3G82A

Complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with mant-itp and mn
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
189
structure length
189
Chain Sequence
MMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVREMTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLSYLNGDYEVEPGCGGERNAYLKEHSIETFLIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Adenylate cyclase type 5
publication title 2',3'-(O)-(N-Methyl)anthraniloyl-inosine 5'-triphosphate is the Most Potent Adenylyl Cyclase 1 and 5 Inhibitor Known so far and Effectively Promotes Catalytic Subunit Assembly in the Absence of Forskolin
rcsb
source organism Canis lupus familiaris
molecule tags Lyase/lyase inhibitor
total genus 57
structure length 189
sequence length 189
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2009-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 3g82A00
3C16A 1CULA 4OYOA 1CJVA 3UVJB 4CM0A 3C14A 4NI2B 1WC5A 4CLUA 5IV4A 4WP3A 4CM2A 1TL7A 4CLLA 1YK9A 1CS4B 1FX2A 2GVDA 1CJUB 4OYAA 4WP9A 4OYIA 1WC1A 4USUA 3MAAA 3ET6A 3C15B 4P2MA 4USWA 4OYZA 5D0HA 3G82A 4WP8A 4USVA 4OZ3A 1CJKA 5D15A 3MR7A 4P2FA 4CLWA 1WC0A 1WC4A 4OYPA 1CJTA 3R5GA 1U0HA 1TL7B 4USTA 3C16B 1AZSA 1CULB 4CLPA 1CJVB 4OYBA 2BW7A 2GVZA 3C14B 4WPAA 4CLTA 3UVJA 1AB8A 1Y10A 2QV6A 4CLYA 4NI2A 4CLZA 4OYXA 5IV3A 1WC6A 1CS4A 1Y11A 3MAAB 3ET6B 4OYMA 1CJUA 1FX4A 4OZ2A 1YBTA 5D0GA 1WC3A 3G82B 3C15A 4P2XA 1YBUA 1CJKB 5D0RA 5D0EA 4CLFA 4OYWA 4CLSA 2WZ1A 1CJTB 1U0HB 2GVDB 4CLKA 1AZSB 2W01A 2GVZB
chains in the Genus database with same CATH superfamily
5ADZA 3W9IA 3JTNA 1D9DA 3ZNUA 2ZH6A 1V3ZA 1FCAA 4M5JA 4F25A 4ECUA 3PO5A 3MECA 1WC1A 3VCDA 5LT5A 1R8HA 1Y4ZB 1HW8A 1G1XA 4LFCF 4IFVA 1Z1ZA 1IBMJ 1RCXB 2FC8A 2C2EA 5K20B 1A0OB 4FVMA 1LFWA 1P9YA 1RTDA 2IAJB 5EN1A 3S7RA 2YWFA 4C3MA 2CDQA 2DEJA 1DFDA 1S5ZA 2QLXA 3TUPA 1V5VA 2FVCA 2NQPA 2QRRA 3HK2A 4LSZB 2MGZA 1ZM2A 1T94A 3HP6A 1FNXH 2I5JB 4F02A 2ZKUA 5A8RB 4ELTA 2B4PA 4DDFA 4WIIA 2ZJQQ 4DFKA 3FEZA 4CH1A 2LXUA 2WCXA 2ZKTA 1VHIA 4QPTA 1S6OA 1QVFR 3V4MA 1J5OA 2R2SA 2VPWB 4G6VB 1M5KC 4KC5A 4F0MA 3PFEA 4LR9A 5KG6A 2UXDF 1SL2A 4DR2F 2DXFA 3MR6A 4MFBB 4YN3B 5DG9A 3EMTA 1SJ4P 4FS2A 1U6FA 3TAMB 4ZVGA 3UCUP 5ETLA 4RO0A 4DN9A 2V4JB 1JLAB 2P2CB 4EBDA 2BKNA 1LXNA 3MEEB 3D0GE 3DLBA 3OSPA 3GFHA 5D4OA 5L1JA 4ZP8A 3DLJA 2YWKA 3GONA 4NZ6A 2GJ2A 4AQYF 2YKPA 2KT5A 1FT8A 3FZBA 4ZIWA 4BDPA 2WW8A 3VWSA 3PKYA 1YJWS 2FY1A 4F4KA 2VFVA 2RRBA 2RU3A 2NSCA 2IA0A 2BV3A 1U1RA 1T0TV 3W2WB 1U0SA 3G9CA 1RI7A 1AROP 3BN4A 4X66J 2ZH2A 2AKWB 3KLIA 4I6AA 3HFKA 1SQEA 3K5PA 1WTFA 1RTHB 2FVQA 2RIJA 2XO7A 4B9TA 1MLAA 3AD9C 4DS4A 5K14A 3ET6A 3EWGA 3MAHA 1NHKL 1S0MA 3NS6A 2FB0A 3KUGA 4N41A 1W25A 2QL5B 4DQQA 2G0IA 2C3MA 2EFGA 2N7CA 1IBKJ 5L8RC 2V2KA 1UWBB 3IS9B 3BSNA 4B3MF 5HANA 4CLYA 5JXSA 1S0NA 4ZPTR 1R89A 3DLGB 2FIUA 3TUZC 4OLOA 4NLOA 3ZC4A 1DTQB 3H2VE 2C1EB 3PJXA 2Y1LB 4QOTA 4WCEQ 2WVFA 1TMMA 2RT3A 1I1GA 2GHVC 1IM4A 2RMLA 3Q24A 1YITS 3IMQJ 5B0GA 1B4SA 3G71S 5H9EJ 5IWAJ 2ZH7A 2GZOA 2PO4A 4C3KA 4CNYA 4B3RF 5LM7E 5J1NA 2VFUA 2H4WB 4F4YA 4MMOA 3I9V9 3G82A 1L5UA 5LJ3Y 2DEIA 2VPYB 1D8ZA 5H9FJ 4DWIA 4BWJA 3N79A 3CJ2A 4N77A 2CXEA 3R1LA 4WF9Q 4QIEA 1S1XB 1QUVA 1RWKB 1WEYA 5IXUA 2HGLA 1RWXB 5KTQA 2IA6A 3TX0A 3BO3A 5LMUJ 4ZP9A 3W3SA 3NBPA 4I2QA 1RTJA 5HQLA 1S7HA 3KG1A 2IVFB 3BBCA 5LXRA 3P4UB 2XMUA 2MLYA 3J80Y 1YJUA 3BDEA 3DDIA 5D0EA 2HHHF 1JNZB 2AX1A 1W7WA 4CO4A 4JUZA 1RACB 4IG0B 1J27A 4UOCA 1HBNA 2WSFC 1TTHB 3GCWP 3DRRB 4Y2AA 4ZK7M 4BCAA 2BJDA 2J7KA 4A8QA 2UUCF 2QA4G 4CO1A 4KAIA 3GV5B 3RYLA 2MQPA 4ZVOB 2HFVA 1C0UB 2RKIB 3TUIC 1YJNS 4ED3A 3FFIA 5EHHA 4KSEB 4NCGA 2W4DA 4IG3B 1UZHA 4ZITA 5E3QA 2Y8WA 3U1NA 2Y1JA 3H59A 2FJXA 3LH2S 4Q44A 3R7NB 5J2NB 4FBUA 4F3QA 3FNNA 2X3DA 1JQGA 4MK9A 4USIA 1WKLA 5CZXA 3PKMA 2L9WA 1VK8A 1SBRA 3AD8C 3T9NA 3O44A 1GMUA 3PX6A 4OZLA 4K4ZA 1KKHA 4DFJA 2OAUA 2XMKA 4NEYA 2BM0A 4IOAQ 4X64F 3K7RA 3RBXA 3C6TA 2XI2A 3IWNC 3DMJA 2DR6A 5H9EK 5GADU 1T02A 1HI0P 2UV8A 4Y2MA 1YBAA 3BR9A 4DUYJ 4LF1A 5KFRA 1KN6A 2AT1B 4WE1B 4EYHB 4OLPA 1NJWA 4PPZA 4PXBA 1XNQF 5KFQA 1NO8A 3IA0A 5ETVA 3MI7X 1H6KX 1YVFA 5H9FK 1VOMA 4CI0B 1RT5B 2E9TA 2LA6A 3DFEA 3ZZYA 3GFYA 4LRFA 1Y9OA 1ZYQA 4A8MP 3C16B 3MEKA 4EBCA 3KK2A 3WX4A 3CCSS 2W2QP 3D9BA 2CUYA 3D2WA 2CYYA 4NEZA 3HLUA 2J0QD 4RBTA 3SQGB 3HZGA 2WRMA 2YWWA 1VC0A 3ZO7A 4ZPWR 1RT4B 2FVSA 1TKZB 4A8KA 4QYRA 5JJBA 4ECVA 2F4VF 3OT9A 1ELOA 1HWKA 3CJ5A 2DKOB 4NCAA 3H98A 3UNYA 4UF4A 2ZOGA 3WDOA 1VK3A 2J0SD 3D5MA 2H9ZA 1HA1A 1CJVA 1A6LA 3PNIA 3QAUA 1RBOB 1VQMS 2DGOA 2NUHA 2GQQA 3RRGA 1C1CA 1X0PA 2OI2A 3VGTA 2W2NP 2QG9B 4Q8EA 5CXTA 2ZFHA 2HVIA 3CSKA 1U0HA 5HSPA 1S72S 1NJYA 1VBKA 4ZIVA 1PG5B 3HHLB 4RW7B 1GXUA 3DOLB 2GHWA 2KTQA 1BY9A 3ENVA 3DLEB 3FC9A 2QO3A 4MIBA 1UJ4A 3CJ3A 4NXNJ 3GB0A 1B99A 3K59A 2OH2A 3S8SA 2CNOB 2BACA 2EC0A 2SXLA 4F0HA 3C66A 4OZ2A 3MFHA 2AWZA 2BJ8A 4ES2A 2FJWA 1XC9A 2DRDA 4OJHA 4K8RA 4DF8A 1LW2B 4ZDNA 3G6VA 4PCQA 1HNZF 1JLGA 1U4BA 4EI2A 4C4WA 5GMDA 3RTVA 3RZAA 3CO0P 3Q83A 1I5OB 4O4GB 1N33J 1Q4RA 5GAGI 2EK1A 4RW4B 1EP4A 3HKWA 3TJ9A 2O66A 1GX6A 4DPUA 2WAQD 4M8LA 4CO2A 2IJFA 3QGGA 4C8KA 4E8UA 3ISZA 4HT7A 3QYYA 1Y7PA 5D4NA 5DG7A 3GJSB 5FLXY 3ILIA 3FGVA 4OZ5A 3FBEA 4USTA 1GMWA 4KGXB 3F44A 1RWVB 5K5MA 5ITHA 2J9CA 1YZ7A 1H2TZ 1YGYA 2UZAA 3VVUA 3N9UC 2FJAB 5IZHA 4DLGA 5KFUA 5AE1A 1QE1B 4HACB 1OYEA 3UPFA 1SC4B 4QIWD 5FD1A 4H4KA 4OV6A 1SPBP 3HHLC 2CPEA 2YY3A 3DI6B 3BR8A 1DARA 2A18A 2NXCA 3OR2A 5HROB 1VYAA 2KT2A 4NXMJ 4NLXA 5HLFB 1T7PA 4ETXA 1HQUB 1WF0A 3R2DJ 2DCUB 5HP1A 4OYOA 5ETQA 3QLHA 5CCMA 4CO0A 1R27B 2XCPA 4KJIA 3UN5A 3SDEA 4DV3F 4H4OB 4X65F 3W65A 2BZ2A 1FXDA 3FZ2A 3CCUS 1MNEA 3P96A 1VI7A 5BJRA 2K3KA 2MYFA 1NZ8A 3VQTA 1RAEB 3LP2B 3PHTA 2C2DA 2AP6A 2VKRA 4KHPF 4IDKB 1TR0A 2XG8A 1PO6A 4RNOA 4GVBA 2B56A 5A8WB 4BHQA 2YQ1A 3KLFB 1PSDA 3Q8QB 3QGIA 2C28A 2JHEA 4KY3A 2M2BA 4ED0A 2OTLS 1Q8IA 2J6SA 2G1HA 3C19A 3ZZUA 2XHCA 1S0VA 5A8KB 3HF5A 4YOEA 5KFFA 1C2PA 1V6HA 2F9JA 4JI7J 3IP0A 1RAJA 2W2OP 2AX0A 3SI8A 4M5KA 3QQCD 2E1RA 2OSRA 3TO8A 1DBDA 3CMES 2U2FA 2B6AB 3D28A 1X4CA 4RW9A 1HNVA 3N6LA 4NE9C 3N4WA 1TVRA 1IQZA 4WK3A 1H2VZ 4DLEA 3OTOJ 1URRA 2CVEA 2MZQA 1KLMB 2AGOA 4BC7A 2QC3A 5KG3A 1TV6B 1RBLA 3P45B 1PYSB 3MM9B 3GG1A 4RL1A 2JEJA 1RP5A 1YKWA 2V94A 4DI6A 1MU2A 5KFSA 3UVJA 3KK3B 3BKTA 4IYQA 5IV3A 2QZ8A 5KG1A 4NOHA 1M5SA 5EUHA 2PMWA 1SIZA 3H5SA 4HH0A 2GO8A 2AJ4A 2NXUA 3O5TB 5K8PA 3MTKA 1G2EA 2AJ2A 5B0CA 1PBAA 3N5BA 4MYUA 3K17A 4LRAA 2DJWA 2J6TA 3IO1A 1RABB 1Y00A 5LSLA 5ETSA 4P7VA 1QSLA 4QU7A 4ZVHA 2F9DA 4KV8B 2KZMA 3PEHA 4O3RA 3IWXA 3OW2R 4ZPAA 4ED4A 2DHGA 1VRTB 3D1HA 1R8CA 4L6V3 5GVQA 1NUEA 2GMHA 4CRJA 1RTZA 4KH1B 3BEGB 1RT2A 4GKJF 4LF9F 1S1TA 2MLZA 1FRXA 4FF2A 1VQOS 4UY8T 2JEIA 4HR2A 2X1BA 2DGWA 4UZCA 2VG6A 2DPJA 2ZHAA 3FUYA 3N28A 2HK3A 1SKUB 1PC5A 2E5IA 1NDLA 1RUSA 1UFWA 2VG7A 4N56A 3K57A 5C42A 1OIAA 5ETOA 5JMNA 1VQPS 3EGZA 2D3ZA 3MECB 4DX8H 2JZ5A 1KHVA 4B3TF 1WI6A 3IWLA 3HCXA 2W9BA 4IFVB 2QL9B 2QA4S 3TVZA 1VQSA 3CEDA 1RTDB 2ZZNA 4DR3F 2DISA 2BVZA 7AT1B 3T41A 1ZTTA 3O2IA 1J5EJ 4RNNA 1XMQF 2IDLA 1N4LA 3FBCA 2MGZB 3MD1A 1K0TA 1UJ6A 4WFZA 5LL6d 2JDJA 3KTQA 2B5JA 1HYSA 3KNAA 3PW4A 4GC6A 4EWTA 3E01A 1OS5A 1NDKA 2XBPA 3W9JA 2YX1A 2C3OA 2FQQB 1HARA 3V6KA 2DR5A 4OZ1A 2E66A 2CPHA 1AB8A 3MURP 1FNMA 2MJUA 1N5TA 4K4VA 5A6WA 4ZS6A 1GNKA 2B8QA 5KAKA 3UN3A 2IMOA 4LJMA 4XDDA 2CQ1A 3M6XA 4ZHRA 3GLJA 3LF0A 3AH6A 1Y3KA 2ADCA 1EIYB 4RNHA 2W7AA 1H3DA 2WBMA 2HWTA 2HQFA 1RB0A 3TP2A 4CM0A 1WHVA 4X62J 3L3CA 3UCZP 3BQ0A 4B3OA 2GVDA 2PC6A 3UDCA 1QM9A 1GEHA 2FJVA 1T3OA 2V8DA 4RU9A 1NH8A 1JLCA 1FI4A 4U8VA 4JV1A 2AJ0A 2HFSA 3G8QA 4X4VA 2DHXA 2E5LF 2FLPA 3ZXWA 2FD2A 3TAPA 3QPIA 4KE5A 3RG6A 2UU9J 1YHQS 2DNRA 2BANA 1HQEA 3FVYA 2OPPA 2I1RA 3HI9A 2BEFA 3T1AA 3JAMY 1ZM4A 4HHJA 4MKVA 5K14B 3G6ES 3D6HB 3ET6B 4J9SA 4I64A 4DSKA 1U24A 1WUUA 4RBVA 4GKKF 3P3DA 4IRDA 4KKOA 4M94A 5KG7A 4C3LA 1GAOA 2EI5A 3DRPA 1T3NA 1HWJA 3IGVA 2G9OA 1FRMA 1ZH5A 1VRQC 1GTHA 2YXLA 2MHNA 1VJQA 5IV4A 1SH3A 5HAOA 1R0AA 1FRKA 4LF8J 3UQSA 1IJEB 3BDPA 1NK9A 5KOXA 2Z8QA 3ZZTA 2HS4A 1NDPA 5DS7A 2YH1A 4W92B 5THWA 1XMOJ 2V0NA 2XCAA 2DPIA 3GPAA 1XBWA 1SJ1A 4OX9J 2V63A 4CP5A 1QVGR 4J9MA 1N32J 4DZDA 1U8SA 3HVWA 2XSJA 5GAGU 2XZWA 4DV7F 2YNIA 1CSJA 5G0RA 2ZDPA 4U7UD 4J9UE 4URSA 3ZZZA 3M1VA 2B4UA 3ONQA 4J9OA 3UCGA 2RILA 1XWLA 1AUDA 2DNHA 3TEGA 5HMWA 4RPFA 3HD1A 3G82B 1EETA 1YDLA 2QYCA 2V8GA 3GE9A 1EQ0A 3CJ8A 3WHIA 2RS8A 4C8NA 2A10A 4ILMA 2PA8D 4NL5A 4DR4J 2E7XA 2B9XA 1NCLA 2RQMA 2V4QA 4KPCA 3IBFB 3ZFVA 4R8UA 3NBPB 4I2QB 1OY6A 4U6PA 3VAMA 1H72C 3EDQB 5SUHA 4L3KA 4OQJA 2KXNB 3K5MA 1Q78A 3QJPA 1I3OB 3PYFA 4AE5A 2OP5A 2UXBJ 2YNHA 3OXGA 5KG5A 2HRUA 3MEGA 1H7WA 3J7Z5 3IR7B 1WELA 1ZM3A 3MF5A 1R8AA 1PAEX 2C2MB 5F0WA 1HBNB 1N34F 3M6VA 3OSNA 1KTVA 4DV4F 2V67A 1T03A 5LJ5Y 4USHA 1XR6A 4LF6F 3DLKA 1DAXA 5EWEA 3T1HF 4HHHA 1PC4A 1FDAA 3AOAA 3FFIB 2NREA 3HO1A 3GYGA 4DU8A 3LP0A 1AFJA 2ASLA 2XEXA 1HFEL 2FPHX 2BW2A 2IPOB 2RU9A 3L7UA 3T5KA 3MEDA 1S7IA 3SSRA 4RNFA 2DNMA 1S6PA 2F8EX 1T05B 2CDRB 4FPRA 3H7HB 3PW7A 3KNGA 1S48A 2EPIA 4PZVA 5K8NA 4JV2A 5L1KA 4USUA 1HR0J 3MAAA 2NPFA 2KXHA 4P2MA 2QTWA 4KGMA 4PQAA 5KFWA 2WTFA 3NY0A 2Q1LA 1L3KA 3A3NB 4P2FA 1XERA 2MY7A 3QRRA 4RW6A 5KFYA 1RXOB 3M2VA 4DR6J 3AQPA 4F2RA 1KFDA 3V6DA 3C6TB 1RGVA 1WTBA 5D77A 3DMJB 1B0VA 4WTOB 4URGA 4U67Q 3K58A 3EVWA 5L1LA 4ZPBA 2GAGC 1RLDA 1WOOA 5ETNA 5E41A 4ECTA 1TK0A 5L9NA 2HVZA 4UT4A 3JTPA 2B7BB 3PJ9A 4QCLA 1VC5A 5DQHA 3I56S 2H5EA 1RBAA 4WFBQ 3KK2B 2DNNA 4IQXA 2O67A 2F3JA 5LSOA 3MMCA 4F4AA 5L1IA 3O8WA 2GHPA 4HT5A 2XTJP 4QWCA 1YK9A 3SBMA 3EM1A 3R27A 3OJSA 4USMA 2ZM6J 1SB6A 2CPJA 2QJ3A 1NK8A 3IRXA 1RZMA 3BV8A 1RA6A 4USVA 1CJKA 2LQ8A 2GFFA 3H42A 1N6QA 1WHWA 1PJ7A 3NL0A 1TKTA 3PZPA 2A1BA 1CJVB 1GT8A 3OUYA 2DHAA 3TA1A 