3G7FL

Crystal structure of blastochloris viridis heterodimer mutant reaction center
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
273
structure length
273
Chain Sequence
ALLSFERKYRVRGGTLIGGDLFDFWVGPYFVGFFGVSAIFFIFLGVSLIGYAASQGPTWDPFAISINPPDLKYGLGAAPLLEGGFWQAITVCALGAFISWMLREVEISRKLGIGWHVPLAFCVPIFMFCVLQVFRPLLLGSWGHAFPYGILSHLDWVNNFGYQYLNWHYNPGHMSSVSFLFVNAMALGLHGGLILSVANPGDGDKVKTAEHENQYFRDVVGYSIGALSIHRLGLFLASNIFLTGAFGTIASGPFWTRGWPEWWGWWLDIPFWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and spectropotentiometric analysis of Blastochloris viridis heterodimer mutant reaction center
pubmed doi rcsb
molecule keywords Photosynthetic reaction center cytochrome c subunit
molecule tags Photosynthesis
total genus 104
structure length 273
sequence length 273
ec nomenclature
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00124 Photo_RC Photosynthetic reaction centre protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.85.10 Mainly Alpha Up-down Bundle Photosynthetic Reaction Center, subunit M; domain 1 Photosystem II protein D1-like 3g7fL01
1.20.85.10 Mainly Alpha Up-down Bundle Photosynthetic Reaction Center, subunit M; domain 1 Photosystem II protein D1-like 3g7fL02
1MPSM 3PRCM 3DTRL 3V3YM 1M3XL 1DV3L 2UXKM 4H99L 4IN5M 1JGXM 1L9JL 2UXJM 2HG3L 4IN6M 4RCRL 5LSEL 3I4DL 2GNUM 1RZHL 3ZUMM 1E6DM 2UX4L 2X5UL 1JH0L 1E14L 2WX5L 1DXRL 2UWUL 1RZZL 2HITL 2UXMM 1S00L 2J8CM 1DS8M 1PCRM 4HBHM 2UWSL 2BNPA 3DU2M 1YF6M 1RQKL 2JIYM 2UXLM 1F6NM 2BNSB 2J8DM 3T6EM 2BNPB 1RG5M 5PRCM 3V3ZM 2UWVL 3T6DM 1MPSL 2UXKL 4IN5L 2UXJL 1JGWL 2GNUL 4IN7M 4HBJM 3WMML 2I5NM 2HJ6M 2UX5M 1E6DL 2JBLM 4CASC 1K6LM 3DTAM 2J8CL 1DS8L 1AIGM 1VRNL 4HBHL 3DSYL 1YSTM 1RVJM 3DU2L 4H9LM 1PSTM 2UXLL 1F6NL 1JGYM 7PRCM 3DUQM 1RG5L 2JJ0L 5PRCL 3T6DL 1R2CM 4LWYM 1QOVM 3DTSM 3DU3M 2UWTM 2WJNM 1EYSL 4IN7L 2HHKM 2I5NL 2UX5L 1FNPL 1FNQM 2WJMM 1K6LL 3PRCL 3V3YL 1K6NM 1PSSM 2PRCM 2RCRM 1JGXL 1RGNM 3G7FM 4IN6L 1YSTL 1RVJL 1PSTL 1DV6M 2GMRM 2UX3M 3ZUML 1JGYL 7PRCL 1UMXM 3DUQL 2X5VM 1L9BM 5LRIM 1R2CL 