UYM A;  2XAB A;  1ZWH A;  3NMQ A;  2H55 A;  3T2S A;  1S16 A;  3Q5K A;  4WUD A;  4ASB A;  3OMU A;  1YSR A;  3WQ9 A;  5CPH A;  4AWQ A;  5BOC A;  4K4O A;  3CGY A;  3INX A;  4BAE A;  3GIG B;  4QPJ A;  1Y4S A;  4KTN A;  3QTF A;  4EM7 A;  3G75 A;  4FCP A;  1KZN A;  3FV5 A;  1NHJ A;  3ZM7 A;  1QY8 A;  2YEF A;  3LNU A;  4P8O A;  4XD8 A;  4L90 A;  2VCI A;  1UY8 A;  1TC0 A;  2XJG A;  2YED A;  2EXL A;  2WI7 A;  4EGI A;  3EHJ A;  5CTU A;  2YKJ A;  2BYH A;  4CWN A;  1MU5 A;  1TIL A;  1EA6 A;  3TZ4 A;  5C93 A;  3HZ1 A;  2ESA A;  4ASA A;  4XKA A;  4YKU A;  3VHC A;  1EI1 A;  2CGF A;  4W7T A;  1Y8O A;  1ID0 A;  4EEH A;  3CGZ A;  2XDL A;  4O05 A;  3U67 A;  2XDK A;  4R1F A;  5CF0 A;  1OSF A;  1H7S A;  4E00 A;  3EHH A;  5CTY A;  5D7R A;  4ASF A;  4O07 A;  3JZ3 A;  3H80 A;  5F5R A;  2YEA A;  2YK2 A;  4GCZ A;  3A0W A;  1YT0 A;  2YGE A;  4PL9 A;  1ZXN A;  1Z5A A;  4GFN A;  4EMV A;  2E0A A;  3TZ0 A;  2YI6 A;  3K60 A;  2YE8 A;  4AWO A;  5D6Q A;  3DGE A;  3KE6 A;  4CWR A;  2FYP A;  3B27 A;  4KP4 A;  3ZKD A;  4E01 A;  5M4M A;  2O1U A;  4MP7 A;  4XIR A;  3HEK A;  3RKZ A;  1YC3 A;  1I5D A;  2YGA A;  4P7A A;  2JJC A;  5J71 A;  3MNR P;  4GQT A;  2BRE A;  3OWD A;  4HZ0 A;  4XC0 A;  2IWS A;  4PRX A;  4DZY A;  2YJX A;  2BU6 A;  3R4O A;  4BQG A;  3D2R A;  3SL2 A;  4L91 A;  1AH6 A;  3HZ5 A;  2VWC A;  3GIF A;  3O2F A;  4URM A;  4PRV A;  4R3M A;  4MPC A;  2YE3 A;  1THN A;  3HYY A;  4EGH A;  3CRL A;  2ZBK B;  2BU2 A;  2YKB A;  4Q20 A;  3IED A;  5M4P A;  4O0B A; 
#chains in the Genus database with same CATH topology
 4KSG A;  2BU7 A;  3CWV A;  2Q8F A;  1QZR A;  3ZXO A;  2XD6 A;  2XK2 A;  1YC4 A;  5GGZ A;  2UWD A;  3T10 A;  4QPK A;  5IN9 A;  4HXZ A;  4E72 A;  4LWG A;  3T0Z A;  2YEH A;  3WHA A;  3T1K A;  3O6O A;  2XJX A;  2O1V A;  1UYF A;  2WI1 A;  4FMT A;  4URO A;  1YSZ A;  3H4L A;  1UYC A;  4L93 A;  4AS9 A;  1YER A;  3RLP A;  4HY1 A;  4MP2 A;  2CCT A;  4EFU A;  4O09 A;  2Q8G A;  3Q5J A;  4FPP A;  2O1W A;  4JAS A;  4MB9 A;  2QG2 A;  1F51 A;  2WI2 A;  2YJW A;  1UYE A;  1YT1 A;  3QDD A;  4I5S A;  1UY9 A;  1AH8 A;  1Z59 A;  4GT8 A;  4L94 A;  2XHT A;  4HXW A;  1BKN A;  4BIU A;  1JM6 A;  4AWP A;  5CTW A;  2BSM A;  3U2K A;  4DUH A;  3R4P A;  2QG0 A;  1YET A;  4FCR A;  2XDU A;  3A0T A;  1ZW9 A;  2BU8 A;  4MPE A;  3HHU