3G7JA

Crystal structure of a genetically modified delta class gst (adgstd4-4) from anopheles dirus, y119e, in complex with s-hexyl glutathione
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
217
structure length
217
Chain Sequence
MDFYYLPGSAPCRAVQMTAAAVGVELNLKLTNLMAGEHMKPEFLKLNPQHCIPTLVDEDGFVLWESRAIQIYLVEKYGAHDADLAERLYPSDPRRRAVVHQRLFFDVAVLYQRFAEYYEPQIFGQKVPVGDPGRLRSMEQALEFLNTFLEGEQYVAGGDDPTIADLSILATIATYEVAGYDLRRYENVQRWYERTSAIVPGADKNVEGAKVFGRYFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural contributions of delta class glutathione transferase active-site residues to catalysis
pubmed doi rcsb
molecule keywords Glutathione transferase GST1-4
molecule tags Transferase
source organism Anopheles dirus
total genus 79
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3g7jA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3g7jA01
1M0UA 1WRYA 1V98A 2F8FA 2LQQA 2H19A 1B4PA 2OE3A 6GSVA 2VAFA 2FY6A 5ELAA 2LJKA 3RHCA 1MDKA 2H1DA 1GNEA 2CAIA 3UEMA 5COHA 2WS2A 4KSOA 1DE2A 2YN1A 1XW5A 1TI1A 1ZCPA 4RI6A 4Z7XA 3J7Yk 3O76A 1TP9A 4TR1A 1M99A 1NHYA 2MYGA 4DSQA 1KTEA 5IO2A 3UBLA 2XC2A 1EGRA 4O7HA 1TK8B 2H0GA 2C0DA 2FGXA 5ELGA 3UVTA 2MMOA 2GQLA 4MK3A 2H70A 5FT3A 2MMNA 1F37A 1Q4JA 2XBQA 2IWTA 3F0IA 2V1MA 3QFBC 4FO5A 4E8HA 1YF0A 5DCGA 4MH3A 1GTIA 4AF2A 5GZZB 2GSTA 2C3NA 1S3CA 3D5JA 1R5AA 1GSDA 2AB6A 1TDIA 6GSUA 3D4MA 3KMOA 3TCOA 4J56E 2JL4A 4FYCA 5DAKA 1Z6MA 4XIHA 2IMKA 3G7IA 1AAZA 4PUAA 4XS6A 2PU9C 2O8VB 3KH9A 2C1YA 2MMZA 4V1Ap 3HVSA 4LL4B 9GSSA 2WFCA 4EVMA 2VCTA 1GUKA 3HYPA 5CNWA 2FNOA 3DVWA 1MEKA 4BL7A 4IP6A 3RDWA 4NAXA 1SJZA 1ZYQB 1K0NA 3TKRA 2CT6A 1FB6A 2CAQA 2HRKB 1ABAA 3ERGA 1N2AA 2L4QA 3PR8A 1WOUA 2CQ9A 4OCFA 1A2LA 2N5BA 3GH9A 1TI3A 3G7YA 4OMVA 3UIWA 5DAKB 2GDRA 4IKHA 3VPQA 1UN2A 1MD3A 1SD8A 2H0HA 14GSA 3UARA 4FQUA 5ID2B 4OO4A 22GSA 4GF0A 1XW9A 3UAPA 1XVQA 2BMXA 2H30A 4RQXA 2DSAA 5CP1A 5DQYA 2IMEA 4NHWA 4MF6A 2NVLA 3GURA 4LMWA 3TB2A 1GTUA 4ML6A 3E9JB 2HSHA 1ERWA 2VOCA 2B5EA 5B8BA 3TKSA 2VM2A 4JR6A 4XHMA 4NV2A 1ACVA 1ST9A 5B6MA 3CTGA 4O5RA 3H8QA 2P0GA 4K6XA 3D0ZA 4F03A 3TJFA 2HSNB 3IXRA 1KBNA 1GSYA 1XPVA 2O89A 1RQMA 2HT9A 4OO5A 2KOKA 1WP0A 4GSTA 3C71A 1XCCA 4MPFA 2BTOT 2LRTA 1QK8A 4HDEA 10GSA 3QD9A 1LJRA 2B7KA 3H4KA 4OFNA 1A0FA 3HVVA 2F9SA 4IBPA 1Z5YE 1T8EB 2L5LA 16GSA 3D4TA 3TRQA 2VL2A 3DYRA 1XWAA 1SYXA 2HFDA 3HKRA 3ZVJA 5G5FA 3WGEA 4YAPA 2HRFA 1VGLA 3BJ5A 3H93A 5A4UA 1F6MC 5AN1A 4ZBBA 2VLVA 1TOFA 3FZ5A 2OE1A 4E8EA 3MAKA 4OWYA 5D93A 1O6JA 3Q18A 2L5OA 1AQXA 4GQFA 3EWLA 4PQHA 1IYIA 2HSYA 3HD5A 3PH9A 3P90A 1Y6EA 2GQMA 4MLYA 3TUEA 5B7CA 4IJ3A 4WXTA 2FWEA 2LSTA 3O6TA 2X64A 4PNGA 3KTBA 5G2ZA 5EL8A 2FA8A 2DJKA 3IA1A 5IMZA 1GUHA 3CTFA 4J2FA 3EMPA 3A2XA 1ML6A 1KEBA 5KN2A 4IGJA 1R26A 1ZZYA 3GKXA 1V40A 2P5RA 1JHBA 3ZZXA 2H1GA 2I1UA 1CQGA 2R37A 2YJ7A 2OBKA 4IHUA 4OFMA 2B1LA 4BVXA 5IPGA 2H1AA 1URMA 2CA8A 2HRAA 4N10A 4WBJA 1DE1A 4ZL9A 3L78A 3LEFA 1K0AA 1OC3A 3KP8A 1U6TA 4YH2A 4WEYA 4HUAA 2XPDA 3GNJA 5JCWA 3EU4A 1YKCA 5FHIA 13GSA 4PGTA 3VWWA 3SWLA 2LS5A 2HNLA 4ISDA 3L0HA 2DMMA 3F4SA 2G0FA 4I97A 1YQ1A 3GV1A 1XBSA 1SENA 2H76A 2YJHA 3KCMA 1T00A 1PX6A 2H0IA 5DBQA 3G9BA 3WYWA 4ZB8A 2CVBA 4TR4A 3LSZA 2C3TA 1GSSA 3M0FA 3IAS2 3TRXA 4H86A 2LRNA 8GSSA 4KCAA 2DJ1A 1THOA 2WCIA 1Z3EA 2PN8A 3ME7A 3KZQA 3PGTA 3HY2A 1YEXA 2RM6A 2FHEA 2HQTA 3LYKA 3C73A 1GNWA 4JZQA 1JFUA 4CW9A 4BWQA 2JU5A 4BA7A 1DUGA 3UBKA 3LFLA 3DMLA 3GL5A 4F0BA 4G19A 2VCXA 4YQUA 4JR4A 2QC7A 4EDZA 3IC4A 4ZIJA 2C4JA 4K7NA 2F51A 1AQWA 5HFGA 3MNGA 1PX7A 1SK2A 4X43A 3QR6A 4MZWA 4PQIA 1HNAA 2LKUA 2VCWA 4MZCA 3RBTA 4ZBAA 1G6YA 2GZZA 3P2AA 2OBIA 4EDYA 4IP1A 1ERTA 4L5OA 3RPNA 5DQSA 5KN0A 3P8WA 3GX8A 5AISA 1SJIA 3IK9A 3IK7A 2YV9A 4TXOB 4PXOA 1OKTA 3IV4A 1M2BA 1GULA 3BOAA 4F9ZA 3LG6A 2VO4A 1ON4A 4IS0A 5DVBA 2HSMA 3F6DA 2PUKC 2N5FA 4TVEA 2C0FA 1NW2A 1WMJA 4L0UA 4Q5NA 20GSA 4GCIA 4GSSA 4O92A 4PTSA 3W8SA 3ZITA 1PN9A 3LGCA 2R3XA 1TRUA 1SYRA 2H66A 2A2RA 1OC9A 2K6VA 1Z6NA 5A5KA 1AXDA 2LJRA 6GSWA 1E6BA 4XS4A 3HJOA 2H71A 2CX3A 3KIJA 3VI7A 5J5NA 5EPFA 1J08A 5BMUA 5A4WA 5DJMA 3VPTA 1EV4A 2RUFA 2YNXA 5ECKB 1PRXA 3TKSE 5GAND 1OE7A 2KP2A 3ZIJA 1GSUA 3VURA 1EP8A 1XXUA 2C0EA 3FR3A 3GTUA 2PERA 5F8BA 1B8XA 4D73A 4KDUA 2LV3A 1SU9A 1THXA 4N30A 3FK8A 4EL1A 5JWOB 1A2MA 2V32A 3GRXA 4TR0A 1X9WB 1XW6A 3I9V2 1R4WA 4FIWA 4PX1A 2DJ0A 1EOHA 2H8LA 1SKSB 5ECHB 4Q5QA 5D9TA 5LD0A 3K8NA 2HZFA 1HYUA 2KP1A 1JLVA 4O32A 2AHEA 5E4WA 1GWCA 2B5YA 3I69A 3GL3A 5LNKe 4FYUA 3D21A 3DXBA 3GTUB 1PQNA 3M1GA 5C04A 5ECLB 4TR1B 2VCVA 1HNBA 2ZCTA 2ALBA 1W4VA 5KN1A 3APSA 1TRSA 5JWRB 4POBA 2YWIA 4G10A 1SKRB 4GTUA 2GSSA 1M2DA 1F9MA 4YQVA 3LXZA 2ES7A 3RPPA 1GLQA 2V6KA 1PA3A 2R2JA 5AGYA 1H4OA 2X8CA 3TKSC 3RHBA 1WE0A 5J9CA 2VL9A 5F0GA 5EY6A 3CSJA 4BWSA 3L9SA 2XPEA 2FWGA 5B8AA 2A2SA 5ENUA 2IMIA 2OA7A 3P7XA 1MDJA 2VIMA 3J7Yb 2H01A 2VUPA 4XS1A 3WT2A 1ZL9A 1TKDB 3TDGA 1A23A 2FA4A 3F6FA 2H6XA 1USBA 1Q98A 3A2WA 4QL9A 1FO5A 3FY7A 5KEJA 1A8LA 2CZ3A 1NSWA 1O8XA 2DJJA 5CO3A 1PKWA 2FD3A 5DJLA 2VL2C 2ZNMA 1VF4A 3R2QA 3DWVA 2JZSA 5HFIA 2C8UA 2F3MA 1TU8A 3CSHA 4BL7B 6GSTA 3GH6A 4L0WA 1GH2A 2IL3A 3GX0A 3NZNA 4GRFA 4FYBA 1B9YC 4WF5A 3QCPA 4LL1B 2BJXA 1TW9A 1FG4A 4TR3A 4I2TA 1YZXA 1K0BA 2J9HA 4KH7A 2WDUA 2OJLA 3QDNA 1A0RP 3FZ9A 4G0LA 2R4VA 3I6AA 4WETA 2VD1A 1Y25A 2D2ZA 2GQKA 3GUSA 3M8NA 2VL3A 5DALA 2V2GA 3IRAA 1M9BA 5A4VA 1GSEA 3IAM2 4HOJA 2NDOA 1J0FA 1TRWA 1XOBA 5IOXA 5CREA 4GWRA 3EC3A 3CBUA 2M46A 2IPAA 1SL2B 2IIYA 1WIKA 5CRDA 2H6YA 2AUVA 2YZHA 3G7JA 4ZB6A 3GFKA 1N8JA 2EIOA 5F05A 3BCIA 2H75A 2VLTA 4KDXA 4ZB9A 5E59A 4IQAA 1X5DA 3GSTA 4EXJA 5DALB 11GSA 3UVHA 3GKKA 3SBCA 4ECIA 3JCML 3HJMA 4K0GA 1B4QA 1V2AA 2WJUA 4AGSA 1FHEA 3ME8A 2KUCA 3ZFLA 2JACA 2PVQA 5ECPB 4AJ6A 3F63A 4RQRA 2GLRA 5IIZA 4XTSA 3QAWA 3QFAC 3BD2A 1XWBA 3UL3A 3VWVA 2KHPA 3CSIA 3LXTA 1PSQA 1PL1A 4USSA 3HHVA 4X1UA 4NMUA 4HQZA 5EVOA 4MP4A 4MZBA 3M3MA 5HFKA 2P5QA 3GIXA 4EUYA 2V41A 4NV5A 4PURA 3APOA 3KTLA 2KLXA 1BEDA 4JRRA 3D22A 3U6VA 4V2NA 4JE1A 2HZEA 4WR5A 4K0NA 2YP6A 2GSRA 2H74A 5INYA 3DGQA 4L8EA 2VLUA 5G31A 1FVJA 1OYJA 4YAVA 2AAWA 2ON5A 2O87A 5KN3A 1HQOA 3ERFA 2CV4A 3R3EA 1MTCA 4IW9A 5ECIB 1QFNA 2QGVA 2LTKA 4K1FA 5JCUA 4IN0A 4BVXB 1TJDA 3FR6A 4N0VA 1YY7A 1XWCA 3QOUA 4EC0A 4RI7A 4G0KA 2YWNA 3HJPA 2UZ8A 4ILFA 6GSSA 1BQ7A 3HVXA 3NOFA 5CRGA 3E3EA 4BPYA 2C0GA 3ZMKA 4G9HA 1K0DA 2HZEB 4HU7A 2HRNA 1PGTA 2M80A 1T7PB 2I3YA 4KDYA 1VF3A 4MJBA 5HR0A 1C72A 3VI5A 3FZ4A 1YF1A 5ECOB 3KP9A 7GSSA 4POMA 1V9WA 4XRAA 2HXKA 4J57E 3A2VA 1YKAA 3ISOA 5DDLA 2K8SA 1O8WA 1A24A 4KW6A 2H6ZA 1RK4A 1PL2A 3KD0A 4FH8A 3W6GA 2B1KA 1K3OA 3GSSA 2DJ2A 3M9JA 4X0XA 2I4AA 4ECJA 2V6OA 2HE3A 2WGRA 1IYHA 3EMXA 3ZVJD 1AW9A 1S3DA 2K8VA 3H1NA 3TJGA 3HXSA 4ML1A 2VCQA 3IR4A 1VF2A 3IHQA 1J9BA 5CYYA 3E0UA 1EZKA 4XRDA 2LEGA 1G6WA 3L9UA 2L4CA 1R7HA 4WF4A 2B6MA 3FEUA 2YV7A 3TKPA 2H1BA 2GZPA 4TXVA 2L6DA 5D8IA 5IO0A 1GTBA 3DVXA 4MJEA 2XHFA 4EKZA 1WPIA 5J3RA 2TRXA 3LJRA 5D9WA 3LORA 4HQSA 4HU9A 4HZ4A 4JBBA 3KMNA 1T4ZA 2O7KA 1SJ6A 3LWAA 4NWYA 1EP7A 3IBHA 1X9MB 3ZRDA 4ACSA 4HI7A 3IOSA 5IOWA 1G7EA 1M9AA 3VWXA 3VWUA 4MJCA 3HZ4A 1FB0A 1EV9A 4K8MA 4KX4A 3V1WA 2DMLA 4K7OA 3Q19A 4TRXA 1UC7A 3N9JA 3EE2A 2I81A 2HSMB 1FOVA 4P3YB 2EC4A 1JZWA 4F0CA 4I2UA 1MD4A 3TJKA 4QL7A 4L5LA 3F4RA 3ED3A 2FLSA 3C1SA 4BVYA 3KEBA 1F2EA 1EWXA 4NXIA 2E7PA 3CYNA 4IJIA 1OC9B 3HA9A 4AJ8A 2NTOA 4ZILA 3M9KA 1ZOFA 4KNDA 4ULXA 4XS4B 3WT1A 4LA1A 4KA0A 2RM5A 1OKDA 1VF1A 1F3BA 4ZL7A 5CRWA 1MDIA 4MF7A 3HCZA 2ON7A 2R5GA 4GQCA 2GZYA 4RUVA 1ZGNA 2FWHA 1AUCA 2NBSA 3KH7A 5IMFA 3TKQA 5JWQB 4K7IA 1JZRA 3ZL5A 4HJMA 4BVYB 2WRTA 5D9XA 2QKEA 4KGIA 3FHKA 1V58A 3D6IA 3GN3A 4DVCA 3TOTA 4D73B 2IN3A 2J23A 1QUWA 4LMVA 4TW5A 1GL8A 3PPUA 3WD6A 2CVKA 4K9ZA 4G2EA 3QPMA 1OE8A 3QAVA 3TRPA 1FVKA 2LRCA 1SL0B 3N5OA 4KCEA 4YQMA 4ZL8A 2I9HA 2HLSA 3EVIA 5D96A 1QQ2A 1ZMAA 2GT5A 3Q74A 2MZCA 2IFQA 4TN8A 2HRKA 1I5GA 2CX4A 5G1KA 3ZREA 5ECSA 3CRUA 1JLWA 1TU7A 4N11A 3ZTLA 2GS3A 2TIRA 12GSA 3H79A 4MJAA 5ECMB 3OR5A 2MBTA 5ID2A 18GSA 2VCZA 5HR1A 1R5PA 4EO3A 1TXXA 1JZOA 5AIVA 3F4TA 1ERVA 2JSYA 4GSNA 2K9FA 1F3AA 2YOIA 1FW1A 4WBRD 2VD0A 2X8GA 5ECQB 2TRCP 3WGXA 3DRNA 5IQYA 4KE3A 2IFQB 3DIEA 2Z9SA 3W8JA 2WZ9A 1BX9A 5ECNB 1ZYEA 2OKAA 3ZLPA 3S9FA 1K0MA 4MA9A 4OFTA 1H75A 4KSMA 3UOMA 3DEXA 3EU3A 1JZDA 5IPHA 1XWKA 4OD7A 2C3QA 1RW1A 4TOPA 4NPBA 2L6CA 2YPMA 3VK9A 1XZOA 2DJ3A 3A5WA 3KM6A 1XFLA 2AJQB 4HEA2 3ZMLA 5J4UA 1OVNA 2B7JA 1GSFA 4HS1A 4POLA 5IM9A 1X5CA 4DEJA 2GGTA 2QSIA 3FW2A 4HJ2A 4XCSA 1FAAA 2L57A 1TRVA 1M2AA 3NIVA 3GHAA 5G5EA 2DBCA 4WR4A 1K0OA 4OCEA 4I5QA 1K3YA 1PD21 4N0ZA 4EF0A 5JCGA 5IMDA 1Z9HA 1GLPA 2EIRA 2B3SA 4MH2A 2DC5A 3C7MA 1M7TA 3RAZA 4CDOA 4TKYA 3LYPA 3ERWA 3MSZA 3GKMA 4ID0A 2H72A 3F3QA 5J9BA 5HQPA 2PWJA 2X99A 1TK0B 5H5RA 2NPBA 1AIUA 2P31A 2AYTA 1QGVA 4KUNA 2OADA 2ZUPA 1ILOA 1A2JA 1T4YA 3Q6OA 5G1LA 3F8UA 4MF5A 1OAZA 1NHOA 2PVOC 1K0CA 1U87A 3QMXA 5L71A 4PNFA 4I8BA 4NHZA 1VRSD 1XVWA 4POKA 1K3LA 2MBSA 1X5EA 2C80A 4F2IA 1LBKA 4ECCA 1I9DA 3HDCA 2FWFA 3GA4A 2RUEA 1YDKA 4PUFC 1BJXA 1CQHA 1EGOA 4G0IA 5IMAA 1DBYA 2LUSA 3FYGA 4ECBA 1X0RA 6GSXA 3U5RE 5H5QA 1BG5A 1TTZA 3GKNA 2OACA 1O85A 5LCZA 3UMAA 2WB9A 4PQ1A 4EE0A 2HI7A 19GSA 3BBYA 4V1Ag 3EYTA 1E2YA 1V57A 2N5AA 2M72A 1BAYA 3ZYWA 3HZ8A 5G30A 1S3AA 1YEPA 2GTUA 3EURA 5D9VA 1GP1A 2B5XA 4MPGA 2JSZA 1UVZA 3L4NA 1W89A 2LQOA 5GSSA 2E0QA 2FUG2 5ECRB 1B48A 3IE3A 4GXZA 2JADA 5C00A 2G2QA 1O81A 2DIYA 1QMVA 1GUMA 2H73A 3C1RA 1G7OA 2YANA 4K2DA 4CHSA 3A3TA 4F82A 2WULA 1B9XC 1SD9A 3CRTA 5F06A 3DD3A 4MDCA 1U3AA 1XIYA 2YWMA 1KNGA 1PKZA 4ZBDA 2DLXA 3CXGA 1LU4A 4KB3A 2GT6A 3WGDA 1HD2A 2CZ2A 3VFIA 1O73A 5B6NA 3LQ7A 3KXOA 1AC1A 3FZAA 2O85A 2L59A 1AQVA 1TK5B 1SK1A 3CMIA 1SL1B 2LNTA 4MABA 5CRHA 3O3TA 2K18A 3F3RA 3IC8A 4JU5A 4V2LA 3MWHA 1YJ6A 1A8YA 1EEJA 1T3BA 4IELA 3MDKA 2YWOA 4MCUA 1QXHA 3TJJA 5DCHA 3F9UA 4DSSA 4QQ7A 4Q5FA 5J41A 5HR3A 3TOUA 1GSQA 1WJKA 3DKSA 4IVFA 2JZRA 4KF9A 2PBJA 2DIZA 1EOGA 1PMTA 3PINA 5HR2A 2PMTA 1DSBA 5ABRA 5CAXA 4TXOA 1X9SB 3FRCA 6GSYA 5D73A 3BCKA 3APQA 3C8EA 2PPTA 3L9VA 2PGTA 17GSA 3ZFBA 3US3A 1SK0A 2FCHA 2RLIA 4WKWA 2RIIA 1Z7PA 2JZTA 1BYEA 3UJ1A 1UA5A 4LLRA 1T1VA 4DSSB 1XOAA 3GMFA 2IMFA 4JEDA 4I6XA 2IMDA 4V2MA 1GRXA 5GAPD 4IQ1A 2EIQA 1OC8A 1Z7RA 4AJ7A 2CVDA 1ERUA 3KJYA 5FWGA 4ZXGA 2OE0A 3QAGA 2LJAA 2YZUA 2IJYA 2E2MA 4HZ2A 2A4VA 5AIXA 3FKFA 3VLNA 1O7UA 1GTAA 3FR9A 4KAEA 5F07A 3EINA 3IPZA 3TGZA 4GLTA 1NM3A 3KGKA 5GSTA 1HNCA 4Q5RA 5IMCA 1WWJA 3IDVA 1XWGA 2F8AA 2VM1A 1SKWB 1U3IA 2MMAA 2XBIA 2GVPA 3GYKA 2YCDA 4DSRA 2X8HA 3AY8A 2R6KA 4MMMA 1EEMA 5IMVA 3TJBA 2LNSA 2GSQA 3I43A 3ZIVA 1U88A 2E2GA 1G0TA 2AV4A 5H5SA 2HYXA 2REMA