4LWYL 2UXML 3DU3L 2UWTL 1PCRL 4N7KM 1YF6L 1M3XM 2JIYL 4H99M 1L9JM 4RCRM 2HG3M 2J8DL 1FNQL 3V3ZL 3T6EL 4N7LM 1RY5M 1RZHM 1K6NL 1PSSL 2RCRL 2UX4M 2X5UM 1JH0M 1E14M 1RGNL 2WX5M 2HITM 6PRCM 1S00M 4HBJL 1AIJM 1DV6L 1KBYM 1OGVM 2GMRL 2HJ6L 2JBLL 1PRCM 2HH1M 2UWSM 1L9BL 2X5VL 4TQQM 5LRIL 3DTAL 3D38M 1AIGL 2UWWM 2UWVM 1JGZM 4H9LL 1JGWM 2HG9M 4CASB 4N7LL 3ZUWM 3WMMM 1RY5L 1QOVL 3DTSL 2WJNL 2BOZM 6PRCL 3DTRM 2HHKL 1AIJL 1DV3M 1KBYL 1OGVL 1VRNM 4N7KL 1PRCL 3DSYM 2BNSA 2HH1L 2WJML 3I4DM 4TQQL 5LSEM 2PRCL 3D38L 2JJ0M 2UWWL 3G7FL 1DXRM 1JGZL 2UWUM 1RZZM 2UX3L 1EYSM 1UMXL 2HG9L 3ZUWL 1RQKM 1FNPM 2BOZL
chains in the Genus database with same CATH superfamily
1MPSM 3PRCM 3DTRL 3V3YM 1M3XL 1DV3L 2UXKM 4H99L 4IN5M 1JGXM 1L9JL 2UXJM 2HG3L 4IN6M 4RCRL 5LSEL 3I4DL 2GNUM 1RZHL 3ZUMM 1E6DM 2UX4L 2X5UL 1JH0L 1E14L 2WX5L 1DXRL 2UWUL 1RZZL 2HITL 2UXMM 1S00L 2J8CM 1DS8M 1PCRM 4HBHM 2UWSL 2BNPA 3DU2M 1YF6M 1RQKL 2JIYM 2UXLM 1F6NM 2BNSB 2J8DM 3T6EM 2BNPB 1RG5M 5PRCM 3V3ZM 2UWVL 3T6DM 1MPSL 3WRXC 2UXKL 4IN5L 2UXJL 1JGWL 2GNUL 4IN7M 4HBJM 3WMML 2I5NM 2HJ6M 2UX5M 1E6DL 2JBLM 4CASC 1K6LM 3DTAM 2J8CL 1DS8L 1AIGM 1VRNL 4HBHL 3DSYL 1YSTM 1RVJM 3DU2L 4H9LM 1PSTM 2UXLL 1F6NL 1JGYM 7PRCM 3DUQM 1RG5L 2JJ0L 5PRCL 3T6DL 1R2CM 4LWYM 1QOVM 3DTSM 3DU3M 2UWTM 2WJNM 1EYSL 4IN7L 2HHKM 2I5NL 2UX5L 1FNPL 1FNQM 2WJMM 1K6LL 3PRCL 3V3YL 1K6NM 1PSSM 2PRCM 2RCRM 1JGXL 1RGNM 3G7FM 4IN6L 1YSTL 1RVJL 1PSTL 1DV6M 2GMRM 2UX3M 3ZUML 1JGYL 7PRCL 1UMXM 3DUQL 2X5VM 1L9BM 5LRIM 1R2CL 4LWYL 2UXML 3DU3L 2UWTL 1PCRL 4N7KM 3VKWA 1YF6L 1M3XM 2JIYL 4H99M 1L9JM 4RCRM 2HG3M 2J8DL 1FNQL 3V3ZL 3T6EL 4N7LM 1RY5M 1RZHM 1K6NL 1PSSL 2RCRL 2UX4M 2X5UM 1JH0M 1E14M 1RGNL 2WX5M 2HITM 6PRCM 1S00M 4HBJL 3WRYC 1AIJM 1DV6L 1KBYM 1OGVM 2GMRL 2HJ6L 2JBLL 1PRCM 2HH1M 2UWSM 1L9BL 2X5VL 4TQQM 5LRIL 3DTAL 3D38M 1AIGL 2UWWM 2UWVM 1JGZM 4H9LL 1JGWM 2HG9M 4CASB 4N7LL 3ZUWM 3WMMM 1RY5L 1QOVL 3DTSL 2WJNL 2BOZM 6PRCL 3DTRM 2HHKL 1AIJL 1DV3M 1KBYL 1OGVL 1VRNM 4N7KL 1PRCL 3DSYM 2BNSA 2HH1L 2WJML 3I4DM 4TQQL 5LSEM 2PRCL 3D38L 2JJ0M 2UWWL 3G7FL 1DXRM 1JGZL 2UWUM 1RZZM 2UX3L 1EYSM 1UMXL 2HG9L 3ZUWL 1RQKM 1FNPM 2BOZL