A;  2VCJ A;  3BMY A;  4EFT A;  3CRK A;  3U2D A;  4PU9 A;  3EHF A;  2C2A A;  5FND A;  4BIZ A;  1Z5C A;  5F3K A;  4XDM A;  3TZ5 A;  1UYI A;  4GGL A;  5BOD A;  2YKC A;  4XKO A;  4I3H A;  1B3Q A;  2GQP A;  1I5A A;  3INW A;  2Q8H A;  4KSH A;  2ZDY A;  4V26 A;  3ZKB A;  2Q2E B;  5M4K A;  4B6C A;  5J6A A;  4B7P A;  2CH4 A;  4XCL A;  5IDM A;  1TID A;  2YKI A;  4HZ5 A;  1GKX A;  2IWU A;  4EGK A;  1AJ6 A;  2HKJ A;  2JKI A;  4YKT A;  2QF6 A;  3PEH A;  4CE3 A;  1Y8N A;  3Q5L A;  4O04 A;  5FNF A;  1UY7 A;  3HYZ A;  1Y8P A;  2XX5 A;  2IOR A;  4HY6 A;  5D7D A;  3B26 A;  5D6P A;  3VHD A;  2VW5 A;  2H8M A;  1UYG A;  1NHH A;  3A0X A;  2WI6 A;  1A4H A;  2XDX A;  2YE5 A;  3C11 A;  4XCJ A;  1B63 A;  5M4N A;  2IOP A;  4WUB A;  4YKY A;  1H7U A;  2XJJ A;  5CTX A;  3GIG A;  2FWZ A;  4YKR A;  1UY6 A;  2HCH A;  3B24 A;  1U0Z A;  1YT2 A;  4ASG A;  4YKW A;  5FNC A;  4E02 A;  4X9L A;  4ZKI A;  2WER A;  2YE2 A;  3K98 A;  4MBC A;  3T0H A;  4V25 A;  4R3A A;  3EKR A;  1BXD A;  2XHX A;  2FXS A;  3A0Z A;  3RLR A;  1I5B A;  1L0O A;  1TBW A;  4XE2 A;  2CCS A;  2AKP A;  4CWQ A;  3EHG A;  3FT5 A;  4LP0 A;  2YEB A;  4NH9 A;  4U7O A;  2XCM A;  2HG1 A;  3TUH A;  5L3J A;  3C0E A;  1AMW A;  1B62 A;  1TC6 A;  3B28 A;  2YE6 A;  4WUC A;  3VAD A;  1QYE A;  1PVG A;  2C1I A;  4KFG A;  1NHI A;  1BYQ A;  4LWF A;  3B25 A;  4CWO A;  2YKE A;  3BM9 A;  3R4N A;  4CE2 A;  2YI5 A;  2BU5 A;  3A0R A;  2WI5 A;  4JAV A;  2YI0 A;  5FWK A;  3GIE A;  1US7 A;  2WI3 A;  3D36 A;  2BZ5 A;  1YES A;  4ZVI A;  2XDS A;  1BGQ A;  4H7Q A;  5IDJ A;  3LPS A;  4XIT A;  4YKX A;  2ZKJ A;  2XX4 A;  4HYM A;  3ZXQ A;  4CWF A;  2WI4 A;  4CWS A;  4MOT A;  3OPD A;  3R91 A;  2BYI A;  4XKK A;  2PNR A;  1ZXM A;  2CG9 A;  2YE7 A;  2YEJ A;  2BRC A;  5M4E A;  4U93 A;  2GFD A;  3TTZ A;  3OW6 A;  4YKQ A;  4L8Z A;  2FTK A;  3OWB A;  3VHA A;  4HYP A;  5D7C A;  4XIQ A;  2WEQ A;  3K97 A;  1AM1 A;  4CWT A;  2XHR A;  2YEG A;  4LPB A;  1R62 A;  1TH8 A;  3FT8 A;  1U2O A;  1Z5B A;  3O0I A;  4XTJ A;  4FCQ A;  1UYL A;  3R4M A;  2YE9 A;  2BT0 A;  1IXM A;  1I58 A;  4JQL A;  1KIJ A;  2YEC A;  4LWE A;  4MPN A;  4JAU A;  3D0B A;  3PEJ A;  4YKZ A;  3G7B A;  4LWH A;  3K99 A;  4GEE A;  2IWX A;  3EKO A;  4XIP A;  2HHI A;  4U7N A;  2IOQ A;  3A0Y A;  2YK9 A;  4BXI A;  1UYK A;  2YEI A;  