chains in the Genus database with same CATH superfamily
1M0UA 1WRYA 1V98A 2F8FA 2LQQA 2H19A 1B4PA 2OE3A 6GSVA 2VAFA 2FY6A 5J4YA 5ELAA 2LJKA 3RHCA 1MDKA 2H1DA 1GNEA 2CAIA 3UEMA 5COHA 2WS2A 4KSOA 1DE2A 2YN1A 1XW5A 1TI1A 1ZCPA 4RI6A 4Z7XA 3J7Yk 3O76A 1TP9A 4TR1A 1M99A 1NHYA 2MYGA 4DSQA 1KTEA 5IO2A 3UBLA 2XC2A 1EGRA 4O7HA 1TK8B 2H0GA 4E68A 2C0DA 2FGXA 5ELGA 3UVTA 2MMOA 2GQLA 4MK3A 2H70A 5FT3A 2MMNA 1F37A 1Q4JA 2XBQA 2IWTA 3F0IA 2V1MA 3QFBC 4FO5A 4E8HA 1YF0A 5DCGA 4MH3A 4EIQA 1M3IA 1GTIA 4AF2A 5GZZB 2GSTA 2C3NA 1S3CA 3D5JA 1R5AA 1GSDA 2AB6A 1TDIA 6GSUA 3D4MA 3KMOA 3TCOA 4J56E 2JL4A 2H1LA 4FYCA 5DAKA 1Z6MA 4XIHA 2IMKA 3G7IA 4Z2UA 1AAZA 4PUAA 4XS6A 2PU9C 2O8VB 3KH9A 2C1YA 2MMZA 4V1Ap 3HVSA 4LL4B 9GSSA 2WFCA 4EVMA 2VCTA 1GUKA 3HYPA 5CNWA 4O5QA 2FNOA 3DVWA 1MEKA 4BL7A 4IP6A 3RDWA 4NAXA 1SJZA 1ZYQB 1K0NA 3TKRA 2CT6A 1FB6A 2CAQA 2HRKB 1ABAA 3ERGA 1N2AA 2L4QA 3PR8A 1WOUA 2CQ9A 4OCFA 1A2LA 2N5BA 3GH9A 1TI3A 3G7YA 4OMVA 3UIWA 5DAKB 2GDRA 4IKHA 3VPQA 1UN2A 1MD3A 1SD8A 2H0HA 4AKGA 2HSNA 14GSA 3UARA 4FQUA 5ID2B 4OO4A 22GSA 4GF0A 1XW9A 3UAPA 1XVQA 2BMXA 2H30A 4RQXA 2DSAA 5CP1A 5DQYA 2IMEA 4NHWA 4MF6A 2NVLA 3GURA 4LMWA 3TB2A 1GTUA 4ML6A 3E9JB 2HSHA 1ERWA 2VOCA 4CY6A 2B5EA 3LW9A 5B8BA 3TKSA 2VM2A 4JR6A 4XHMA 4NV2A 4MNNA 1ACVA 1ST9A 5B6MA 3CTGA 4O5RA 3H8QA 2P0GA 4K6XA 3D0ZA 4F03A 3TJFA 2HSNB 3IXRA 1KBNA 1GSYA 1XPVA 2O89A 1RQMA 2HT9A 4OO5A 2VKZG 2KOKA 1BF5A 1WP0A 4GSTA 3C71A 1XCCA 4MPFA 2BTOT 2LRTA 5A5HB 1QK8A 4HDEA 10GSA 3QD9A 4Z2RA 1LJRA 2B7KA 3H4KA 4OFNA 1A0FA 2O5VA 3HVVA 2F9SA 4IBPA 1Z5YE 1T8EB 2L5LA 16GSA 3D4TA 3TRQA 2VL2A 3DYRA 1XWAA 1SYXA 2HFDA 3HKRA 3ZVJA 5G5FA 3WGEA 4YAPA 5BRTA 2HRFA 1VGLA 3BJ5A 3H93A 5A4UA 1F6MC 5AN1A 4ZBBA 2VLVA 1TOFA 3FZ5A 3CQFA 2OE1A 4E8EA 3MAKA 4OWYA 5D93A 1O6JA 3Q18A 2L5OA 1AQXA 4GQFA 3EWLA 4PQHA 1IYIA 2HSYA 3HD5A 3PH9A 3P90A 1Y6EA 2GQMA 4MLYA 3TUEA 5B7CA 4IJ3A 4WXTA 2FWEA 2LSTA 3O6TA 2X64A 4PNGA 3KTBA 5G2ZA 5EL8A 2FA8A 2DJKA 3IA1A 5IMZA 1GUHA 3CTFA 4J2FA 3EMPA 3A2XA 1ML6A 1KEBA 5KN2A 4IGJA 1R26A 1ZZYA 1ZYNA 3GKXA 1V40A 2P5RA 1JHBA 3ZZXA 2WVZA 2H1GA 2I1UA 1CQGA 2R37A 2YJ7A 2OBKA 4IHUA 4OFMA 2B1LA 4BVXA 5IPGA 2H1AA 1URMA 2CA8A 2HRAA 4N10A 4N3ZA 4WBJA 1DE1A 4ZL9A 3L78A 3LEFA 1K0AA 1OC3A 3KP8A 1U6TA 4YH2A 4WEYA 4HUAA 2XPDA 3GNJA 5JCWA 3EU4A 1YKCA 5FHIA 13GSA 4PGTA 3VWWA 3SWLA 2LS5A 2HNLA 4ISDA 3L0HA 2DMMA 2WVXA 3F4SA 2G0FA 4I97A 1YQ1A 3GV1A 1XBSA 1SENA 2H76A 2YJHA 3KCMA 1T00A 1PX6A 2H0IA 4X4JA 5DBQA 3G9BA 2X4AA 3WYWA 4ZB8A 2CVBA 4TR4A 3LSZA 4AKIA 2C3TA 4K5SA 1GSSA 3M0FA 3IAS2 3TU3B 3TRXA 4H86A 1SVOA 2LRNA 8GSSA 4KCAA 2DJ1A 1THOA 2WCIA 1Z3EA 2PN8A 3ME7A 3KZQA 3PGTA 3HY2A 4W66A 1YEXA 2RM6A 2FHEA 2HQTA 3LYKA 3C73A 1GNWA 4JZQA 1JFUA 4CW9A 4HSCX 4BWQA 2JU5A 4BA7A 1DUGA 3UBKA 3LFLA 3DMLA 3GL5A 4F0BA 4G19A 2VCXA 4YQUA 4JR4A 2QC7A 4EDZA 3IC4A 4ZIJA 2C4JA 4K7NA 2F51A 1AQWA 5HFGA 3MNGA 1PX7A 1SK2A 4X43A 3QR6A 4MZWA 4PQIA 1YEWC 1HNAA 2LKUA 2VCWA 4MZCA 3RBTA 4ZBAA 1G6YA 2GZZA 3P2AA 2OBIA 4EDYA 4IP1A 1ERTA 4L5OA 3RPNA 5DQSA 5KN0A 3P8WA 3GX8A 5AISA 1SJIA 3IK9A 3IK7A 2YV9A 4TXOB 4PXOA 1OKTA 3IV4A 1M2BA 1GULA 3BOAA 4F9ZA 3LG6A 4FXYP 2VO4A 1ON4A 4IS0A 5DVBA 2HSMA 4ZB7A 3F6DA 5J47A 2PUKC 2N5FA 4TVEA 2C0FA 1ZYPA 1NW2A 1WMJA 4L0UA 3CWGA 4Q5NA 20GSA 4GCIA 4GSSA 4O92A 4PTSA 3W8SA 3ZITA 1PN9A 3LGCA 2R3XA 1TRUA 1SYRA 2H66A 2A2RA 1OC9A 2K6VA 1Z6NA 5A5KA 1AXDA 2LJRA 6GSWA 1E6BA 4XS4A 3HJOA 1TXUA 2H71A 2CX3A 3KIJA 3VI7A 5J5NA 5EPFA 1J08A 5BMUA 5A4WA 5DJMA 3VPTA 1EV4A 2RUFA 2YNXA 5ECKB 1PRXA 3TKSE 5GAND 1OE7A 2KP2A 3ZIJA 1GSUA 3VURA 1EP8A 1XXUA 2C0EA 3FR3A 3GTUA 2PERA 5F8BA 1M3JA 1B8XA 4D73A 4Z2TA 4KDUA 2LV3A 1SU9A 1THXA 4N30A 2WW3A 3FK8A 4EL1A 5JWOB 1A2MA 2V32A 3GRXA 4TR0A 1X9WB 1XW6A 3I9V2 1R4WA 4FIWA 4PX1A 2DJ0A 1EOHA 2H8LA 5BMUB 1SKSB 3CHXC 5ECHB 4Q5QA 5D9TA 5LD0A 3K8NA 2HZFA 1HYUA 2KP1A 1JLVA 4O32A 4CY8A 2AHEA 5E4WA 1GWCA 2B5YA 3I69A 3GL3A 5LNKe 4FYUA 3D21A 3DXBA 3GTUB 1PQNA 3M1GA 5C04A 2WVYA 5ECLB 4TR1B 2VCVA 1HNBA 2ZCTA 3IHGA 2ALBA 1W4VA 5KN1A 3APSA 1TRSA 5JWRB 4POBA 2YWIA 4G10A 1SKRB 4GTUA 2GSSA 1M2DA 1F9MA 4YQVA 3LXZA 2ES7A 3RPPA 1GLQA 2V6KA 1PA3A 2R2JA 5AGYA 1H4OA 1Y1UA 2X8CA 3TKSC 4BIKA 3RHBA 1WE0A 5J9CA 2VL9A 2R0PA 5F0GA 5EY6A 3CSJA 4BWSA 3L9SA 2XPEA 2FWGA 5B8AA 2A2SA 5ENUA 2IMIA 2OA7A 3P7XA 1MDJA 2VIMA 3J7Yb 2H01A 2VUPA 4XS1A 3WT2A 1ZL9A 1TKDB 3TDGA 1A23A 2FA4A 3F6FA 2H6XA 1USBA 1Q98A 3A2WA 4QL9A 1FO5A 4YKFA 3FY7A 5KEJA 1A8LA 2CZ3A 1NSWA 1O8XA 2DJJA 5CO3A 1PKWA 2FD3A 5DJLA 1YVLA 2VL2C 2ZNMA 1VF4A 3R2QA 3DWVA 2JZSA 5HFIA 2C8UA 2F3MA 1TU8A 3CSHA 4BL7B 6GSTA 3GH6A 4L0WA 1GH2A 2IL3A 3GX0A 3NZNA 4GRFA 4FYBA 1B9YC 4WF5A 3QCPA 4LL1B 2BJXA 1TW9A 1FG4A 4TR3A 4I2TA 1YZXA 1K0BA 2J9HA 4KH7A 2WDUA 2OJLA 3QDNA 1A0RP 3FZ9A 4G0LA 2WW0A 4YKGA 2R4VA 3I6AA 4WETA 2VD1A 1Y25A 2D2ZA 2GQKA 3GUSA 3M8NA 2VL3A 5DALA 2V2GA 3IRAA 1M9BA 5A4VA 1GSEA 3IAM2 4HOJA 2DKIA 2NDOA 1J0FA 1TRWA 1XOBA 5IOXA 5CREA 4GWRA 3EC3A 3CBUA 2M46A 4G01A 2IPAA 1PFOA 1SL2B 2IIYA 1WIKA 5CRDA 2H6YA 2QA2A 3MYDA 2AUVA 4K5RA 2YZHA 3G7JA 4ZB6A 3GFKA 1N8JA 2EIOA 5F05A 3BCIA 2H75A 2VLTA 4KDXA 4ZB9A 5E59A 4IQAA 5A1NA 1X5DA 2EFCA 3GSTA 4EXJA 5DALB 11GSA 3UVHA 3GKKA 3SBCA 4ECIA 3JCML 3HJMA 4K0GA 1B4QA 1V2AA 2WJUA 4AGSA 1FHEA 3ME8A 2KUCA 3ZFLA 2JACA 2PVQA 5ECPB 4AJ6A 3F63A 4RQRA 2GLRA 5IIZA 4XTSA 3QAWA 3QFAC 3BD2A 1XWBA 3UL3A 3VWVA 2KHPA 3CSIA 5J4VA 3LXTA 1PSQA 1PL1A 4USSA 3HHVA 4X1UA 4NMUA 4HQZA 5EVOA 4MP4A 4MZBA 3M3MA 5HFKA 2P5QA 3GIXA 4EUYA 2V41A 4NV5A 4PURA 3APOA 3KTLA 2KLXA 1BEDA 4JRRA 3D22A 3U6VA 4V2NA 4JE1A 2HZEA 4WR5A 4K0NA 2YP6A 2GSRA 2H74A 5INYA 3DGQA 4L8EA 2VLUA 5G31A 1FVJA 1OYJA 4YAVA 2AAWA 2ON5A 2O87A 5KN3A 1HQOA 3ERFA 2CV4A 5KOXA 3R3EA 1SVMA 1MTCA 4IW9A 5ECIB 4AKHA 1QFNA 2QGVA 2LTKA 4K1FA 5JCUA 4IN0A 2EFHA 4BVXB 1TJDA 3FR6A 4N0VA 1YY7A 1XWCA 3QOUA 4EC0A 4RI7A 4G0KA 2YWNA 3HJPA 2UZ8A 4ILFA 6GSSA 1BQ7A 3HVXA 3NOFA 5CRGA 3E3EA 1S3RA 4BPYA 2C0GA 3ZMKA 4G9HA 1K0DA 2HZEB 4HU7A 2HRNA 1PGTA 2M80A 1T7PB 2A4HA 2I3YA 4KDYA 1VF3A 4MJBA 5HR0A 1C72A 3VI5A 3FZ4A 2EFEA 2WVXB 1YF1A 5ECOB 3KP9A 2R0CA 7GSSA 4POMA 4PHZC 1V9WA 1SVLA 3HMJG 4XRAA 2HXKA 4J57E 3A2VA 1YKAA 3ISOA 5DDLA 2K8SA 1O8WA 1A24A 4KW6A 5KOWA 2H6ZA 1RK4A 1PL2A 3KD0A 4FH8A 3W6GA 2B1KA 1K3OA 3GSSA 2DJ2A 3M9JA 4X0XA 2I4AA 4ECJA 2V6OA 2HE3A 2WGRA 1IYHA 3EMXA 3ZVJD 1AW9A 1S3DA 2K8VA 3H1NA 3TJGA 3HXSA 4ML1A 2VCQA 3IR4A 1VF2A 3IHQA 1J9BA 5CYYA 3E0UA 1EZKA 4XRDA 2LEGA 1G6WA 3L9UA 2L4CA 1R7HA 4WF4A 2B6MA 3FEUA 2YV7A 3TKPA 2H1BA 4O5UA 2GZPA 4TXVA 2L6DA 5D8IA 5IO0A 1GTBA 3DVXA 4MJEA 2XHFA 4EKZA 1WPIA 5J3RA 2TRXA 3LJRA 5D9WA 3LORA 4HQSA 4HU9A 4HZ4A 4JBBA 4QMKA 3KMNA 1T4ZA 2O7KA 2OT3A 1SJ6A 3LWAA 4NWYA 1EP7A 3IBHA 1X9MB 3ZRDA 4ACSA 4HI7A 3IOSA 5IOWA 1G7EA 1M9AA 3VWXA 3VWUA 4MJCA 3HZ4A 1FB0A 2EFDA 1EV9A 4K8MA 4KX4A 3V1WA 2DMLA 4K7OA 3Q19A 4TRXA 1UC7A 3N9JA 3EE2A 2I81A 2HSMB 1FOVA 4P3YB 2EC4A 1JZWA 4F0CA 4I2UA 1MD4A 3TJKA 4QL7A 4L5LA 3F4RA 3ED3A 2FLSA 3C1SA 4BVYA 3KEBA 1F2EA 1EWXA 4NXIA 2E7PA 3CYNA 4IJIA 1OC9B 3HA9A 4AJ8A 2NTOA 4ZILA 3M9KA 1ZOFA 4KNDA 4ULXA 4XS4B 3WT1A 4LA1A 4KA0A 2RM5A 1OKDA 1VF1A 1F3BA 4ZL7A 5CRWA 1MDIA 4MF7A 3HCZA 2ON7A 2R5GA 4GQCA 2GZYA 1XG8A 4RUVA 3MIXA 4AI6A 4GDFA 1ZGNA 2FWHA 1AUCA 2NBSA 3KH7A 5IMFA 3TKQA 5JWQB 2A2PA 4K7IA 4EIPA 1JZRA 3ZL5A 4HJMA 4BVYB 2WRTA 2QA1A 5D9XA 3RGBC 2QKEA 4KGIA 3FHKA 1V58A 3D6IA 3GN3A 4DVCA 3TOTA 4D73B 2IN3A 2J23A 1QUWA 4LMVA 4TW5A 3RFRC 1GL8A 3PPUA 3WD6A 2CVKA 4K9ZA 4G2EA 3QPMA 1OE8A 3QAVA 3TRPA 1FVKA 2LRCA 1SL0B 3N5OA 4KCEA 4YQMA 4ZL8A 2I9HA 2HLSA 3EVIA 5D96A 1QQ2A 1ZMAA 2GT5A 3Q74A 2MZCA 2IFQA 4TN8A 2HRKA 1I5GA 2CX4A 5G1KA 3ZREA 5ECSA 3CRUA 1JLWA 1TU7A 4N11A 3ZTLA 2GS3A 2TIRA 12GSA 3H79A 4MJAA 5ECMB 3OR5A 2MBTA 5ID2A 18GSA 2VCZA 5HR1A 1R5PA 4EO3A 1TXXA 1JZOA 5AIVA 3F4TA 1ERVA 2JSYA 4GSNA 2K9FA 1F3AA 2YOIA 1FW1A 4WBRD 2VD0A 2X8GA 5ECQB 2TRCP 3WGXA 3DRNA 5IQYA 4KE3A 3A5IA 2IFQB 3DIEA 2Z9SA 3W8JA 2WZ9A 1BX9A 5ECNB 4A5PA 2WW1A 1ZYEA 2OKAA 3ZLPA 3S9FA 1K0MA 4MA9A 4OFTA 1H75A 4KSMA 3UOMA 3DEXA 3EU3A 1JZDA 2WW2A 5IPHA 1XWKA 4OD7A 2C3QA 1RW1A 4TOPA 4NPBA 2L6CA 2YPMA 3VK9A 1XZOA 2DJ3A 3A5WA 3KM6A 5A5HA 1XFLA 2AJQB 4HEA2 3ZMLA 5J4UA 1OVNA 2B7JA 1GSFA 4HS1A 4AKXB 4POLA 5IM9A 1X5CA 4DEJA 2GGTA 2QSIA 3FW2A 4HJ2A 4XCSA 1FAAA 2L57A 1TRVA 1M2AA 3NIVA 3GHAA 3FMWA 5G5EA 2DBCA 4WR4A 1K0OA 4OCEA 4I5QA 1K3YA 1PD21 4N0ZA 4EF0A 5JCGA 5IMDA 1Z9HA 1GLPA 2EIRA 2B3SA 4MH2A 2DC5A 3C7MA 1M7TA 3RAZA 4CDOA 4TKYA 3LYPA 3ERWA 3MSZA 1I1IP 3GKMA 4ID0A 2H72A 3F3QA 5J9BA 5HQPA 2PWJA 2X99A 1TK0B 5H5RA 2NPBA 1AIUA 2P31A 2AYTA 1QGVA 4KUNA 2OADA 2ZUPA 1ILOA 1A2JA 1T4YA 3Q6OA 5G1LA 3F8UA 4MF5A 1OAZA 1NHOA 2PVOC 1K0CA 1U87A 3QMXA 5L71A 4PNFA 4I8BA 4NHZA 1VRSD 1XVWA 4POKA 1K3LA 2MBSA 1X5EA 2C80A 4F2IA 