chains in the Genus database with same CATH topology
1MPSM 3PRCM 3DTRL 3V3YM 1M3XL 1DV3L 2UXKM 4H99L 4IN5M 1JGXM 1L9JL 2UXJM 2HG3L 4IN6M 4RCRL 5LSEL 3I4DL 2GNUM 1RZHL 3ZUMM 1E6DM 2UX4L 2X5UL 1JH0L 1E14L 2WX5L 1DXRL 2UWUL 1RZZL 2HITL 2UXMM 1S00L 2J8CM 1DS8M 1PCRM 4HBHM 2UWSL 2BNPA 3DU2M 1YF6M 1RQKL 2JIYM 2UXLM 1F6NM 2BNSB 2J8DM 3T6EM 2BNPB 1RG5M 5PRCM 3V3ZM 2UWVL 3T6DM 1MPSL 2UXKL 4IN5L 2UXJL 1JGWL 2GNUL 4IN7M 4HBJM 3WMML 2I5NM 2HJ6M 2UX5M 1E6DL 2JBLM 4CASC 1K6LM 3DTAM 2J8CL 1DS8L 1AIGM 1VRNL 4HBHL 3DSYL 1YSTM 1RVJM 3DU2L 4H9LM 1PSTM 2UXLL 1F6NL 1JGYM 7PRCM 3DUQM 1RG5L 2JJ0L 5PRCL 3T6DL 1R2CM 4LWYM 1QOVM 3DTSM 3DU3M 2UWTM 2WJNM 1EYSL 4IN7L 2HHKM 2I5NL 2UX5L 1FNPL 1FNQM 2WJMM 1K6LL 3PRCL 3V3YL 1K6NM 1PSSM 2PRCM 2RCRM 1JGXL 1RGNM 3G7FM 4IN6L 1YSTL 1RVJL 1PSTL 1DV6M 2GMRM 2UX3M 3ZUML 1JGYL 7PRCL 1UMXM 3DUQL 2X5VM 1L9BM 5LRIM 1R2CL 4LWYL 2UXML 3DU3L 2UWTL 1PCRL 4N7KM 1YF6L 1M3XM 2JIYL 4H99M 1L9JM 4RCRM 2HG3M 2J8DL 1FNQL 3V3ZL 3T6EL 4N7LM 1RY5M 1RZHM 1K6NL 1PSSL 2RCRL 2UX4M 2X5UM 1JH0M 1E14M 1RGNL 2WX5M 2HITM 6PRCM 1S00M 4HBJL 1AIJM 1DV6L 1KBYM 1OGVM 2GMRL 2HJ6L 2JBLL 1PRCM 2HH1M 2UWSM 1L9BL 2X5VL 4TQQM 5LRIL 3DTAL 3D38M 1AIGL 2UWWM 2UWVM 1JGZM 4H9LL 1JGWM 2HG9M 4CASB 4N7LL 3ZUWM 3WMMM 1RY5L 1QOVL 3DTSL 2WJNL 2BOZM 6PRCL 3DTRM 2HHKL 1AIJL 1DV3M 1KBYL 1OGVL 1VRNM 4N7KL 1PRCL 3DSYM 2BNSA 2HH1L 2WJML 3I4DM 4TQQL 5LSEM 2PRCL 3D38L 2JJ0M 2UWWL 3G7FL 1DXRM 1JGZL 2UWUM 1RZZM 2UX3L 1EYSM 1UMXL 2HG9L 3ZUWL 1RQKM 1FNPM 2BOZL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MPS M;  3PRC M;  3DTR L;  3V3Y M;  1M3X L;  1DV3 L;  2UXK M;  4H99 L;  4IN5 M;  1JGX M;  1L9J L;  2UXJ M;  2HG3 L;  4IN6 M;  4RCR L;  5LSE L;  3I4D L;  2GNU M;  1RZH L;  3ZUM M;  1E6D M;  2UX4 L;  2X5U L;  1JH0 L;  1E14 L;  2WX5 L;  1DXR L;  2UWU L;  1RZZ L;  2HIT L;  2UXM M;  1S00 L;  2J8C M;  1DS8 M;  1PCR M;  4HBH M;  2UWS L;  2BNP A;  3DU2 M;  1YF6 M;  1RQK L;  2JIY M;  2UXL M;  1F6N M;  2BNS B;  2J8D M;  3T6E M;  2BNP B;  1RG5 M;  