4ZOSA 1NKCA 2V8PA 4F4WA 1F1BB 2ZH9A 1O8BA 1C1CB 3W66A 3A8EA 3BO2A 2IAJA 3CIZA 1WG5A 2Z56B 4I6WA 2FJDB 5IT4A 1NLKL 1VMBA 2OKQA 1FERA 2BE9B 2GAHC 3FCHA 1U0HB 3JTOA 4HVZA 4I69A 1U2FA 5AJ3J 4JI4J 5A8RA 1RSCA 2DIVA 4K4UA 4OIXA 4ES3A 5IT0A 3P8BB 2FHJA 3L4BC 5DG8A 4XPCA 1VLOA 3MAQA 4W98A 3NEKA 1RLCL 5LSRA 1WACA 1WC4A 3GV8B 1JLGB 3EVOA 2Y1IA 2QLWA 2ZH1A 2WSCC 1JMTA 3SSSA 3QAEA 4K4XA 1KP6A 4NI2A 3G87A 4P2SA 1EP4B 1DY3A 2KKHA 2XGPA 4OFZA 4JYAJ 1APSA 4OI1A 1M0SA 4PRFA 3MR3A 9RUBA 3I0RA 3Q2SC 1WKKA 2AEFA 3GR1A 2ILZA 2KJWA 3JQJA 5U47A 1X8DA 4IFYA 3LP1A 4I67A 4JI6J 2AJ1A 3JSMA 3ETOA 3MMAA 4PXEA 3MCSA 2YX7A 3D6MB 5D4PA 1LV5A 4M63A 1T9WA 3HPOA 4YS2A 4QJVA 3M6WA 2IHR1 5IWAF 3F56A 4RNMA 3WIUA 3GR0A 2CJKA 4Q0BB 2RRNA 3OTCA 2VF3A 4ZCMA 3HM9A 1EZZB 2CQPA 2L41A 5CQGA 3OR2B 1VFJA 2XGQA 4DPYA 2LU1A 4FPIA 1U47A 5HP1B 1N88A 3P5BP 4ZN3A 3W8GA 4DBQA 5I3UA 3QLHB 2C3PA 4QR2A 2A3JA 4BBYA 3GILA 3SDEB 1X4HA 4GO5X 5LMUF 1KEKA 1XK8A 1LWEA 1MWQA 2I38A 1UWAA 2NYHA 2R8JA 4LSNA 2DY1A 3OL9A 2HGMA 3CJTA 5HVGA 5F8HA 2Z2ZA 1VISA 4DL0C 4DV1J 4YY3J 1N36J 5H1SV 1X5OA 3VVTA 1S12A 4GVBB 4CT9A 8RUCA 1NB2A 4C98A 4JI2J 2E29A 4YFUA 1YLXA 4MH8A 5EDWA 4EK2A 3NS5A 4Y2IA 1ULRA 1X4AA 2Z4PA 3R3TA 3LAKA 3GWCA 1UZDA 2KZZA 1TELA 2CIMA 3LO3A 2OD6A 2YWGA 4FYVB 1SXLA 3OHAA 3IC1A 5A0YA 4PPDA 2OEKA 2HVHA 3ELHA 4H4KC 2W7OA 3AHPA 2VQFJ 1DJ0A 3TQEA 3CW2C 1FO1A 4RWWA 5A2QU 2VKZG 5E3PA 1IR1A 4OHXA 3DGVA 4R25A 4RW9B 4NMLA 3ZZOA 5KFBA 1AW0A 3OBIA 1NXIA 4ANEA 1D3WA 1TVRB 3D0IE 4M5IA 3MR2A 3PYEA 1OY8A 1CVJA 3VAFA 2KT3A 4KH0B 5F8MA 4Y0FA 1GQEA 2RDIA 1M1KT 4MKAA 2FHKA 1YJ7A 2IDEA 4IUFA 1MU2B 2CPYA 2HHWA 3UVJB 1ZAXA 2VASA 1NBEB 4WZQA 3GIJA 4ER8A 2ERRA 2Q43A 1WG1A 1TFYA 2KVIA 3M6UA 4O44A 3HSJA 3W5XA 3AXKA 4DUYF 4DZ6A 1DRZA 1OY9A 2J76E 2FTRA 4NLDA 4Q8FA 1O0PA 4JV0A 2UVRA 1M5PC 3CC2S 2QIFA 3R5GA 4ZVTB 5D3GB 1NAQA 3G6XA 4V1Ak 4B3SF 3CF5Q 1CBKA 1XJWB 2RF2A 1QAYA 2A0FB 1FJGJ 1FJ7A 2YX4A 3RB6A 2ROEA 2CFXA 1Y11A 2J8AA 2XI3A 5DM7Q 3VF0B 1CJUA 3J7YI 2AU0A 1UP1A 3V81A 2XY5A 1VQ5S 1YQHA 1S1TB 2VUGA 1K0VA 2EXUA 1YBUA 5C5JA 5F9LA 4KHRA 1QSYA 4QIFA 4LF4J 3SXLA 2CZ9A 2VG6B 3TNVA 1CEZA 2HBZB 2CJQA 4WFAQ 2VBZA 5HJXA 3BREA 3G8TA 2VG7B 4DV6J 1EJ7L 2ADBA 2RSQA 5C42B 5D4LA 2MKCA 1VQ7S 4WP3A 4B9UA 5DETA 3K5LA 4N76A 4ICLA 4NYOA 1BQXA 2W9BB 3JSYA 1WDTA 2ILYA 1KVKA 2J6UA 2OMOA 3VV2B 4I68A 2EEYA 4A48A 3V4IA 4N7TA 1VIXA 4X4PA 1PILA 2BE7D 2P5VA 1S9EA 2XS5A 3ZTQA 1Q8KA 3NGTA 3PM9A 3LAMA 1KFSA 4K4WA 1RHQB 3CMQA 4ZJQA 4RW8A 2B7CB 2QLBB 2VC1A 2LXFA 2CZVC 4NXNF 3BH7B 2X1AA 2B5JB 3OJUA 1HYSB 2DRBA 2LVWA 1MG7A 4P6QA 4FYWB 2IJNA 3E01B 1V9OA 4FBTA 2CPZA 1V3RA 2DGTA 1RTIA 3QWPA 3W63A 4O3OA 4IO9Q 3DNCA 3D6TB 1WORA 2LQJA 2WVDA 2YBVA 1TKXA 3VAGA 1N33F 4DL7A 1F5CA 3ISNC 4ZHRB 2CG4A 3HVRA 2IYIA 3ZZRA 5HVHA 2ABYA 2M4MA 5GAHU 4ALZA 2XB2D 5B0AA 1L3TA 1B7FA 5HI7A 3TRGA 1MWZA 5KG4A 2OELA 1VRUA 4WTYA 1Q8LA 4R0EA 1NJIT 2V2ZA 4ECZA 2ZH5A 3G86A 4B3OB 2ZJRQ 2BJ7A 3I96A 1CQMA 3DKDA 4WXOA 5HQ8A 1UA0A 1FJCA 3N01A 2FY8A 2RB7A 1DQ8A 4MYTA 1JLCB 2F1FA 3DLEA 4HH1A 2DH8A 2BA9A 1IKVA 4A47A 3IBCB 2E5HA 4EBEA 4OI4A 4DFMA 2EW9A 2O3DA 4ZVSB 2AJFE 2NPIA 4NXMF 5KT6A 4YEAA 1HD0A 3M30B 1TL4A 3HJFA 2BANB 1HQEB 5KFJA 2G0CA 5KFHA 4PG7A 2OPPB 4J9QA 3KUEA 2CNNB 1F0XA 1FTRA 1ICEB 3TA2A 5G4DA 2QX0A 4JV5J 3W61A 2L9DA 4XPEA 1FNOA 2PN6A 5KFGA 4KKOB 4DSLA 2RDJA 3D0HE 2KXFA 5DQIA 3DRPB 1RWWB 1V5IB 2NLWA 4NRTA 3BSAA 4RUCA 2IM1A 2ZBQA 1BHNA 2GVZA 2PI4A 1P1TA 1VQ4S 2R7VA 4DMZA 3EGNA 1R0AB 1NHVA 3T5LA 4MIAA 1TUWA 3DOMA 3DOKA 4KR0B 4QU6A 1K1SA 1CS4A 2GJFA 3VTIA 1R6YA 1Q95G 4URQU 2BQUA 2FDNA 2YKNA 5DDRC 1FE0A 5BYSA 1N0VC 2N7YA 2Z2MA 4JI7F 4K2XA 3TJ8A 4HTJA 3DM2A 3D3CJ 2XSJB 2KFZA 2ALZA 4PG4A 2E7WA 4A46A 2F8MA 2VPXB 5KFTA 2YNIB 2LU2A 4KFBA 4B02A 4CO3A 5G0RB 3MCOA 3M1VB 3CJQA 3DU5A 1BE4A 2LEBA 1RAIB 5CD4A 3WBZA 1EETB 4OI3A 3DDNA 3H2LA 2V50A 3CXCR 2C22A 1NPPA 4NA1A 3NCQA 4H4OA 2L3MA 3DGPA 4ELUA 5J2QA 1T9YA 1JLFB 2DO0A 2UUAJ 4R8UB 1U45A 4UOGA 2HBYB 5HMXA 2OFHX 2R7SA 2ZITA 3TA0A 3GMGA 1SQGA 1JLEB 2YNHB 4NLSA 2UP1A 1RISA 3PVXA 1NU4A 3MEGB 5GAEI 3RB3A 4OV1A 5CYQA 3KLFA 2UUTA 2FLLA 1BMQB 3CC4S 3A13A 4A8OA 4QWDA 1F9HA 2WONA 2DNOA 4WU2A 5DDOC 1T03B 2M0GB 4EZ9A 2CAJA 3Q23A 4CLLA 3DLKB 3R5DA 4QYZK 4Z37A 2X1GA 1BQNA 2D1CA 4C6AA 1MN9A 3R5JB 3LP0B 1S59A 3QZ7A 1YIJS 1NB7A 3TR5A 3BO4A 1LWFA 1V3SA 3SQOP 3MEDB 2OSQA 1S6PB 2F8HA 3OL6A 2CPXA 1M5OC 1KS2A 3M8QA 2NCKL 1GH8A 2FJBB 2CZ4A 4ILLA 3MM9A 2AEMA 3MAAB 3RB4A 1GTEA 3ETMA 1QAIA 3CDUA 4IR1A 4C0BA 5D0RA 3ITHA 1PJ5A 3BGFA 4RW6B 3M2VB 4C8LA 2HHTA 4NYPA 1PIEA 3V6DB 4QWAA 2V4RA 4I7FA 4OMFG 2OMLA 3NP5A 5FIIA 4XK8C 2Y0SD 1Z4UA 5DQGA 1J5EF 2IM0A 1FKAF 4F3OA 3KHRA 1NSAA 5DZ7A 2EG1A 3RUBL 1WNEA 2DR7A 3QO9A 3C6UA 4ZVRB 1XMBA 4G65A 2HHQA 4EMDA 3DRSA 3DXBA 1BGXT 2PE8A 3G6YA 2ZDOA 3PW5A 2APOA 4H54A 2Q66A 1WHXA 3MMCB 4QWEA 3B4DA 4J9KA 4CYUA 2FZGB 4D3HA 4LVNP 3VAKA 1C4AA 5C2GA 4FXDA 3NMRA 5KOWA 3KMSA 3JQKA 3EYZA 2Y3YA 1TUVA 3M9MB 2M8HA 1OPIA 1TP7A 4WU3A 1SCJB 4NX9A 4CNZA 3IRXB 1NSKL 3SIPB 1CJKB 2IFXA 5ETTA 1X0FA 4M5LA 1FE4A 3D6FB 1N6QB 1TKTB 2CQIA 4OZJA 2LMIA 3HSGA 2K2PA 3R1HA 3BKUA 1ZM9A 2HNYA 2MKKA 4ZA1A 3OUYB 1YJ9S 3C46A 2ZHOA 3KLVA 3PX0A 4I56A 1Q8BA 1SH0A 5KFKA 3PW2A 4D3GA 4ZVPB 4X62F 1RHRB 1ZOTA 2IIHA 1ITPA 2E9ZA 2K1RA 3J7YU 2GW8A 2GV1A 3SCKE 3IFEA 2MLXA 2ROGA 1QDUB 1XQIA 4ED5A 1NSQA 3I31A 5BXIA 2IRYA 1W26A 4AFFA 3K8WA 3SFUA 3HHNB 4RU2A 1X5SA 4OHZA 1RYSA 1U1MA 2JL9A 3DYAA 4J91A 3UNGC 1RWPB 2W24A 4ED2A 3I5BA 3UE2A 4JI8F 2UU9F 2CWKA 3Q8RB 2DNYA 2JFKA 2EFVA 1MROA 1HQ2A 2XMVA 3DLLQ 2KYXA 4UQGA 4USJC 4UOFA 2R7TA 1JNRB 3PW0A 4F26A 2XMMA 2EFOA 1NPRA 4CLSA 2XHWA 3DHXA 1VQLS 1UW9A 2JX2A 4LQ3A 2Z0GA 1LWCB 5C25A 2ZWOA 4HYKA 4OJ1A 4NI2B 1QSSA 1FFGB 1FJEB 2C2NA 2F4VJ 1UPMB 1H38A 3BN7A 4FF4A 4K4SA 1PBUA 4LT6A 4LF8F 2D3O1 1OO0B 2N3OA 2JEGA 3I0RB 1NNDA 1KOOA 3THVA 4ZVFA 2EWHA 4IFYB 1AA1B 3LP1B 1B7YB 1XMOF 3IAS9 2G1DA 1KQFB 3JSMB 3MMAB 4IH6A 2CKWA 4CQ1A 1LXJA 4TQRA 1R0BG 2MZTA 2VJUA 2ROPA 5AXKA 4JI3J 1N32F 1Y10A 2BR0A 2B9EA 1UVNA 4XTTA 2PMHA 3VGSA 4K4TA 3EPGA 5A6PA 3H5YA 2YH0A 4F4ZA 4ECQA 2OPRA 3R7SB 4A8SA 4K59A 4ZLNA 3TI0A 3ZTPA 4YP3A 3W60A 2L48A 4F0KA 1VIOA 1KBRA 4OHYA 2YPYA 3FRYA 2ZBPA 4ED7A 5I3UB 3N5FA 3HJVA 3VZHA 4DR4F 2PGCA 2BYCA 4QQBA 3MMBA 4OL8A 2BQRA 3A8KA 3TZZA 1LWEB 4YMEA 1KHWA 4LSNB 1HNZJ 3U27A 2JOQA 4ED6A 3MXHP 1FRHA 1JJ2R 2QLFB 1AYEA 1SIWB 4N8NA 2UXBF 3SEOA 3VGVA 1CJTA 4RX6A 1H7XA 2PMZD 4MTPA 3K89A 1UL3A 1QY7A 4YDDB 2PI5A 8ATCB 3EGWB 2XYGB 2XS2A 3BYPA 5IC4B 3NNAA 3E51A 2WW4A 2W9AA 3CGIA 2RQKA 1KRPA 1PGZA 2HHPA 1R43A 1FFSB 3KHGA 1FX4A 4M5NA 1WC3A 2F63A 3MM5A 1HNWF 5C2CA 2HHVA 5A0YB 2ASJA 5EGYA 3NS7B 2FLOA 3POTA 3RRHA 3C3LA 5B0DA 2MZRA 1YJTA 1HPZA 2B4OA 2ZNYA 2O5DA 2MMYA 3S6EA 2W1BA 2G13A 5CZVA 4RLEA 2I2YA 4P71A 5AXLA 1Z2ZA 4K0KJ 3ZZ0A 4MAKA 3U02A 3OFFA 1WI8A 2VONA 3CNQP 3MR7A 5T7LA 1U1PA 3K5OA 2E1CA 2D7SA 4DQIA 1AZSA 2FJEB 4EEYA 3R6LB 2BW7A 1RJJA 3CJ0A 4DR6F 1TL3A 2EFNA 3LPEA 4PABA 4O44B 1UW4A 4Y28C 2UXCJ 4UUWA 2AGPA 1U49A 1UKUA 4AT1B 2EBGA 1A9NB 1IN0A 2V8VA 4NLQA 2HHXA 3O1LA 1KR4A 2IVYA 1FVSA 1UJ5A 2IM3A 2QEXS 5EX0A 2MZJA 3HDSA 1KDNA 1TQLA 3NRBA 3I4HX 2VZ9A 1RK8A 2RF2B 5ETKA 1HWLA 4X4OA 4DR1J 1S79A 2M52A 1CJUB 5E7OB 3QT7A 4KT0C 4ECYA 3BBFA 3V81B 2V2VA 5D78A 4X4SA 5IM0A 1N5VA 2VU5A 2ZM6F 5GAEU 5HVFA 3JYTA 3EJMA 1T05A 5I42A 4KIAA 1JLQA 4NYZA 2X51A 3A3PB 3VZIA 1NK0A 3T1YJ 1VS3A 3M8WA 3EX7B 2CJXB 2NUUG 5KFAA 4X4QA 2HK2A 1IXKA 2JLGA 3F0NA 4ICLB 3GZ7A 3OVAA 3F73A 3AB2B 1S77D 1MW7A 3HZEA 1F3VA 1HNXJ 3V4IB 3T19A 2VH7A 2J9DA 2G2OA 1S9EB 3IN5A 3VAIA 1YTYA 3NNCA 4ECRA 2QGFB 4RW8B 5AJ3F 2DO4A 2DNKA 2XS7A 4JI4F 4DR7J 2VBWA 1EKRA 4PR6A 3SCIE 1K73T 2LDIA 3R5CA 1G6BA 5CCLA 3NG8A 4ZP7A 3Q8YA 2VJVA 2OHDA 2GS8A 4WP8A 4KO0A 2QE5A 1TKDA 1S99A 1RTIB 3MWBA 1GK8A 2OGUA 3S1TA 1DTTA 4FKXA 4ANCA 2HBQB 2QV6A 3ULHA 3MUTP 1TKXB 2MY8A 1TFWA 2UVVA 3JS9A 1LWXA 2HFZA 3SYZA 1IWGA 3GP9A 3CC7S 4F7VA 3FMBA 4JYAF 2HYIB 3K0JA 4KB7A 3JAMU 4I4BA 1OSDA 1SJFA 1CC8A 2XYPB 2MQMA 1EARA 1RT6A 3FJ2A 2XLIA 3EPIA 1VRUB 3W2VA 1S1UA 2R7RA 1J2VA 1Y5NB 2OLWA 4ETZA 3AXMA 3THPA 2CJ9A 1VQNS 5HN0A 2HS0A 3I82A 3N6NA 3D67A 4O3NA 5KFPA 3OLAA 1F9FA 2N4CA 2XMAA 3SZ2A 1OYDA 4U95A 1NKBA 3CJKB 1TZ0A 2E1MC 1UAWA 4B17A 2HWHA 4FZVA 3MGJA 3BPDA 3QATA 2Y1RI 1N8RT 1A7GE 1IKVB 2W4CA 1YJRA 4CLWA 2B9WA 2F7VA 1X31C 2KU7A 3C8YA 1IBCB 1FA0A 1R3NA 2GMJA 4PQUA 3D68A 2NR0A 4DL4A 2ZE2A 2AHOB 1ZTWA 3CCTA 3TW0A 2R2TA 3SV3A 2AV5A 3FDSA 3T5JA 2GO9A 3MM6A 2KRRA 2XY6A 1HHTP 1X7VA 2OO4A 4DV1F 4YY3F 1GMVA 2GVZB 1N36F 4CH7A 3A12A 4JI2F 2QA2A 4DPOA 3DOMB 3DOKB 1B0PA 2X7IA 1CS4B 5HMZA 4AL6A 2UVWA 2H65B 2OPSA 3ENWA 1ZETA 1R8BA 3BPSP 4C11A 2YKNB 1F6TA 2R8KA 3OPKA 2DD8S 5DDQC 3PR5B 2A6OA 2R7OA 3DM2B 3KK1A 2ALYB 4DEZA 2VQFF 1XR7A 3PACA 4MK8A 3UD4P 3U7JA 3GIKA 2K3IA 4Q0BA 2AF6A 4KFBB 4DUZF 2D9OA 5K8MA 2E5LJ 1HWUA 1XTZA 3Q0AA 3Q86A 4NMXA 4WFNQ 7FD1A 4KRWA 1UA1A 4FXVA 4S0MA 4DL2A 1R7IA 4NA3A 1LW0A 3K8VA 2J7UA 2I6WA 1RKIA 4NA2A 2BJ1A 1C0TA 4QR0A 3MM7A 3AFGA 4OYWA 1UVJA 2ZH8A 2HNZA 3DGPB 1REVA 5J2QB 5F9NA 3OD2A 5HO4A 3RBDA 2IYGA 1Q7LB 3QWUA 5F8NA 3R7BB 1B70B 4DX6A 2FYXA 5E3CA 3NOCA 4DSIA 5K8OA 4QW9A 1YWXA 1RAAB 1KVJA 2EC2A 4Z7CA 1WKJA 2VHGA 4TU7A 4DN0A 3NGDA 2JVRA 2I9SA 4I1TA 5CYQB 2DITA 2ACYA 2WB4A 3PJWA 5I3QA 3UI3A 1QTNB 3IM8A 4NWBA 3PX4A 2WONB 2WB1D 3Q8VA 2JC0A 4ZLPA 3B78A 1N5YA 3NCPA 1FJGF 5J2PA 5ETMA 2EVZA 4PUOA 1BQNB 2EKNA 2ZC3A 2EK6A 2PDAA 2YWHA 3ZTRA 1RT3A 4OX6A 3W9HA 3GJRB 4LQ9A 1U2RA 4DX5A 3JQMA 2W4PA 4LF4F 1LWFB 4WYLA 3M32A 1FKPA 4JI0J 2RQ4A 4ENOA 2WVEA 4Y3CA 3M8QB 2KG0A 5LMNJ 4GRSA 2HQ3A 4ZPVR 1G7CB 2HZAA 1QD1A 3KJVA 1MWYA 1K9MT 3HVAA 4JP8A 5J1EB 2IRXA 3OQ2A 4WJBA 3VHQA 4CIOA 3OVBA 3QT8A 2BOPA 3ITHB 2NS1B 2IM2A 3OFGA 3H40A 1RAFB 3LALA 2M9KA 1AXQA 4OYPA 2VBXA 1WF2A 4AL7A 3BQ2A 4ZVEA 4I7FB 4DV5F 