1LBKA 4ECCA 1I9DA 3HDCA 2FWFA 3GA4A 2RUEA 1YDKA 4PUFC 1BJXA 1CQHA 1EGOA 4G0IA 5IMAA 1DBYA 2LUSA 3FYGA 4ECBA 1X0RA 5A1NB 6GSXA 3U5RE 5H5QA 1BG5A 1TTZA 3GKNA 2OACA 1O85A 5LCZA 3UMAA 4PI2C 2WB9A 4PQ1A 4EE0A 2HI7A 19GSA 3BBYA 4V1Ag 3EYTA 1E2YA 1V57A 2N5AA 2M72A 1BAYA 3ZYWA 3HZ8A 1FOHA 5G30A 1S3AA 1YEPA 2GTUA 3EURA 5D9VA 1GP1A 2B5XA 4MPGA 2JSZA 1UVZA 3L4NA 1W89A 1PN0A 2LQOA 5GSSA 2E0QA 2FUG2 5ECRB 1B48A 3IE3A 4GXZA 2JADA 5C00A 2G2QA 2UV8G 1O81A 2DIYA 1QMVA 1GUMA 2H73A 3C1RA 1G7OA 2YANA 4K2DA 4CHSA 3A3TA 4K2XA 4F82A 2WULA 2O36A 1B9XC 3EPTA 1SD9A 3CRTA 5F06A 3DD3A 4MDCA 1U3AA 1XIYA 2YWMA 1KNGA 1PKZA 4ZBDA 2DLXA 3CXGA 1LU4A 4KB3A 2GT6A 3WGDA 1HD2A 2CZ2A 3VFIA 1O73A 5B6NA 3LQ7A 3KXOA 1AC1A 3FZAA 2O85A 2L59A 1AQVA 1TK5B 2WZSA 1SK1A 3CMIA 1SL1B 2LNTA 4ICYA 4MABA 1BG1A 1N25A 4PI0C 5CRHA 3HVNA 3O3TA 2K18A 3F3RA 5J40A 3IC8A 4JU5A 4V2LA 3MWHA 1YJ6A 1A8YA 1EEJA 1T3BA 4IELA 3MDKA 2YWOA 4MCUA 1QXHA 3TJJA 5DCHA 2O3EA 3F9UA 4DSSA 4QQ7A 4Q5FA 5J41A 5HR3A 3TOUA 1GSQA 1WJKA 3DKSA 4IVFA 2JZRA 2DIZA 4KF9A 2PBJA 1EOGA 1PMTA 5A34A 3PINA 5HR2A 2PMTA 1DSBA 5ABRA 5CAXA 4TXOA 1X9SB 3FRCA 6GSYA 5D73A 3BCKA 3APQA 2R0GA 3C8EA 2PPTA 3L9VA 2PGTA 17GSA 3ZFBA 3US3A 1SK0A 2FCHA 2RLIA 4WKWA 2RIIA 1Z7PA 2JZTA 1BYEA 3UJ1A 1UA5A 4LLRA 1T1VA 4DSSB 1XOAA 3GMFA 2IMFA 4JEDA 4I6XA 2IMDA 4V2MA 1GRXA 5GAPD 4IQ1A 2EIQA 1OC8A 1Z7RA 4AJ7A 2X49A 5A34B 2CVDA 1ERUA 3KJYA 5FWGA 4ZXGA 2OE0A 3QAGA 2LJAA 2YZUA 2IJYA 2E2MA 4HZ2A 2A4VA 5AIXA 3FKFA 3VLNA 1O7UA 1GTAA 3FR9A 4KAEA 5F07A 3EINA 3IPZA 3TGZA 4GLTA 1NM3A 3KGKA 1S4BP 5GSTA 1HNCA 4Q5RA 5IMCA 1WWJA 3IDVA 1XWGA 2F8AA 2VM1A 1SKWB 1U3IA 2MMAA 2XBIA 2GVPA 3GYKA 2YCDA 4DSRA 2X8HA 3AY8A 2R6KA 4MMMA 1EEMA 5IMVA 2DKHA 3TJBA 2LNSA 2GSQA 3I43A 3ZIVA 1U88A 2E2GA 1G0TA 2AV4A 5H5SA 2HYXA 2REMA
chains in the Genus database with same CATH topology
1M0UA 1WRYA 1V98A 2F8FA 2LQQA 2H19A 1B4PA 2OE3A 6GSVA 2VAFA 2FY6A 5J4YA 5ELAA 2LJKA 3RHCA 1MDKA 2H1DA 1GNEA 2CAIA 3UEMA 5COHA 2WS2A 4KSOA 1DE2A 2YN1A 1XW5A 1TI1A 1ZCPA 4RI6A 4Z7XA 3J7Yk 3O76A 1TP9A 4TR1A 1M99A 1NHYA 2MYGA 4DSQA 1KTEA 5IO2A 3UBLA 2XC2A 1EGRA 4O7HA 1TK8B 2H0GA 4E68A 2C0DA 2FGXA 5ELGA 3UVTA 2MMOA 2GQLA 4MK3A 2H70A 5FT3A 2MMNA 1F37A 1Q4JA 2XBQA 2IWTA 3F0IA 2V1MA 3QFBC 4FO5A 4E8HA 1YF0A 5DCGA 4MH3A 4EIQA 1GTIA 4AF2A 5GZZB 2GSTA 2C3NA 1S3CA 3D5JA 1R5AA 1GSDA 2AB6A 1TDIA 6GSUA 3D4MA 3KMOA 3TCOA 4J56E 2JL4A 2H1LA 4FYCA 5DAKA 1Z6MA 4XIHA 2IMKA 3G7IA 4Z2UA 1AAZA 4PUAA 4XS6A 2PU9C 2O8VB 3KH9A 2C1YA 2MMZA 4V1Ap 3HVSA 4LL4B 9GSSA 2WFCA 4EVMA 2VCTA 1GUKA 3HYPA 5CNWA 4O5QA 2FNOA 3DVWA 1MEKA 4BL7A 4IP6A 3RDWA 4NAXA 1SJZA 1ZYQB 1K0NA 3TKRA 2CT6A 1FB6A 2CAQA 2HRKB 1ABAA 3ERGA 1N2AA 2L4QA 3PR8A 1WOUA 2CQ9A 4OCFA 1A2LA 2N5BA 3GH9A 1TI3A 3G7YA 4OMVA 3UIWA 5DAKB 2GDRA 4IKHA 3VPQA 1UN2A 1MD3A 1SD8A 2H0HA 4AKGA 2HSNA 14GSA 3UARA 4FQUA 5ID2B 4OO4A 22GSA 4GF0A 1XW9A 3UAPA 1XVQA 2BMXA 2H30A 4RQXA 2DSAA 5CP1A 5DQYA 2IMEA 4NHWA 4MF6A 2NVLA 3GURA 4LMWA 3TB2A 1GTUA 4ML6A 3E9JB 2HSHA 1ERWA 2VOCA 4CY6A 2B5EA 3LW9A 5B8BA 3TKSA 2VM2A 4JR6A 4XHMA 4NV2A 4MNNA 1ACVA 1ST9A 5B6MA 3CTGA 4O5RA 3H8QA 2P0GA 4K6XA 3D0ZA 4F03A 3TJFA 2HSNB 3IXRA 1KBNA 1GSYA 1XPVA 2O89A 1RQMA 2HT9A 4OO5A 2VKZG 2KOKA 1BF5A 1WP0A 4GSTA 3C71A 1XCCA 4MPFA 2BTOT 2LRTA 5A5HB 1QK8A 4HDEA 10GSA 3QD9A 4Z2RA 1LJRA 2B7KA 3H4KA 4OFNA 1A0FA 2O5VA 3HVVA 2F9SA 4IBPA 1Z5YE 1T8EB 2L5LA 16GSA 3D4TA 3TRQA 2VL2A 3DYRA 1XWAA 1SYXA 2HFDA 3HKRA 3ZVJA 5G5FA 3WGEA 4YAPA 5BRTA 2HRFA 1VGLA 3BJ5A 3H93A 5A4UA 1F6MC 5AN1A 4ZBBA 2VLVA 1TOFA 3FZ5A 2OE1A 4E8EA 3MAKA 4OWYA 5D93A 1O6JA 3Q18A 2L5OA 1AQXA 4GQFA 3EWLA 4PQHA 1IYIA 2HSYA 3HD5A 3PH9A 3P90A 1Y6EA 2GQMA 4MLYA 3TUEA 5B7CA 4IJ3A 4WXTA 2FWEA 2LSTA 3O6TA 2X64A 4PNGA 3KTBA 5G2ZA 5EL8A 2FA8A 2DJKA 3IA1A 5IMZA 1GUHA 3CTFA 4J2FA 3EMPA 3A2XA 1ML6A 1KEBA 5KN2A 4IGJA 1R26A 1ZZYA 1ZYNA 3GKXA 1V40A 2P5RA 1JHBA 3ZZXA 2H1GA 2I1UA 1CQGA 2R37A 2YJ7A 2OBKA 4IHUA 4OFMA 2B1LA 4BVXA 5IPGA 2H1AA 1URMA 2CA8A 2HRAA 4N10A 4N3ZA 4WBJA 1DE1A 4ZL9A 3L78A 3LEFA 1K0AA 1OC3A 3KP8A 1U6TA 4YH2A 4WEYA 4HUAA 2XPDA 3GNJA 5JCWA 3EU4A 1YKCA 5FHIA 13GSA 4PGTA 3VWWA 3SWLA 2LS5A 2HNLA 4ISDA 3L0HA 2DMMA 3F4SA 2G0FA 4I97A 1YQ1A 3GV1A 1XBSA 1SENA 2H76A 2YJHA 3KCMA 1T00A 1PX6A 2H0IA 4X4JA 5DBQA 3G9BA 2X4AA 3WYWA 4ZB8A 2CVBA 4TR4A 3LSZA 4AKIA 2C3TA 4K5SA 1GSSA 3M0FA 3IAS2 3TU3B 3TRXA 4H86A 1SVOA 2LRNA 8GSSA 4KCAA 2DJ1A 1THOA 2WCIA 1Z3EA 2PN8A 3ME7A 3KZQA 3PGTA 3HY2A 4W66A 1YEXA 2RM6A 2FHEA 2HQTA 3LYKA 3C73A 1GNWA 4JZQA 1JFUA 4CW9A 4BWQA 2JU5A 4BA7A 1DUGA 3UBKA 3LFLA 3DMLA 3GL5A 4F0BA 4G19A 2VCXA 4YQUA 4JR4A 2QC7A 4EDZA 3IC4A 4ZIJA 2C4JA 4K7NA 2F51A 1AQWA 5HFGA 3MNGA 1PX7A 1SK2A 4X43A 3QR6A 4MZWA 4PQIA 1HNAA 2LKUA 2VCWA 4MZCA 3RBTA 4ZBAA 1G6YA 2GZZA 3P2AA 2OBIA 4EDYA 4IP1A 1ERTA 4L5OA 3RPNA 5DQSA 5KN0A 3P8WA 3GX8A 5AISA 1SJIA 3IK9A 3IK7A 2YV9A 4TXOB 4PXOA 1OKTA 3IV4A 1M2BA 1GULA 3BOAA 4F9ZA 3LG6A 2VO4A 1ON4A 4IS0A 5DVBA 2HSMA 4ZB7A 3F6DA 5J47A 2PUKC 2N5FA 4TVEA 2C0FA 1ZYPA 1NW2A 1WMJA 4L0UA 3CWGA 4Q5NA 20GSA 4GCIA 4GSSA 4O92A 4PTSA 3W8SA 3ZITA 1PN9A 3LGCA 2R3XA 1TRUA 1SYRA 2H66A 2A2RA 1OC9A 2K6VA 1Z6NA 5A5KA 1AXDA 2LJRA 6GSWA 1E6BA 4XS4A 3HJOA 1TXUA 2H71A 2CX3A 3KIJA 3VI7A 5J5NA 5EPFA 1J08A 5BMUA 5A4WA 5DJMA 3VPTA 1EV4A 2RUFA 2YNXA 5ECKB 1PRXA 3TKSE 5GAND 1OE7A 2KP2A 3ZIJA 1GSUA 3VURA 1EP8A 1XXUA 2C0EA 3FR3A 3GTUA 2PERA 5F8BA 1B8XA 4D73A 4Z2TA 4KDUA 2LV3A 1SU9A 1THXA 4N30A 3FK8A 4EL1A 5JWOB 1A2MA 2V32A 3GRXA 4TR0A 1X9WB 1XW6A 3I9V2 1R4WA 4FIWA 4PX1A 2DJ0A 1EOHA 2H8LA 5BMUB 1SKSB 5ECHB 4Q5QA 5D9TA 5LD0A 3K8NA 2HZFA 1HYUA 2KP1A 1JLVA 4O32A 4CY8A 2AHEA 5E4WA 1GWCA 2B5YA 3I69A 3GL3A 5LNKe 4FYUA 3D21A 3DXBA 3GTUB 1PQNA 3M1GA 5C04A 5ECLB 4TR1B 2VCVA 1HNBA 2ZCTA 3IHGA 2ALBA 1W4VA 5KN1A 3APSA 1TRSA 5JWRB 4POBA 2YWIA 4G10A 1SKRB 4GTUA 2GSSA 1M2DA 1F9MA 4YQVA 3LXZA 2ES7A 3RPPA 1GLQA 2V6KA 1PA3A 2R2JA 5AGYA 1H4OA 1Y1UA 2X8CA 3TKSC 3RHBA 1WE0A 5J9CA 2VL9A 2R0PA 5F0GA 5EY6A 3CSJA 4BWSA 3L9SA 2XPEA 2FWGA 5B8AA 2A2SA 5ENUA 2IMIA 2OA7A 3P7XA 1MDJA 2VIMA 3J7Yb 2H01A 2VUPA 4XS1A 3WT2A 1ZL9A 1TKDB 3TDGA 1A23A 2FA4A 3F6FA 2H6XA 1USBA 1Q98A 3A2WA 4QL9A 1FO5A 4YKFA 3FY7A 5KEJA 1A8LA 2CZ3A 1NSWA 1O8XA 2DJJA 5CO3A 1PKWA 2FD3A 5DJLA 1YVLA 2VL2C 2ZNMA 1VF4A 3R2QA 3DWVA 2JZSA 5HFIA 2C8UA 2F3MA 1TU8A 3CSHA 4BL7B 6GSTA 3GH6A 4L0WA 1GH2A 2IL3A 3GX0A 3NZNA 4GRFA 4FYBA 1B9YC 4WF5A 3QCPA 4LL1B 2BJXA 1TW9A 1FG4A 4TR3A 4I2TA 1YZXA 1K0BA 2J9HA 4KH7A 2WDUA 2OJLA 3QDNA 1A0RP 3FZ9A 4G0LA 4YKGA 2R4VA 3I6AA 4WETA 2VD1A 1Y25A 2D2ZA 2GQKA 3GUSA 3M8NA 2VL3A 5DALA 2V2GA 3IRAA 1M9BA 5A4VA 1GSEA 3IAM2 4HOJA 2DKIA 2NDOA 1J0FA 1TRWA 1XOBA 5IOXA 5CREA 4GWRA 3EC3A 3CBUA 2M46A 4G01A 2IPAA 1SL2B 2IIYA 1WIKA 5CRDA 2H6YA 2QA2A 3MYDA 2AUVA 4K5RA 2YZHA 3G7JA 4ZB6A 3GFKA 1N8JA 2EIOA 5F05A 3BCIA 2H75A 2VLTA 4KDXA 4ZB9A 5E59A 4IQAA 5A1NA 1X5DA 2EFCA 3GSTA 4EXJA 5DALB 11GSA 3UVHA 3GKKA 3SBCA 4ECIA 3JCML 3HJMA 4K0GA 1B4QA 1V2AA 2WJUA 4AGSA 1FHEA 3ME8A 2KUCA 3ZFLA 2JACA 2PVQA 5ECPB 4AJ6A 3F63A 4RQRA 2GLRA 5IIZA 4XTSA 3QAWA 3QFAC 3BD2A 1XWBA 3UL3A 3VWVA 2KHPA 3CSIA 5J4VA 3LXTA 1PSQA 1PL1A 4USSA 3HHVA 4X1UA 4NMUA 4HQZA 5EVOA 4MP4A 4MZBA 3M3MA 5HFKA 2P5QA 3GIXA 4EUYA 2V41A 4NV5A 4PURA 3APOA 3KTLA 2KLXA 1BEDA 4JRRA 3D22A 3U6VA 4V2NA 4JE1A 2HZEA 4WR5A 4K0NA 2YP6A 2GSRA 2H74A 5INYA 3DGQA 4L8EA 2VLUA 5G31A 1FVJA 1OYJA 4YAVA 2AAWA 2ON5A 2O87A 5KN3A 1HQOA 3ERFA 2CV4A 5KOXA 3R3EA 1SVMA 1MTCA 4IW9A 5ECIB 4AKHA 1QFNA 2QGVA 2LTKA 4K1FA 5JCUA 4IN0A 2EFHA 4BVXB 1TJDA 3FR6A 4N0VA 1YY7A 1XWCA 3QOUA 4EC0A 4RI7A 4G0KA 2YWNA 3HJPA 2UZ8A 4ILFA 6GSSA 1BQ7A 3HVXA 3NOFA 5CRGA 3E3EA 4BPYA 2C0GA 3ZMKA 4G9HA 1K0DA 2HZEB 4HU7A 2HRNA 1PGTA 2M80A 1T7PB 2A4HA 2I3YA 4KDYA 1VF3A 4MJBA 5HR0A 1C72A 3VI5A 3FZ4A 2EFEA 1YF1A 5ECOB 3KP9A 2R0CA 7GSSA 4POMA 1V9WA 1SVLA 3HMJG 4XRAA 2HXKA 4J57E 3A2VA 1YKAA 3ISOA 5DDLA 2K8SA 1O8WA 1A24A 4KW6A 5KOWA 2H6ZA 1RK4A 1PL2A 3KD0A 4FH8A 3W6GA 2B1KA 1K3OA 3GSSA 2DJ2A 3M9JA 4X0XA 2I4AA 4ECJA 2V6OA 2HE3A 2WGRA 1IYHA 3EMXA 3ZVJD 1AW9A 1S3DA 2K8VA 3H1NA 3TJGA 3HXSA 4ML1A 2VCQA 3IR4A 1VF2A 3IHQA 1J9BA 5CYYA 3E0UA 1EZKA 4XRDA 2LEGA 1G6WA 3L9UA 2L4CA 1R7HA 4WF4A 2B6MA 3FEUA 2YV7A 3TKPA 2H1BA 4O5UA 2GZPA 4TXVA 2L6DA 5D8IA 5IO0A 1GTBA 3DVXA 4MJEA 2XHFA 4EKZA 1WPIA 5J3RA 2TRXA 3LJRA 5D9WA 3LORA 4HQSA 4HU9A 4HZ4A 4JBBA 4QMKA 3KMNA 1T4ZA 2O7KA 2OT3A 1SJ6A 3LWAA 4NWYA 1EP7A 3IBHA 1X9MB 3ZRDA 4ACSA 4HI7A 3IOSA 5IOWA 1G7EA 1M9AA 3VWXA 3VWUA 4MJCA 3HZ4A 1FB0A 2EFDA 1EV9A 4K8MA 4KX4A 3V1WA 2DMLA 4K7OA 3Q19A 4TRXA 1UC7A 3N9JA 3EE2A 2I81A 2HSMB 1FOVA 4P3YB 2EC4A 1JZWA 4F0CA 4I2UA 1MD4A 3TJKA 4QL7A 4L5LA 3F4RA 3ED3A 2FLSA 3C1SA 4BVYA 3KEBA 1F2EA 1EWXA 4NXIA 2E7PA 3CYNA 4IJIA 1OC9B 3HA9A 4AJ8A 2NTOA 4ZILA 3M9KA 1ZOFA 4KNDA 4ULXA 4XS4B 3WT1A 4LA1A 4KA0A 2RM5A 1OKDA 1VF1A 1F3BA 4ZL7A 5CRWA 1MDIA 4MF7A 3HCZA 2ON7A 2R5GA 4GQCA 2GZYA 4RUVA 3MIXA 4AI6A 4GDFA 1ZGNA 2FWHA 1AUCA 2NBSA 3KH7A 5IMFA 3TKQA 5JWQB 2A2PA 4K7IA 4EIPA 1JZRA 3ZL5A 4HJMA 4BVYB 2WRTA 2QA1A 5D9XA 2QKEA 4KGIA 3FHKA 1V58A 3D6IA 3GN3A 4DVCA 3TOTA 4D73B 2IN3A 2J23A 1QUWA 4LMVA 4TW5A 1GL8A 3PPUA 3WD6A 2CVKA 4K9ZA 4G2EA 3QPMA 1OE8A 3QAVA 3TRPA 1FVKA 2LRCA 1SL0B 3N5OA 4KCEA 4YQMA 4ZL8A 2I9HA 2HLSA 3EVIA 5D96A 1QQ2A 1ZMAA 2GT5A 3Q74A 2MZCA 2IFQA 4TN8A 2HRKA 1I5GA 2CX4A 5G1KA 3ZREA 5ECSA 3CRUA 1JLWA 1TU7A 4N11A 3ZTLA 2GS3A 2TIRA 12GSA 3H79A 4MJAA 5ECMB 3OR5A 2MBTA 5ID2A 18GSA 2VCZA 5HR1A 1R5PA 4EO3A 1TXXA 1JZOA 5AIVA 3F4TA 1ERVA 2JSYA 4GSNA 2K9FA 1F3AA 2YOIA 1FW1A 4WBRD 2VD0A 2X8GA 5ECQB 2TRCP 3WGXA 3DRNA 5IQYA 4KE3A 3A5IA 2IFQB 3DIEA 2Z9SA 3W8JA 2WZ9A 1BX9A 5ECNB 4A5PA 1ZYEA 2OKAA 3ZLPA 3S9FA 1K0MA 4MA9A 4OFTA 1H75A 4KSMA 3UOMA 3DEXA 3EU3A 1JZDA 