5PRC M;  3V3Z M;  2UWV L;  3T6D M;  1MPS L;  2UXK L;  4IN5 L;  2UXJ L;  1JGW L;  2GNU L;  4IN7 M;  4HBJ M;  3WMM L;  2I5N M;  2HJ6 M;  2UX5 M;  1E6D L;  2JBL M;  4CAS C;  1K6L M;  3DTA M;  2J8C L;  1DS8 L;  1AIG M;  1VRN L;  4HBH L;  3DSY L;  1YST M;  1RVJ M;  3DU2 L;  4H9L M;  1PST M;  2UXL L;  1F6N L;  1JGY M;  7PRC M;  3DUQ M;  1RG5 L;  2JJ0 L;  5PRC L;  3T6D L;  1R2C M;  4LWY M;  1QOV M;  3DTS M;  3DU3 M;  2UWT M;  2WJN M;  1EYS L;  4IN7 L;  2HHK M;  2I5N L;  2UX5 L;  1FNP L;  1FNQ M;  2WJM M;  1K6L L;  3PRC L;  3V3Y L;  1K6N M;  1PSS M;  2PRC M;  2RCR M;  1JGX L;  1RGN M;  3G7F M;  4IN6 L;  1YST L;  1RVJ L;  1PST L;  1DV6 M;  2GMR M;  2UX3 M;  3ZUM L;  1JGY L;  7PRC L;  1UMX M;  3DUQ L;  2X5V M;  1L9B M;  5LRI M;  1R2C L;  4LWY L;  2UXM L;  3DU3 L;  2UWT L;  1PCR L;  4N7K M;  1YF6 L;  1M3X M;  2JIY L;  4H99 M;  1L9J M;  4RCR M;  2HG3 M;  2J8D L;  1FNQ L;  3V3Z L;  3T6E L;  4N7L M;  1RY5 M;  1RZH M;  1K6N L;  1PSS L;  2RCR L;  2UX4 M;  2X5U M;  1JH0 M;  1E14 M;  1RGN L;  2WX5 M;  2HIT M;  6PRC M;  1S00 M;  4HBJ L;  1AIJ M;  1DV6 L;  1KBY M;  1OGV M;  2GMR L;  2HJ6 L;  2JBL L;  1PRC M;  2HH1 M;  2UWS M;  1L9B L;  2X5V L;  4TQQ M;  5LRI L;  3DTA L;  3D38 M;  1AIG L;  2UWW M;  2UWV M;  1JGZ M;  4H9L L;  1JGW M;  2HG9 M;  4CAS B;  4N7L L;  3ZUW M;  3WMM M;  1RY5 L;  1QOV L;  3DTS L;  2WJN L;  2BOZ M;  6PRC L;  3DTR M;  2HHK L;  1AIJ L;  1DV3 M;  1KBY L;  1OGV L;  1VRN M;  4N7K L;  1PRC L;  3DSY M;  2BNS A;  2HH1 L;  2WJM L;  3I4D M;  4TQQ L;  5LSE M;  2PRC L;  3D38 L;  2JJ0 M;  2UWW L;  3G7F L;  1DXR M;  1JGZ L;  2UWU M;  1RZZ M;  2UX3 L;  1EYS M;  1UMX L;  2HG9 L;  3ZUW L;  1RQK M;  1FNP M;  2BOZ L; 
#chains in the Genus database with same CATH topology
 1MPS M;  3PRC M;  3DTR L;  3V3Y M;  1M3X L;  1DV3 L;  2UXK M;  4H99 L;  4IN5 M;  1JGX M;  1L9J L;  2UXJ M;  2HG3 L;  4IN6 M;  4RCR L;  5LSE L;  3I4D L;  2GNU M;  1RZH L;  3ZUM M;  1E6D M;  2UX4 L;  2X5U L;  1JH0 L;  1E14 L;  2WX5 L;  1DXR L;  2UWU L;  1RZZ L;  2HIT L;  2UXM M;  1S00 L;  2J8C M;  1DS8 