4H85 A;  1UYH A;  1GJV A;  3TZ2 A;  1I59 A;  2QFO A;  2ZDX A;  4BQJ A;  2K5B A;  2YE4 A;  2XX2 A;  4CWP A;  2BTZ A;  2YEE A;  4URL A;  3RLQ A;  1GKZ A;  2WEP A;  1YS3 A;  4LWI A;  4URN A;  1S14 A;  1Y4U A;  1YC1 A;  4KQV A;  1I5C A;  4H81 A;  1MX0 A;  2YGF A;  2FWY A;  4NH7 A;  5M4H A;  4NH8 A;  1UYD A;  3R92 A;  3G7E A;  2Q8I A;  2YI7 A;  4CE1 A;  2CCU A;  1UYM A;  2XAB A;  1ZWH A;  3NMQ A;  2H55 A;  3T2S A;  1S16 A;  3Q5K A;  4WUD A;  4ASB A;  3OMU A;  1YSR A;  3WQ9 A;  5CPH A;  4AWQ A;  5BOC A;  4K4O A;  3CGY A;  3INX A;  4BAE A;  3GIG B;  4QPJ A;  1Y4S A;  4KTN A;  3QTF A;  4EM7 A;  3G75 A;  4FCP A;  3CYG A;  1KZN A;  3FV5 A;  1NHJ A;  3ZM7 A;  1QY8 A;  2YEF A;  3LNU A;  4P8O A;  4XD8 A;  4L90 A;  2VCI A;  1UY8 A;  1TC0 A;  2XJG A;  2YED A;  2EXL A;  2WI7 A;  4EGI A;  3EHJ A;  5CTU A;  2YKJ A;  2BYH A;  4CWN A;  1MU5 A;  1TIL A;  1EA6 A;  3TZ4 A;  5C93 A;  3HZ1 A;  2ESA A;  4ASA A;  4XKA A;  4YKU A;  3VHC A;  1EI1 A;  2CGF A;  4W7T A;  1Y8O A;  1ID0 A;  4EEH A;  3CGZ A;  2XDL A;  4O05 A;  3U67 A;  2XDK A;  4R1F A;  5CF0 A;  1OSF A;  1H7S A;  4E00 A;  3EHH A;  5CTY A;  3S5T A;  5D7R A;  4ASF A;  4O07 A;  3JZ3 A;  3H80 A;  5F5R A;  2YEA A;  2YK2 A;  4GCZ A;  3A0W A;  1YT0 A;  2YGE A;  4PL9 A;  1ZXN A;  1Z5A A;  4GFN A;  4EMV A;  5JEN A;  2E0A A;  3TZ0 A;  2YI6 A;  3K60 A;  2YE8 A;  4AWO A;  5D6Q A;  3DGE A;  3KE6 A;  4CWR A;  2FYP A;  3B27 A;  4KP4 A;  3ZKD A;  4E01 A;  5M4M A;  2O1U A;  4MP7 A;  4XIR A;  3HEK A;  3LMM A;  3RKZ A;  1YC3 A;  1I5D A;  2YGA A;  4P7A A;  2JJC A;  5J71 A;  3MNR P;  4GQT A;  2BRE A;  3OWD A;  4HZ0 A;  4XC0 A;  2IWS A;  4PRX A;  4DZY A;  2YJX A;  2BU6 A;  3R4O A;  4BQG A;  3D2R A;  3SL2 A;  4L91 A;  1AH6 A;  3HZ5 A;  2VWC A;  3GIF A;  3O2F A;  2C1G A;  4URM A;  4PRV A;  4R3M A;  4MPC A;  2YE3 A;  1THN A;  3HYY A;  4EGH A;  3CRL A;  2ZBK B;  2BU2 A;  2YKB A;  4Q20 A;  3IED A;  5M4P A;  4O0B A; 
#chains in the Genus database with same CATH homology