5IPHA 1XWKA 4OD7A 2C3QA 1RW1A 4TOPA 4NPBA 2L6CA 2YPMA 3VK9A 1XZOA 2DJ3A 3A5WA 3KM6A 5A5HA 1XFLA 2AJQB 4HEA2 3ZMLA 5J4UA 1OVNA 2B7JA 1GSFA 4HS1A 4AKXB 4POLA 5IM9A 1X5CA 4DEJA 2GGTA 2QSIA 3FW2A 4HJ2A 4XCSA 1FAAA 2L57A 1TRVA 1M2AA 3NIVA 3GHAA 3FMWA 5G5EA 2DBCA 4WR4A 1K0OA 4OCEA 4I5QA 1K3YA 1PD21 4N0ZA 4EF0A 5JCGA 5IMDA 1Z9HA 1GLPA 2EIRA 2B3SA 4MH2A 2DC5A 3C7MA 1M7TA 3RAZA 4CDOA 4TKYA 3LYPA 3ERWA 3MSZA 3GKMA 4ID0A 2H72A 3F3QA 5J9BA 5HQPA 2PWJA 2X99A 1TK0B 5H5RA 2NPBA 1AIUA 2P31A 2AYTA 1QGVA 4KUNA 2OADA 2ZUPA 1ILOA 1A2JA 1T4YA 3Q6OA 5G1LA 3F8UA 4MF5A 1OAZA 1NHOA 2PVOC 1K0CA 1U87A 3QMXA 5L71A 4PNFA 4I8BA 4NHZA 1VRSD 1XVWA 4POKA 1K3LA 2MBSA 1X5EA 2C80A 4F2IA 1LBKA 4ECCA 1I9DA 3HDCA 2FWFA 3GA4A 2RUEA 1YDKA 4PUFC 1BJXA 1CQHA 1EGOA 4G0IA 5IMAA 1DBYA 2LUSA 3FYGA 4ECBA 1X0RA 5A1NB 6GSXA 3U5RE 5H5QA 1BG5A 1TTZA 3GKNA 2OACA 1O85A 5LCZA 3UMAA 2WB9A 4PQ1A 4EE0A 2HI7A 19GSA 3BBYA 4V1Ag 3EYTA 1E2YA 1V57A 2N5AA 2M72A 1BAYA 3ZYWA 3HZ8A 1FOHA 5G30A 1S3AA 1YEPA 2GTUA 3EURA 5D9VA 1GP1A 2B5XA 4MPGA 2JSZA 1UVZA 3L4NA 1W89A 1PN0A 2LQOA 5GSSA 2E0QA 2FUG2 5ECRB 1B48A 3IE3A 4GXZA 2JADA 5C00A 2G2QA 2UV8G 1O81A 2DIYA 1QMVA 1GUMA 2H73A 3C1RA 1G7OA 2YANA 4K2DA 4CHSA 3A3TA 4K2XA 4F82A 2WULA 1B9XC 3EPTA 1SD9A 3CRTA 5F06A 3DD3A 4MDCA 1U3AA 1XIYA 2YWMA 1KNGA 1PKZA 4ZBDA 2DLXA 3CXGA 1LU4A 4KB3A 2GT6A 3WGDA 1HD2A 2CZ2A 3VFIA 1O73A 5B6NA 3LQ7A 3KXOA 1AC1A 3FZAA 2O85A 2L59A 1AQVA 1TK5B 1SK1A 3CMIA 1SL1B 2LNTA 4ICYA 4MABA 1BG1A 1N25A 5CRHA 3O3TA 2K18A 3F3RA 5J40A 3IC8A 4JU5A 4V2LA 3MWHA 1YJ6A 1A8YA 1EEJA 1T3BA 4IELA 3MDKA 2YWOA 4MCUA 1QXHA 3TJJA 5DCHA 3F9UA 4DSSA 4QQ7A 4Q5FA 5J41A 5HR3A 3TOUA 1GSQA 1WJKA 3DKSA 4IVFA 2JZRA 2DIZA 4KF9A 2PBJA 1EOGA 1PMTA 5A34A 3PINA 5HR2A 2PMTA 1DSBA 5ABRA 5CAXA 4TXOA 1X9SB 3FRCA 6GSYA 5D73A 3BCKA 3APQA 2R0GA 3C8EA 2PPTA 3L9VA 2PGTA 17GSA 3ZFBA 3US3A 1SK0A 2FCHA 2RLIA 4WKWA 2RIIA 1Z7PA 2JZTA 1BYEA 3UJ1A 1UA5A 4LLRA 1T1VA 4DSSB 1XOAA 3GMFA 2IMFA 4JEDA 4I6XA 2IMDA 4V2MA 1GRXA 5GAPD 4IQ1A 2EIQA 1OC8A 1Z7RA 4AJ7A 2X49A 5A34B 2CVDA 1ERUA 3KJYA 5FWGA 4ZXGA 2OE0A 3QAGA 2LJAA 2YZUA 2IJYA 2E2MA 4HZ2A 2A4VA 5AIXA 3FKFA 3VLNA 1O7UA 1GTAA 3FR9A 4KAEA 5F07A 3EINA 3IPZA 3TGZA 4GLTA 1NM3A 3KGKA 5GSTA 1HNCA 4Q5RA 5IMCA 1WWJA 3IDVA 1XWGA 2F8AA 2VM1A 1SKWB 1U3IA 2MMAA 2XBIA 2GVPA 3GYKA 2YCDA 4DSRA 2X8HA 3AY8A 2R6KA 4MMMA 1EEMA 5IMVA 2DKHA 3TJBA 2LNSA 2GSQA 3I43A 3ZIVA 1U88A 2E2GA 1G0TA 2AV4A 5H5SA 2HYXA 2REMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M0U A;  1WRY A;  1V98 A;  2F8F A;  2LQQ A;  2H19 A;  1B4P A;  2OE3 A;  6GSV A;  2VAF A;  2FY6 A;  5ELA A;  2LJK A;  3RHC A;  1MDK A;  2H1D A;  1GNE A;  2CAI A;  3UEM A;  5COH A;  2WS2 A;  4KSO A;  1DE2 A;  2YN1 A;  1XW5 A;  1TI1 A;  1ZCP A;  4RI6 A;  4Z7X A;  3J7Y k;  3O76 A;  1TP9 A;  4TR1 A;  1M99 A;  1NHY A;  2MYG A;  4DSQ A;  1KTE A;  5IO2 A;  3UBL A;  2XC2 A;  1EGR A;  4O7H A;  1TK8 B;  2H0G A;  2C0D A;  2FGX A;  5ELG A;  3UVT A;  2MMO A;  2GQL A;  4MK3 A;  2H70 A;  5FT3 A;  2MMN A;  1F37 A;  1Q4J A;  2XBQ A;  2IWT A;  3F0I A;  2V1M A;  3QFB C;  4FO5 A;  4E8H A;  1YF0 A;  5DCG A;  4MH3 A;  1GTI A;  4AF2 A;  5GZZ B;  2GST A;  2C3N A;  1S3C A;  3D5J A;  1R5A A;  1GSD A;  2AB6 A;  1TDI A;  6GSU A;  3D4M A;  3KMO A;  3TCO A;  4J56 E;  2JL4 A;  4FYC A;  5DAK A;  1Z6M A;  4XIH A;  2IMK A;  3G7I A;  1AAZ A;  4PUA A;  4XS6 A;  2PU9 C;  2O8V B;  3KH9 A;  2C1Y A;  2MMZ A;  4V1A p;  3HVS A;  4LL4 B;  9GSS A;  2WFC A;  4EVM A;  2VCT A;  1GUK A;  3HYP A;  5CNW A;  2FNO A;  3DVW A;  1MEK A;  4BL7 A;  4IP6 A;  3RDW A;  4NAX A;  1SJZ A;  1ZYQ B;  1K0N A;  3TKR A;  2CT6 A;  1FB6 A;  2CAQ A;  2HRK B;  1ABA A;  3ERG A;  1N2A A;  2L4Q A;  3PR8 A;  1WOU A;  2CQ9 A;  4OCF A;  1A2L A;  2N5B A;  3GH9 A;  1TI3 A;  3G7Y A;  4OMV A;  3UIW A;  5DAK B;  2GDR A;  4IKH A;  3VPQ A;  1UN2 A;  1MD3 A;  1SD8 A;  2H0H A;  14GS A;  3UAR A;  4FQU A;  5ID2 B;  4OO4 A;  22GS A;  4GF0 A;  1XW9 A;  3UAP A;  1XVQ A;  2BMX A;  2H30 A;  4RQX A;  2DSA A;  5CP1 A;  5DQY A;  2IME A;  4NHW A;  4MF6 A;  2NVL A;  3GUR A;  4LMW A;  3TB2 A;  1GTU A;  4ML6 A;  3E9J B;  2HSH A;  1ERW A;  2VOC A;  2B5E A;  5B8B A;  3TKS A;  2VM2 A;  4JR6 A;  4XHM A;  4NV2 A;  1ACV A;  1ST9 A;  5B6M A;  3CTG A;  4O5R A;  3H8Q A;  2P0G A;  4K6X A;  3D0Z A;  4F03 A;  3TJF A;  2HSN B;  3IXR A;  1KBN A;  1GSY A;  1XPV A;  2O89 A;  1RQM A;  2HT9 A;  4OO5 A;  2KOK A;  1WP0 A;  4GST A;  3C71 A;  1XCC A;  4MPF A;  2BTO T;  2LRT A;  1QK8 A;  4HDE A;  10GS A;  3QD9 A;  1LJR A;  2B7K A;  3H4K A;  4OFN A;  1A0F A;  3HVV A;  2F9S A;  4IBP A;  1Z5Y E;  1T8E B;  2L5L A;  16GS A;  3D4T A;  3TRQ A;  2VL2 A;  3DYR A;  1XWA A;  1SYX A;  2HFD A;  3HKR A;  3ZVJ A;  5G5F A;  3WGE A;  4YAP A;  2HRF A;  1VGL A;  3BJ5 A;  3H93 A;  5A4U A;  1F6M C;  5AN1 A;  4ZBB A;  2VLV A;  1TOF A;  3FZ5 A;  2OE1 A;  4E8E A;  3MAK A;  4OWY A;  5D93 A;  1O6J A;  3Q18 A;  2L5O A;  1AQX A;  4GQF A;  3EWL A;  4PQH A;  1IYI A;  2HSY A;  3HD5 A;  3PH9 A;  3P90 A;  1Y6E A;  2GQM A;  4MLY A;  3TUE A;  5B7C A;  4IJ3 A;  4WXT A;  2FWE A;  2LST A;  3O6T A;  2X64 A;  4PNG A;  3KTB A;  5G2Z A;  5EL8 A;  2FA8 A;  2DJK A;  3IA1 A;  5IMZ A;  1GUH A;  3CTF A;  4J2F A;  3EMP A;  3A2X A;  1ML6 A;  1KEB A;  5KN2 A;  4IGJ A;  1R26 A;  1ZZY A;  3GKX A;  1V40 A;  2P5R A;  1JHB A;  3ZZX A;  2H1G A;  2I1U A;  1CQG A;  2R37 A;  2YJ7 A;  2OBK A;  4IHU A;  4OFM A;  2B1L A;  4BVX A;  5IPG A;  2H1A A;  1URM A;  2CA8 A;  2HRA A;  4N10 A;  4WBJ A;  1DE1 A;  4ZL9 A;  3L78 A;  3LEF A;  1K0A A;  1OC3 A;  3KP8 A;  1U6T A;  4YH2 A;  4WEY A;  4HUA A;  2XPD A;  3GNJ A;  5JCW A;  3EU4 A;  1YKC A;  5FHI A;  13GS A;  4PGT A;  3VWW A;  3SWL A;  2LS5 A;  2HNL A;  4ISD A;  3L0H A;  2DMM A;  3F4S A;  2G0F A;  4I97 A;  1YQ1 A;  3GV1 A;  1XBS A;  1SEN A;  2H76 A;  2YJH A;  3KCM A;  1T00 A;  1PX6 A;  2H0I A;  5DBQ A;  3G9B A;  3WYW A;  4ZB8 A;  2CVB A;  4TR4 A;  3LSZ A;  2C3T A;  1GSS A;  3M0F A;  3IAS 2;  3TRX A;  4H86 A;  2LRN A;  8GSS A;  4KCA A;  2DJ1 A;  1THO A;  2WCI A;  1Z3E A;  2PN8 A;  3ME7 A;  3KZQ A;  3PGT A;  3HY2 A;  1YEX A;  2RM6 A;  2FHE A;  2HQT A;  3LYK A;  3C73 A;  1GNW A;  4JZQ A;  1JFU A;  4CW9 A;  4BWQ A;  2JU5 A;  4BA7 A;  1DUG A;  3UBK A;  3LFL A;  3DML A;  3GL5 A;  4F0B A;  4G19 A;  2VCX A;  4YQU A;  4JR4 A;  2QC7 A;  4EDZ A;  3IC4 A;  4ZIJ A;  2C4J A;  4K7N A;  2F51 A;  1AQW A;  5HFG A;  3MNG A;  1PX7 A;  1SK2 A;  4X43 A;  3QR6 A;  4MZW A;  4PQI A;  1HNA A;  2LKU A;  2VCW A;  4MZC A;  3RBT A;  4ZBA A;  1G6Y A;  2GZZ A;  3P2A A;  2OBI A;  4EDY A;  4IP1 A;  1ERT A;  4L5O A;  3RPN A;  5DQS A;  5KN0 A;  3P8W A;  3GX8 A;  5AIS A;  1SJI A;  3IK9 A;  3IK7 A;  2YV9 A;  4TXO B;  4PXO A;  1OKT A;  3IV4 A;  1M2B A;  1GUL A;  3BOA A;  4F9Z A;  3LG6 A;  2VO4 A;  1ON4 A;  4IS0 A;  5DVB A;  2HSM A;  3F6D A;  2PUK C;  2N5F A;  4TVE A;  2C0F A;  1NW2 A;  1WMJ A;  4L0U A;  4Q5N A;  20GS A;  4GCI A;  4GSS A;  4O92 A;  4PTS A;  3W8S A;  3ZIT A;  1PN9 A;  3LGC A;  2R3X A;  1TRU A;  1SYR A;  2H66 A;  2A2R A;  1OC9 A;  2K6V A;  1Z6N A;  5A5K A;  1AXD A;  2LJR A;  6GSW A;  1E6B A;  4XS4 A;  3HJO A;  2H71 A;  2CX3 A;  3KIJ A;  3VI7 A;  5J5N A;  5EPF A;  1J08 A;  5BMU A;  5A4W A;  5DJM A;  3VPT A;  1EV4 A;  2RUF A;  2YNX A;  5ECK B;  1PRX A;  3TKS E;  5GAN D;  1OE7 A;  2KP2 A;  3ZIJ A;  1GSU A;  3VUR A;  1EP8 A;  1XXU A;  2C0E A;  3FR3 A;  3GTU A;  2PER A;  5F8B A;  1B8X A;  4D73 A;  4KDU A;  2LV3 A;  1SU9 A;  1THX A;  4N30 A;  3FK8 A;  4EL1 A;  5JWO B;  1A2M A;  2V32 A;  3GRX A;  4TR0 A;  1X9W B;  1XW6 A;  3I9V 2;  1R4W A;  4FIW A;  4PX1 A;  2DJ0 A;  1EOH A;  2H8L A;  1SKS B;  5ECH B;  4Q5Q A;  5D9T A;  5LD0 A;  3K8N A;  2HZF A;  1HYU A;  2KP1 A;  1JLV A;  4O32 A;  2AHE A;  5E4W A;  1GWC A;  2B5Y A;  3I69 A;  3GL3 A;  5LNK e;  4FYU A;  3D21 A;  3DXB A;  3GTU B;  1PQN A;  3M1G A;  5C04 A;  5ECL B;  4TR1 B;  2VCV A;  1HNB A;  2ZCT A;  2ALB A;  1W4V A;  5KN1 A;  3APS A;  1TRS A;  5JWR B;  4POB A;  2YWI A;  4G10 A;  1SKR B;  4GTU A;  2GSS A;  1M2D A;  1F9M A;  4YQV A;  3LXZ A;  2ES7 A;  3RPP A;  1GLQ A;  2V6K A;  1PA3 A;  2R2J A;  5AGY A;  1H4O A;  2X8C A;  3TKS C;  3RHB A;  1WE0 A;  5J9C A;  2VL9 A;  5F0G A;  5EY6 A;  3CSJ A;  4BWS A;  3L9S A;  2XPE A;  2FWG A;  5B8A A;  2A2S A;  5ENU A;  2IMI A;  2OA7 A;  3P7X A;  1MDJ A;  2VIM A;  3J7Y b;  2H01 A;  2VUP A;  4XS1 A;  3WT2 A;  1ZL9 A;  1TKD B;  3TDG A;  1A23 A;  2FA4 A;  3F6F A;  2H6X A;  1USB A;  1Q98 A;  3A2W A;  4QL9 A;  1FO5 A;  3FY7 A;  5KEJ A;  1A8L A;  2CZ3 A;  1NSW A;  1O8X A;  2DJJ A;  5CO3 A;  1PKW A;  2FD3 A;  5DJL A;  2VL2 C;  2ZNM A;  1VF4 A;  3R2Q A;  3DWV A;  2JZS A;  5HFI A;  2C8U A;  2F3M A;  1TU8 A;  3CSH A;  4BL7 B;  6GST A;  3GH6 A;  4L0W A;  1GH2 A;  2IL3 A;  3GX0 A;  3NZN A;  4GRF A;  4FYB A;  1B9Y C;  4WF5 A;  3QCP A;  4LL1 B;  2BJX A;  1TW9 A;  1FG4 A;  4TR3 A;  4I2T A;  1YZX A;  1K0B A;  2J9H A;  4KH7 A;  2WDU A;  2OJL A;  3QDN A;  1A0R P;  3FZ9 A;  4G0L A;  2R4V A;  3I6A A;  4WET A;  2VD1 A;  1Y25 A;  2D2Z A;  2GQK A;  3GUS A;  3M8N A;  2VL3 A;  5DAL A;  2V2G A;  3IRA A;  1M9B A;  5A4V A;  1GSE A;  3IAM 2;  4HOJ A;  2NDO A;  1J0F A;  1TRW A;  1XOB A;  5IOX A;  5CRE A;  4GWR A;  3EC3 A;  3CBU A;  2M46 A;  2IPA A;  1SL2 B;  2IIY A;  1WIK A;  5CRD A;  2H6Y A;  2AUV A;  2YZH A;  3G7J A;  4ZB6 A;  3GFK A;  1N8J A;  2EIO A;  5F05 A;  3BCI A;  2H75 A;  2VLT A;  4KDX A;  4ZB9 A;  5E59 A;  4IQA A;  1X5D A;  3GST A;  4EXJ A;  5DAL B;  11GS A;  3UVH A;  3GKK A;  3SBC A;  4ECI A;  3JCM L;  3HJM A;  4K0G A;  1B4Q A;  1V2A A;  2WJU A;  