M;  1PCR M;  4HBH M;  2UWS L;  2BNP A;  3DU2 M;  1YF6 M;  1RQK L;  2JIY M;  2UXL M;  1F6N M;  2BNS B;  2J8D M;  3T6E M;  2BNP B;  1RG5 M;  5PRC M;  3V3Z M;  2UWV L;  3T6D M;  1MPS L;  3WRX C;  2UXK L;  4IN5 L;  2UXJ L;  1JGW L;  2GNU L;  4IN7 M;  4HBJ M;  3WMM L;  2I5N M;  2HJ6 M;  2UX5 M;  1E6D L;  2JBL M;  4CAS C;  1K6L M;  3DTA M;  2J8C L;  1DS8 L;  1AIG M;  1VRN L;  4HBH L;  3DSY L;  1YST M;  1RVJ M;  3DU2 L;  4H9L M;  1PST M;  2UXL L;  1F6N L;  1JGY M;  7PRC M;  3DUQ M;  1RG5 L;  2JJ0 L;  5PRC L;  3T6D L;  1R2C M;  4LWY M;  1QOV M;  3DTS M;  3DU3 M;  2UWT M;  2WJN M;  1EYS L;  4IN7 L;  2HHK M;  2I5N L;  2UX5 L;  1FNP L;  1FNQ M;  2WJM M;  1K6L L;  3PRC L;  3V3Y L;  1K6N M;  1PSS M;  2PRC M;  2RCR M;  1JGX L;  1RGN M;  3G7F M;  4IN6 L;  1YST L;  1RVJ L;  1PST L;  1DV6 M;  2GMR M;  2UX3 M;  3ZUM L;  1JGY L;  7PRC L;  1UMX M;  3DUQ L;  2X5V M;  1L9B M;  5LRI M;  1R2C L;  4LWY L;  2UXM L;  3DU3 L;  2UWT L;  1PCR L;  4N7K M;  3VKW A;  1YF6 L;  1M3X M;  2JIY L;  4H99 M;  1L9J M;  4RCR M;  2HG3 M;  2J8D L;  1FNQ L;  3V3Z L;  3T6E L;  4N7L M;  1RY5 M;  1RZH M;  1K6N L;  1PSS L;  2RCR L;  2UX4 M;  2X5U M;  1JH0 M;  1E14 M;  1RGN L;  2WX5 M;  2HIT M;  6PRC M;  1S00 M;  4HBJ L;  3WRY C;  1AIJ M;  1DV6 L;  1KBY M;  1OGV M;  2GMR L;  2HJ6 L;  2JBL L;  1PRC M;  2HH1 M;  2UWS M;  1L9B L;  2X5V L;  4TQQ M;  5LRI L;  3DTA L;  3D38 M;  1AIG L;  2UWW M;  2UWV M;  1JGZ M;  4H9L L;  1JGW M;  2HG9 M;  4CAS B;  4N7L L;  3ZUW M;  3WMM M;  1RY5 L;  1QOV L;  3DTS L;  2WJN L;  2BOZ M;  6PRC L;  3DTR M;  2HHK L;  1AIJ L;  1DV3 M;  1KBY L;  1OGV L;  1VRN M;  4N7K L;  1PRC L;  3DSY M;  2BNS A;  2HH1 L;  2WJM L;  3I4D M;  4TQQ L;  5LSE M;  2PRC L;  3D38 L;  2JJ0 M;  2UWW L;  3G7F L;  1DXR M;  1JGZ L;  2UWU M;  1RZZ M;  2UX3 L;  1EYS M;  1UMX L;  2HG9 L;  3ZUW L;  1RQK M;  1FNP M;  2BOZ L; 
#chains in the Genus database with same CATH homology