1U2CA 5CHCB 1LK5A 2NYIA 3D7SB 5E0OA 4JI1J 3BSCA 3HFZB 5A2QY 3JB9k 3Q89A 4P52A 3MM8A 5HL7Q 4U7UK 1FEEA 2L9NA 3CD0A 1I94J 5IC6B 3QO9B 5D3GA 3C6UB 2N82B 2HG4A 3CCZA 4HHUA 4TU8A 1VHFA 2RHQB 4P73A 3ZTOA 3DRSB 1SVDA 2BMBA 2GQ2A 3CCMS 2M3DA 3CCLS 3T1HJ 2ZZMA 1S1VA 4F67A 5AE2A 4CYUB 5KT7A 5BYQA 4YB7A 2CJAA 2KN4A 1U8WA 1SC1B 1MN7A 5KT5A 2ZZTA 6FDRA 4F4XA 4WYWA 2OUGA 2HQDA 1FX2A 1U1NA 2D3UA 2DGXA 2XO6A 2E44A 2BJ9A 3FSIA 2VOOA 1WDDA 2J7WA 4UY85 2DBBA 1NK4A 3AB4B 2CA9A 2AD9A 3H4BA 4HKQA 3AJDA 2HNYB 3CDWA 1L3SA 3LTOA 3PYDA 2R9LA 4F3MA 2MQQA 1IKWA 1PYTA 5E33A 5AXMA 4ZCIA 2MKJA 3THTA 3W5ZA 2K1RB 4M5DA 4CZCA 1X5TA 4HLBA 2LDYA 2VBYA 1MMDA 2XWXA 2D69A 3BS9A 1HW9A 4DQSA 1VLYA 3KJQB 3DYAB 3T6JA 4C0OC 1X9SA 3M2RA 1JXLA 1UVIA 1P1LA 3MPVA 1E6VA 2MXYA 2AEJA 3EZOA 1MROB 2AMCB 3BJYA 2BDPA 4ZCKA 2I8EA 3AQOA 2RAQA 4K4YA 4IH5A 4NLVA 2B9YA 3CCVS 1UEVA 3CIMA 1MMNA 4JV5F 1U09A 5BYRA 1DQAA 4M5GA 2MZ1A 5GMEA 3L7OA 3M2UA 4HTIA 1D8YA 2DH7A 2YKMA 2RNEA 5DGAA 4Q43A 5C25B 1Q5YA 1XNRJ 5F8JA 2AJQA 3RU0A 2EG2A 3KHLA 3RR7A 1S6QA 2QT7A 4PG8A 4TVAB 2UUWA 2WVBA 4XAKA 5L39A 3IBWA 4AXJA 1HNIA 2J9EA 1NJZA 1WOPA 2FUG9 2HURA 5AT1B 4YDXA 4V19J 3GYNA 4MK7A 1G4CA 2MHEA 2PA3A 2CADA 2QN6B 4F8RA 3ENAA 2OEJA 1FF2A 3H0PA 2KI2A 2R4FA 2J0WA 3SCJE 4GVLA 5DO2A 1TL7A 1TUGB 2P6SA 4PYDA 2JWNA 4JI5J 3C14A 3D1QA 4HL9A 3RAXA 5CD4H 2RDDA 4YUDA 3DU6A 1E6YA 4YHHJ 2KRBA 2OPRB 4KGZB 1TMJA 4PG6A 3M30A 1N5SA 4LSLA 4FDFA 3HHLD 4Y2KA 3W1YC 1JK9B 4PWUA 2HWIA 2IC3A 1S9FA 5B7WA 3MMBB 4N5SA 2WOMB 2CQ4A 5B0BA 2K06A 5KFMA 4DJBA 2UUAF 3OVSA 1X9WA 1FEHA 2E1AA 2F5GA 2NXJA 3TOQA 2BQ3A 3MUMP 2QSFA 1YRUA 1SKSA 2M70A 1C1BA 3D3BJ 1KVIA 3S01A 1L3UA 3FQKA 1CJTB 2C3UA 2FVPA 1M5VC 1P9QC 4OX8A 2D74B 3LOUA 1S49A 1TL5A 1Q0NA 1WC5A 3M7VA 3A8IA 1LNQA 1MMLA 1LEOA 3MMJA 3LANA 3GYXB 2CPFA 3Q8UA 1JX4A 1UVLA 3B6BA 4FP9A 2ZVSA 4C0HA 2E5GA 3MM5B 2JC1A 3WQPA 5EX3A 3OHBA 1NHUA 2HNDA 2AZ1A 3POTB 2XZTB 3WX8A 5KFIA 2QYGA 2Q79A 4M1KA 1HPZB 2P8IA 1S4FA 4O3PA 1GX5A 1B0TA 3EUNA 3PIPQ 2VG5A 4L76A 4YB1P 1T9XA 2DHHA 1DQ9A 2CQ2A 1PJ6A 1VC6A 3M8ZA 1OJ4A 4M95A 2HAIA 1JLFA 5HK4A 1ZZNA 3CUNA 1NK5A 1UFLA 2CQGA 2MEWA 5T7LB 2FLNA 3M05A 2HEKA 3FMWA 2O01C 1AZSB 3GJTB 2CPIA 1JLEA 2CVIA 2HGNA 1TL3B 2F65A 1TL1A 1ROFA 2EFPA 4IKAA 5F8IA 3NAIA 2UVUA 5HATA 3O3LA 4TYBA 5LXYA 3CD6S 2HSEB 1FRJA 2OD4A 2DR8A 3M8PA 2JLEA 5J2MA 1EQMA 1F3FA 1N0UA 3I5CA 2YTCA 4PAAA 2GIFA 2Q6BA 3GJQB 2FZCB 1U1QA 4JBCA 2ZBIA 2CQCA 2OEMA 3DN9A 4CCHA 4OYBA 1Q5VA 2DXDA 2R8IA 2XM3A 3W7BA 2ASDA 1YRXA 3QMQA 3LWLA 3C2PA 4B9NA 4WIQA 3HKZD 2H51B 2ZUAA 5SZTA 2C2ZB 5IM0B 2BRLA 1VDHA 4IQMA 5CYMA 3JYTB 5I42B 2VPZB 2BJ3A 2C2OB 1JLQB 1GXTA 2IMWP 1PYOB 2EBEA 1S0OA 4DV0J 4DR5J 3TEHB 4WFYA 5F3ZA 5KFEA 3HX9A 3KUHA 1UMJA 2VDIA 4M5MA 2V9WA 1W2IA 1T11A 1IBMF 3AA8A 4QPXA 4TKTA 2MPUA 1IUJA 4LIWA 2COLA 4NLGA 2ZD1A 4USWA 4DOZA 4NLPA 3CD7A 4KBIA 4U8YA 1BWVA 4G1QA 3NWRA 3VGUA 1IKYA 2XMJA 3EDRB 3MTJA 2YNFA 3KLHA 4DU7A 4AD6A 1SJ3P 5K9FA 2QLJB 2R7UA 1I51B 1D1UA 4RBUA 1RWUA 4DQPA 1DZ5A 4B3SJ 2XQCA 5I3PA 2BXJA 2PIIA 5T14A 3Q8SB 3AT1B 3H4DA 4KO0B 2AYBA 3QFWA 5KG2A 1RWNB 3B8HA 5HBMA 2ZBCA 5GMKa 3J7AN 3MPDA 3HHKA 1DTTB 1CC7A 3K5NA 4DCJB 4IRKA 2AIRB 1DHMA 2DNQA 5J1PA 3QSYB 4OX7A 3GSDA 2CQDA 1RT7A 3KDNA 3UO0A 3CT9A 5KFXA 5CABA 1FD8A 1RT6B 4R0JA 3QRQA 5IFMA 3W2VB 1S1UB 5BR8J 2V2QA 2HZVA 5IT9U 3QSIA 1HBUA 1BUXA 4A8XA 4JI3F 3OLBA 4L75A 1WD6A 1NEEA 2V6AA 3OTEA 4C2MA 1ZZFA 3QGHA 4I2PB 4UUXA 1U6ZA 2Z2LA 3DRYA 3C15A 4X66F 2E7VA 1QAJA 4E98A 4KYZA 2IJRA 3X3UA 2CNKB 2MQNA 1IQTA 1UETA 1AT1B 3BKFA 4PQUB 3FCVA 4LBHA 5DRKA 1QTMA 2G2ZA 3CVKA 3BGLA 4A8YA 3BSOA 3NGUA 1HIYA 2ZWPA 1N54B 1JJ4A 4JOUA 2ZE2B 3TARA 2PEHA 5ETRA 2PD1A 2VOPA 2QA1A 4DX7A 4OYAA 4O0NA 3T3FA 1HWIA 1IBKF 1LWCA 3MOZA 3TWZA 2MJNA 3MM6B 1HBOA 8AT1B 2XLKA 1VBXA 2LXIA 4Y34A 1FK9A 3AODA 1JXVA 4N8OA 3OFHA 3MD3A 1S9GA 4B08A 4KTQA 1CG2A 2R2RA 1FD2A 7FDRA 4X4RA 1D0EA 4XDCA 3TZYA 4FYYB 1XEZA 1RAGB 2J0XA 2OPSB 2KDOA 3FCWA 4FXWA 5KFVA 4C11B 1YBTA 3PY8A 4RUHA 4NLWA 2HBRB 4OZNA 1IBLJ 2NSBA 4DHVA 3DHWC 3ZNJ1 1SJQA 2HRYA 2O1PA 4ZJLA 1IR0A 2YWEA 3KK1B 4LMZA 2XLJA 1D09B 2W9CA 2M88A 4WWSA 2E9RX 3BYRA 1ZAVA 4MT1A 4G3IA 2QFIA 2I0XA 2HS3A 4WP9A 4LRDA 2DK2A 3OFEA 1LW0B 4K0KF 3E2EA 5D0HA 1C0TB 2BE2A 5KFOA 3HVTA 2OPQA 3MM7B 2XYHB 2ZEJA 3R8YA 3E8OA 3ICLA 2GGPA 4X2BA 2ZOFA 1U1KA 2HNZB 4FKYA 3BF4A 2MQLA 1REVB 2K8GA 1YSJA 3QNWB 4ECXA 2V34A 1BQMA 2BX6A 4PYAA 2RH3A 4OI0A 4UOHA 3QT5A 2R7QA 1FXLA 3GIMA 3NLCA 1N5QA 2PSZA 1YX2A 4ILRA 1VCTA 2DXEA 5HJYA 3ADAC 3PEJA 3KLEA 2D3OR 2UXCF 3PCOB 4J7CA 1ZA2B 3GU0A 4U7CA 3D66A 5F8GA 4G1IA 1KNZA 4P2XA 2BKOA 3AJ1A 3J81U 1NJXA 3TQ1A 1WSRA 3A3OB 2AYGA 3HSZA 3WC0A 2KB2A 2VDHA 4LF7J 3PYGA 1N5YB 4DV2J 5J2PB 3HSDA 4NLRA 4DR1F 4PUOB 1BLUA 3RAQA 5D6GA 2QSWA 2F40A 1Q1KA 1RT3B 1NPKA 3TZXA 3PRVA 2C2RA 1KWMA 2HW3A 3M32B 1FKPB 2VC0A 4X84A 3NGRA 5F41A 3IG1A 1JXEA 1R8PA 2G2YA 4ECWA 2YKOA 3T1YF 1IJFB 2CQ0A 2CRLA 3BBBA 4L3NA 4NCBA 3U1LA 2H3EB 2UUBJ 3KJVB 3UR0A 1S97A 1G3OA 1Y0HA 1KTQA 1KQGB 3OL8A 3EE3A 1JJHA 3UDLA 3RGIA 2M5YA 1HMVA 4J9VA 1BD6A 1OQ3A 4PXDA 1FDNA 1HNXF 4LFBJ 4UQTA 2P9GA 2LLZA 1JIHA 1UVMA 2RVJA 3BGOP 1Y3JA 1RHUB 4P72A 2HVDA 3D54A 3MM8B 1S57A 4DR7F 3KG4A 5JVGQ 2B4VA 1UVKA 4X4NA 2H4YB 4IH7A 2G0JA 1JKHA 3CDAA 2KO1A 4OZ3A 4O0IA 2GC8A 4Y6IA 1PKUA 1S1VB 4EU0A 4LF2A 2VQEJ 1U6BA 3AJ2A 2DGUA 2LP4A 5E3AA 3H2UB 2JNJA 3V5RA 5IOLA 4ID8A 4TNOA 5KG0A 1I6JA 2XMWA 3I0SA 2DHSA 2FZKB 3L09A 4LF5J 3GQCA 1ACMB 2BRKA 2H5IB 1UCNA 4O23A 3X1LB 3BGRA 1U02A 3LGMA 4ZMMA 3RR8A 4ZVUB 5L9XA 5B08A 5M2PA 5C7PA 1IKWB 4P75A 1T9UA 1VQ8S 4M5DB 1IWAA 1JJCB 1HLWA 1KQKA 2Z2YB 2C42A 3LPYA 3VAHA 1SQFA 3KLGA 1VQ9S 3QFHA 4DG1A 3CE8A 1FRIA 1QUPA 3PXGa 2JJ4D 4ID5A 4I6YA 2YPZA 4DSEA 2KH9A 3M2RB 3GIIA 1E6VB 1KSPA 3WIVA 3M8YA 2HLTA 3CJSA 4FVCA 4DPWA 2KG1A 5FJ4A 2CG8A 3I5AA 3LQVA 3JSRA 4IOCQ 4CH0S 5JUMA 1WC6A 4Q45A 4J9RA 2AZ3A 3MPUB 1J5OB 2JFDA 1YI2S 3IAM9 2MSTA 5D8HB 2ZVIA 1XN9A 1YG0A 4L72B 2RRAA 2WK4A 3V6HA 4LFAJ 3I32A 2A2DA 4WKYA 3M2UB 1MSWD 1RA7A 4AUKA 2WVCA 2YKMB 4H4MA 2LEAA 2RE1A 3TVKA 4KHMA 4FF3A 3ENQA 3WC2A 4CWBA 3J81j 1B64A 1S6QB 2W2MP 2ZC4A 3IGNA 4MKBA 3CB4A 4YB5A 3OXLA 1HNIB 1X4GA 2XWYA 2LECA 4KGVB 2CNLB 2YVSA 1SJRA 5ETPA 1DLOA 1REGX 4W4MA 4LFCJ 1KOHA 1ZS6A 2BUNA 1RT1A 4TQSA 4IOBA 1IM6A 1TL7B 3PIOQ 3AAWB 3CJKA 4U96A 3C14B 3I55S 2HHUA 1VBYA 1EAYC 1S10A 4CDIA 3GFXA 1E6YB 1SC6A 4L73A 4TU9A 2J8SA 3KLIB 4LSLB 2XSFA 5DGBA 4JI8J 3GSIA 2HMIA 3PO4A 2POKA 1GFWB 1HHQA 3R5AA 3G2XA 1SV5A 3KG0A 2IC3B 1AUSL 2ZH3A 4QYZJ 3TYTA 5FDLA 1CULA 3RBEA 2UXDJ 3UDVA 4OHVA 4Q5VA 2DNGA 3MOJB 4ITSA 4DR2J 3Q22A 2JRSA 1NH7A 3OR1A 3WZ0A 4P9SA 2DB1A 2LQ5A 1T9TA 4OYIA 2E1PA 4ED1A 3IRWP 2LFVA 5DLFA 1F5AA 1C1BB 3U1MA 3QIPA 1R31A 4IRCA 4E2FB 1SKRA 4C8YA 3CJ4A 5KFDA 2A2CA 4TY8A 1BXNA 2GQCA 1KC8T 1D9AA 2PFDA 3BQ1A 5M2RA 1CLFA 1N52B 1LKZA 1JLBA 2Y9HA 4AQYJ 4OYXA 4FYDA 4KPYA 3PTWA 1RWOB 3J80U 1GMWD 2FC9A 1P8GA 1VBZA 1FWPA 2UV8G 4LR8A 2HNDB 1S76D 5C24A 4B9SA 1NM2A 3IR5B 1OSCA 4QZVB 1P27B 2G4BA 3CCWA 2ZHBA 1ZBTA 4JI0F 2WBRA 1K1QA 2VG5B 4OJ3A 1EB0A 4PKDB 2EKYA 2JVOA 3OTOF 4LRCA 3US5A 1UEKA 3H5UA 3V6JA 5LMNF 5L38A 4OI6A 3CD5A 1UTAA 2W25A 1CQNA 1EX8A 5KT3A 2MQOA 2DYAA 1AFIA 4C7QA 4LBPA 4L74A 4DFPA 3HT3A 1YRTA 3CCQS 1LK7A 3J7ZT 3AOCA 2XZDB 1RTJB 5T41A 1CPZA 4F36A 3EZ5A 4ZPCA 3H5XA 2MB0B 3GCXP 2YKAA 1TL1B 2RD5C 3TZWA 2AW0A 4B3MJ 3H90A 1X4EA 3NKYA 4Q2MA 2J5AA 2XMTA 1FKOA 3W62A 4RKUC 2R8HA 2DIUA 4JI1F 1VQKS 3M8PB 2NZ4A 3L7PA 1HBMA 4MIWA 5J2MB 4OYMA 2M8DB 3CULA 3D4JA 1NZAA 1R0CB 1I94F 4DL5A 4FYXB 4YQWA 2YNGA 3FRZA 5LOQA 3B82A 4O3QA 3VAJA 3B54A 3FKBA 5F8LA 1RE1B 2HQGA 1H2UX 2W01A 1YJVA 4CTAA 2CQHA 4R5PA 1HNWJ 1SUQA 2GJIA 5IS2A 3QIDA 4NCGB 2ZOMA 3IXQA 4B3RJ 2XC9A 2V68A 3OTDA 5HQMA 3FQLA 1RDRA 5CYMB 1IKXA 3I87A 3NCRA 4C8MA 2JLFA 5HMYA 4HI2A 3HXMA 4RZRA 1PCAA 3GTYX 3TANA 4HI1A 2V69A 2LCWA 4G1PA 4PG5A 4CLPA 3KHHA 3I9ZA 1D9FA 3TVYA 5J1EA 4FNIA 2DRAA 3UFCX 3P49B 2VB6A 1F9EB 4QR1A 2C3YA 4ED8A 2ZD1B 4HDHA 1NK6A 2H54B 2HHHJ 1RADB 4DXLA 2LEPA 3SFGA 4G1QB 1QAXA 2WZ1A 1IKYB 3DRXA 4BC9A 2YNFB 4J37A 3KLHB 4DPTA 2R7WA 2B0GA 4CO5A 4PWDA 2KJVA 2HFOA 2BOAA 4USKA 2QMWA 1Q7YT 2L08A 5GAHI 1VQYA 4LREA 4DL3A 1L3VA 3ILOA 4P74A 4IR9A 2UUCJ 3CO9A 2HQCA 1S1WA 3NMAA 5HBMB 5RUBA 1LFPA 2W2PP 2FVRA 5IQ6A 3KXDA 2FHOB 3RW6A 2RJZA 4C8ZA 3UWTA 2EFQA 3QRPA 3W64A 3OL7A 1XNRF 2JSXA 2GIRA 2CQ3A 3M8RA 2DGQA 5AE3A 2WSEC 4CLZA 3A1YG 4WKRA 1B3TA 6FD1A 1RT7B 3LUYA 2HAFA 3ISND 2F4FA 5CAAA 4ECSA 1F5BA 1C4CA 2HHSA 5B0EA 2DY9A 3HULA 5M2UA 5EWGA 4PWWA 4X64J 2DGSA 1BC6A 1HBUB 2W8KA 4JI5F 6AT1B 3MZIA 3NGKA 2IBKA 1X4FA 1RWMB 2PEBA 1EHWA 4I0WA 2RUSA 4J5OA 4F2SA 3R6GB 1XNQJ 2I5JA 4YHHF 3C15B 1HKAA 5FLXU 1H74A 2JEFA 2IRUA 4J90A 2PT0A 3T5HA 3MPYA 1FRLA 2HLUA 2VL1A 4K5SA 4ZJOA 4OZ0A 3TUJC 2AYMA 3QJJA 4EUVA 4M5HA 2IBOA 2IY5B 3OXFA 2ZBRA 4EZ6A 1VR6A 5KFLA 4X4TA 4MFBA 1U25A 1HBOB 3SMZA 3BB5A 3HHEA 5KFNA 3HD2A 4NZ7A 4C9DA 3OTBA 1F2GA 3TAMA 1FESA 4KQZA 1Y5IB 1FK9B 3G4SS 1TU0B 2V4JA 1DURA 3ZZPA 1JLAA 4XIUA 1M90T 3MEEA 1S9GB 4O4RA 2LQBA 2HFUA 4LVOP 2D9PA 4LRBA 3CMAS 1Q16B 1FDDA 5I4MA 3Q8PB 4FNHA 4EYIB 2MSSA 4NRUA 2MKIA 1M1GA 2NXEA 3BZQA 4OX9F 2VFRA 4GC7A 2ZNZA 4GMKA 1NSPA 4UZBA 3O6QA 1RHJB 3W2WA 2KFNA 2W9CB 1RHKB 4Y2CA 4MKYA 1FHTA 1RTHA 4ATNA 3QBCA 3MPWA 2VODA 2W8LA 4A8WA 2HZCA 2Q3PA 2KFYA 2X1FA 4Q7AA 1H73A 5CA5A 1X9MA 4Y65A 2WHOA 2BE2B 3HVTB 2OPQB 2WOMA 3KWMA 2GCFA 2GGPB 3CPWR 3UDEA 1M5HA 4AYBD 2KL8A 1NK7A 5F0UA 1W2BR 3FK4A 2DNLA 4DQRA 1BQMB 5E3RA 1Q86T 4DUTA 5EWFA 1UWBA 3IS9A 4GO7X 1OWXA 1R6VA 1H0HB 2JH3A 2GX8A 4HEA9 4WK1A 3NWGA 3KLEB 3DLGA 2W7PA 2HIQA 3FEXB 3L9ZA 1DTQA 2NZCA 3HFVA 4Y00A 3NNHA 2CWXA 3G8SA 4LIRA 5CH7B 3UR3C 2ZJPQ 3PG9A 2OTJS 1T9VA 3M9NB 2DR9A 2ASYA 1RCOB 1T8EA 4BLGA 4TY9A 4WPAA 4ZVQB 4FS1A 3FEYB 3BM7A 3RB0A 3BGUA 1ZAWA 1VQ6S 3DDKA 2Z57B 2LQ9A 