4AGS A;  1FHE A;  3ME8 A;  2KUC A;  3ZFL A;  2JAC A;  2PVQ A;  5ECP B;  4AJ6 A;  3F63 A;  4RQR A;  2GLR A;  5IIZ A;  4XTS A;  3QAW A;  3QFA C;  3BD2 A;  1XWB A;  3UL3 A;  3VWV A;  2KHP A;  3CSI A;  3LXT A;  1PSQ A;  1PL1 A;  4USS A;  3HHV A;  4X1U A;  4NMU A;  4HQZ A;  5EVO A;  4MP4 A;  4MZB A;  3M3M A;  5HFK A;  2P5Q A;  3GIX A;  4EUY A;  2V41 A;  4NV5 A;  4PUR A;  3APO A;  3KTL A;  2KLX A;  1BED A;  4JRR A;  3D22 A;  3U6V A;  4V2N A;  4JE1 A;  2HZE A;  4WR5 A;  4K0N A;  2YP6 A;  2GSR A;  2H74 A;  5INY A;  3DGQ A;  4L8E A;  2VLU A;  5G31 A;  1FVJ A;  1OYJ A;  4YAV A;  2AAW A;  2ON5 A;  2O87 A;  5KN3 A;  1HQO A;  3ERF A;  2CV4 A;  3R3E A;  1MTC A;  4IW9 A;  5ECI B;  1QFN A;  2QGV A;  2LTK A;  4K1F A;  5JCU A;  4IN0 A;  4BVX B;  1TJD A;  3FR6 A;  4N0V A;  1YY7 A;  1XWC A;  3QOU A;  4EC0 A;  4RI7 A;  4G0K A;  2YWN A;  3HJP A;  2UZ8 A;  4ILF A;  6GSS A;  1BQ7 A;  3HVX A;  3NOF A;  5CRG A;  3E3E A;  4BPY A;  2C0G A;  3ZMK A;  4G9H A;  1K0D A;  2HZE B;  4HU7 A;  2HRN A;  1PGT A;  2M80 A;  1T7P B;  2I3Y A;  4KDY A;  1VF3 A;  4MJB A;  5HR0 A;  1C72 A;  3VI5 A;  3FZ4 A;  1YF1 A;  5ECO B;  3KP9 A;  7GSS A;  4POM A;  1V9W A;  4XRA A;  2HXK A;  4J57 E;  3A2V A;  1YKA A;  3ISO A;  5DDL A;  2K8S A;  1O8W A;  1A24 A;  4KW6 A;  2H6Z A;  1RK4 A;  1PL2 A;  3KD0 A;  4FH8 A;  3W6G A;  2B1K A;  1K3O A;  3GSS A;  2DJ2 A;  3M9J A;  4X0X A;  2I4A A;  4ECJ A;  2V6O A;  2HE3 A;  2WGR A;  1IYH A;  3EMX A;  3ZVJ D;  1AW9 A;  1S3D A;  2K8V A;  3H1N A;  3TJG A;  3HXS A;  4ML1 A;  2VCQ A;  3IR4 A;  1VF2 A;  3IHQ A;  1J9B A;  5CYY A;  3E0U A;  1EZK A;  4XRD A;  2LEG A;  1G6W A;  3L9U A;  2L4C A;  1R7H A;  4WF4 A;  2B6M A;  3FEU A;  2YV7 A;  3TKP A;  2H1B A;  2GZP A;  4TXV A;  2L6D A;  5D8I A;  5IO0 A;  1GTB A;  3DVX A;  4MJE A;  2XHF A;  4EKZ A;  1WPI A;  5J3R A;  2TRX A;  3LJR A;  5D9W A;  3LOR A;  4HQS A;  4HU9 A;  4HZ4 A;  4JBB A;  3KMN A;  1T4Z A;  2O7K A;  1SJ6 A;  3LWA A;  4NWY A;  1EP7 A;  3IBH A;  1X9M B;  3ZRD A;  4ACS A;  4HI7 A;  3IOS A;  5IOW A;  1G7E A;  1M9A A;  3VWX A;  3VWU A;  4MJC A;  3HZ4 A;  1FB0 A;  1EV9 A;  4K8M A;  4KX4 A;  3V1W A;  2DML A;  4K7O A;  3Q19 A;  4TRX A;  1UC7 A;  3N9J A;  3EE2 A;  2I81 A;  2HSM B;  1FOV A;  4P3Y B;  2EC4 A;  1JZW A;  4F0C A;  4I2U A;  1MD4 A;  3TJK A;  4QL7 A;  4L5L A;  3F4R A;  3ED3 A;  2FLS A;  3C1S A;  4BVY A;  3KEB A;  1F2E A;  1EWX A;  4NXI A;  2E7P A;  3CYN A;  4IJI A;  1OC9 B;  3HA9 A;  4AJ8 A;  2NTO A;  4ZIL A;  3M9K A;  1ZOF A;  4KND A;  4ULX A;  4XS4 B;  3WT1 A;  4LA1 A;  4KA0 A;  2RM5 A;  1OKD A;  1VF1 A;  1F3B A;  4ZL7 A;  5CRW A;  1MDI A;  4MF7 A;  3HCZ A;  2ON7 A;  2R5G A;  4GQC A;  2GZY A;  4RUV A;  1ZGN A;  2FWH A;  1AUC A;  2NBS A;  3KH7 A;  5IMF A;  3TKQ A;  5JWQ B;  4K7I A;  1JZR A;  3ZL5 A;  4HJM A;  4BVY B;  2WRT A;  5D9X A;  2QKE A;  4KGI A;  3FHK A;  1V58 A;  3D6I A;  3GN3 A;  4DVC A;  3TOT A;  4D73 B;  2IN3 A;  2J23 A;  1QUW A;  4LMV A;  4TW5 A;  1GL8 A;  3PPU A;  3WD6 A;  2CVK A;  4K9Z A;  4G2E A;  3QPM A;  1OE8 A;  3QAV A;  3TRP A;  1FVK A;  2LRC A;  1SL0 B;  3N5O A;  4KCE A;  4YQM A;  4ZL8 A;  2I9H A;  2HLS A;  3EVI A;  5D96 A;  1QQ2 A;  1ZMA A;  2GT5 A;  3Q74 A;  2MZC A;  2IFQ A;  4TN8 A;  2HRK A;  1I5G A;  2CX4 A;  5G1K A;  3ZRE A;  5ECS A;  3CRU A;  1JLW A;  1TU7 A;  4N11 A;  3ZTL A;  2GS3 A;  2TIR A;  12GS A;  3H79 A;  4MJA A;  5ECM B;  3OR5 A;  2MBT A;  5ID2 A;  18GS A;  2VCZ A;  5HR1 A;  1R5P A;  4EO3 A;  1TXX A;  1JZO A;  5AIV A;  3F4T A;  1ERV A;  2JSY A;  4GSN A;  2K9F A;  1F3A A;  2YOI A;  1FW1 A;  4WBR D;  2VD0 A;  2X8G A;  5ECQ B;  2TRC P;  3WGX A;  3DRN A;  5IQY A;  4KE3 A;  2IFQ B;  3DIE A;  2Z9S A;  3W8J A;  2WZ9 A;  1BX9 A;  5ECN B;  1ZYE A;  2OKA A;  3ZLP A;  3S9F A;  1K0M A;  4MA9 A;  4OFT A;  1H75 A;  4KSM A;  3UOM A;  3DEX A;  3EU3 A;  1JZD A;  5IPH A;  1XWK A;  4OD7 A;  2C3Q A;  1RW1 A;  4TOP A;  4NPB A;  2L6C A;  2YPM A;  3VK9 A;  1XZO A;  2DJ3 A;  3A5W A;  3KM6 A;  1XFL A;  2AJQ B;  4HEA 2;  3ZML A;  5J4U A;  1OVN A;  2B7J A;  1GSF A;  4HS1 A;  4POL A;  5IM9 A;  1X5C A;  4DEJ A;  2GGT A;  2QSI A;  3FW2 A;  4HJ2 A;  4XCS A;  1FAA A;  2L57 A;  1TRV A;  1M2A A;  3NIV A;  3GHA A;  5G5E A;  2DBC A;  4WR4 A;  1K0O A;  4OCE A;  4I5Q A;  1K3Y A;  1PD2 1;  4N0Z A;  4EF0 A;  5JCG A;  5IMD A;  1Z9H A;  1GLP A;  2EIR A;  2B3S A;  4MH2 A;  2DC5 A;  3C7M A;  1M7T A;  3RAZ A;  4CDO A;  4TKY A;  3LYP A;  3ERW A;  3MSZ A;  3GKM A;  4ID0 A;  2H72 A;  3F3Q A;  5J9B A;  5HQP A;  2PWJ A;  2X99 A;  1TK0 B;  5H5R A;  2NPB A;  1AIU A;  2P31 A;  2AYT A;  1QGV A;  4KUN A;  2OAD A;  2ZUP A;  1ILO A;  1A2J A;  1T4Y A;  3Q6O A;  5G1L A;  3F8U A;  4MF5 A;  1OAZ A;  1NHO A;  2PVO C;  1K0C A;  1U87 A;  3QMX A;  5L71 A;  4PNF A;  4I8B A;  4NHZ A;  1VRS D;  1XVW A;  4POK A;  1K3L A;  2MBS A;  1X5E A;  2C80 A;  4F2I A;  1LBK A;  4ECC A;  1I9D A;  3HDC A;  2FWF A;  3GA4 A;  2RUE A;  1YDK A;  4PUF C;  1BJX A;  1CQH A;  1EGO A;  4G0I A;  5IMA A;  1DBY A;  2LUS A;  3FYG A;  4ECB A;  1X0R A;  6GSX A;  3U5R E;  5H5Q A;  1BG5 A;  1TTZ A;  3GKN A;  2OAC A;  1O85 A;  5LCZ A;  3UMA A;  2WB9 A;  4PQ1 A;  4EE0 A;  2HI7 A;  19GS A;  3BBY A;  4V1A g;  3EYT A;  1E2Y A;  1V57 A;  2N5A A;  2M72 A;  1BAY A;  3ZYW A;  3HZ8 A;  5G30 A;  1S3A A;  1YEP A;  2GTU A;  3EUR A;  5D9V A;  1GP1 A;  2B5X A;  4MPG A;  2JSZ A;  1UVZ A;  3L4N A;  1W89 A;  2LQO A;  5GSS A;  2E0Q A;  2FUG 2;  5ECR B;  1B48 A;  3IE3 A;  4GXZ A;  2JAD A;  5C00 A;  2G2Q A;  1O81 A;  2DIY A;  1QMV A;  1GUM A;  2H73 A;  3C1R A;  1G7O A;  2YAN A;  4K2D A;  4CHS A;  3A3T A;  4F82 A;  2WUL A;  1B9X C;  1SD9 A;  3CRT A;  5F06 A;  3DD3 A;  4MDC A;  1U3A A;  1XIY A;  2YWM A;  1KNG A;  1PKZ A;  4ZBD A;  2DLX A;  3CXG A;  1LU4 A;  4KB3 A;  2GT6 A;  3WGD A;  1HD2 A;  2CZ2 A;  3VFI A;  1O73 A;  5B6N A;  3LQ7 A;  3KXO A;  1AC1 A;  3FZA A;  2O85 A;  2L59 A;  1AQV A;  1TK5 B;  1SK1 A;  3CMI A;  1SL1 B;  2LNT A;  4MAB A;  5CRH A;  3O3T A;  2K18 A;  3F3R A;  3IC8 A;  4JU5 A;  4V2L A;  3MWH A;  1YJ6 A;  1A8Y A;  1EEJ A;  1T3B A;  4IEL A;  3MDK A;  2YWO A;  4MCU A;  1QXH A;  3TJJ A;  5DCH A;  3F9U A;  4DSS A;  4QQ7 A;  4Q5F A;  5J41 A;  5HR3 A;  3TOU A;  1GSQ A;  1WJK A;  3DKS A;  4IVF A;  2JZR A;  4KF9 A;  2PBJ A;  2DIZ A;  1EOG A;  1PMT A;  3PIN A;  5HR2 A;  2PMT A;  1DSB A;  5ABR A;  5CAX A;  4TXO A;  1X9S B;  3FRC A;  6GSY A;  5D73 A;  3BCK A;  3APQ A;  3C8E A;  2PPT A;  3L9V A;  2PGT A;  17GS A;  3ZFB A;  3US3 A;  1SK0 A;  2FCH A;  2RLI A;  4WKW A;  2RII A;  1Z7P A;  2JZT A;  1BYE A;  3UJ1 A;  1UA5 A;  4LLR A;  1T1V A;  4DSS B;  1XOA A;  3GMF A;  2IMF A;  4JED A;  4I6X A;  2IMD A;  4V2M A;  1GRX A;  5GAP D;  4IQ1 A;  2EIQ A;  1OC8 A;  1Z7R A;  4AJ7 A;  2CVD A;  1ERU A;  3KJY A;  5FWG A;  4ZXG A;  2OE0 A;  3QAG A;  2LJA A;  2YZU A;  2IJY A;  2E2M A;  4HZ2 A;  2A4V A;  5AIX A;  3FKF A;  3VLN A;  1O7U A;  1GTA A;  3FR9 A;  4KAE A;  5F07 A;  3EIN A;  3IPZ A;  3TGZ A;  4GLT A;  1NM3 A;  3KGK A;  5GST A;  1HNC A;  4Q5R A;  5IMC A;  1WWJ A;  3IDV A;  1XWG A;  2F8A A;  2VM1 A;  1SKW B;  1U3I A;  2MMA A;  2XBI A;  2GVP A;  3GYK A;  2YCD A;  4DSR A;  2X8H A;  3AY8 A;  2R6K A;  4MMM A;  1EEM A;  5IMV A;  3TJB A;  2LNS A;  2GSQ A;  3I43 A;  3ZIV A;  1U88 A;  2E2G A;  1G0T A;  2AV4 A;  5H5S A;  2HYX A;  2REM A; 
#chains in the Genus database with same CATH topology
 1M0U A;  1WRY A;  1V98 A;  2F8F A;  2LQQ A;  2H19 A;  1B4P A;  2OE3 A;  6GSV A;  2VAF A;  2FY6 A;  5J4Y A;  5ELA A;  2LJK A;  3RHC A;  1MDK A;  2H1D A;  1GNE A;  2CAI A;  3UEM A;  5COH A;  2WS2 A;  4KSO A;  1DE2 A;  2YN1 A;  1XW5 A;  1TI1 A;  1ZCP A;  4RI6 A;  4Z7X A;  3J7Y k;  3O76 A;  1TP9 A;  4TR1 A;  1M99 A;  1NHY A;  2MYG A;  4DSQ A;  1KTE A;  5IO2 A;  3UBL A;  2XC2 A;  1EGR A;  4O7H A;  1TK8 B;  2H0G A;  4E68 A;  2C0D A;  2FGX A;  5ELG A;  3UVT A;  2MMO A;  2GQL A;  4MK3 A;  2H70 A;  5FT3 A;  2MMN A;  1F37 A;  1Q4J A;  2XBQ A;  2IWT A;  3F0I A;  2V1M A;  3QFB C;  4FO5 A;  4E8H A;  1YF0 A;  5DCG A;  4MH3 A;  4EIQ A;  1M3I A;  1GTI A;  4AF2 A;  5GZZ B;  2GST A;  2C3N A;  1S3C A;  3D5J A;  1R5A A;  1GSD A;  2AB6 A;  1TDI A;  6GSU A;  3D4M A;  3KMO A;  3TCO A;  4J56 E;  2JL4 A;  2H1L A;  4FYC A;  5DAK A;  1Z6M A;  4XIH A;  2IMK A;  3G7I A;  4Z2U A;  1AAZ A;  4PUA A;  4XS6 A;  2PU9 C;  2O8V B;  3KH9 A;  2C1Y A;  2MMZ A;  4V1A p;  3HVS A;  4LL4 B;  9GSS A;  2WFC A;  4EVM A;  2VCT A;  1GUK A;  3HYP A;  5CNW A;  4O5Q A;  2FNO A;  3DVW A;  1MEK A;  4BL7 A;  4IP6 A;  3RDW A;  4NAX A;  1SJZ A;  1ZYQ B;  1K0N A;  3TKR A;  2CT6 A;  1FB6 A;  2CAQ A;  2HRK B;  1ABA A;  3ERG A;  1N2A A;  2L4Q A;  3PR8 A;  1WOU A;  2CQ9 A;  4OCF A;  1A2L A;  2N5B A;  3GH9 A;  1TI3 A;  3G7Y A;  4OMV A;  3UIW A;  5DAK B;  2GDR A;  4IKH A;  3VPQ A;  1UN2 A;  1MD3 A;  1SD8 A;  2H0H A;  4AKG A;  2HSN A;  14GS A;  3UAR A;  4FQU A;  5ID2 B;  4OO4 A;  22GS A;  4GF0 A;  1XW9 A;  3UAP A;  1XVQ A;  2BMX A;  2H30 A;  4RQX A;  2DSA A;  5CP1 A;  5DQY A;  2IME A;  4NHW A;  4MF6 A;  2NVL A;  3GUR A;  4LMW A;  3TB2 A;  1GTU A;  4ML6 A;  3E9J B;  2HSH A;  1ERW A;  2VOC A;  4CY6 A;  2B5E A;  3LW9 A;  5B8B A;  3TKS A;  2VM2 A;  4JR6 A;  4XHM A;  4NV2 A;  4MNN A;  1ACV A;  1ST9 A;  5B6M A;  3CTG A;  4O5R A;  3H8Q A;  2P0G A;  4K6X A;  3D0Z A;  4F03 A;  3TJF A;  2HSN B;  3IXR A;  1KBN A;  1GSY A;  1XPV A;  2O89 A;  1RQM A;  2HT9 A;  4OO5 A;  2VKZ G;  2KOK A;  1BF5 A;  1WP0 A;  4GST A;  3C71 A;  1XCC A;  4MPF A;  2BTO T;  2LRT A;  5A5H B;  1QK8 A;  4HDE A;  10GS A;  3QD9 A;  4Z2R A;  1LJR A;  