 4KSG A;  2BU7 A;  3CWV A;  2Q8F A;  1QZR A;  3ZXO A;  2XD6 A;  2XK2 A;  1YC4 A;  5GGZ A;  2UWD A;  3T10 A;  4QPK A;  5IN9 A;  4HXZ A;  4LWG A;  3T0Z A;  2YEH A;  3WHA A;  3T1K A;  3O6O A;  2XJX A;  2O1V A;  1UYF A;  2WI1 A;  4FMT A;  4URO A;  1YSZ A;  3H4L A;  1UYC A;  4L93 A;  4AS9 A;  1YER A;  3RLP A;  4HY1 A;  4MP2 A;  2CCT A;  4EFU A;  4O09 A;  2Q8G A;  3Q5J A;  4FPP A;  2O1W A;  4JAS A;  4MB9 A;  2QG2 A;  2WI2 A;  2YJW A;  1UYE A;  1YT1 A;  3QDD A;  4I5S A;  1UY9 A;  1AH8 A;  1Z59 A;  4GT8 A;  4L94 A;  2XHT A;  4HXW A;  1BKN A;  4BIU A;  1JM6 A;  4AWP A;  5CTW A;  2BSM A;  3U2K A;  4DUH A;  3R4P A;  2QG0 A;  1YET A;  4FCR A;  2XDU A;  3A0T A;  1ZW9 A;  2BU8 A;  4MPE A;  3HHU A;  2VCJ A;  3BMY A;  4EFT A;  3CRK A;  3U2D A;  4PU9 A;  3EHF A;  2C2A A;  5FND A;  4BIZ A;  1Z5C A;  5F3K A;  4XDM A;  3TZ5 A;  1UYI A;  4GGL A;  5BOD A;  2YKC A;  4XKO A;  4I3H A;  1B3Q A;  2GQP A;  1I5A A;  3INW A;  2Q8H A;  4KSH A;  2ZDY A;  4V26 A;  3ZKB A;  2Q2E B;  5M4K A;  4B6C A;  5J6A A;  4B7P A;  2CH4 A;  4XCL A;  5IDM A;  1TID A;  2YKI A;  4HZ5 A;  1GKX A;  2IWU A;  4EGK A;  1AJ6 A;  2HKJ A;  2JKI A;  4YKT A;  2QF6 A;  3PEH A;  4CE3 A;  1Y8N A;  3Q5L A;  4O04 A;  5FNF A;  1UY7 A;  3HYZ A;  1Y8P A;  2XX5 A;  2IOR A;  4HY6 A;  5D7D A;  3B26 A;  5D6P A;  3VHD A;  2VW5 A;  2H8M A;  1UYG A;  1NHH A;  3A0X A;  2WI6 A;  1A4H A;  2XDX A;  2YE5 A;  3C11 A;  4XCJ A;  1B63 A;  5M4N A;  2IOP A;  4WUB A;  4YKY A;  1H7U A;  2XJJ A;  5CTX A;  3GIG A;  2FWZ A;  4YKR A;  1UY6 A;  2HCH A;  3B24 A;  1U0Z A;  1YT2 A;  4ASG A;  4YKW A;  5FNC A;  4E02 A;  4X9L A;  4ZKI A;  2WER A;  2YE2 A;  3K98 A;  4MBC A;  3T0H A;  4V25 A;  4R3A A;  3EKR A;  1BXD A;  2XHX A;  2FXS A;  3A0Z A;  3RLR A;  1I5B A;  1L0O A;  1TBW A;  4XE2 A;  2CCS A;  2AKP A;  4CWQ A;  3EHG A;  3FT5 A;  4LP0 A;  2YEB A;  4NH9 A;  4U7O A;  2XCM A;  2HG1 A;  3TUH A;  5L3J A;  3C0E A;  1AMW A;  1B62 A;  1TC6 A;  3B28 A;  2YE6 A;  4WUC A;  3VAD A;  1QYE A;  1PVG A;  4KFG A;  1NHI A;  1BYQ A;  4LWF A;  3B25 A;  4CWO A;  2YKE A;  3BM9 A;  3R4N A;  4CE2 A;  2YI5 A;  2BU5 A;  3A0R A;  2WI5 A;  4JAV A;  2YI0 A;  5FWK A;  3GIE A;  1US7 A;  2WI3 A;  3D36 A;  2BZ5 A;  1YES A;  4ZVI A;  2XDS A;  1BGQ A;  4H7Q A;  5IDJ A;  3LPS A;  4XIT A;  4YKX A;  2ZKJ A;  2XX4 A;  4HYM A;  3ZXQ A;  4CWF A;  2WI4 A;  4CWS A;  4MOT A;  3OPD A;  3R91 A;  2BYI A;  4XKK A;  2PNR A;  1ZXM A;  2CG9 A;  2YE7 A;  2YEJ A;  2BRC A;  5M4E A;  4U93 A;  2GFD A;  3TTZ A;  3OW6 A;  4YKQ A;  4L8Z A;  3OWB A;  3VHA A;  4HYP A;  5D7C A;  4XIQ A;  2WEQ A;  3K97 A;  1AM1 A;  4CWT A;  