2RUGA 3MDFA 4DUZJ 1WSVA 1HL6A 3N6MA 4TLRA 2RQCA 1HD1A 3I6PA 2H5JB 4FN5A 4K50A 1HNVB 4ERDA 5MAOA 3EGVA 4K5RA 3IG1B 1S1XA 1HR0F 5E5NA 1OMSA 4BWMA 4DV3J 3CDBA 4DV0F 4CM2A 4DR5F 2R7XA 5AXNA 4X65J 4P7TA 1HI1A 2LA4A 2XULA 1FXRA 3PR4A 3KKFA 3D1OA 1HMVB 1RHMB 4ZP6A 5D15A 1WJ9A 4KHPJ 4EFAC 5JVHQ 3TJAA 3CWJA 1OQ6A 2P6TA 4IG0A 3E3XA 3H20A 4U9RA 4QIVA 4QIGA 2GNKA 3DRRA 1LQ9A 4ZN1A 3MCNA 4DF4A 4RUBA 2Q6CA 4P10A 1K44A 2DGVA 3MR5A 4K2JA 9ATCB 2NXNA 1JKHB 3F41A 2HVEA 3P6YC 1C0UA 2RKIA 3GIRA 1K8AT 3SV4A 2DNPA 3KJNB 4IG3A 4MJKA 3VQSA 2B43A 1FWKA 1RT2B 2KM8B 1JB0C 2LKZA 2XNQA 2B51A 2MTLA 2R2UA 4CLUA 4WXWA 1VGYA 3AY0A 4F04B 4FF1A 4AXIA 3L95X 2Y8YA 5DJBA 5J2NA 4TXSA 4WZMA 2KYZA 5KT4A 3I0SB 1XIQA 3TAQA 2X3GA 5DM6Q 4ZPDA 3IR6B 3HT0A 3FBBA 3BGRB 5DDPC 1U1OA 2V5HG 4B9LA 4TN2A 2M7SA 1URNA 3EICA 2OJ3A 5BR8F 1Z2LA 1RQ0A 3KOAA 2CPDA 3FBFA 5KT2A 3PHEA 3CCJS 3J7A1 2AQ4A 1NRKA 2R8GA 4NPOA 1VJWA 1KONA 4DV5J 2GIQA 4WE1A 3KYLA 1S4EA 2C2KB 3KLGB 3B4MA 4ELVA 1TAUA 4DG1B 2LYVA 2QL7B 2DNZA 4PEOA 1RT5A 1WF1A 4ID5B 1GXLA 3ILLA 4CLKA 4LBIA 2BBEA 3SSQA 3C16A 1H98A 1UPPA 4KGKA 5CYJA 3N0VA 3CTRA 1RAOA 1RAHB 2GA7A 1IR2A 3QGPA 3FSXA 1O5JA 4EO8A 1RYRA 4PXCA 3MCMA 3SQGA 5DZ6A 3H8YA 4GKJJ 2KM8C 4LF9J 1TK5A 4BS2A 1RT4A 3BH6B 1TKZA 3W5YA 4IO1A 3EXYA 3UN2A 1YZ6A 3KDOA 2DTJA 4H4MB 3W8PA 3RRKA 4NLTA 3OV7A 1N48A 3CCES 5IQQA 3MHYA 4WBFA 2CQBA 1RU2A 4CLTA 1Q79A 3LWMA 1ZPVA 4DSJA 2CJBA 2N3LA 4XO0A 2K7KA 3GV7B 3SCLE 1FVQA 2H48B 4JI6F 4B3TJ 3MUVP 1DLOB 4OHWA 4Z7YA 2V9KA 5D0GA 1RT1B 3GFZA 3EXCX 4TYAA 3M8SA 3G96A 2VIHA 3QJLA 4NASA 1IBLF 3UD5A 4DR3J 4ES1A 2HKEA 3Q2TC 2GVDB 2R3VA 3HHDA 4EGLA 3VR1A 5B09A 1FTCA 1N56A 3NAHA 3KJFB 1XMQJ 2ACMA 2QFJA 4I2PA 1EKSA 3HHLA 4RW7A 3DOLA 3R97A 1X4BA 2HPUA 4F50A 1OPZA 5KFZA 4DCOB 3CDEA 4RUAA 3K2YA 2YQ0A 4RR5A 4ANDA 4NZ0A 4OYZA 4DL6A 1U26A 1WOSA 2YQ3A 2HMIB 3LGHA 2B3TB 2QMXA 1SV5B 3PFOA 2VA3A 3A4TA 1QLNA 5FDLB 2QMUB 1LW2A 4RJVA 1SL1A 2KHDA 1CULB 2B8PA 2XY7A 4NLYA 3KFWX 4LUBA 5F3TA 1WWHA 4Z2XA 5KFCA 2FHJD 2GMLA 4O4GA 1X5PA 4DPXA 4OI2A 3AD7C 1NMEB 3OR1B 5IT9Y 3DC2A 1K47A 2MQ8A 4RW4A 2VA2A 3LGNA 3T9ZA 4E0DA 1WEXA 3A8JA 1WEZA 2DH9A 4J9LA 2V8HA 2Z30B 4A8FA 4EO6A 1RU1A 3QIPB 1IVZA 2AYEA 1O51A 3AOBA 2FGCA 3KMQA 1SKWA 1NDCA 2HQIA 1RKJA 1SI9A 4TY8B 4C97A 2RHSB 1QJHA 2P9EA 1WHYA 2HIYA 4A4JA 1KD1T 4DSFA 1XR5A 2CJYB 4LF7F 1JLBB 1F60B 3LA0A 3VALA 1QE1A 4QBUA 4HACA 4YR3A 1F2HA 4DV2F 3CCRS 3HMJG 3JXOA 3RW7A 2Y0BB 3UW1A 2BKPA 4YR0A 5C24B 3DI6A 4DS5A 1M1HA 2VD3A 1WC0A 3JSBA 4ZLJA 5HROA 2KVQE 1FFWB 5HLFA 1HQUA 4N47A 5B0FA 2U1AA 3NGSA 1O6XA 4Q2LA 3I4PA 1Q53A 4LR7A 3RJMB 1P6TA 1Q81T 1SL0A 2ATLA 4GKKJ 2UUBF 3R5BA 3QZ8A 1SC3B 3R2CJ 2RS2A 3GG0A 3EZUA 4OJGA 2HRTA 2D41A 4V19X 4B9MA 2IVMA 3LP2A 4NLUA 4IDKA 4LFBF 2MKYA 4YB6A 1FKOB 1X60A 2ZUGA 3FSYA 3UD3P 2MDAA 2FGOA 1U1LA 3LW5C 5A8WA 4K7QA 2N4DA 1HBMB 1U7LA 2OIHA 5A76A 3T6BA 4C48A 2YNGB 3H25A 1TK8A 4ZCLA 1ZPWX 2OFGX 3NOGA 5A8KA 1KQSR 1TAQA 2DVIA 2DT9A 3PV8A 4CTAB 4R5PB 1HI8A 1SUQB 1WG4A 2K7JA 3CJRA 4TLQA 1U48A 4DV7J 3DCAA 1FDBA 1PAUB 1FWLA 4C8OA 2VQEF 1UEUA 2HFNA 5GADI 4HDGA 2B6AA 2BJEA 5E2QA 1SH2A 1ZA1B 4J9NA 1IKXB 3M9OB 3PRDA 3IM9A 4QW8A 4QWBA 4B9VA 2P9CA 4DV6F 2VFTA 4CLFA 3PDNA 4LF5F 4DCPB 1JWWA 1LOUA 3R9LA 1KLMA 1UFKA 1TV6A 3QT6A 3J81Y 4AL5A 4UW2A 3MFIA 2PFFB 1KLNA 2DCLA 5DLGA 1NKEA 1HHSA 3KK3A 3DXSX 2H1YA 2A6MA 1S6UA 3EVMA 3V2UC 3RBZA 4W90B 2ATCB 4ZLLA 3RAMA 2YKQA 2ZH4A 2R42A 3PRBA 4WFXA 2MKSA 2MKHA 1N34J 1X4DA 4UTGA 4O3SA 2MZSA 5L46A 4ZKAA 4PWDB 4J9PA 4DV4J 2VFSA 5MLCV 1BWEA 4KV8A 2AGQA 4YR2A 4LF6J 3ZTSA 2XNRA 2KHCA 3M4XA 2VICA 2BABA 1VRTA 3AA9A 3DLHA 4RWXA 2E5JA 1S1WB 3TX8A 2BM1A 4JB8B 3ILJA 2Z58B 3NXZA 2VV5A 1T95A 2FHMA 4LFAF 3P5TL 4CT8A 2J9DE 4X4UA 1Q82T 1Y5LB
chains in the Genus database with same CATH topology
3C16A 1CULA 4OYOA 1CJVA 3UVJB 4CM0A 3C14A 4NI2B 1WC5A 4CLUA 5IV4A 4WP3A 4CM2A 1TL7A 4CLLA 1YK9A 1CS4B 1FX2A 2GVDA 1CJUB 4OYAA 4WP9A 4OYIA 1WC1A 4USUA 3MAAA 3ET6A 3C15B 4P2MA 4USWA 4OYZA 5D0HA 3G82A 4WP8A 4USVA 4OZ3A 1CJKA 5D15A 3MR7A 4P2FA 4CLWA 1WC0A 1WC4A 4OYPA 1CJTA 3R5GA 1U0HA 1TL7B 4USTA 3C16B 1AZSA 1CULB 4CLPA 1CJVB 4OYBA 2BW7A 2GVZA 3C14B 4WPAA 4CLTA 3UVJA 1AB8A 1Y10A 2QV6A 4CLYA 4NI2A 4CLZA 4OYXA 5IV3A 1WC6A 1CS4A 1Y11A 3MAAB 3ET6B 4OYMA 1CJUA 1FX4A 4OZ2A 1YBTA 5D0GA 1WC3A 3G82B 3C15A 4P2XA 1YBUA 1CJKB 5D0RA 5D0EA 4CLFA 4OYWA 4CLSA 2WZ1A 1CJTB 1U0HB 2GVDB 4CLKA 1AZSB 2W01A 2GVZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C16 A;  1CUL A;  4OYO A;  1CJV A;  3UVJ B;  4CM0 A;  3C14 A;  4NI2 B;  1WC5 A;  4CLU A;  5IV4 A;  4WP3 A;  4CM2 A;  1TL7 A;  4CLL A;  1YK9 A;  1CS4 B;  1FX2 A;  2GVD A;  1CJU B;  4OYA A;  4WP9 A;  4OYI A;  1WC1 A;  4USU A;  3MAA A;  3ET6 A;  3C15 B;  4P2M A;  4USW A;  4OYZ A;  5D0H A;  3G82 A;  4WP8 A;  4USV A;  4OZ3 A;  1CJK A;  5D15 A;  3MR7 A;  4P2F A;  4CLW A;  1WC0 A;  1WC4 A;  4OYP A;  1CJT A;  3R5G A;  1U0H A;  1TL7 B;  4UST A;  3C16 B;  1AZS A;  1CUL B;  4CLP A;  1CJV B;  4OYB A;  2BW7 A;  2GVZ A;  3C14 B;  4WPA A;  4CLT A;  3UVJ A;  1AB8 A;  1Y10 A;  2QV6 A;  4CLY A;  4NI2 A;  4CLZ A;  4OYX A;  5IV3 A;  1WC6 A;  1CS4 A;  1Y11 A;  3MAA B;  3ET6 B;  4OYM A;  1CJU A;  1FX4 A;  4OZ2 A;  1YBT A;  5D0G A;  1WC3 A;  3G82 B;  3C15 A;  4P2X A;  1YBU A;  1CJK B;  5D0R A;  5D0E A;  4CLF A;  4OYW A;  4CLS A;  2WZ1 A;  1CJT B;  1U0H B;  2GVD B;  4CLK A;  1AZS B;  2W01 A;  2GVZ B; 
#chains in the Genus database with same CATH topology
 5ADZ A;  3W9I A;  3JTN A;  1D9D A;  3ZNU A;  2ZH6 A;  1V3Z A;  1FCA A;  4M5J A;  4F25 A;  4ECU A;  3PO5 A;  3MEC A;  1WC1 A;  3VCD A;  5LT5 A;  1R8H A;  1Y4Z B;  1HW8 A;  1G1X A;  4LFC F;  4IFV A;  1Z1Z A;  1IBM J;  1RCX B;  2FC8 A;  2C2E A;  5K20 B;  1A0O B;  4FVM A;  1LFW A;  1P9Y A;  1RTD A;  2IAJ B;  5EN1 A;  3S7R A;  2YWF A;  4C3M A;  2CDQ A;  2DEJ A;  1DFD A;  1S5Z A;  2QLX A;  3TUP A;  1V5V A;  2FVC A;  2NQP A;  2QRR A;  3HK2 A;  4LSZ B;  2MGZ A;  1ZM2 A;  1T94 A;  3HP6 A;  1FNX H;  2I5J B;  4F02 A;  2ZKU A;  5A8R B;  4ELT A;  2B4P A;  4DDF A;  4WII A;  2ZJQ Q;  4DFK A;  3FEZ A;  4CH1 A;  2LXU A;  2WCX A;  2ZKT A;  1VHI A;  4QPT A;  1S6O A;  1QVF R;  3V4M A;  1J5O A;  2R2S A;  2VPW B;  4G6V B;  1M5K C;  4KC5 A;  4F0M A;  3PFE A;  4LR9 A;  5KG6 A;  2UXD F;  1SL2 A;  4DR2 F;  2DXF A;  3MR6 A;  4MFB B;  4YN3 B;  5DG9 A;  3EMT A;  1SJ4 P;  4FS2 A;  1U6F A;  3TAM B;  4ZVG A;  3UCU P;  5ETL A;  4RO0 A;  4DN9 A;  2V4J B;  1JLA B;  2P2C B;  4EBD A;  2BKN A;  1LXN A;  3MEE B;  3D0G E;  3DLB A;  3OSP A;  3GFH A;  5D4O A;  5L1J A;  4ZP8 A;  3DLJ A;  2YWK A;  3GON A;  4NZ6 A;  2GJ2 A;  4AQY F;  2YKP A;  2KT5 A;  1FT8 A;  3FZB A;  4ZIW A;  4BDP A;  2WW8 A;  3VWS A;  3PKY A;  1YJW S;  2FY1 A;  4F4K A;  2VFV A;  2RRB A;  2RU3 A;  2NSC A;  2IA0 A;  2BV3 A;  1U1R A;  1T0T V;  3W2W B;  1U0S A;  3G9C A;  1RI7 A;  1ARO P;  3BN4 A;  4X66 J;  2ZH2 A;  2AKW B;  3KLI A;  4I6A A;  3HFK A;  1SQE A;  3K5P A;  1WTF A;  1RTH B;  2FVQ A;  2RIJ A;  2XO7 A;  4B9T A;  1MLA A;  3AD9 C;  4DS4 A;  5K14 A;  3ET6 A;  3EWG A;  3MAH A;  1NHK L;  1S0M A;  3NS6 A;  2FB0 A;  3KUG A;  4N41 A;  1W25 A;  2QL5 B;  4DQQ A;  2G0I A;  2C3M A;  2EFG A;  2N7C A;  1IBK J;  5L8R C;  2V2K A;  1UWB B;  3IS9 B;  3BSN A;  4B3M F;  5HAN A;  4CLY A;  5JXS A;  1S0N A;  4ZPT R;  1R89 A;  3DLG B;  2FIU A;  3TUZ C;  4OLO A;  4NLO A;  3ZC4 A;  1DTQ B;  3H2V E;  2C1E B;  3PJX A;  2Y1L B;  4QOT A;  4WCE Q;  2WVF A;  1TMM A;  2RT3 A;  1I1G A;  2GHV C;  1IM4 A;  2RML A;  3Q24 A;  1YIT S;  3IMQ J;  5B0G A;  1B4S A;  3G71 S;  5H9E J;  5IWA J;  2ZH7 A;  2GZO A;  2PO4 A;  4C3K A;  4CNY A;  4B3R F;  5LM7 E;  5J1N A;  2VFU A;  2H4W B;  4F4Y A;  4MMO A;  3I9V 9;  3G82 A;  1L5U A;  5LJ3 Y;  2DEI A;  2VPY B;  1D8Z A;  5H9F J;  4DWI A;  4BWJ A;  3N79 A;  3CJ2 A;  4N77 A;  2CXE A;  3R1L A;  4WF9 Q;  4QIE A;  1S1X B;  1QUV A;  1RWK B;  1WEY A;  5IXU A;  2HGL A;  1RWX B;  5KTQ A;  2IA6 A;  3TX0 A;  3BO3 A;  5LMU J;  4ZP9 A;  3W3S A;  3NBP A;  4I2Q A;  1RTJ A;  5HQL A;  1S7H A;  3KG1 A;  2IVF B;  3BBC A;  5LXR A;  3P4U B;  2XMU A;  2MLY A;  3J80 Y;  1YJU A;  3BDE A;  3DDI A;  5D0E A;  2HHH F;  1JNZ B;  2AX1 A;  1W7W A;  4CO4 A;  4JUZ A;  1RAC B;  4IG0 B;  1J27 A;  4UOC A;  1HBN A;  2WSF C;  1TTH B;  3GCW P;  3DRR B;  4Y2A A;  4ZK7 M;  4BCA A;  2BJD A;  2J7K A;  4A8Q A;  2UUC F;  2QA4 G;  4CO1 A;  4KAI A;  3GV5 B;  3RYL A;  2MQP A;  4ZVO B;  2HFV A;  1C0U B;  2RKI B;  3TUI C;  1YJN S;  4ED3 A;  3FFI A;  5EHH A;  4KSE B;  4NCG A;  2W4D A;  4IG3 B;  1UZH A;  4ZIT A;  5E3Q A;  2Y8W A;  3U1N A;  2Y1J A;  3H59 A;  2FJX A;  3LH2 S;  4Q44 A;  3R7N B;  5J2N B;  4FBU A;  4F3Q A;  3FNN A;  2X3D A;  1JQG A;  4MK9 A;  4USI A;  1WKL A;  5CZX A;  3PKM A;  2L9W A;  1VK8 A;  1SBR A;  3AD8 C;  3T9N A;  3O44 A;  1GMU A;  3PX6 A;  4OZL A;  4K4Z A;  1KKH A;  4DFJ A;  2OAU A;  2XMK A;  4NEY A;  2BM0 A;  4IOA Q;  4X64 F;  3K7R A;  3RBX A;  3C6T A;  2XI2 A;  3IWN C;  3DMJ A;  2DR6 A;  5H9E K;  5GAD U;  1T02 A;  1HI0 P;  2UV8 A;  4Y2M A;  1YBA A;  3BR9 A;  4DUY J;  4LF1 A;  5KFR A;  1KN6 A;  2AT1 B;  4WE1 B;  4EYH B;  4OLP A;  1NJW A;  4PPZ A;  4PXB A;  1XNQ F;  5KFQ A;  1NO8 A;  3IA0 A;  5ETV A;  3MI7 X;  1H6K X;  1YVF A;  5H9F K;  1VOM A;  4CI0 B;  1RT5 B;  2E9T A;  2LA6 A;  3DFE A;  3ZZY A;  3GFY A;  4LRF A;  1Y9O A;  1ZYQ A;  4A8M P;  3C16 B;  3MEK A;  4EBC A;  3KK2 A;  3WX4 A;  3CCS S;  2W2Q P;  3D9B A;  2CUY A;  3D2W A;  2CYY A;  4NEZ A;  3HLU A;  2J0Q D;  4RBT A;  3SQG B;  3HZG A;  2WRM A;  2YWW A;  1VC0 A;  3ZO7 A;  4ZPW R;  1RT4 B;  2FVS A;  1TKZ B;  4A8K A;  4QYR A;  5JJB A;  4ECV A;  2F4V F;  3OT9 A;  1ELO A;  1HWK A;  3CJ5 A;  2DKO B;  4NCA A;  3H98 A;  3UNY A;  4UF4 A;  2ZOG