2B7K A;  3H4K A;  4OFN A;  1A0F A;  2O5V A;  3HVV A;  2F9S A;  4IBP A;  1Z5Y E;  1T8E B;  2L5L A;  16GS A;  3D4T A;  3TRQ A;  2VL2 A;  3DYR A;  1XWA A;  1SYX A;  2HFD A;  3HKR A;  3ZVJ A;  5G5F A;  3WGE A;  4YAP A;  5BRT A;  2HRF A;  1VGL A;  3BJ5 A;  3H93 A;  5A4U A;  1F6M C;  5AN1 A;  4ZBB A;  2VLV A;  1TOF A;  3FZ5 A;  3CQF A;  2OE1 A;  4E8E A;  3MAK A;  4OWY A;  5D93 A;  1O6J A;  3Q18 A;  2L5O A;  1AQX A;  4GQF A;  3EWL A;  4PQH A;  1IYI A;  2HSY A;  3HD5 A;  3PH9 A;  3P90 A;  1Y6E A;  2GQM A;  4MLY A;  3TUE A;  5B7C A;  4IJ3 A;  4WXT A;  2FWE A;  2LST A;  3O6T A;  2X64 A;  4PNG A;  3KTB A;  5G2Z A;  5EL8 A;  2FA8 A;  2DJK A;  3IA1 A;  5IMZ A;  1GUH A;  3CTF A;  4J2F A;  3EMP A;  3A2X A;  1ML6 A;  1KEB A;  5KN2 A;  4IGJ A;  1R26 A;  1ZZY A;  1ZYN A;  3GKX A;  1V40 A;  2P5R A;  1JHB A;  3ZZX A;  2WVZ A;  2H1G A;  2I1U A;  1CQG A;  2R37 A;  2YJ7 A;  2OBK A;  4IHU A;  4OFM A;  2B1L A;  4BVX A;  5IPG A;  2H1A A;  1URM A;  2CA8 A;  2HRA A;  4N10 A;  4N3Z A;  4WBJ A;  1DE1 A;  4ZL9 A;  3L78 A;  3LEF A;  1K0A A;  1OC3 A;  3KP8 A;  1U6T A;  4YH2 A;  4WEY A;  4HUA A;  2XPD A;  3GNJ A;  5JCW A;  3EU4 A;  1YKC A;  5FHI A;  13GS A;  4PGT A;  3VWW A;  3SWL A;  2LS5 A;  2HNL A;  4ISD A;  3L0H A;  2DMM A;  2WVX A;  3F4S A;  2G0F A;  4I97 A;  1YQ1 A;  3GV1 A;  1XBS A;  1SEN A;  2H76 A;  2YJH A;  3KCM A;  1T00 A;  1PX6 A;  2H0I A;  4X4J A;  5DBQ A;  3G9B A;  2X4A A;  3WYW A;  4ZB8 A;  2CVB A;  4TR4 A;  3LSZ A;  4AKI A;  2C3T A;  4K5S A;  1GSS A;  3M0F A;  3IAS 2;  3TU3 B;  3TRX A;  4H86 A;  1SVO A;  2LRN A;  8GSS A;  4KCA A;  2DJ1 A;  1THO A;  2WCI A;  1Z3E A;  2PN8 A;  3ME7 A;  3KZQ A;  3PGT A;  3HY2 A;  4W66 A;  1YEX A;  2RM6 A;  2FHE A;  2HQT A;  3LYK A;  3C73 A;  1GNW A;  4JZQ A;  1JFU A;  4CW9 A;  4HSC X;  4BWQ A;  2JU5 A;  4BA7 A;  1DUG A;  3UBK A;  3LFL A;  3DML A;  3GL5 A;  4F0B A;  4G19 A;  2VCX A;  4YQU A;  4JR4 A;  2QC7 A;  4EDZ A;  3IC4 A;  4ZIJ A;  2C4J A;  4K7N A;  2F51 A;  1AQW A;  5HFG A;  3MNG A;  1PX7 A;  1SK2 A;  4X43 A;  3QR6 A;  4MZW A;  4PQI A;  1YEW C;  1HNA A;  2LKU A;  2VCW A;  4MZC A;  3RBT A;  4ZBA A;  1G6Y A;  2GZZ A;  3P2A A;  2OBI A;  4EDY A;  4IP1 A;  1ERT A;  4L5O A;  3RPN A;  5DQS A;  5KN0 A;  3P8W A;  3GX8 A;  5AIS A;  1SJI A;  3IK9 A;  3IK7 A;  2YV9 A;  4TXO B;  4PXO A;  1OKT A;  3IV4 A;  1M2B A;  1GUL A;  3BOA A;  4F9Z A;  3LG6 A;  4FXY P;  2VO4 A;  1ON4 A;  4IS0 A;  5DVB A;  2HSM A;  4ZB7 A;  3F6D A;  5J47 A;  2PUK C;  2N5F A;  4TVE A;  2C0F A;  1ZYP A;  1NW2 A;  1WMJ A;  4L0U A;  3CWG A;  4Q5N A;  20GS A;  4GCI A;  4GSS A;  4O92 A;  4PTS A;  3W8S A;  3ZIT A;  1PN9 A;  3LGC A;  2R3X A;  1TRU A;  1SYR A;  2H66 A;  2A2R A;  1OC9 A;  2K6V A;  1Z6N A;  5A5K A;  1AXD A;  2LJR A;  6GSW A;  1E6B A;  4XS4 A;  3HJO A;  1TXU A;  2H71 A;  2CX3 A;  3KIJ A;  3VI7 A;  5J5N A;  5EPF A;  1J08 A;  5BMU A;  5A4W A;  5DJM A;  3VPT A;  1EV4 A;  2RUF A;  2YNX A;  5ECK B;  1PRX A;  3TKS E;  5GAN D;  1OE7 A;  2KP2 A;  3ZIJ A;  1GSU A;  3VUR A;  1EP8 A;  1XXU A;  2C0E A;  3FR3 A;  3GTU A;  2PER A;  5F8B A;  1M3J A;  1B8X A;  4D73 A;  4Z2T A;  4KDU A;  2LV3 A;  1SU9 A;  1THX A;  4N30 A;  2WW3 A;  3FK8 A;  4EL1 A;  5JWO B;  1A2M A;  2V32 A;  3GRX A;  4TR0 A;  1X9W B;  1XW6 A;  3I9V 2;  1R4W A;  4FIW A;  4PX1 A;  2DJ0 A;  1EOH A;  2H8L A;  5BMU B;  1SKS B;  3CHX C;  5ECH B;  4Q5Q A;  5D9T A;  5LD0 A;  3K8N A;  2HZF A;  1HYU A;  2KP1 A;  1JLV A;  4O32 A;  4CY8 A;  2AHE A;  5E4W A;  1GWC A;  2B5Y A;  3I69 A;  3GL3 A;  5LNK e;  4FYU A;  3D21 A;  3DXB A;  3GTU B;  1PQN A;  3M1G A;  5C04 A;  2WVY A;  5ECL B;  4TR1 B;  2VCV A;  1HNB A;  2ZCT A;  3IHG A;  2ALB A;  1W4V A;  5KN1 A;  3APS A;  1TRS A;  5JWR B;  4POB A;  2YWI A;  4G10 A;  1SKR B;  4GTU A;  2GSS A;  1M2D A;  1F9M A;  4YQV A;  3LXZ A;  2ES7 A;  3RPP A;  1GLQ A;  2V6K A;  1PA3 A;  2R2J A;  5AGY A;  1H4O A;  1Y1U A;  2X8C A;  3TKS C;  4BIK A;  3RHB A;  1WE0 A;  5J9C A;  2VL9 A;  2R0P A;  5F0G A;  5EY6 A;  3CSJ A;  4BWS A;  3L9S A;  2XPE A;  2FWG A;  5B8A A;  2A2S A;  5ENU A;  2IMI A;  2OA7 A;  3P7X A;  1MDJ A;  2VIM A;  3J7Y b;  2H01 A;  2VUP A;  4XS1 A;  3WT2 A;  1ZL9 A;  1TKD B;  3TDG A;  1A23 A;  2FA4 A;  3F6F A;  2H6X A;  1USB A;  1Q98 A;  3A2W A;  4QL9 A;  1FO5 A;  4YKF A;  3FY7 A;  5KEJ A;  1A8L A;  2CZ3 A;  1NSW A;  1O8X A;  2DJJ A;  5CO3 A;  1PKW A;  2FD3 A;  5DJL A;  1YVL A;  2VL2 C;  2ZNM A;  1VF4 A;  3R2Q A;  3DWV A;  2JZS A;  5HFI A;  2C8U A;  2F3M A;  1TU8 A;  3CSH A;  4BL7 B;  6GST A;  3GH6 A;  4L0W A;  1GH2 A;  2IL3 A;  3GX0 A;  3NZN A;  4GRF A;  4FYB A;  1B9Y C;  4WF5 A;  3QCP A;  4LL1 B;  2BJX A;  1TW9 A;  1FG4 A;  4TR3 A;  4I2T A;  1YZX A;  1K0B A;  2J9H A;  4KH7 A;  2WDU A;  2OJL A;  3QDN A;  1A0R P;  3FZ9 A;  4G0L A;  2WW0 A;  4YKG A;  2R4V A;  3I6A A;  4WET A;  2VD1 A;  1Y25 A;  2D2Z A;  2GQK A;  3GUS A;  3M8N A;  2VL3 A;  5DAL A;  2V2G A;  3IRA A;  1M9B A;  5A4V A;  1GSE A;  3IAM 2;  4HOJ A;  2DKI A;  2NDO A;  1J0F A;  1TRW A;  1XOB A;  5IOX A;  5CRE A;  4GWR A;  3EC3 A;  3CBU A;  2M46 A;  4G01 A;  2IPA A;  1PFO A;  1SL2 B;  2IIY A;  1WIK A;  5CRD A;  2H6Y A;  2QA2 A;  3MYD A;  2AUV A;  4K5R A;  2YZH A;  3G7J A;  4ZB6 A;  3GFK A;  1N8J A;  2EIO A;  5F05 A;  3BCI A;  2H75 A;  2VLT A;  4KDX A;  4ZB9 A;  5E59 A;  4IQA A;  5A1N A;  1X5D A;  2EFC A;  3GST A;  4EXJ A;  5DAL B;  11GS A;  3UVH A;  3GKK A;  3SBC A;  4ECI A;  3JCM L;  3HJM A;  4K0G A;  1B4Q A;  1V2A A;  2WJU A;  4AGS A;  1FHE A;  3ME8 A;  2KUC A;  3ZFL A;  2JAC A;  2PVQ A;  5ECP B;  4AJ6 A;  3F63 A;  4RQR A;  2GLR A;  5IIZ A;  4XTS A;  3QAW A;  3QFA C;  3BD2 A;  1XWB A;  3UL3 A;  3VWV A;  2KHP A;  3CSI A;  5J4V A;  3LXT A;  1PSQ A;  1PL1 A;  4USS A;  3HHV A;  4X1U A;  4NMU A;  4HQZ A;  5EVO A;  4MP4 A;  4MZB A;  3M3M A;  5HFK A;  2P5Q A;  3GIX A;  4EUY A;  2V41 A;  4NV5 A;  4PUR A;  3APO A;  3KTL A;  2KLX A;  1BED A;  4JRR A;  3D22 A;  3U6V A;  4V2N A;  4JE1 A;  2HZE A;  4WR5 A;  4K0N A;  2YP6 A;  2GSR A;  2H74 A;  5INY A;  3DGQ A;  4L8E A;  2VLU A;  5G31 A;  1FVJ A;  1OYJ A;  4YAV A;  2AAW A;  2ON5 A;  2O87 A;  5KN3 A;  1HQO A;  3ERF A;  2CV4 A;  5KOX A;  3R3E A;  1SVM A;  1MTC A;  4IW9 A;  5ECI B;  4AKH A;  1QFN A;  2QGV A;  2LTK A;  4K1F A;  5JCU A;  4IN0 A;  2EFH A;  4BVX B;  1TJD A;  3FR6 A;  4N0V A;  1YY7 A;  1XWC A;  3QOU A;  4EC0 A;  4RI7 A;  4G0K A;  2YWN A;  3HJP A;  2UZ8 A;  4ILF A;  6GSS A;  1BQ7 A;  3HVX A;  3NOF A;  5CRG A;  3E3E A;  1S3R A;  4BPY A;  2C0G A;  3ZMK A;  4G9H A;  1K0D A;  2HZE B;  4HU7 A;  2HRN A;  1PGT A;  2M80 A;  1T7P B;  2A4H A;  2I3Y A;  4KDY A;  1VF3 A;  4MJB A;  5HR0 A;  1C72 A;  3VI5 A;  3FZ4 A;  2EFE A;  2WVX B;  1YF1 A;  5ECO B;  3KP9 A;  2R0C A;  7GSS A;  4POM A;  4PHZ C;  1V9W A;  1SVL A;  3HMJ G;  4XRA A;  2HXK A;  4J57 E;  3A2V A;  1YKA A;  3ISO A;  5DDL A;  2K8S A;  1O8W A;  1A24 A;  4KW6 A;  5KOW A;  2H6Z A;  1RK4 A;  1PL2 A;  3KD0 A;  4FH8 A;  3W6G A;  2B1K A;  1K3O A;  3GSS A;  2DJ2 A;  3M9J A;  4X0X A;  2I4A A;  4ECJ A;  2V6O A;  2HE3 A;  2WGR A;  1IYH A;  3EMX A;  3ZVJ D;  1AW9 A;  1S3D A;  2K8V A;  3H1N A;  3TJG A;  3HXS A;  4ML1 A;  2VCQ A;  3IR4 A;  1VF2 A;  3IHQ A;  1J9B A;  5CYY A;  3E0U A;  1EZK A;  4XRD A;  2LEG A;  1G6W A;  3L9U A;  2L4C A;  1R7H A;  4WF4 A;  2B6M A;  3FEU A;  2YV7 A;  3TKP A;  2H1B A;  4O5U A;  2GZP A;  4TXV A;  2L6D A;  5D8I A;  5IO0 A;  1GTB A;  3DVX A;  4MJE A;  2XHF A;  4EKZ A;  1WPI A;  5J3R A;  2TRX A;  3LJR A;  5D9W A;  3LOR A;  4HQS A;  4HU9 A;  4HZ4 A;  4JBB A;  4QMK A;  3KMN A;  1T4Z A;  2O7K A;  2OT3 A;  1SJ6 A;  3LWA A;  4NWY A;  1EP7 A;  3IBH A;  1X9M B;  3ZRD A;  4ACS A;  4HI7 A;  3IOS A;  5IOW A;  1G7E A;  1M9A A;  3VWX A;  3VWU A;  4MJC A;  3HZ4 A;  1FB0 A;  2EFD A;  1EV9 A;  4K8M A;  4KX4 A;  3V1W A;  2DML A;  4K7O A;  3Q19 A;  4TRX A;  1UC7 A;  3N9J A;  3EE2 A;  2I81 A;  2HSM B;  1FOV A;  4P3Y B;  2EC4 A;  1JZW A;  4F0C A;  4I2U A;  1MD4 A;  3TJK A;  4QL7 A;  4L5L A;  3F4R A;  3ED3 A;  2FLS A;  3C1S A;  4BVY A;  3KEB A;  1F2E A;  1EWX A;  4NXI A;  2E7P A;  3CYN A;  4IJI A;  1OC9 B;  3HA9 A;  4AJ8 A;  2NTO A;  4ZIL A;  3M9K A;  1ZOF A;  4KND A;  4ULX A;  4XS4 B;  3WT1 A;  4LA1 A;  4KA0 A;  2RM5 A;  1OKD A;  1VF1 A;  1F3B A;  4ZL7 A;  5CRW A;  1MDI A;  4MF7 A;  3HCZ A;  2ON7 A;  2R5G A;  4GQC A;  2GZY A;  1XG8 A;  4RUV A;  3MIX A;  4AI6 A;  4GDF A;  1ZGN A;  2FWH A;  1AUC A;  2NBS A;  3KH7 A;  5IMF A;  3TKQ A;  5JWQ B;  2A2P A;  4K7I A;  4EIP A;  1JZR A;  3ZL5 A;  4HJM A;  4BVY B;  2WRT A;  2QA1 A;  5D9X A;  3RGB C;  2QKE A;  4KGI A;  3FHK A;  1V58 A;  3D6I A;  3GN3 A;  4DVC A;  3TOT A;  4D73 B;  2IN3 A;  2J23 A;  1QUW A;  4LMV A;  4TW5 A;  3RFR C;  1GL8 A;  3PPU A;  3WD6 A;  2CVK A;  4K9Z A;  4G2E A;  3QPM A;  1OE8 A;  3QAV A;  3TRP A;  1FVK A;  2LRC A;  1SL0 B;  3N5O A;  4KCE A;  4YQM A;  4ZL8 A;  2I9H A;  2HLS A;  3EVI A;  5D96 A;  1QQ2 A;  1ZMA A;  2GT5 A;  3Q74 A;  2MZC A;  2IFQ A;  4TN8 A;  2HRK A;  1I5G A;  2CX4 A;  5G1K A;  3ZRE A;  5ECS A;  3CRU A;  1JLW A;  1TU7 A;  4N11 A;  3ZTL A;  2GS3 A;  2TIR A;  12GS A;  3H79 A;  4MJA A;  5ECM B;  3OR5 A;  2MBT A;  5ID2 A;  18GS A;  2VCZ A;  5HR1 A;  1R5P A;  4EO3 A;  1TXX A;  1JZO A;  5AIV A;  3F4T A;  1ERV A;  2JSY A;  4GSN A;  2K9F A;  1F3A A;  2YOI A;  1FW1 A;  4WBR D;  2VD0 A;  2X8G A;  5ECQ B;  2TRC P;  3WGX A;  3DRN A;  5IQY A;  4KE3 A;  3A5I A;  2IFQ B;  3DIE A;  2Z9S A;  3W8J A;  2WZ9 A;  1BX9 A;  5ECN B;  4A5P A;  2WW1 A;  1ZYE A;  2OKA A;  3ZLP A;  3S9F A;  1K0M A;  4MA9 A;  4OFT A;  1H75 