2XHR A;  2YEG A;  4LPB A;  1R62 A;  1TH8 A;  3FT8 A;  1U2O A;  1Z5B A;  3O0I A;  4XTJ A;  4FCQ A;  1UYL A;  3R4M A;  2YE9 A;  2BT0 A;  1I58 A;  4JQL A;  1KIJ A;  2YEC A;  4LWE A;  4MPN A;  4JAU A;  3D0B A;  3PEJ A;  4YKZ A;  3G7B A;  4LWH A;  3K99 A;  4GEE A;  2IWX A;  3EKO A;  4XIP A;  4U7N A;  2IOQ A;  3A0Y A;  2YK9 A;  4BXI A;  1UYK A;  2YEI A;  4H85 A;  1UYH A;  1GJV A;  3TZ2 A;  1I59 A;  2QFO A;  2ZDX A;  4BQJ A;  2K5B A;  2YE4 A;  2XX2 A;  4CWP A;  2BTZ A;  2YEE A;  4URL A;  3RLQ A;  1GKZ A;  2WEP A;  1YS3 A;  4LWI A;  4URN A;  1S14 A;  1Y4U A;  1YC1 A;  4KQV A;  1I5C A;  4H81 A;  1MX0 A;  2YGF A;  2FWY A;  4NH7 A;  5M4H A;  4NH8 A;  1UYD A;  3R92 A;  3G7E A;  2Q8I A;  2YI7 A;  4CE1 A;  2CCU A;  1UYM A;  2XAB A;  1ZWH A;  3NMQ A;  2H55 A;  3T2S A;  1S16 A;  3Q5K A;  4WUD A;  4ASB A;  3OMU A;  1YSR A;  3WQ9 A;  5CPH A;  4AWQ A;  5BOC A;  4K4O A;  3CGY A;  3INX A;  4BAE A;  3GIG B;  4QPJ A;  1Y4S A;  4KTN A;  3QTF A;  4EM7 A;  3G75 A;  4FCP A;  1KZN A;  3FV5 A;  1NHJ A;  3ZM7 A;  1QY8 A;  2YEF A;  3LNU A;  4P8O A;  4XD8 A;  4L90 A;  2VCI A;  1UY8 A;  1TC0 A;  2XJG A;  2YED A;  2EXL A;  2WI7 A;  4EGI A;  3EHJ A;  5CTU A;  2YKJ A;  2BYH A;  4CWN A;  1MU5 A;  1TIL A;  1EA6 A;  3TZ4 A;  5C93 A;  3HZ1 A;  2ESA A;  4ASA A;  4XKA A;  4YKU A;  3VHC A;  1EI1 A;  2CGF A;  4W7T A;  1Y8O A;  1ID0 A;  4EEH A;  3CGZ A;  2XDL A;  4O05 A;  3U67 A;  2XDK A;  4R1F A;  5CF0 A;  1OSF A;  1H7S A;  4E00 A;  3EHH A;  5CTY A;  5D7R A;  4ASF A;  4O07 A;  3JZ3 A;  3H80 A;  5F5R A;  2YEA A;  2YK2 A;  4GCZ A;  3A0W A;  1YT0 A;  2YGE A;  4PL9 A;  1ZXN A;  1Z5A A;  4GFN A;  4EMV A;  2E0A A;  3TZ0 A;  2YI6 A;  3K60 A;  2YE8 A;  4AWO A;  5D6Q A;  3DGE A;  3KE6 A;  4CWR A;  2FYP A;  3B27 A;  4KP4 A;  3ZKD A;  4E01 A;  5M4M A;  2O1U A;  4MP7 A;  4XIR A;  3HEK A;  3RKZ A;  1YC3 A;  1I5D A;  2YGA A;  4P7A A;  2JJC A;  5J71 A;  3MNR P;  4GQT A;  2BRE A;  3OWD A;  4HZ0 A;  4XC0 A;  2IWS A;  4PRX A;  4DZY A;  2YJX A;  2BU6 A;  3R4O A;  4BQG A;  3D2R A;  3SL2 A;  4L91 A;  1AH6 A;  3HZ5 A;  2VWC A;  3GIF A;  3O2F A;  4URM A;  4PRV A;  4R3M A;  4MPC A;  2YE3 A;  1THN A;  3HYY A;  4EGH A;  3CRL A;  2ZBK B;  2BU2 A;  2YKB A;  4Q20 A;  3IED A;  5M4P A;  4O0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...