A;  3WDO A;  1VK3 A;  2J0S D;  3D5M A;  2H9Z A;  1HA1 A;  1CJV A;  1A6L A;  3PNI A;  3QAU A;  1RBO B;  1VQM S;  2DGO A;  2NUH A;  2GQQ A;  3RRG A;  1C1C A;  1X0P A;  2OI2 A;  3VGT A;  2W2N P;  2QG9 B;  4Q8E A;  5CXT A;  2ZFH A;  2HVI A;  3CSK A;  1U0H A;  5HSP A;  1S72 S;  1NJY A;  1VBK A;  4ZIV A;  1PG5 B;  3HHL B;  4RW7 B;  1GXU A;  3DOL B;  2GHW A;  2KTQ A;  1BY9 A;  3ENV A;  3DLE B;  3FC9 A;  2QO3 A;  4MIB A;  1UJ4 A;  3CJ3 A;  4NXN J;  3GB0 A;  1B99 A;  3K59 A;  2OH2 A;  3S8S A;  2CNO B;  2BAC A;  2EC0 A;  2SXL A;  4F0H A;  3C66 A;  4OZ2 A;  3MFH A;  2AWZ A;  2BJ8 A;  4ES2 A;  2FJW A;  1XC9 A;  2DRD A;  4OJH A;  4K8R A;  4DF8 A;  1LW2 B;  4ZDN A;  3G6V A;  4PCQ A;  1HNZ F;  1JLG A;  1U4B A;  4EI2 A;  4C4W A;  5GMD A;  3RTV A;  3RZA A;  3CO0 P;  3Q83 A;  1I5O B;  4O4G B;  1N33 J;  1Q4R A;  5GAG I;  2EK1 A;  4RW4 B;  1EP4 A;  3HKW A;  3TJ9 A;  2O66 A;  1GX6 A;  4DPU A;  2WAQ D;  4M8L A;  4CO2 A;  2IJF A;  3QGG A;  4C8K A;  4E8U A;  3ISZ A;  4HT7 A;  3QYY A;  1Y7P A;  5D4N A;  5DG7 A;  3GJS B;  5FLX Y;  3ILI A;  3FGV A;  4OZ5 A;  3FBE A;  4UST A;  1GMW A;  4KGX B;  3F44 A;  1RWV B;  5K5M A;  5ITH A;  2J9C A;  1YZ7 A;  1H2T Z;  1YGY A;  2UZA A;  3VVU A;  3N9U C;  2FJA B;  5IZH A;  4DLG A;  5KFU A;  5AE1 A;  1QE1 B;  4HAC B;  1OYE A;  3UPF A;  1SC4 B;  4QIW D;  5FD1 A;  4H4K A;  4OV6 A;  1SPB P;  3HHL C;  2CPE A;  2YY3 A;  3DI6 B;  3BR8 A;  1DAR A;  2A18 A;  2NXC A;  3OR2 A;  5HRO B;  1VYA A;  2KT2 A;  4NXM J;  4NLX A;  5HLF B;  1T7P A;  4ETX A;  1HQU B;  1WF0 A;  3R2D J;  2DCU B;  5HP1 A;  4OYO A;  5ETQ A;  3QLH A;  5CCM A;  4CO0 A;  1R27 B;  2XCP A;  4KJI A;  3UN5 A;  3SDE A;  4DV3 F;  4H4O B;  4X65 F;  3W65 A;  2BZ2 A;  1FXD A;  3FZ2 A;  3CCU S;  1MNE A;  3P96 A;  1VI7 A;  5BJR A;  2K3K A;  2MYF A;  1NZ8 A;  3VQT A;  1RAE B;  3LP2 B;  3PHT A;  2C2D A;  2AP6 A;  2VKR A;  4KHP F;  4IDK B;  1TR0 A;  2XG8 A;  1PO6 A;  4RNO A;  4GVB A;  2B56 A;  5A8W B;  4BHQ A;  2YQ1 A;  3KLF B;  1PSD A;  3Q8Q B;  3QGI A;  2C28 A;  2JHE A;  4KY3 A;  2M2B A;  4ED0 A;  2OTL S;  1Q8I A;  2J6S A;  2G1H A;  3C19 A;  3ZZU A;  2XHC A;  1S0V A;  5A8K B;  3HF5 A;  4YOE A;  5KFF A;  1C2P A;  1V6H A;  2F9J A;  4JI7 J;  3IP0 A;  1RAJ A;  2W2O P;  2AX0 A;  3SI8 A;  4M5K A;  3QQC D;  2E1R A;  2OSR A;  3TO8 A;  1DBD A;  3CME S;  2U2F A;  2B6A B;  3D28 A;  1X4C A;  4RW9 A;  1HNV A;  3N6L A;  4NE9 C;  3N4W A;  1TVR A;  1IQZ A;  4WK3 A;  1H2V Z;  4DLE A;  3OTO J;  1URR A;  2CVE A;  2MZQ A;  1KLM B;  2AGO A;  4BC7 A;  2QC3 A;  5KG3 A;  1TV6 B;  1RBL A;  3P45 B;  1PYS B;  3MM9 B;  3GG1 A;  4RL1 A;  2JEJ A;  1RP5 A;  1YKW A;  2V94 A;  4DI6 A;  1MU2 A;  5KFS A;  3UVJ A;  3KK3 B;  3BKT A;  4IYQ A;  5IV3 A;  2QZ8 A;  5KG1 A;  4NOH A;  1M5S A;  5EUH A;  2PMW A;  1SIZ A;  3H5S A;  4HH0 A;  2GO8 A;  2AJ4 A;  2NXU A;  3O5T B;  5K8P A;  3MTK A;  1G2E A;  2AJ2 A;  5B0C A;  1PBA A;  3N5B A;  4MYU A;  3K17 A;  4LRA A;  2DJW A;  2J6T A;  3IO1 A;  1RAB B;  1Y00 A;  5LSL A;  5ETS A;  4P7V A;  1QSL A;  4QU7 A;  4ZVH A;  2F9D A;  4KV8 B;  2KZM A;  3PEH A;  4O3R A;  3IWX A;  3OW2 R;  4ZPA A;  4ED4 A;  2DHG A;  1VRT B;  3D1H A;  1R8C A;  4L6V 3;  5GVQ A;  1NUE A;  2GMH A;  4CRJ A;  1RTZ A;  4KH1 B;  3BEG B;  1RT2 A;  4GKJ F;  4LF9 F;  1S1T A;  2MLZ A;  1FRX A;  4FF2 A;  1VQO S;  4UY8 T;  2JEI A;  4HR2 A;  2X1B A;  2DGW A;  4UZC A;  2VG6 A;  2DPJ A;  2ZHA A;  3FUY A;  3N28 A;  2HK3 A;  1SKU B;  1PC5 A;  2E5I A;  1NDL A;  1RUS A;  1UFW A;  2VG7 A;  4N56 A;  3K57 A;  5C42 A;  1OIA A;  5ETO A;  5JMN A;  1VQP S;  3EGZ A;  2D3Z A;  3MEC B;  4DX8 H;  2JZ5 A;  1KHV A;  4B3T F;  1WI6 A;  3IWL A;  3HCX A;  2W9B A;  4IFV B;  2QL9 B;  2QA4 S;  3TVZ A;  1VQS A;  3CED A;  1RTD B;  2ZZN A;  4DR3 F;  2DIS A;  2BVZ A;  7AT1 B;  3T41 A;  1ZTT A;  3O2I A;  1J5E J;  4RNN A;  1XMQ F;  2IDL A;  1N4L A;  3FBC A;  2MGZ B;  3MD1 A;  1K0T A;  1UJ6 A;  4WFZ A;  5LL6 d;  2JDJ A;  3KTQ A;  2B5J A;  1HYS A;  3KNA A;  3PW4 A;  4GC6 A;  4EWT A;  3E01 A;  1OS5 A;  1NDK A;  2XBP A;  3W9J A;  2YX1 A;  2C3O A;  2FQQ B;  1HAR A;  3V6K A;  2DR5 A;  4OZ1 A;  2E66 A;  2CPH A;  1AB8 A;  3MUR P;  1FNM A;  2MJU A;  1N5T A;  4K4V A;  5A6W A;  4ZS6 A;  1GNK A;  2B8Q A;  5KAK A;  3UN3 A;  2IMO A;  4LJM A;  4XDD A;  2CQ1 A;  3M6X A;  4ZHR A;  3GLJ A;  3LF0 A;  3AH6 A;  1Y3K A;  2ADC A;  1EIY B;  4RNH A;  2W7A A;  1H3D A;  2WBM A;  2HWT A;  2HQF A;  1RB0 A;  3TP2 A;  4CM0 A;  1WHV A;  4X62 J;  3L3C A;  3UCZ P;  3BQ0 A;  4B3O A;  2GVD A;  2PC6 A;  3UDC A;  1QM9 A;  1GEH A;  2FJV A;  1T3O A;  2V8D A;  4RU9 A;  1NH8 A;  1JLC A;  1FI4 A;  4U8V A;  4JV1 A;  2AJ0 A;  2HFS A;  3G8Q A;  4X4V A;  2DHX A;  2E5L F;  2FLP A;  3ZXW A;  2FD2 A;  3TAP A;  3QPI A;  4KE5 A;  3RG6 A;  2UU9 J;  1YHQ S;  2DNR A;  2BAN A;  1HQE A;  3FVY A;  2OPP A;  2I1R A;  3HI9 A;  2BEF A;  3T1A A;  3JAM Y;  1ZM4 A;  4HHJ A;  4MKV A;  5K14 B;  3G6E S;  3D6H B;  3ET6 B;  4J9S A;  4I64 A;  4DSK A;  1U24 A;  1WUU A;  4RBV A;  4GKK F;  3P3D A;  4IRD A;  4KKO A;  4M94 A;  5KG7 A;  4C3L A;  1GAO A;  2EI5 A;  3DRP A;  1T3N A;  1HWJ A;  3IGV A;  2G9O A;  1FRM A;  1ZH5 A;  1VRQ C;  1GTH A;  2YXL A;  2MHN A;  1VJQ A;  5IV4 A;  1SH3 A;  5HAO A;  1R0A A;  1FRK A;  4LF8 J;  3UQS A;  1IJE B;  3BDP A;  1NK9 A;  5KOX A;  2Z8Q A;  3ZZT A;  2HS4 A;  1NDP A;  5DS7 A;  2YH1 A;  4W92 B;  5THW A;  1XMO J;  2V0N A;  2XCA A;  2DPI A;  3GPA A;  1XBW A;  1SJ1 A;  4OX9 J;  2V63 A;  4CP5 A;  1QVG R;  4J9M A;  1N32 J;  4DZD A;  1U8S A;  3HVW A;  2XSJ A;  5GAG U;  2XZW A;  4DV7 F;  2YNI A;  1CSJ A;  5G0R A;  2ZDP A;  4U7U D;  4J9U E;  4URS A;  3ZZZ A;  3M1V A;  2B4U A;  3ONQ A;  4J9O A;  3UCG A;  2RIL A;  1XWL A;  1AUD A;  2DNH A;  3TEG A;  5HMW A;  4RPF A;  3HD1 A;  3G82 B;  1EET A;  1YDL A;  2QYC A;  2V8G A;  3GE9 A;  1EQ0 A;  3CJ8 A;  3WHI A;  2RS8 A;  4C8N A;  2A10 A;  4ILM A;  2PA8 D;  4NL5 A;  4DR4 J;  2E7X A;  2B9X A;  1NCL A;  2RQM A;  2V4Q A;  4KPC A;  3IBF B;  3ZFV A;  4R8U A;  3NBP B;  4I2Q B;  1OY6 A;  4U6P A;  3VAM A;  1H72 C;  3EDQ B;  5SUH A;  4L3K A;  4OQJ A;  2KXN B;  3K5M A;  1Q78 A;  3QJP A;  1I3O B;  3PYF A;  4AE5 A;  2OP5 A;  2UXB J;  2YNH A;  3OXG A;  5KG5 A;  2HRU A;  3MEG A;  1H7W A;  3J7Z 5;  3IR7 B;  1WEL A;  1ZM3 A;  3MF5 A;  1R8A A;  1PAE X;  2C2M B;  5F0W A;  1HBN B;  1N34 F;  3M6V A;  3OSN A;  1KTV A;  4DV4 F;  2V67 A;  1T03 A;  5LJ5 Y;  4USH A;  1XR6 A;  4LF6 F;  3DLK A;  1DAX A;  5EWE A;  3T1H F;  4HHH A;  1PC4 A;  1FDA A;  3AOA A;  3FFI B;  2NRE A;  3HO1 A;  3GYG A;  4DU8 A;  3LP0 A;  1AFJ A;  2ASL A;  2XEX A;  1HFE L;  2FPH X;  2BW2 A;  2IPO B;  2RU9 A;  3L7U A;  3T5K A;  3MED A;  1S7I A;  3SSR A;  4RNF A;  2DNM A;  1S6P A;  2F8E X;  1T05 B;  2CDR B;  4FPR A;  3H7H B;  3PW7 A;  3KNG A;  1S48 A;  2EPI A;  4PZV A;  5K8N A;  4JV2 A;  5L1K A;  4USU A;  1HR0 J;  3MAA A;  2NPF A;  2KXH A;  4P2M A;  2QTW A;  4KGM A;  4PQA A;  5KFW A;  2WTF A;  3NY0 A;  2Q1L A;  1L3K A;  3A3N B;  4P2F A;  1XER A;  2MY7 A;  3QRR A;  4RW6 A;  5KFY A;  1RXO B;  3M2V A;  4DR6 J;  3AQP A;  4F2R A;  1KFD A;  3V6D A;  3C6T B;  1RGV A;  1WTB A;  5D77 A;  3DMJ B;  1B0V A;  4WTO B;  4URG A;  4U67 Q;  3K58 A;  3EVW A;  5L1L A;  4ZPB A;  2GAG C;  1RLD A;  1WOO A;  5ETN A;  5E41 A;  4ECT A;  1TK0 A;  5L9N A;  2HVZ A;  4UT4 A;  3JTP A;  2B7B B;  3PJ9 A;  4QCL A;  1VC5 A;  5DQH A;  3I56 S;  2H5E A;  1RBA A;  4WFB Q;  3KK2 B;  2DNN A;  4IQX A;  2O67 A;  2F3J A;  5LSO A;  3MMC A;  4F4A A;  5L1I A;  3O8W A;  2GHP A;  4HT5 A;  2XTJ P;  4QWC A;  1YK9 A;  3SBM A;  3EM1 A;  3R27 A;  3OJS A;  4USM A;  2ZM6 J;  1SB6 A;  2CPJ A;  2QJ3 A;  1NK8 A;  3IRX A;  1RZM A;  3BV8 A;  1RA6 A;  4USV A;  1CJK A;  2LQ8 A;  2GFF A;  3H42 A;  1N6Q A;  1WHW A;  1PJ7 A;  3NL0 A;  1TKT A;  3PZP A;  2A1B A;  1CJV B;  1GT8 A;  3OUY A;  2DHA A;  3TA1 A;  4ZOS A;  1NKC A;  2V8P A;  4F4W A;  1F1B B;  2ZH9 A;  1O8B A;  1C1C B;  3W66 A;  3A8E A;  3BO2 A;  2IAJ A;  3CIZ A;  1WG5 A;  2Z56 B;  4I6W A;  2FJD B;  5IT4 A;  1NLK L;  1VMB A;  2OKQ A;  1FER A;  2BE9 B;  2GAH C;  3FCH A;  1U0H B;  3JTO A;  4HVZ A;  4I69 A;  1U2F A;  5AJ3 J;  4JI4 J;  5A8R A;  1RSC A;  2DIV A;  4K4U A;  4OIX A;  4ES3 A;  5IT0 A;  3P8B B;  2FHJ A;  3L4B C;  5DG8 A;  4XPC A;  1VLO A;  3MAQ A;  4W98 A;  3NEK A;  1RLC L;  5LSR A;  1WAC A;  1WC4 A;  3GV8 B;  1JLG B;  3EVO A;  2Y1I A;  2QLW A;  2ZH1 A;  2WSC C;  1JMT A;  3SSS A;  3QAE A;  4K4X A;  1KP6 A;  4NI2 A;  3G87 A;  4P2S A;  1EP4 B;  1DY3 A;  2KKH A;  2XGP A;  4OFZ A;  4JYA J;  1APS A;  4OI1 A;  1M0S A;  4PRF A;  3MR3 A;  9RUB A;  3I0R A;  3Q2S C;  1WKK A;  2AEF A;  3GR1 A;  2ILZ A;  2KJW A;  3JQJ A;  5U47 A;  1X8D A;  4IFY A;  3LP1 A;  4I67 A;  4JI6 J;  2AJ1 A;  3JSM A;  3ETO A;  3MMA A;  4PXE A;  3MCS A;  2YX7 A;  3D6M B;  5D4P A;  1LV5 A;  4M63 A;  1T9W A;  3HPO A;  4YS2 A;  4QJV A;  3M6W A;  2IHR 1;  5IWA F;  3F56 A;  4RNM A;  3WIU A;  3GR0 A;  2CJK A;  4Q0B B;  2RRN A;  3OTC A;  2VF3 A;  4ZCM A;  3HM9 A;  1EZZ B;  2CQP A;  2L41 A;  5CQG A;  3OR2 B;  1VFJ A;  2XGQ A;  4DPY A;  2LU1 A;  4FPI A;  1U47 A;  5HP1 B;  1N88 A;  3P5B P;  4ZN3 A;  3W8G A;  4DBQ A;  5I3U A;  3QLH B;  2C3P A;  4QR2 A;  2A3J A;  4BBY A;  3GIL A;  3SDE B;  1X4H A;  4GO5 X;  5LMU F;  1KEK A;  1XK8 A;  1LWE A;  1MWQ A;  2I38 A;  1UWA A;  2NYH A;  2R8J A;  4LSN A;  2DY1 A;  3OL9 A;  2HGM A;  3CJT A;  5HVG A;  5F8H A;  2Z2Z A;  1VIS A;  4DL0 C;  4DV1 J;  4YY3 J;  1N36 J;  5H1S V;  1X5O A;  3VVT A;  1S12 A;  4GVB B;  4CT9 A;  8RUC A;  1NB2 A;  4C98 A;  4JI2 J;  2E29 A;  4YFU A;  1YLX A;  4MH8 A;  5EDW A;  4EK2 A;  3NS5 A;  4Y2I A;  1ULR A;  1X4A A;  2Z4P A;  3R3T A;  3LAK