A;  4KSM A;  3UOM A;  3DEX A;  3EU3 A;  1JZD A;  2WW2 A;  5IPH A;  1XWK A;  4OD7 A;  2C3Q A;  1RW1 A;  4TOP A;  4NPB A;  2L6C A;  2YPM A;  3VK9 A;  1XZO A;  2DJ3 A;  3A5W A;  3KM6 A;  5A5H A;  1XFL A;  2AJQ B;  4HEA 2;  3ZML A;  5J4U A;  1OVN A;  2B7J A;  1GSF A;  4HS1 A;  4AKX B;  4POL A;  5IM9 A;  1X5C A;  4DEJ A;  2GGT A;  2QSI A;  3FW2 A;  4HJ2 A;  4XCS A;  1FAA A;  2L57 A;  1TRV A;  1M2A A;  3NIV A;  3GHA A;  3FMW A;  5G5E A;  2DBC A;  4WR4 A;  1K0O A;  4OCE A;  4I5Q A;  1K3Y A;  1PD2 1;  4N0Z A;  4EF0 A;  5JCG A;  5IMD A;  1Z9H A;  1GLP A;  2EIR A;  2B3S A;  4MH2 A;  2DC5 A;  3C7M A;  1M7T A;  3RAZ A;  4CDO A;  4TKY A;  3LYP A;  3ERW A;  3MSZ A;  1I1I P;  3GKM A;  4ID0 A;  2H72 A;  3F3Q A;  5J9B A;  5HQP A;  2PWJ A;  2X99 A;  1TK0 B;  5H5R A;  2NPB A;  1AIU A;  2P31 A;  2AYT A;  1QGV A;  4KUN A;  2OAD A;  2ZUP A;  1ILO A;  1A2J A;  1T4Y A;  3Q6O A;  5G1L A;  3F8U A;  4MF5 A;  1OAZ A;  1NHO A;  2PVO C;  1K0C A;  1U87 A;  3QMX A;  5L71 A;  4PNF A;  4I8B A;  4NHZ A;  1VRS D;  1XVW A;  4POK A;  1K3L A;  2MBS A;  1X5E A;  2C80 A;  4F2I A;  1LBK A;  4ECC A;  1I9D A;  3HDC A;  2FWF A;  3GA4 A;  2RUE A;  1YDK A;  4PUF C;  1BJX A;  1CQH A;  1EGO A;  4G0I A;  5IMA A;  1DBY A;  2LUS A;  3FYG A;  4ECB A;  1X0R A;  5A1N B;  6GSX A;  3U5R E;  5H5Q A;  1BG5 A;  1TTZ A;  3GKN A;  2OAC A;  1O85 A;  5LCZ A;  3UMA A;  4PI2 C;  2WB9 A;  4PQ1 A;  4EE0 A;  2HI7 A;  19GS A;  3BBY A;  4V1A g;  3EYT A;  1E2Y A;  1V57 A;  2N5A A;  2M72 A;  1BAY A;  3ZYW A;  3HZ8 A;  1FOH A;  5G30 A;  1S3A A;  1YEP A;  2GTU A;  3EUR A;  5D9V A;  1GP1 A;  2B5X A;  4MPG A;  2JSZ A;  1UVZ A;  3L4N A;  1W89 A;  1PN0 A;  2LQO A;  5GSS A;  2E0Q A;  2FUG 2;  5ECR B;  1B48 A;  3IE3 A;  4GXZ A;  2JAD A;  5C00 A;  2G2Q A;  2UV8 G;  1O81 A;  2DIY A;  1QMV A;  1GUM A;  2H73 A;  3C1R A;  1G7O A;  2YAN A;  4K2D A;  4CHS A;  3A3T A;  4K2X A;  4F82 A;  2WUL A;  2O36 A;  1B9X C;  3EPT A;  1SD9 A;  3CRT A;  5F06 A;  3DD3 A;  4MDC A;  1U3A A;  1XIY A;  2YWM A;  1KNG A;  1PKZ A;  4ZBD A;  2DLX A;  3CXG A;  1LU4 A;  4KB3 A;  2GT6 A;  3WGD A;  1HD2 A;  2CZ2 A;  3VFI A;  1O73 A;  5B6N A;  3LQ7 A;  3KXO A;  1AC1 A;  3FZA A;  2O85 A;  2L59 A;  1AQV A;  1TK5 B;  2WZS A;  1SK1 A;  3CMI A;  1SL1 B;  2LNT A;  4ICY A;  4MAB A;  1BG1 A;  1N25 A;  4PI0 C;  5CRH A;  3HVN A;  3O3T A;  2K18 A;  3F3R A;  5J40 A;  3IC8 A;  4JU5 A;  4V2L A;  3MWH A;  1YJ6 A;  1A8Y A;  1EEJ A;  1T3B A;  4IEL A;  3MDK A;  2YWO A;  4MCU A;  1QXH A;  3TJJ A;  5DCH A;  2O3E A;  3F9U A;  4DSS A;  4QQ7 A;  4Q5F A;  5J41 A;  5HR3 A;  3TOU A;  1GSQ A;  1WJK A;  3DKS A;  4IVF A;  2JZR A;  2DIZ A;  4KF9 A;  2PBJ A;  1EOG A;  1PMT A;  5A34 A;  3PIN A;  5HR2 A;  2PMT A;  1DSB A;  5ABR A;  5CAX A;  4TXO A;  1X9S B;  3FRC A;  6GSY A;  5D73 A;  3BCK A;  3APQ A;  2R0G A;  3C8E A;  2PPT A;  3L9V A;  2PGT A;  17GS A;  3ZFB A;  3US3 A;  1SK0 A;  2FCH A;  2RLI A;  4WKW A;  2RII A;  1Z7P A;  2JZT A;  1BYE A;  3UJ1 A;  1UA5 A;  4LLR A;  1T1V A;  4DSS B;  1XOA A;  3GMF A;  2IMF A;  4JED A;  4I6X A;  2IMD A;  4V2M A;  1GRX A;  5GAP D;  4IQ1 A;  2EIQ A;  1OC8 A;  1Z7R A;  4AJ7 A;  2X49 A;  5A34 B;  2CVD A;  1ERU A;  3KJY A;  5FWG A;  4ZXG A;  2OE0 A;  3QAG A;  2LJA A;  2YZU A;  2IJY A;  2E2M A;  4HZ2 A;  2A4V A;  5AIX A;  3FKF A;  3VLN A;  1O7U A;  1GTA A;  3FR9 A;  4KAE A;  5F07 A;  3EIN A;  3IPZ A;  3TGZ A;  4GLT A;  1NM3 A;  3KGK A;  1S4B P;  5GST A;  1HNC A;  4Q5R A;  5IMC A;  1WWJ A;  3IDV A;  1XWG A;  2F8A A;  2VM1 A;  1SKW B;  1U3I A;  2MMA A;  2XBI A;  2GVP A;  3GYK A;  2YCD A;  4DSR A;  2X8H A;  3AY8 A;  2R6K A;  4MMM A;  1EEM A;  5IMV A;  2DKH A;  3TJB A;  2LNS A;  2GSQ A;  3I43 A;  3ZIV A;  1U88 A;  2E2G A;  1G0T A;  2AV4 A;  5H5S A;  2HYX A;  2REM A; 
#chains in the Genus database with same CATH homology
 1M0U A;  1WRY A;  1V98 A;  2F8F A;  2LQQ A;  2H19 A;  1B4P A;  2OE3 A;  6GSV A;  2VAF A;  2FY6 A;  5J4Y A;  5ELA A;  2LJK A;  3RHC A;  1MDK A;  2H1D A;  1GNE A;  2CAI A;  3UEM A;  5COH A;  2WS2 A;  4KSO A;  1DE2 A;  2YN1 A;  1XW5 A;  1TI1 A;  1ZCP A;  4RI6 A;  4Z7X A;  3J7Y k;  3O76 A;  1TP9 A;  4TR1 A;  1M99 A;  1NHY A;  2MYG A;  4DSQ A;  1KTE A;  5IO2 A;  3UBL A;  2XC2 A;  1EGR A;  4O7H A;  1TK8 B;  2H0G A;  4E68 A;  2C0D A;  2FGX A;  5ELG A;  3UVT A;  2MMO A;  2GQL A;  4MK3 A;  2H70 A;  5FT3 A;  2MMN A;  1F37 A;  1Q4J A;  2XBQ A;  2IWT A;  3F0I A;  2V1M A;  3QFB C;  4FO5 A;  4E8H A;  1YF0 A;  5DCG A;  4MH3 A;  4EIQ A;  1GTI A;  4AF2 A;  5GZZ B;  2GST A;  2C3N A;  1S3C A;  3D5J A;  1R5A A;  1GSD A;  2AB6 A;  1TDI A;  6GSU A;  3D4M A;  3KMO A;  3TCO A;  4J56 E;  2JL4 A;  2H1L A;  4FYC A;  5DAK A;  1Z6M A;  4XIH A;  2IMK A;  3G7I A;  4Z2U A;  1AAZ A;  4PUA A;  4XS6 A;  2PU9 C;  2O8V B;  3KH9 A;  2C1Y A;  2MMZ A;  4V1A p;  3HVS A;  4LL4 B;  9GSS A;  2WFC A;  4EVM A;  2VCT A;  1GUK A;  3HYP A;  5CNW A;  4O5Q A;  2FNO A;  3DVW A;  1MEK A;  4BL7 A;  4IP6 A;  3RDW A;  4NAX A;  1SJZ A;  1ZYQ B;  1K0N A;  3TKR A;  2CT6 A;  1FB6 A;  2CAQ A;  2HRK B;  1ABA A;  3ERG A;  1N2A A;  2L4Q A;  3PR8 A;  1WOU A;  2CQ9 A;  4OCF A;  1A2L A;  2N5B A;  3GH9 A;  1TI3 A;  3G7Y A;  4OMV A;  3UIW A;  5DAK B;  2GDR A;  4IKH A;  3VPQ A;  1UN2 A;  1MD3 A;  1SD8 A;  2H0H A;  4AKG A;  2HSN A;  14GS A;  3UAR A;  4FQU A;  5ID2 B;  4OO4 A;  22GS A;  4GF0 A;  1XW9 A;  3UAP A;  1XVQ A;  2BMX A;  2H30 A;  4RQX A;  2DSA A;  5CP1 A;  5DQY A;  2IME A;  4NHW A;  4MF6 A;  2NVL A;  3GUR A;  4LMW A;  3TB2 A;  1GTU A;  4ML6 A;  3E9J B;  2HSH A;  1ERW A;  2VOC A;  4CY6 A;  2B5E A;  3LW9 A;  5B8B A;  3TKS A;  2VM2 A;  4JR6 A;  4XHM A;  4NV2 A;  4MNN A;  1ACV A;  1ST9 A;  5B6M A;  3CTG A;  4O5R A;  3H8Q A;  2P0G A;  4K6X A;  3D0Z A;  4F03 A;  3TJF A;  2HSN B;  3IXR A;  1KBN A;  1GSY A;  1XPV A;  2O89 A;  1RQM A;  2HT9 A;  4OO5 A;  2VKZ G;  2KOK A;  1BF5 A;  1WP0 A;  4GST A;  3C71 A;  1XCC A;  4MPF A;  2BTO T;  2LRT A;  5A5H B;  1QK8 A;  4HDE A;  10GS A;  3QD9 A;  4Z2R A;  1LJR A;  2B7K A;  3H4K A;  4OFN A;  1A0F A;  2O5V A;  3HVV A;  2F9S A;  4IBP A;  1Z5Y E;  1T8E B;  2L5L A;  16GS A;  3D4T A;  3TRQ A;  2VL2 A;  3DYR A;  1XWA A;  1SYX A;  2HFD A;  3HKR A;  3ZVJ A;  5G5F A;  3WGE A;  4YAP A;  5BRT A;  2HRF A;  1VGL A;  3BJ5 A;  3H93 A;  5A4U A;  1F6M C;  5AN1 A;  4ZBB A;  2VLV A;  1TOF A;  3FZ5 A;  2OE1 A;  4E8E A;  3MAK A;  4OWY A;  5D93 A;  1O6J A;  3Q18 A;  2L5O A;  1AQX A;  4GQF A;  3EWL A;  4PQH A;  1IYI A;  2HSY A;  3HD5 A;  3PH9 A;  3P90 A;  1Y6E A;  2GQM A;  4MLY A;  3TUE A;  5B7C A;  4IJ3 A;  4WXT A;  2FWE A;  2LST A;  3O6T A;  2X64 A;  4PNG A;  3KTB A;  5G2Z A;  5EL8 A;  2FA8 A;  2DJK A;  3IA1 A;  5IMZ A;  1GUH A;  3CTF A;  4J2F A;  3EMP A;  3A2X A;  1ML6 A;  1KEB A;  5KN2 A;  4IGJ A;  1R26 A;  1ZZY A;  1ZYN A;  3GKX A;  1V40 A;  2P5R A;  1JHB A;  3ZZX A;  2H1G A;  2I1U A;  1CQG A;  2R37 A;  2YJ7 A;  2OBK A;  4IHU A;  4OFM A;  2B1L A;  4BVX A;  5IPG A;  2H1A A;  1URM A;  2CA8 A;  2HRA A;  4N10 A;  4N3Z A;  4WBJ A;  1DE1 A;  4ZL9 A;  3L78 A;  3LEF A;  1K0A A;  1OC3 A;  3KP8 A;  1U6T A;  4YH2 A;  4WEY A;  4HUA A;  2XPD A;  3GNJ A;  5JCW A;  3EU4 A;  1YKC A;  5FHI A;  13GS A;  4PGT A;  3VWW A;  3SWL A;  2LS5 A;  2HNL A;  4ISD A;  3L0H A;  2DMM A;  3F4S A;  2G0F A;  4I97 A;  1YQ1 A;  3GV1 A;  1XBS A;  1SEN A;  2H76 A;  2YJH A;  3KCM A;  1T00 A;  1PX6 A;  2H0I A;  4X4J A;  5DBQ A;  3G9B A;  2X4A A;  3WYW A;  4ZB8 A;  2CVB A;  4TR4 A;  3LSZ A;  4AKI A;  2C3T A;  4K5S A;  1GSS A;  3M0F A;  3IAS 2;  3TU3 B;  3TRX A;  4H86 A;  1SVO A;  2LRN A;  8GSS A;  4KCA A;  2DJ1 A;  1THO A;  2WCI A;  1Z3E A;  2PN8 A;  3ME7 A;  3KZQ A;  3PGT A;  3HY2 A;  4W66 A;  1YEX A;  2RM6 A;  2FHE A;  2HQT A;  3LYK A;  3C73 A;  1GNW A;  4JZQ A;  1JFU A;  4CW9 A;  4BWQ A;  2JU5 A;  4BA7 A;  1DUG A;  3UBK A;  3LFL A;  3DML A;  3GL5 A;  4F0B A;  4G19 A;  2VCX A;  4YQU A;  4JR4 A;  2QC7 A;  4EDZ A;  3IC4 A;  4ZIJ A;  2C4J A;  4K7N A;  2F51 A;  1AQW A;  5HFG A;  3MNG A;  1PX7 A;  1SK2 A;  4X43 A;  3QR6 A;  4MZW A;  4PQI A;  1HNA A;  2LKU A;  2VCW A;  4MZC A;  3RBT A;  4ZBA A;  1G6Y A;  2GZZ A;  3P2A A;  2OBI A;  4EDY A;  4IP1 A;  1ERT A;  4L5O A;  3RPN A;  5DQS A;  5KN0 A;  3P8W A;  3GX8 A;  5AIS A;  1SJI A;  3IK9 A;  3IK7 A;  2YV9 A;  4TXO B;  4PXO A;  1OKT A;  3IV4 A;  1M2B A;  1GUL A;  3BOA A;  4F9Z A;  3LG6 A;  2VO4 A;  1ON4 A;  4IS0 A;  5DVB A;  2HSM A;  4ZB7 A;  3F6D A;  5J47 A;  2PUK C;  2N5F A;  4TVE A;  2C0F A;  1ZYP A;  1NW2 A;  1WMJ A;  4L0U A;  3CWG A;  4Q5N A;  20GS A;  4GCI A;  4GSS A;  4O92 A;  4PTS A;  3W8S A;  3ZIT A;  1PN9 A;  3LGC A;  2R3X A;  1TRU A;  1SYR A;  2H66 A;  2A2R A;  1OC9 A;  2K6V A;  1Z6N A;  5A5K A;  1AXD A;  2LJR A;  6GSW A;  1E6B A;  4XS4 A;  3HJO A;  1TXU A;  2H71 A;  2CX3 A;  3KIJ A;  3VI7 A;  5J5N A;  5EPF A;  1J08 A;  5BMU A;  5A4W A;  5DJM A;  3VPT A;  1EV4 A;  2RUF A;  2YNX A;  5ECK B;  1PRX A;  3TKS E;  5GAN D;  1OE7 A;  2KP2 A;  3ZIJ A;  1GSU A;  3VUR A;  1EP8 A;  1XXU A;  2C0E A;  3FR3 A;  3GTU A;  2PER A;  5F8B A;  1B8X A;  4D73 A;  4Z2T A;  4KDU A;  2LV3 A;  1SU9 A;  1THX A;  4N30 A;  3FK8 A;  4EL1 A;  5JWO B;  1A2M A;  2V32 A;  3GRX A;  4TR0 A;  1X9W B;  1XW6 A;  3I9V 2;  1R4W A;  4FIW A;  4PX1 A;  2DJ0 A;  1EOH A;  2H8L A;  5BMU B;  1SKS B;  5ECH B;  4Q5Q A;  5D9T A;  5LD0 A;  3K8N A;  2HZF A;  1HYU A;  2KP1 A;  1JLV A;  4O32 A;  4CY8 A;  2AHE A;  5E4W A;  1GWC A;  2B5Y A;  3I69 A;  3GL3 A;  5LNK e;  4FYU A;  3D21 A;  3DXB A;  3GTU B;  1PQN A;  3M1G A;  5C04 A;  5ECL B;  4TR1 B;  2VCV A;  1HNB A;  