 1MPS M;  3PRC M;  3DTR L;  3V3Y M;  1M3X L;  1DV3 L;  2UXK M;  4H99 L;  4IN5 M;  1JGX M;  1L9J L;  2UXJ M;  2HG3 L;  4IN6 M;  4RCR L;  5LSE L;  3I4D L;  2GNU M;  1RZH L;  3ZUM M;  1E6D M;  2UX4 L;  2X5U L;  1JH0 L;  1E14 L;  2WX5 L;  1DXR L;  2UWU L;  1RZZ L;  2HIT L;  2UXM M;  1S00 L;  2J8C M;  1DS8 M;  1PCR M;  4HBH M;  2UWS L;  2BNP A;  3DU2 M;  1YF6 M;  1RQK L;  2JIY M;  2UXL M;  1F6N M;  2BNS B;  2J8D M;  3T6E M;  2BNP B;  1RG5 M;  5PRC M;  3V3Z M;  2UWV L;  3T6D M;  1MPS L;  2UXK L;  4IN5 L;  2UXJ L;  1JGW L;  2GNU L;  4IN7 M;  4HBJ M;  3WMM L;  2I5N M;  2HJ6 M;  2UX5 M;  1E6D L;  2JBL M;  4CAS C;  1K6L M;  3DTA M;  2J8C L;  1DS8 L;  1AIG M;  1VRN L;  4HBH L;  3DSY L;  1YST M;  1RVJ M;  3DU2 L;  4H9L M;  1PST M;  2UXL L;  1F6N L;  1JGY M;  7PRC M;  3DUQ M;  1RG5 L;  2JJ0 L;  5PRC L;  3T6D L;  1R2C M;  4LWY M;  1QOV M;  3DTS M;  3DU3 M;  2UWT M;  2WJN M;  1EYS L;  4IN7 L;  2HHK M;  2I5N L;  2UX5 L;  1FNP L;  1FNQ M;  2WJM M;  1K6L L;  3PRC L;  3V3Y L;  1K6N M;  1PSS M;  2PRC M;  2RCR M;  1JGX L;  1RGN M;  3G7F M;  4IN6 L;  1YST L;  1RVJ L;  1PST L;  1DV6 M;  2GMR M;  2UX3 M;  3ZUM L;  1JGY L;  7PRC L;  1UMX M;  3DUQ L;  2X5V M;  1L9B M;  5LRI M;  1R2C L;  4LWY L;  2UXM L;  3DU3 L;  2UWT L;  1PCR L;  4N7K M;  1YF6 L;  1M3X M;  2JIY L;  4H99 M;  1L9J M;  4RCR M;  2HG3 M;  2J8D L;  1FNQ L;  3V3Z L;  3T6E L;  4N7L M;  1RY5 M;  1RZH M;  1K6N L;  1PSS L;  2RCR L;  2UX4 M;  2X5U M;  1JH0 M;  1E14 M;  1RGN L;  2WX5 M;  2HIT M;  6PRC M;  1S00 M;  4HBJ L;  1AIJ M;  1DV6 L;  1KBY M;  1OGV M;  2GMR L;  2HJ6 L;  2JBL L;  1PRC M;  2HH1 M;  2UWS M;  1L9B L;  2X5V L;  4TQQ M;  5LRI L;  3DTA L;  3D38 M;  1AIG L;  2UWW M;  2UWV M;  1JGZ M;  4H9L L;  1JGW M;  2HG9 M;  4CAS B;  4N7L L;  3ZUW M;  3WMM M;  1RY5 L;  1QOV L;  3DTS L;  2WJN L;  2BOZ M;  6PRC L;  3DTR M;  2HHK L;  1AIJ L;  1DV3 M;  1KBY L;  1OGV L;  1VRN M;  4N7K L;  1PRC L;  3DSY M;  2BNS A;  2HH1 L;  2WJM L;  3I4D M;  4TQQ L;  5LSE M;  2PRC L;  3D38 L;  2JJ0 M;  2UWW L;  3G7F L;  1DXR M;  1JGZ L;  2UWU M;  1RZZ M;  2UX3 L;  1EYS M;  1UMX L;  2HG9 L;  3ZUW L;  1RQK M;  1FNP M;  2BOZ L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...