A;  3GWC A;  1UZD A;  2KZZ A;  1TEL A;  2CIM A;  3LO3 A;  2OD6 A;  2YWG A;  4FYV B;  1SXL A;  3OHA A;  3IC1 A;  5A0Y A;  4PPD A;  2OEK A;  2HVH A;  3ELH A;  4H4K C;  2W7O A;  3AHP A;  2VQF J;  1DJ0 A;  3TQE A;  3CW2 C;  1FO1 A;  4RWW A;  5A2Q U;  2VKZ G;  5E3P A;  1IR1 A;  4OHX A;  3DGV A;  4R25 A;  4RW9 B;  4NML A;  3ZZO A;  5KFB A;  1AW0 A;  3OBI A;  1NXI A;  4ANE A;  1D3W A;  1TVR B;  3D0I E;  4M5I A;  3MR2 A;  3PYE A;  1OY8 A;  1CVJ A;  3VAF A;  2KT3 A;  4KH0 B;  5F8M A;  4Y0F A;  1GQE A;  2RDI A;  1M1K T;  4MKA A;  2FHK A;  1YJ7 A;  2IDE A;  4IUF A;  1MU2 B;  2CPY A;  2HHW A;  3UVJ B;  1ZAX A;  2VAS A;  1NBE B;  4WZQ A;  3GIJ A;  4ER8 A;  2ERR A;  2Q43 A;  1WG1 A;  1TFY A;  2KVI A;  3M6U A;  4O44 A;  3HSJ A;  3W5X A;  3AXK A;  4DUY F;  4DZ6 A;  1DRZ A;  1OY9 A;  2J76 E;  2FTR A;  4NLD A;  4Q8F A;  1O0P A;  4JV0 A;  2UVR A;  1M5P C;  3CC2 S;  2QIF A;  3R5G A;  4ZVT B;  5D3G B;  1NAQ A;  3G6X A;  4V1A k;  4B3S F;  3CF5 Q;  1CBK A;  1XJW B;  2RF2 A;  1QAY A;  2A0F B;  1FJG J;  1FJ7 A;  2YX4 A;  3RB6 A;  2ROE A;  2CFX A;  1Y11 A;  2J8A A;  2XI3 A;  5DM7 Q;  3VF0 B;  1CJU A;  3J7Y I;  2AU0 A;  1UP1 A;  3V81 A;  2XY5 A;  1VQ5 S;  1YQH A;  1S1T B;  2VUG A;  1K0V A;  2EXU A;  1YBU A;  5C5J A;  5F9L A;  4KHR A;  1QSY A;  4QIF A;  4LF4 J;  3SXL A;  2CZ9 A;  2VG6 B;  3TNV A;  1CEZ A;  2HBZ B;  2CJQ A;  4WFA Q;  2VBZ A;  5HJX A;  3BRE A;  3G8T A;  2VG7 B;  4DV6 J;  1EJ7 L;  2ADB A;  2RSQ A;  5C42 B;  5D4L A;  2MKC A;  1VQ7 S;  4WP3 A;  4B9U A;  5DET A;  3K5L A;  4N76 A;  4ICL A;  4NYO A;  1BQX A;  2W9B B;  3JSY A;  1WDT A;  2ILY A;  1KVK A;  2J6U A;  2OMO A;  3VV2 B;  4I68 A;  2EEY A;  4A48 A;  3V4I A;  4N7T A;  1VIX A;  4X4P A;  1PIL A;  2BE7 D;  2P5V A;  1S9E A;  2XS5 A;  3ZTQ A;  1Q8K A;  3NGT A;  3PM9 A;  3LAM A;  1KFS A;  4K4W A;  1RHQ B;  3CMQ A;  4ZJQ A;  4RW8 A;  2B7C B;  2QLB B;  2VC1 A;  2LXF A;  2CZV C;  4NXN F;  3BH7 B;  2X1A A;  2B5J B;  3OJU A;  1HYS B;  2DRB A;  2LVW A;  1MG7 A;  4P6Q A;  4FYW B;  2IJN A;  3E01 B;  1V9O A;  4FBT A;  2CPZ A;  1V3R A;  2DGT A;  1RTI A;  3QWP A;  3W63 A;  4O3O A;  4IO9 Q;  3DNC A;  3D6T B;  1WOR A;  2LQJ A;  2WVD A;  2YBV A;  1TKX A;  3VAG A;  1N33 F;  4DL7 A;  1F5C A;  3ISN C;  4ZHR B;  2CG4 A;  3HVR A;  2IYI A;  3ZZR A;  5HVH A;  2ABY A;  2M4M A;  5GAH U;  4ALZ A;  2XB2 D;  5B0A A;  1L3T A;  1B7F A;  5HI7 A;  3TRG A;  1MWZ A;  5KG4 A;  2OEL A;  1VRU A;  4WTY A;  1Q8L A;  4R0E A;  1NJI T;  2V2Z A;  4ECZ A;  2ZH5 A;  3G86 A;  4B3O B;  2ZJR Q;  2BJ7 A;  3I96 A;  1CQM A;  3DKD A;  4WXO A;  5HQ8 A;  1UA0 A;  1FJC A;  3N01 A;  2FY8 A;  2RB7 A;  1DQ8 A;  4MYT A;  1JLC B;  2F1F A;  3DLE A;  4HH1 A;  2DH8 A;  2BA9 A;  1IKV A;  4A47 A;  3IBC B;  2E5H A;  4EBE A;  4OI4 A;  4DFM A;  2EW9 A;  2O3D A;  4ZVS B;  2AJF E;  2NPI A;  4NXM F;  5KT6 A;  4YEA A;  1HD0 A;  3M30 B;  1TL4 A;  3HJF A;  2BAN B;  1HQE B;  5KFJ A;  2G0C A;  5KFH A;  4PG7 A;  2OPP B;  4J9Q A;  3KUE A;  2CNN B;  1F0X A;  1FTR A;  1ICE B;  3TA2 A;  5G4D A;  2QX0 A;  4JV5 J;  3W61 A;  2L9D A;  4XPE A;  1FNO A;  2PN6 A;  5KFG A;  4KKO B;  4DSL A;  2RDJ A;  3D0H E;  2KXF A;  5DQI A;  3DRP B;  1RWW B;  1V5I B;  2NLW A;  4NRT A;  3BSA A;  4RUC A;  2IM1 A;  2ZBQ A;  1BHN A;  2GVZ A;  2PI4 A;  1P1T A;  1VQ4 S;  2R7V A;  4DMZ A;  3EGN A;  1R0A B;  1NHV A;  3T5L A;  4MIA A;  1TUW A;  3DOM A;  3DOK A;  4KR0 B;  4QU6 A;  1K1S A;  1CS4 A;  2GJF A;  3VTI A;  1R6Y A;  1Q95 G;  4URQ U;  2BQU A;  2FDN A;  2YKN A;  5DDR C;  1FE0 A;  5BYS A;  1N0V C;  2N7Y A;  2Z2M A;  4JI7 F;  4K2X A;  3TJ8 A;  4HTJ A;  3DM2 A;  3D3C J;  2XSJ B;  2KFZ A;  2ALZ A;  4PG4 A;  2E7W A;  4A46 A;  2F8M A;  2VPX B;  5KFT A;  2YNI B;  2LU2 A;  4KFB A;  4B02 A;  4CO3 A;  5G0R B;  3MCO A;  3M1V B;  3CJQ A;  3DU5 A;  1BE4 A;  2LEB A;  1RAI B;  5CD4 A;  3WBZ A;  1EET B;  4OI3 A;  3DDN A;  3H2L A;  2V50 A;  3CXC R;  2C22 A;  1NPP A;  4NA1 A;  3NCQ A;  4H4O A;  2L3M A;  3DGP A;  4ELU A;  5J2Q A;  1T9Y A;  1JLF B;  2DO0 A;  2UUA J;  4R8U B;  1U45 A;  4UOG A;  2HBY B;  5HMX A;  2OFH X;  2R7S A;  2ZIT A;  3TA0 A;  3GMG A;  1SQG A;  1JLE B;  2YNH B;  4NLS A;  2UP1 A;  1RIS A;  3PVX A;  1NU4 A;  3MEG B;  5GAE I;  3RB3 A;  4OV1 A;  5CYQ A;  3KLF A;  2UUT A;  2FLL A;  1BMQ B;  3CC4 S;  3A13 A;  4A8O A;  4QWD A;  1F9H A;  2WON A;  2DNO A;  4WU2 A;  5DDO C;  1T03 B;  2M0G B;  4EZ9 A;  2CAJ A;  3Q23 A;  4CLL A;  3DLK B;  3R5D A;  4QYZ K;  4Z37 A;  2X1G A;  1BQN A;  2D1C A;  4C6A A;  1MN9 A;  3R5J B;  3LP0 B;  1S59 A;  3QZ7 A;  1YIJ S;  1NB7 A;  3TR5 A;  3BO4 A;  1LWF A;  1V3S A;  3SQO P;  3MED B;  2OSQ A;  1S6P B;  2F8H A;  3OL6 A;  2CPX A;  1M5O C;  1KS2 A;  3M8Q A;  2NCK L;  1GH8 A;  2FJB B;  2CZ4 A;  4ILL A;  3MM9 A;  2AEM A;  3MAA B;  3RB4 A;  1GTE A;  3ETM A;  1QAI A;  3CDU A;  4IR1 A;  4C0B A;  5D0R A;  3ITH A;  1PJ5 A;  3BGF A;  4RW6 B;  3M2V B;  4C8L A;  2HHT A;  4NYP A;  1PIE A;  3V6D B;  4QWA A;  2V4R A;  4I7F A;  4OMF G;  2OML A;  3NP5 A;  5FII A;  4XK8 C;  2Y0S D;  1Z4U A;  5DQG A;  1J5E F;  2IM0 A;  1FKA F;  4F3O A;  3KHR A;  1NSA A;  5DZ7 A;  2EG1 A;  3RUB L;  1WNE A;  2DR7 A;  3QO9 A;  3C6U A;  4ZVR B;  1XMB A;  4G65 A;  2HHQ A;  4EMD A;  3DRS A;  3DXB A;  1BGX T;  2PE8 A;  3G6Y A;  2ZDO A;  3PW5 A;  2APO A;  4H54 A;  2Q66 A;  1WHX A;  3MMC B;  4QWE A;  3B4D A;  4J9K A;  4CYU A;  2FZG B;  4D3H A;  4LVN P;  3VAK A;  1C4A A;  5C2G A;  4FXD A;  3NMR A;  5KOW A;  3KMS A;  3JQK A;  3EYZ A;  2Y3Y A;  1TUV A;  3M9M B;  2M8H A;  1OPI A;  1TP7 A;  4WU3 A;  1SCJ B;  4NX9 A;  4CNZ A;  3IRX B;  1NSK L;  3SIP B;  1CJK B;  2IFX A;  5ETT A;  1X0F A;  4M5L A;  1FE4 A;  3D6F B;  1N6Q B;  1TKT B;  2CQI A;  4OZJ A;  2LMI A;  3HSG A;  2K2P A;  3R1H A;  3BKU A;  1ZM9 A;  2HNY A;  2MKK A;  4ZA1 A;  3OUY B;  1YJ9 S;  3C46 A;  2ZHO A;  3KLV A;  3PX0 A;  4I56 A;  1Q8B A;  1SH0 A;  5KFK A;  3PW2 A;  4D3G A;  4ZVP B;  4X62 F;  1RHR B;  1ZOT A;  2IIH A;  1ITP A;  2E9Z A;  2K1R A;  3J7Y U;  2GW8 A;  2GV1 A;  3SCK E;  3IFE A;  2MLX A;  2ROG A;  1QDU B;  1XQI A;  4ED5 A;  1NSQ A;  3I31 A;  5BXI A;  2IRY A;  1W26 A;  4AFF A;  3K8W A;  3SFU A;  3HHN B;  4RU2 A;  1X5S A;  4OHZ A;  1RYS A;  1U1M A;  2JL9 A;  3DYA A;  4J91 A;  3UNG C;  1RWP B;  2W24 A;  4ED2 A;  3I5B A;  3UE2 A;  4JI8 F;  2UU9 F;  2CWK A;  3Q8R B;  2DNY A;  2JFK A;  2EFV A;  1MRO A;  1HQ2 A;  2XMV A;  3DLL Q;  2KYX A;  4UQG A;  4USJ C;  4UOF A;  2R7T A;  1JNR B;  3PW0 A;  4F26 A;  2XMM A;  2EFO A;  1NPR A;  4CLS A;  2XHW A;  3DHX A;  1VQL S;  1UW9 A;  2JX2 A;  4LQ3 A;  2Z0G A;  1LWC B;  5C25 A;  2ZWO A;  4HYK A;  4OJ1 A;  4NI2 B;  1QSS A;  1FFG B;  1FJE B;  2C2N A;  2F4V J;  1UPM B;  1H38 A;  3BN7 A;  4FF4 A;  4K4S A;  1PBU A;  4LT6 A;  4LF8 F;  2D3O 1;  1OO0 B;  2N3O A;  2JEG A;  3I0R B;  1NND A;  1KOO A;  3THV A;  4ZVF A;  2EWH A;  4IFY B;  1AA1 B;  3LP1 B;  1B7Y B;  1XMO F;  3IAS 9;  2G1D A;  1KQF B;  3JSM B;  3MMA B;  4IH6 A;  2CKW A;  4CQ1 A;  1LXJ A;  4TQR A;  1R0B G;  2MZT A;  2VJU A;  2ROP A;  5AXK A;  4JI3 J;  1N32 F;  1Y10 A;  2BR0 A;  2B9E A;  1UVN A;  4XTT A;  2PMH A;  3VGS A;  4K4T A;  3EPG A;  5A6P A;  3H5Y A;  2YH0 A;  4F4Z A;  4ECQ A;  2OPR A;  3R7S B;  4A8S A;  4K59 A;  4ZLN A;  3TI0 A;  3ZTP A;  4YP3 A;  3W60 A;  2L48 A;  4F0K A;  1VIO A;  1KBR A;  4OHY A;  2YPY A;  3FRY A;  2ZBP A;  4ED7 A;  5I3U B;  3N5F A;  3HJV A;  3VZH A;  4DR4 F;  2PGC A;  2BYC A;  4QQB A;  3MMB A;  4OL8 A;  2BQR A;  3A8K A;  3TZZ A;  1LWE B;  4YME A;  1KHW A;  4LSN B;  1HNZ J;  3U27 A;  2JOQ A;  4ED6 A;  3MXH P;  1FRH A;  1JJ2 R;  2QLF B;  1AYE A;  1SIW B;  4N8N A;  2UXB F;  3SEO A;  3VGV A;  1CJT A;  4RX6 A;  1H7X A;  2PMZ D;  4MTP A;  3K89 A;  1UL3 A;  1QY7 A;  4YDD B;  2PI5 A;  8ATC B;  3EGW B;  2XYG B;  2XS2 A;  3BYP A;  5IC4 B;  3NNA A;  3E51 A;  2WW4 A;  2W9A A;  3CGI A;  2RQK A;  1KRP A;  1PGZ A;  2HHP A;  1R43 A;  1FFS B;  3KHG A;  1FX4 A;  4M5N A;  1WC3 A;  2F63 A;  3MM5 A;  1HNW F;  5C2C A;  2HHV A;  5A0Y B;  2ASJ A;  5EGY A;  3NS7 B;  2FLO A;  3POT A;  3RRH A;  3C3L A;  5B0D A;  2MZR A;  1YJT A;  1HPZ A;  2B4O A;  2ZNY A;  2O5D A;  2MMY A;  3S6E A;  2W1B A;  2G13 A;  5CZV A;  4RLE A;  2I2Y A;  4P71 A;  5AXL A;  1Z2Z A;  4K0K J;  3ZZ0 A;  4MAK A;  3U02 A;  3OFF A;  1WI8 A;  2VON A;  3CNQ P;  3MR7 A;  5T7L A;  1U1P A;  3K5O A;  2E1C A;  2D7S A;  4DQI A;  1AZS A;  2FJE B;  4EEY A;  3R6L B;  2BW7 A;  1RJJ A;  3CJ0 A;  4DR6 F;  1TL3 A;  2EFN A;  3LPE A;  4PAB A;  4O44 B;  1UW4 A;  4Y28 C;  2UXC J;  4UUW A;  2AGP A;  1U49 A;  1UKU A;  4AT1 B;  2EBG A;  1A9N B;  1IN0 A;  2V8V A;  4NLQ A;  2HHX A;  3O1L A;  1KR4 A;  2IVY A;  1FVS A;  1UJ5 A;  2IM3 A;  2QEX S;  5EX0 A;  2MZJ A;  3HDS A;  1KDN A;  1TQL A;  3NRB A;  3I4H X;  2VZ9 A;  1RK8 A;  2RF2 B;  5ETK A;  1HWL A;  4X4O A;  4DR1 J;  1S79 A;  2M52 A;  1CJU B;  5E7O B;  3QT7 A;  4KT0 C;  4ECY A;  3BBF A;  3V81 B;  2V2V A;  5D78 A;  4X4S A;  5IM0 A;  1N5V A;  2VU5 A;  2ZM6 F;  5GAE U;  5HVF A;  3JYT A;  3EJM A;  1T05 A;  5I42 A;  4KIA A;  1JLQ A;  4NYZ A;  2X51 A;  3A3P B;  3VZI A;  1NK0 A;  3T1Y J;  1VS3 A;  3M8W A;  3EX7 B;  2CJX B;  2NUU G;  5KFA A;  4X4Q A;  2HK2 A;  1IXK A;  2JLG A;  3F0N A;  4ICL B;  3GZ7 A;  3OVA A;  3F73 A;  3AB2 B;  1S77 D;  1MW7 A;  3HZE A;  1F3V A;  1HNX J;  3V4I B;  3T19 A;  2VH7 A;  2J9D A;  2G2O A;  1S9E B;  3IN5 A;  3VAI A;  1YTY A;  3NNC A;  4ECR A;  2QGF B;  4RW8 B;  5AJ3 F;  2DO4 A;  2DNK A;  2XS7 A;  4JI4 F;  4DR7 J;  2VBW A;  1EKR A;  4PR6 A;  3SCI E;  1K73 T;  2LDI A;  3R5C A;  1G6B A;  5CCL A;  3NG8 A;  4ZP7 A;  3Q8Y A;  2VJV A;  2OHD A;  2GS8 A;  4WP8 A;  4KO0 A;  2QE5 A;  1TKD A;  1S99 A;  1RTI