2ZCT A;  3IHG A;  2ALB A;  1W4V A;  5KN1 A;  3APS A;  1TRS A;  5JWR B;  4POB A;  2YWI A;  4G10 A;  1SKR B;  4GTU A;  2GSS A;  1M2D A;  1F9M A;  4YQV A;  3LXZ A;  2ES7 A;  3RPP A;  1GLQ A;  2V6K A;  1PA3 A;  2R2J A;  5AGY A;  1H4O A;  1Y1U A;  2X8C A;  3TKS C;  3RHB A;  1WE0 A;  5J9C A;  2VL9 A;  2R0P A;  5F0G A;  5EY6 A;  3CSJ A;  4BWS A;  3L9S A;  2XPE A;  2FWG A;  5B8A A;  2A2S A;  5ENU A;  2IMI A;  2OA7 A;  3P7X A;  1MDJ A;  2VIM A;  3J7Y b;  2H01 A;  2VUP A;  4XS1 A;  3WT2 A;  1ZL9 A;  1TKD B;  3TDG A;  1A23 A;  2FA4 A;  3F6F A;  2H6X A;  1USB A;  1Q98 A;  3A2W A;  4QL9 A;  1FO5 A;  4YKF A;  3FY7 A;  5KEJ A;  1A8L A;  2CZ3 A;  1NSW A;  1O8X A;  2DJJ A;  5CO3 A;  1PKW A;  2FD3 A;  5DJL A;  1YVL A;  2VL2 C;  2ZNM A;  1VF4 A;  3R2Q A;  3DWV A;  2JZS A;  5HFI A;  2C8U A;  2F3M A;  1TU8 A;  3CSH A;  4BL7 B;  6GST A;  3GH6 A;  4L0W A;  1GH2 A;  2IL3 A;  3GX0 A;  3NZN A;  4GRF A;  4FYB A;  1B9Y C;  4WF5 A;  3QCP A;  4LL1 B;  2BJX A;  1TW9 A;  1FG4 A;  4TR3 A;  4I2T A;  1YZX A;  1K0B A;  2J9H A;  4KH7 A;  2WDU A;  2OJL A;  3QDN A;  1A0R P;  3FZ9 A;  4G0L A;  4YKG A;  2R4V A;  3I6A A;  4WET A;  2VD1 A;  1Y25 A;  2D2Z A;  2GQK A;  3GUS A;  3M8N A;  2VL3 A;  5DAL A;  2V2G A;  3IRA A;  1M9B A;  5A4V A;  1GSE A;  3IAM 2;  4HOJ A;  2DKI A;  2NDO A;  1J0F A;  1TRW A;  1XOB A;  5IOX A;  5CRE A;  4GWR A;  3EC3 A;  3CBU A;  2M46 A;  4G01 A;  2IPA A;  1SL2 B;  2IIY A;  1WIK A;  5CRD A;  2H6Y A;  2QA2 A;  3MYD A;  2AUV A;  4K5R A;  2YZH A;  3G7J A;  4ZB6 A;  3GFK A;  1N8J A;  2EIO A;  5F05 A;  3BCI A;  2H75 A;  2VLT A;  4KDX A;  4ZB9 A;  5E59 A;  4IQA A;  5A1N A;  1X5D A;  2EFC A;  3GST A;  4EXJ A;  5DAL B;  11GS A;  3UVH A;  3GKK A;  3SBC A;  4ECI A;  3JCM L;  3HJM A;  4K0G A;  1B4Q A;  1V2A A;  2WJU A;  4AGS A;  1FHE A;  3ME8 A;  2KUC A;  3ZFL A;  2JAC A;  2PVQ A;  5ECP B;  4AJ6 A;  3F63 A;  4RQR A;  2GLR A;  5IIZ A;  4XTS A;  3QAW A;  3QFA C;  3BD2 A;  1XWB A;  3UL3 A;  3VWV A;  2KHP A;  3CSI A;  5J4V A;  3LXT A;  1PSQ A;  1PL1 A;  4USS A;  3HHV A;  4X1U A;  4NMU A;  4HQZ A;  5EVO A;  4MP4 A;  4MZB A;  3M3M A;  5HFK A;  2P5Q A;  3GIX A;  4EUY A;  2V41 A;  4NV5 A;  4PUR A;  3APO A;  3KTL A;  2KLX A;  1BED A;  4JRR A;  3D22 A;  3U6V A;  4V2N A;  4JE1 A;  2HZE A;  4WR5 A;  4K0N A;  2YP6 A;  2GSR A;  2H74 A;  5INY A;  3DGQ A;  4L8E A;  2VLU A;  5G31 A;  1FVJ A;  1OYJ A;  4YAV A;  2AAW A;  2ON5 A;  2O87 A;  5KN3 A;  1HQO A;  3ERF A;  2CV4 A;  5KOX A;  3R3E A;  1SVM A;  1MTC A;  4IW9 A;  5ECI B;  4AKH A;  1QFN A;  2QGV A;  2LTK A;  4K1F A;  5JCU A;  4IN0 A;  2EFH A;  4BVX B;  1TJD A;  3FR6 A;  4N0V A;  1YY7 A;  1XWC A;  3QOU A;  4EC0 A;  4RI7 A;  4G0K A;  2YWN A;  3HJP A;  2UZ8 A;  4ILF A;  6GSS A;  1BQ7 A;  3HVX A;  3NOF A;  5CRG A;  3E3E A;  4BPY A;  2C0G A;  3ZMK A;  4G9H A;  1K0D A;  2HZE B;  4HU7 A;  2HRN A;  1PGT A;  2M80 A;  1T7P B;  2A4H A;  2I3Y A;  4KDY A;  1VF3 A;  4MJB A;  5HR0 A;  1C72 A;  3VI5 A;  3FZ4 A;  2EFE A;  1YF1 A;  5ECO B;  3KP9 A;  2R0C A;  7GSS A;  4POM A;  1V9W A;  1SVL A;  3HMJ G;  4XRA A;  2HXK A;  4J57 E;  3A2V A;  1YKA A;  3ISO A;  5DDL A;  2K8S A;  1O8W A;  1A24 A;  4KW6 A;  5KOW A;  2H6Z A;  1RK4 A;  1PL2 A;  3KD0 A;  4FH8 A;  3W6G A;  2B1K A;  1K3O A;  3GSS A;  2DJ2 A;  3M9J A;  4X0X A;  2I4A A;  4ECJ A;  2V6O A;  2HE3 A;  2WGR A;  1IYH A;  3EMX A;  3ZVJ D;  1AW9 A;  1S3D A;  2K8V A;  3H1N A;  3TJG A;  3HXS A;  4ML1 A;  2VCQ A;  3IR4 A;  1VF2 A;  3IHQ A;  1J9B A;  5CYY A;  3E0U A;  1EZK A;  4XRD A;  2LEG A;  1G6W A;  3L9U A;  2L4C A;  1R7H A;  4WF4 A;  2B6M A;  3FEU A;  2YV7 A;  3TKP A;  2H1B A;  4O5U A;  2GZP A;  4TXV A;  2L6D A;  5D8I A;  5IO0 A;  1GTB A;  3DVX A;  4MJE A;  2XHF A;  4EKZ A;  1WPI A;  5J3R A;  2TRX A;  3LJR A;  5D9W A;  3LOR A;  4HQS A;  4HU9 A;  4HZ4 A;  4JBB A;  4QMK A;  3KMN A;  1T4Z A;  2O7K A;  2OT3 A;  1SJ6 A;  3LWA A;  4NWY A;  1EP7 A;  3IBH A;  1X9M B;  3ZRD A;  4ACS A;  4HI7 A;  3IOS A;  5IOW A;  1G7E A;  1M9A A;  3VWX A;  3VWU A;  4MJC A;  3HZ4 A;  1FB0 A;  2EFD A;  1EV9 A;  4K8M A;  4KX4 A;  3V1W A;  2DML A;  4K7O A;  3Q19 A;  4TRX A;  1UC7 A;  3N9J A;  3EE2 A;  2I81 A;  2HSM B;  1FOV A;  4P3Y B;  2EC4 A;  1JZW A;  4F0C A;  4I2U A;  1MD4 A;  3TJK A;  4QL7 A;  4L5L A;  3F4R A;  3ED3 A;  2FLS A;  3C1S A;  4BVY A;  3KEB A;  1F2E A;  1EWX A;  4NXI A;  2E7P A;  3CYN A;  4IJI A;  1OC9 B;  3HA9 A;  4AJ8 A;  2NTO A;  4ZIL A;  3M9K A;  1ZOF A;  4KND A;  4ULX A;  4XS4 B;  3WT1 A;  4LA1 A;  4KA0 A;  2RM5 A;  1OKD A;  1VF1 A;  1F3B A;  4ZL7 A;  5CRW A;  1MDI A;  4MF7 A;  3HCZ A;  2ON7 A;  2R5G A;  4GQC A;  2GZY A;  4RUV A;  3MIX A;  4AI6 A;  4GDF A;  1ZGN A;  2FWH A;  1AUC A;  2NBS A;  3KH7 A;  5IMF A;  3TKQ A;  5JWQ B;  2A2P A;  4K7I A;  4EIP A;  1JZR A;  3ZL5 A;  4HJM A;  4BVY B;  2WRT A;  2QA1 A;  5D9X A;  2QKE A;  4KGI A;  3FHK A;  1V58 A;  3D6I A;  3GN3 A;  4DVC A;  3TOT A;  4D73 B;  2IN3 A;  2J23 A;  1QUW A;  4LMV A;  4TW5 A;  1GL8 A;  3PPU A;  3WD6 A;  2CVK A;  4K9Z A;  4G2E A;  3QPM A;  1OE8 A;  3QAV A;  3TRP A;  1FVK A;  2LRC A;  1SL0 B;  3N5O A;  4KCE A;  4YQM A;  4ZL8 A;  2I9H A;  2HLS A;  3EVI A;  5D96 A;  1QQ2 A;  1ZMA A;  2GT5 A;  3Q74 A;  2MZC A;  2IFQ A;  4TN8 A;  2HRK A;  1I5G A;  2CX4 A;  5G1K A;  3ZRE A;  5ECS A;  3CRU A;  1JLW A;  1TU7 A;  4N11 A;  3ZTL A;  2GS3 A;  2TIR A;  12GS A;  3H79 A;  4MJA A;  5ECM B;  3OR5 A;  2MBT A;  5ID2 A;  18GS A;  2VCZ A;  5HR1 A;  1R5P A;  4EO3 A;  1TXX A;  1JZO A;  5AIV A;  3F4T A;  1ERV A;  2JSY A;  4GSN A;  2K9F A;  1F3A A;  2YOI A;  1FW1 A;  4WBR D;  2VD0 A;  2X8G A;  5ECQ B;  2TRC P;  3WGX A;  3DRN A;  5IQY A;  4KE3 A;  3A5I A;  2IFQ B;  3DIE A;  2Z9S A;  3W8J A;  2WZ9 A;  1BX9 A;  5ECN B;  4A5P A;  1ZYE A;  2OKA A;  3ZLP A;  3S9F A;  1K0M A;  4MA9 A;  4OFT A;  1H75 A;  4KSM A;  3UOM A;  3DEX A;  3EU3 A;  1JZD A;  5IPH A;  1XWK A;  4OD7 A;  2C3Q A;  1RW1 A;  4TOP A;  4NPB A;  2L6C A;  2YPM A;  3VK9 A;  1XZO A;  2DJ3 A;  3A5W A;  3KM6 A;  5A5H A;  1XFL A;  2AJQ B;  4HEA 2;  3ZML A;  5J4U A;  1OVN A;  2B7J A;  1GSF A;  4HS1 A;  4AKX B;  4POL A;  5IM9 A;  1X5C A;  4DEJ A;  2GGT A;  2QSI A;  3FW2 A;  4HJ2 A;  4XCS A;  1FAA A;  2L57 A;  1TRV A;  1M2A A;  3NIV A;  3GHA A;  3FMW A;  5G5E A;  2DBC A;  4WR4 A;  1K0O A;  4OCE A;  4I5Q A;  1K3Y A;  1PD2 1;  4N0Z A;  4EF0 A;  5JCG A;  5IMD A;  1Z9H A;  1GLP A;  2EIR A;  2B3S A;  4MH2 A;  2DC5 A;  3C7M A;  1M7T A;  3RAZ A;  4CDO A;  4TKY A;  3LYP A;  3ERW A;  3MSZ A;  3GKM A;  4ID0 A;  2H72 A;  3F3Q A;  5J9B A;  5HQP A;  2PWJ A;  2X99 A;  1TK0 B;  5H5R A;  2NPB A;  1AIU A;  2P31 A;  2AYT A;  1QGV A;  4KUN A;  2OAD A;  2ZUP A;  1ILO A;  1A2J A;  1T4Y A;  3Q6O A;  5G1L A;  3F8U A;  4MF5 A;  1OAZ A;  1NHO A;  2PVO C;  1K0C A;  1U87 A;  3QMX A;  5L71 A;  4PNF A;  4I8B A;  4NHZ A;  1VRS D;  1XVW A;  4POK A;  1K3L A;  2MBS A;  1X5E A;  2C80 A;  4F2I A;  1LBK A;  4ECC A;  1I9D A;  3HDC A;  2FWF A;  3GA4 A;  2RUE A;  1YDK A;  4PUF C;  1BJX A;  1CQH A;  1EGO A;  4G0I A;  5IMA A;  1DBY A;  2LUS A;  3FYG A;  4ECB A;  1X0R A;  5A1N B;  6GSX A;  3U5R E;  5H5Q A;  1BG5 A;  1TTZ A;  3GKN A;  2OAC A;  1O85 A;  5LCZ A;  3UMA A;  2WB9 A;  4PQ1 A;  4EE0 A;  2HI7 A;  19GS A;  3BBY A;  4V1A g;  3EYT A;  1E2Y A;  1V57 A;  2N5A A;  2M72 A;  1BAY A;  3ZYW A;  3HZ8 A;  1FOH A;  5G30 A;  1S3A A;  1YEP A;  2GTU A;  3EUR A;  5D9V A;  1GP1 A;  2B5X A;  4MPG A;  2JSZ A;  1UVZ A;  3L4N A;  1W89 A;  1PN0 A;  2LQO A;  5GSS A;  2E0Q A;  2FUG 2;  5ECR B;  1B48 A;  3IE3 A;  4GXZ A;  2JAD A;  5C00 A;  2G2Q A;  2UV8 G;  1O81 A;  2DIY A;  1QMV A;  1GUM A;  2H73 A;  3C1R A;  1G7O A;  2YAN A;  4K2D A;  4CHS A;  3A3T A;  4K2X A;  4F82 A;  2WUL A;  1B9X C;  3EPT A;  1SD9 A;  3CRT A;  5F06 A;  3DD3 A;  4MDC A;  1U3A A;  1XIY A;  2YWM A;  1KNG A;  1PKZ A;  4ZBD A;  2DLX A;  3CXG A;  1LU4 A;  4KB3 A;  2GT6 A;  3WGD A;  1HD2 A;  2CZ2 A;  3VFI A;  1O73 A;  5B6N A;  3LQ7 A;  3KXO A;  1AC1 A;  3FZA A;  2O85 A;  2L59 A;  1AQV A;  1TK5 B;  1SK1 A;  3CMI A;  1SL1 B;  2LNT A;  4ICY A;  4MAB A;  1BG1 A;  1N25 A;  5CRH A;  3O3T A;  2K18 A;  3F3R A;  5J40 A;  3IC8 A;  4JU5 A;  4V2L A;  3MWH A;  1YJ6 A;  1A8Y A;  1EEJ A;  1T3B A;  4IEL A;  3MDK A;  2YWO A;  4MCU A;  1QXH A;  3TJJ A;  5DCH A;  3F9U A;  4DSS A;  4QQ7 A;  4Q5F A;  5J41 A;  5HR3 A;  3TOU A;  1GSQ A;  1WJK A;  3DKS A;  4IVF A;  2JZR A;  2DIZ A;  4KF9 A;  2PBJ A;  1EOG A;  1PMT A;  5A34 A;  3PIN A;  5HR2 A;  2PMT A;  1DSB A;  5ABR A;  5CAX A;  4TXO A;  1X9S B;  3FRC A;  6GSY A;  5D73 A;  3BCK A;  3APQ A;  2R0G A;  3C8E A;  2PPT A;  3L9V A;  2PGT A;  17GS A;  3ZFB A;  3US3 A;  1SK0 A;  2FCH A;  2RLI A;  4WKW A;  2RII A;  1Z7P A;  2JZT A;  1BYE A;  3UJ1 A;  1UA5 A;  4LLR A;  1T1V A;  4DSS B;  1XOA A;  3GMF A;  2IMF A;  4JED A;  4I6X A;  2IMD A;  4V2M A;  1GRX A;  5GAP D;  4IQ1 A;  2EIQ A;  1OC8 A;  1Z7R A;  4AJ7 A;  2X49 A;  5A34 B;  2CVD A;  1ERU A;  3KJY A;  5FWG A;  4ZXG A;  2OE0 A;  3QAG A;  2LJA A;  2YZU A;  2IJY A;  2E2M A;  4HZ2 A;  2A4V A;  5AIX A;  3FKF A;  3VLN A;  1O7U A;  1GTA A;  3FR9 A;  4KAE A;  5F07 A;  3EIN A;  3IPZ A;  3TGZ A;  4GLT A;  1NM3 A;  3KGK A;  5GST A;  1HNC A;  4Q5R A;  5IMC A;  1WWJ A;  3IDV A;  1XWG A;  2F8A A;  2VM1 A;  1SKW B;  1U3I A;  2MMA A;  2XBI A;  2GVP A;  3GYK A;  2YCD A;  4DSR A;  2X8H A;  3AY8 A;  2R6K A;  4MMM A;  1EEM A;  5IMV A;  2DKH A;  3TJB A;  2LNS A;  2GSQ A;  3I43 A;  3ZIV A;  1U88 A;  2E2G A;  1G0T A;  2AV4 A;  5H5S A;  2HYX A;  2REM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...