B;  3MWB A;  1GK8 A;  2OGU A;  3S1T A;  1DTT A;  4FKX A;  4ANC A;  2HBQ B;  2QV6 A;  3ULH A;  3MUT P;  1TKX B;  2MY8 A;  1TFW A;  2UVV A;  3JS9 A;  1LWX A;  2HFZ A;  3SYZ A;  1IWG A;  3GP9 A;  3CC7 S;  4F7V A;  3FMB A;  4JYA F;  2HYI B;  3K0J A;  4KB7 A;  3JAM U;  4I4B A;  1OSD A;  1SJF A;  1CC8 A;  2XYP B;  2MQM A;  1EAR A;  1RT6 A;  3FJ2 A;  2XLI A;  3EPI A;  1VRU B;  3W2V A;  1S1U A;  2R7R A;  1J2V A;  1Y5N B;  2OLW A;  4ETZ A;  3AXM A;  3THP A;  2CJ9 A;  1VQN S;  5HN0 A;  2HS0 A;  3I82 A;  3N6N A;  3D67 A;  4O3N A;  5KFP A;  3OLA A;  1F9F A;  2N4C A;  2XMA A;  3SZ2 A;  1OYD A;  4U95 A;  1NKB A;  3CJK B;  1TZ0 A;  2E1M C;  1UAW A;  4B17 A;  2HWH A;  4FZV A;  3MGJ A;  3BPD A;  3QAT A;  2Y1R I;  1N8R T;  1A7G E;  1IKV B;  2W4C A;  1YJR A;  4CLW A;  2B9W A;  2F7V A;  1X31 C;  2KU7 A;  3C8Y A;  1IBC B;  1FA0 A;  1R3N A;  2GMJ A;  4PQU A;  3D68 A;  2NR0 A;  4DL4 A;  2ZE2 A;  2AHO B;  1ZTW A;  3CCT A;  3TW0 A;  2R2T A;  3SV3 A;  2AV5 A;  3FDS A;  3T5J A;  2GO9 A;  3MM6 A;  2KRR A;  2XY6 A;  1HHT P;  1X7V A;  2OO4 A;  4DV1 F;  4YY3 F;  1GMV A;  2GVZ B;  1N36 F;  4CH7 A;  3A12 A;  4JI2 F;  2QA2 A;  4DPO A;  3DOM B;  3DOK B;  1B0P A;  2X7I A;  1CS4 B;  5HMZ A;  4AL6 A;  2UVW A;  2H65 B;  2OPS A;  3ENW A;  1ZET A;  1R8B A;  3BPS P;  4C11 A;  2YKN B;  1F6T A;  2R8K A;  3OPK A;  2DD8 S;  5DDQ C;  3PR5 B;  2A6O A;  2R7O A;  3DM2 B;  3KK1 A;  2ALY B;  4DEZ A;  2VQF F;  1XR7 A;  3PAC A;  4MK8 A;  3UD4 P;  3U7J A;  3GIK A;  2K3I A;  4Q0B A;  2AF6 A;  4KFB B;  4DUZ F;  2D9O A;  5K8M A;  2E5L J;  1HWU A;  1XTZ A;  3Q0A A;  3Q86 A;  4NMX A;  4WFN Q;  7FD1 A;  4KRW A;  1UA1 A;  4FXV A;  4S0M A;  4DL2 A;  1R7I A;  4NA3 A;  1LW0 A;  3K8V A;  2J7U A;  2I6W A;  1RKI A;  4NA2 A;  2BJ1 A;  1C0T A;  4QR0 A;  3MM7 A;  3AFG A;  4OYW A;  1UVJ A;  2ZH8 A;  2HNZ A;  3DGP B;  1REV A;  5J2Q B;  5F9N A;  3OD2 A;  5HO4 A;  3RBD A;  2IYG A;  1Q7L B;  3QWU A;  5F8N A;  3R7B B;  1B70 B;  4DX6 A;  2FYX A;  5E3C A;  3NOC A;  4DSI A;  5K8O A;  4QW9 A;  1YWX A;  1RAA B;  1KVJ A;  2EC2 A;  4Z7C A;  1WKJ A;  2VHG A;  4TU7 A;  4DN0 A;  3NGD A;  2JVR A;  2I9S A;  4I1T A;  5CYQ B;  2DIT A;  2ACY A;  2WB4 A;  3PJW A;  5I3Q A;  3UI3 A;  1QTN B;  3IM8 A;  4NWB A;  3PX4 A;  2WON B;  2WB1 D;  3Q8V A;  2JC0 A;  4ZLP A;  3B78 A;  1N5Y A;  3NCP A;  1FJG F;  5J2P A;  5ETM A;  2EVZ A;  4PUO A;  1BQN B;  2EKN A;  2ZC3 A;  2EK6 A;  2PDA A;  2YWH A;  3ZTR A;  1RT3 A;  4OX6 A;  3W9H A;  3GJR B;  4LQ9 A;  1U2R A;  4DX5 A;  3JQM A;  2W4P A;  4LF4 F;  1LWF B;  4WYL A;  3M32 A;  1FKP A;  4JI0 J;  2RQ4 A;  4ENO A;  2WVE A;  4Y3C A;  3M8Q B;  2KG0 A;  5LMN J;  4GRS A;  2HQ3 A;  4ZPV R;  1G7C B;  2HZA A;  1QD1 A;  3KJV A;  1MWY A;  1K9M T;  3HVA A;  4JP8 A;  5J1E B;  2IRX A;  3OQ2 A;  4WJB A;  3VHQ A;  4CIO A;  3OVB A;  3QT8 A;  2BOP A;  3ITH B;  2NS1 B;  2IM2 A;  3OFG A;  3H40 A;  1RAF B;  3LAL A;  2M9K A;  1AXQ A;  4OYP A;  2VBX A;  1WF2 A;  4AL7 A;  3BQ2 A;  4ZVE A;  4I7F B;  4DV5 F;  1U2C A;  5CHC B;  1LK5 A;  2NYI A;  3D7S B;  5E0O A;  4JI1 J;  3BSC A;  3HFZ B;  5A2Q Y;  3JB9 k;  3Q89 A;  4P52 A;  3MM8 A;  5HL7 Q;  4U7U K;  1FEE A;  2L9N A;  3CD0 A;  1I94 J;  5IC6 B;  3QO9 B;  5D3G A;  3C6U B;  2N82 B;  2HG4 A;  3CCZ A;  4HHU A;  4TU8 A;  1VHF A;  2RHQ B;  4P73 A;  3ZTO A;  3DRS B;  1SVD A;  2BMB A;  2GQ2 A;  3CCM S;  2M3D A;  3CCL S;  3T1H J;  2ZZM A;  1S1V A;  4F67 A;  5AE2 A;  4CYU B;  5KT7 A;  5BYQ A;  4YB7 A;  2CJA A;  2KN4 A;  1U8W A;  1SC1 B;  1MN7 A;  5KT5 A;  2ZZT A;  6FDR A;  4F4X A;  4WYW A;  2OUG A;  2HQD A;  1FX2 A;  1U1N A;  2D3U A;  2DGX A;  2XO6 A;  2E44 A;  2BJ9 A;  3FSI A;  2VOO A;  1WDD A;  2J7W A;  4UY8 5;  2DBB A;  1NK4 A;  3AB4 B;  2CA9 A;  2AD9 A;  3H4B A;  4HKQ A;  3AJD A;  2HNY B;  3CDW A;  1L3S A;  3LTO A;  3PYD A;  2R9L A;  4F3M A;  2MQQ A;  1IKW A;  1PYT A;  5E33 A;  5AXM A;  4ZCI A;  2MKJ A;  3THT A;  3W5Z A;  2K1R B;  4M5D A;  4CZC A;  1X5T A;  4HLB A;  2LDY A;  2VBY A;  1MMD A;  2XWX A;  2D69 A;  3BS9 A;  1HW9 A;  4DQS A;  1VLY A;  3KJQ B;  3DYA B;  3T6J A;  4C0O C;  1X9S A;  3M2R A;  1JXL A;  1UVI A;  1P1L A;  3MPV A;  1E6V A;  2MXY A;  2AEJ A;  3EZO A;  1MRO B;  2AMC B;  3BJY A;  2BDP A;  4ZCK A;  2I8E A;  3AQO A;  2RAQ A;  4K4Y A;  4IH5 A;  4NLV A;  2B9Y A;  3CCV S;  1UEV A;  3CIM A;  1MMN A;  4JV5 F;  1U09 A;  5BYR A;  1DQA A;  4M5G A;  2MZ1 A;  5GME A;  3L7O A;  3M2U A;  4HTI A;  1D8Y A;  2DH7 A;  2YKM A;  2RNE A;  5DGA A;  4Q43 A;  5C25 B;  1Q5Y A;  1XNR J;  5F8J A;  2AJQ A;  3RU0 A;  2EG2 A;  3KHL A;  3RR7 A;  1S6Q A;  2QT7 A;  4PG8 A;  4TVA B;  2UUW A;  2WVB A;  4XAK A;  5L39 A;  3IBW A;  4AXJ A;  1HNI A;  2J9E A;  1NJZ A;  1WOP A;  2FUG 9;  2HUR A;  5AT1 B;  4YDX A;  4V19 J;  3GYN A;  4MK7 A;  1G4C A;  2MHE A;  2PA3 A;  2CAD A;  2QN6 B;  4F8R A;  3ENA A;  2OEJ A;  1FF2 A;  3H0P A;  2KI2 A;  2R4F A;  2J0W A;  3SCJ E;  4GVL A;  5DO2 A;  1TL7 A;  1TUG B;  2P6S A;  4PYD A;  2JWN A;  4JI5 J;  3C14 A;  3D1Q A;  4HL9 A;  3RAX A;  5CD4 H;  2RDD A;  4YUD A;  3DU6 A;  1E6Y A;  4YHH J;  2KRB A;  2OPR B;  4KGZ B;  1TMJ A;  4PG6 A;  3M30 A;  1N5S A;  4LSL A;  4FDF A;  3HHL D;  4Y2K A;  3W1Y C;  1JK9 B;  4PWU A;  2HWI A;  2IC3 A;  1S9F A;  5B7W A;  3MMB B;  4N5S A;  2WOM B;  2CQ4 A;  5B0B A;  2K06 A;  5KFM A;  4DJB A;  2UUA F;  3OVS A;  1X9W A;  1FEH A;  2E1A A;  2F5G A;  2NXJ A;  3TOQ A;  2BQ3 A;  3MUM P;  2QSF A;  1YRU A;  1SKS A;  2M70 A;  1C1B A;  3D3B J;  1KVI A;  3S01 A;  1L3U A;  3FQK A;  1CJT B;  2C3U A;  2FVP A;  1M5V C;  1P9Q C;  4OX8 A;  2D74 B;  3LOU A;  1S49 A;  1TL5 A;  1Q0N A;  1WC5 A;  3M7V A;  3A8I A;  1LNQ A;  1MML A;  1LEO A;  3MMJ A;  3LAN A;  3GYX B;  2CPF A;  3Q8U A;  1JX4 A;  1UVL A;  3B6B A;  4FP9 A;  2ZVS A;  4C0H A;  2E5G A;  3MM5 B;  2JC1 A;  3WQP A;  5EX3 A;  3OHB A;  1NHU A;  2HND A;  2AZ1 A;  3POT B;  2XZT B;  3WX8 A;  5KFI A;  2QYG A;  2Q79 A;  4M1K A;  1HPZ B;  2P8I A;  1S4F A;  4O3P A;  1GX5 A;  1B0T A;  3EUN A;  3PIP Q;  2VG5 A;  4L76 A;  4YB1 P;  1T9X A;  2DHH A;  1DQ9 A;  2CQ2 A;  1PJ6 A;  1VC6 A;  3M8Z A;  1OJ4 A;  4M95 A;  2HAI A;  1JLF A;  5HK4 A;  1ZZN A;  3CUN A;  1NK5 A;  1UFL A;  2CQG A;  2MEW A;  5T7L B;  2FLN A;  3M05 A;  2HEK A;  3FMW A;  2O01 C;  1AZS B;  3GJT B;  2CPI A;  1JLE A;  2CVI A;  2HGN A;  1TL3 B;  2F65 A;  1TL1 A;  1ROF A;  2EFP A;  4IKA A;  5F8I A;  3NAI A;  2UVU A;  5HAT A;  3O3L A;  4TYB A;  5LXY A;  3CD6 S;  2HSE B;  1FRJ A;  2OD4 A;  2DR8 A;  3M8P A;  2JLE A;  5J2M A;  1EQM A;  1F3F A;  1N0U A;  3I5C A;  2YTC A;  4PAA A;  2GIF A;  2Q6B A;  3GJQ B;  2FZC B;  1U1Q A;  4JBC A;  2ZBI A;  2CQC A;  2OEM A;  3DN9 A;  4CCH A;  4OYB A;  1Q5V A;  2DXD A;  2R8I A;  2XM3 A;  3W7B A;  2ASD A;  1YRX A;  3QMQ A;  3LWL A;  3C2P A;  4B9N A;  4WIQ A;  3HKZ D;  2H51 B;  2ZUA A;  5SZT A;  2C2Z B;  5IM0 B;  2BRL A;  1VDH A;  4IQM A;  5CYM A;  3JYT B;  5I42 B;  2VPZ B;  2BJ3 A;  2C2O B;  1JLQ B;  1GXT A;  2IMW P;  1PYO B;  2EBE A;  1S0O A;  4DV0 J;  4DR5 J;  3TEH B;  4WFY A;  5F3Z A;  5KFE A;  3HX9 A;  3KUH A;  1UMJ A;  2VDI A;  4M5M A;  2V9W A;  1W2I A;  1T11 A;  1IBM F;  3AA8 A;  4QPX A;  4TKT A;  2MPU A;  1IUJ A;  4LIW A;  2COL A;  4NLG A;  2ZD1 A;  4USW A;  4DOZ A;  4NLP A;  3CD7 A;  4KBI A;  4U8Y A;  1BWV A;  4G1Q A;  3NWR A;  3VGU A;  1IKY A;  2XMJ A;  3EDR B;  3MTJ A;  2YNF A;  3KLH A;  4DU7 A;  4AD6 A;  1SJ3 P;  5K9F A;  2QLJ B;  2R7U A;  1I51 B;  1D1U A;  4RBU A;  1RWU A;  4DQP A;  1DZ5 A;  4B3S J;  2XQC A;  5I3P A;  2BXJ A;  2PII A;  5T14 A;  3Q8S B;  3AT1 B;  3H4D A;  4KO0 B;  2AYB A;  3QFW A;  5KG2 A;  1RWN B;  3B8H A;  5HBM A;  2ZBC A;  5GMK a;  3J7A N;  3MPD A;  3HHK A;  1DTT B;  1CC7 A;  3K5N A;  4DCJ B;  4IRK A;  2AIR B;  1DHM A;  2DNQ A;  5J1P A;  3QSY B;  4OX7 A;  3GSD A;  2CQD A;  1RT7 A;  3KDN A;  3UO0 A;  3CT9 A;  5KFX A;  5CAB A;  1FD8 A;  1RT6 B;  4R0J A;  3QRQ A;  5IFM A;  3W2V B;  1S1U B;  5BR8 J;  2V2Q A;  2HZV A;  5IT9 U;  3QSI A;  1HBU A;  1BUX A;  4A8X A;  4JI3 F;  3OLB A;  4L75 A;  1WD6 A;  1NEE A;  2V6A A;  3OTE A;  4C2M A;  1ZZF A;  3QGH A;  4I2P B;  4UUX A;  1U6Z A;  2Z2L A;  3DRY A;  3C15 A;  4X66 F;  2E7V A;  1QAJ A;  4E98 A;  4KYZ A;  2IJR A;  3X3U A;  2CNK B;  2MQN A;  1IQT A;  1UET A;  1AT1 B;  3BKF A;  4PQU B;  3FCV A;  4LBH A;  5DRK A;  1QTM A;  2G2Z A;  3CVK A;  3BGL A;  4A8Y A;  3BSO A;  3NGU A;  1HIY A;  2ZWP A;  1N54 B;  1JJ4 A;  4JOU A;  2ZE2 B;  3TAR A;  2PEH A;  5ETR A;  2PD1 A;  2VOP A;  2QA1 A;  4DX7 A;  4OYA A;  4O0N A;  3T3F A;  1HWI A;  1IBK F;  1LWC A;  3MOZ A;  3TWZ A;  2MJN A;  3MM6 B;  1HBO A;  8AT1 B;  2XLK A;  1VBX A;  2LXI A;  4Y34 A;  1FK9 A;  3AOD A;  1JXV A;  4N8O A;  3OFH A;  3MD3 A;  1S9G A;  4B08 A;  4KTQ A;  1CG2 A;  2R2R A;  1FD2 A;  7FDR A;  4X4R A;  1D0E A;  4XDC A;  3TZY A;  4FYY B;  1XEZ A;  1RAG B;  2J0X A;  2OPS B;  2KDO A;  3FCW A;  4FXW A;  5KFV A;  4C11 B;  1YBT A;  3PY8 A;  4RUH A;  4NLW A;  2HBR B;  4OZN A;  1IBL J;  2NSB A;  4DHV A;  3DHW C;  3ZNJ 1;  1SJQ A;  2HRY A;  2O1P A;  4ZJL A;  1IR0 A;  2YWE A;  3KK1 B;  4LMZ A;  2XLJ A;  1D09 B;  2W9C A;  2M88 A;  4WWS A;  2E9R X;  3BYR A;  1ZAV A;  4MT1 A;  4G3I A;  2QFI A;  2I0X A;  2HS3 A;  4WP9 A;  4LRD A;  2DK2 A;  3OFE A;  1LW0 B;  4K0K F;  3E2E A;  5D0H A;  1C0T B;  2BE2 A;  5KFO A;  3HVT A;  2OPQ A;  3MM7 B;  2XYH B;  2ZEJ A;  3R8Y A;  3E8O A;  3ICL A;  2GGP A;  4X2B A;  2ZOF A;  1U1K A;  2HNZ B;  4FKY A;  3BF4 A;  2MQL A;  1REV B;  2K8G A;  1YSJ A;  3QNW B;  4ECX A;  2V34 A;  1BQM A;  2BX6 A;  4PYA A;  2RH3 A;  4OI0 A;  4UOH A;  3QT5 A;  2R7Q A;  1FXL A;  3GIM A;  3NLC A;  1N5Q A;  2PSZ A;  1YX2 A;  4ILR A;  1VCT A;  2DXE A;  5HJY A;  3ADA C;  3PEJ A;  3KLE A;  2D3O R;  2UXC F;  3PCO B;  4J7C A;  1ZA2 B;  3GU0 A;  4U7C A;  3D66 A;  5F8G A;  4G1I A;  1KNZ A;  4P2X A;  2BKO A;  3AJ1 A;  3J81 U;  1NJX A;  3TQ1 A;  1WSR A;  3A3O B;  2AYG A;  3HSZ A;  3WC0 A;  2KB2 A;  2VDH A;  4LF7 J;  3PYG A;  1N5Y B;  4DV2 J;  5J2P B;  3HSD A;  4NLR A;  4DR1 F;  4PUO B;  1BLU A;  3RAQ A;  5D6G A;  2QSW A;  2F40 A;  1Q1K A;  1RT3 B;  1NPK A;  3TZX A;  3PRV A;  2C2R A;  1KWM A;  2HW3 A;  3M32 B;  1FKP B;  2VC0 A;  4X84 A;  3NGR A;  5F41 A;  3IG1 A;  1JXE A;  1R8P A;  2G2Y A;  4ECW A;  2YKO A;  3T1Y F;  1IJF B;  2CQ0 A;  2CRL A;  3BBB A;  4L3N A;  4NCB A;  3U1L A;  2H3E B;  2UUB J;  3KJV B;  3UR0 A;  1S97 A;  1G3O A;  1Y0H A;  1KTQ A;  1KQG B;  3OL8 A;  3EE3 A;  1JJH A;  3UDL A;  3RGI A;  2M5Y A;  1HMV A;  4J9V A;  1BD6 A;  1OQ3 A;  4PXD A;  1FDN A;  1HNX F;  4LFB J;  4UQT A;  2P9G A;  2LLZ A;  1JIH A;  1UVM A;  2RVJ A;  3BGO P;  1Y3J A;  1RHU B;  4P72 A;  2HVD A;  3D54 A;  3MM8 B;  1S57 A;  4DR7 F;  3KG4 A;  5JVG Q;  2B4V A;  1UVK A;  4X4N A;  2H4Y B;  4IH7 A;  2G0J A;  1JKH A;  3CDA A;  2KO1 A;  4OZ3 A;  4O0I A;  2GC8 A;  4Y6I A;  1PKU A;  1S1V B;  4EU0 A;  4LF2 A;  2VQE J;  1U6B A;  3AJ2 A;  2DGU A;  2LP4 A;  5E3A A;  3H2U B;  2JNJ A;  3V5R A;  5IOL A;  4ID8 A;  4TNO A;  5KG0 A;  1I6J A;  2XMW A;  3I0S A;  2DHS A;  2FZK B;  3L09 A;  4LF5 J;  3GQC A;  1ACM B;  2BRK A;  2H5I B;  1UCN A;  4O23 A;  3X1L B;  3BGR A;  1U02 A;  3LGM A;  4ZMM A;  3RR8 A;  4ZVU B;  5L9X A;  5B08 A;  5M2P A;  5C7P A;  1IKW B;  4P75 A;  1T9U A;  1VQ8 S;  4M5D B;  1IWA A;  1JJC B;  1HLW A;  1KQK A;  2Z2Y B;  2C42 A;  3LPY A;  3VAH A;  1SQF A;  3KLG A;  1VQ9 S;  3QFH A;  4DG1 A;  3CE8 A;  1FRI A;  1QUP A;  3PXG a;  2JJ4 D;  4ID5 A;  4I6Y A;  2YPZ A;  4DSE A;  2KH9 A;  3M2R B;  3GII A;  1E6V B;  1KSP A;  3WIV A;  3M8Y A;  2HLT A;  3CJS A;  4FVC A;  4DPW A;  2KG1 A;  5FJ4 A;  2CG8 A;  3I5A A;  3LQV A;  3JSR A;  4IOC Q;  4CH0 S;  5JUM A;  1WC6 A;  4Q45 A;  4J9R A;  2AZ3 A;  3MPU B;  1J5O B;  2JFD A;  1YI2 S;  3IAM 9;  2MST A;  5D8H B;  2ZVI A;  1XN9 A;  1YG0 A;  4L72 B;  2RRA A;  2WK4 A;  3V6H A;  4LFA J;  3I32 A;  2A2D A;  4WKY A;  3M2U B;  1MSW D;  1RA7 A;  4AUK A;  2WVC A;  2YKM B;  4H4M A;  2LEA A;  2RE1 A;  3TVK A;  4KHM A;  4FF3 A;  3ENQ A;  3WC2 A;  4CWB A;  3J81 j;  1B64 A;  1S6Q B;  2W2M P;  2ZC4 A;  3IGN A;  4MKB A;  3CB4 A;  4YB5 A;  3OXL A;  1HNI B;  1X4G A;  2XWY A;  2LEC A;  4KGV B;  2CNL B;  2YVS A;  1SJR A;  5ETP A;  1DLO A;  1REG X;  4W4M A;  4LFC J;  1KOH A;  1ZS6 A;  2BUN A;  1RT1 A;  4TQS A;  4IOB A;  1IM6 A;  1TL7 B;  3PIO Q;  3AAW B;  3CJK A;  4U96 A;  3C14 B;  3I55 S;  2HHU A;  1VBY A;  1EAY C;  1S10 A;  4CDI A;  3GFX A;  1E6Y B;  1SC6 A;  4L73 A;  4TU9 A;  2J8S A;  3KLI B;  4LSL B;  2XSF A;  5DGB A;  4JI8 J;  3GSI A;  2HMI A;  3PO4 A;  2POK A;  1GFW B;  1HHQ A;  3R5A A;  3G2X A;  1SV5 A;  3KG0 A;  2IC3 B;  1AUS L;  2ZH3 A;  4QYZ J;  3TYT A;  5FDL A;  1CUL A;  3RBE A;  2UXD J;  3UDV A;  4OHV A;  4Q5V A;  2DNG A;  3MOJ B;  4ITS A;  4DR2 J;  3Q22 A;  2JRS A;  1NH7 A;  3OR1 A;  3WZ0 A;  4P9S A;  2DB1 A;  2LQ5 A;  1T9T A;  4OYI A;  2E1P A;  4ED1 A;  3IRW P;  2LFV A;  5DLF A;  1F5A A;  1C1B B;  3U1M A;  3QIP A;  1R31 A;  4IRC A;  4E2F B;  1SKR A;  4C8Y A;  3CJ4 A;  5KFD A;  2A2C A;  4TY8 A;  1BXN A;  2GQC A;  1KC8 T;  1D9A A;  2PFD A;  3BQ1 A;  5M2R A;  1CLF A;  1N52 B;  1LKZ A;  1JLB A;  2Y9H A;  4AQY J;  4OYX A;  4FYD A;  4KPY A;  3PTW A;  1RWO B;  3J80 U;  1GMW D;  2FC9 A;  1P8G A;  1VBZ A;  1FWP A;  2UV8 G;  4LR8 A;  2HND B;  1S76 D;  5C24 A;  4B9S A;  1NM2 A;  3IR5 B;  1OSC A;  4QZV B;  1P27 B;  2G4B A;  3CCW A;  2ZHB A;  1ZBT A;  4JI0 F;  2WBR A;  1K1Q A;  2VG5 B;  4OJ3 A;  1EB0 A;  4PKD B;  2EKY A;  2JVO A;  3OTO F;  4LRC A;  3US5 A;  1UEK A;  3H5U A;  3V6J A;  5LMN F;  5L38 A;  4OI6 A;  3CD5 A;  1UTA A;  2W25 A;  1CQN A;  1EX8 A;  5KT3 A;  2MQO A;  2DYA A;  1AFI A;  4C7Q A;  4LBP A;  4L74 A;  4DFP A;  3HT3 A;  1YRT A;  3CCQ S;  1LK7 A;  3J7Z T;  3AOC A;  2XZD B;  1RTJ B;  5T41 A;  1CPZ A;  4F36 A;  3EZ5 A;  4ZPC A;  3H5X A;  2MB0 B;  3GCX P;  2YKA A;  1TL1 B;  2RD5 C;  3TZW A;  2AW0 A;  4B3M J;  3H90 A;  1X4E A;  3NKY A;  4Q2M A;  2J5A A;  2XMT A;  1FKO A;  3W62 A;  4RKU C;  2R8H A;  2DIU A;  4JI1 F;  1VQK S;  3M8P B;  2NZ4 A;  3L7P A;  1HBM A;  4MIW A;  5J2M B;  4OYM A;  2M8D B;  3CUL A;  3D4J A;  1NZA A;  1R0C B;  1I94 F;  4DL5 A;  4FYX B;  4YQW A;  2YNG A;  3FRZ A;  5LOQ A;  3B82 A;  4O3Q A;  3VAJ A;  3B54 A;  3FKB A;  5F8L A;  1RE1 B;  2HQG A;  1H2U X;  2W01 A;  1YJV A;  4CTA A;  2CQH A;  4R5P A;  1HNW J;  1SUQ A;  2GJI A;  5IS2 A;  3QID A;  4NCG B;  2ZOM A;  3IXQ A;  4B3R J;  2XC9 A;  2V68 A;  3OTD A;  5HQM A;  3FQL A;  1RDR A;  5CYM B;  1IKX A;  3I87 A;  3NCR A;  4C8M A;  2JLF A;  5HMY A;  4HI2 A;  3HXM A;  4RZR A;  1PCA A;  3GTY X;  3TAN A;  4HI1 A;  2V69 A;  2LCW A;  4G1P A;  4PG5 A;  4CLP A;  3KHH A;  3I9Z A;  1D9F A;  3TVY A;  5J1E A;  4FNI A;  2DRA A;  3UFC X;  3P49 B;  2VB6 A;  1F9E B;  4QR1 A;  2C3Y A;  4ED8 A;  2ZD1 B;  4HDH A;  1NK6 A;  2H54 B;  2HHH J;  1RAD B;  4DXL A;  2LEP A;  3SFG A;  4G1Q B;  1QAX A;  2WZ1 A;  1IKY B;  3DRX A;  4BC9 A;  2YNF B;  4J37 A;  3KLH B;  4DPT A;  2R7W A;  2B0G A;  4CO5 A;  4PWD A;  2KJV A;  2HFO A;  2BOA A;  4USK A;  2QMW A;  1Q7Y T;  2L08 A;  5GAH I;  1VQY A;  4LRE A;  4DL3 A;  1L3V A;  3ILO A;  4P74 A;  4IR9 A;  2UUC J;  3CO9 A;  2HQC A;  1S1W A;  3NMA A;  5HBM B;  5RUB A;  1LFP A;  2W2P P;  2FVR A;  5IQ6 A;  3KXD A;  2FHO B;  3RW6 A;  2RJZ A;  4C8Z A;  3UWT A;  2EFQ A;  3QRP A;  3W64 A;  3OL7 A;  1XNR F;  2JSX A;  2GIR A;  2CQ3 A;  3M8R A;  2DGQ A;  5AE3 A;  2WSE C;  4CLZ A;  3A1Y G;  4WKR A;  1B3T A;  6FD1 A;  1RT7 B;  3LUY A;  2HAF A;  3ISN D;  2F4F A;  5CAA A;  4ECS A;  1F5B A;  1C4C A;  2HHS A;  5B0E A;  2DY9 A;  3HUL A;  5M2U A;  5EWG A;  4PWW A;  4X64 J;  2DGS A;  1BC6 A;  1HBU B;  2W8K A;  4JI5 F;  6AT1 B;  3MZI A;  3NGK A;  2IBK A;  1X4F A;  1RWM B;  2PEB A;  1EHW A;  4I0W A;  2RUS A;  4J5O A;  4F2S A;  3R6G B;  1XNQ J;  2I5J A;  4YHH F;  3C15 B;  1HKA A;  5FLX U;  1H74 A;  2JEF A;  2IRU A;  4J90 A;  2PT0 A;  3T5H A;  3MPY A;  1FRL A;  2HLU A;  2VL1 A;  4K5S A;  4ZJO A;  4OZ0 A;  3TUJ C;  2AYM A;  3QJJ A;  4EUV A;  4M5H A;  2IBO A;  2IY5 B;  3OXF A;  2ZBR A;  4EZ6 A;  1VR6 A;  5KFL A;  4X4T A;  4MFB A;  1U25 A;  1HBO B;  3SMZ A;  3BB5 A;  3HHE A;  5KFN A;  3HD2 A;  4NZ7 A;  4C9D A;  3OTB A;  1F2G A;  3TAM A;  1FES A;  4KQZ A;  1Y5I B;  1FK9 B;  3G4S S;  1TU0 B;  2V4J A;  1DUR A;  3ZZP A;  1JLA A;  4XIU A;  1M90 T;  3MEE A;  1S9G B;  4O4R A;  2LQB A;  2HFU A;  4LVO P;  2D9P A;  4LRB A;  3CMA S;  1Q16 B;  1FDD A;  5I4M A;  3Q8P B;  4FNH A;  4EYI B;  2MSS A;  4NRU A;  2MKI A;  1M1G A;  2NXE A;  3BZQ A;  4OX9 F;  2VFR A;  4GC7 A;  2ZNZ A;  4GMK A;  1NSP A;  4UZB A;  3O6Q A;  1RHJ B;  3W2W A;  2KFN A;  2W9C B;  1RHK B;  4Y2C A;  4MKY A;  1FHT A;  1RTH A;  4ATN A;  3QBC A;  3MPW A;  2VOD A;  2W8L A;  4A8W A;  2HZC A;  2Q3P A;  2KFY A;  2X1F A;  4Q7A A;  1H73 A;  5CA5 A;  1X9M A;  4Y65 A;  2WHO A;  2BE2 B;  3HVT B;  2OPQ B;  2WOM A;  3KWM A;  2GCF A;  2GGP B;  3CPW R;  3UDE A;  1M5H A;  4AYB D;  2KL8 A;  1NK7 A;  5F0U A;  1W2B R;  3FK4 A;  2DNL A;  4DQR A;  1BQM B;  5E3R A;  1Q86 T;  4DUT A;  5EWF A;  1UWB A;  3IS9 A;  4GO7 X;  1OWX A;  1R6V A;  1H0H B;  2JH3 A;  2GX8 A;  4HEA 9;  4WK1 A;  3NWG A;  3KLE B;  3DLG A;  2W7P A;  2HIQ A;  3FEX B;  3L9Z A;  1DTQ A;  2NZC A;  3HFV A;  4Y00 A;  3NNH A;  2CWX A;  3G8S A;  4LIR A;  5CH7 B;  3UR3 C;  2ZJP Q;  3PG9 A;  2OTJ S;  1T9V A;  3M9N B;  2DR9 A;  2ASY A;  1RCO B;  1T8E A;  4BLG A;  4TY9 A;  4WPA A;  4ZVQ B;  4FS1 A;  3FEY B;  3BM7 A;  3RB0 A;  3BGU A;  1ZAW A;  1VQ6 S;  3DDK A;  2Z57 B;  2LQ9 A;  2RUG A;  3MDF A;  4DUZ J;  1WSV A;  1HL6 A;  3N6M A;  4TLR A;  2RQC A;  1HD1 A;  3I6P A;  2H5J B;  4FN5 A;  4K50 A;  1HNV B;  4ERD A;  5MAO A;  3EGV A;  4K5R A;  3IG1 B;  1S1X A;  1HR0 F;  5E5N A;  1OMS A;  4BWM A;  4DV3 J;  3CDB A;  4DV0 F;  4CM2 A;  4DR5 F;  2R7X A;  5AXN A;  4X65 J;  4P7T A;  1HI1 A;  2LA4 A;  2XUL A;  1FXR A;  3PR4 A;  3KKF A;  3D1O A;  1HMV B;  1RHM B;  4ZP6 A;  5D15 A;  1WJ9 A;  4KHP J;  4EFA C;  5JVH Q;  3TJA A;  3CWJ A;  1OQ6 A;  2P6T A;  4IG0 A;  3E3X A;  3H20 A;  4U9R A;  4QIV A;  4QIG A;  2GNK A;  3DRR A;  1LQ9 A;  4ZN1 A;  3MCN A;  4DF4 A;  4RUB A;  2Q6C A;  4P10 A;  1K44 A;  2DGV A;  3MR5 A;  4K2J A;  9ATC B;  2NXN A;  1JKH B;  3F41 A;  2HVE A;  3P6Y C;  1C0U A;  2RKI A;  3GIR A;  1K8A T;  3SV4 A;  2DNP A;  3KJN B;  4IG3 A;  4MJK A;  3VQS A;  2B43 A;  1FWK A;  1RT2 B;  2KM8 B;  1JB0 C;  2LKZ A;  2XNQ A;  2B51 A;  2MTL A;  2R2U A;  4CLU A;  4WXW A;  1VGY A;  3AY0 A;  4F04 B;  4FF1 A;  4AXI A;  3L95 X;  2Y8Y A;  5DJB A;  5J2N A;  4TXS A;  4WZM A;  2KYZ A;  5KT4 A;  3I0S B;  1XIQ A;  3TAQ A;  2X3G A;  5DM6 Q;  4ZPD A;  3IR6 B;  3HT0 A;  3FBB A;  3BGR B;  5DDP C;  1U1O A;  2V5H G;  4B9L A;  4TN2 A;  2M7S A;  1URN A;  3EIC A;  2OJ3 A;  5BR8 F;  1Z2L A;  1RQ0 A;  3KOA A;  2CPD A;  3FBF A;  5KT2 A;  3PHE A;  3CCJ S;  3J7A 1;  2AQ4 A;  1NRK A;  2R8G A;  4NPO A;  1VJW A;  1KON A;  4DV5 J;  2GIQ A;  4WE1 A;  3KYL A;  1S4E A;  2C2K B;  3KLG B;  3B4M A;  4ELV A;  1TAU A;  4DG1 B;  2LYV A;  2QL7 B;  2DNZ A;  4PEO A;  1RT5 A;  1WF1 A;  4ID5 B;  1GXL A;  3ILL A;  4CLK A;  4LBI A;  2BBE A;  3SSQ A;  3C16 A;  1H98 A;  1UPP A;  4KGK A;  5CYJ A;  3N0V A;  3CTR A;  1RAO A;  1RAH B;  2GA7 A;  1IR2 A;  3QGP A;  3FSX A;  1O5J A;  4EO8 A;  1RYR A;  4PXC A;  3MCM A;  3SQG A;  5DZ6 A;  3H8Y A;  4GKJ J;  2KM8 C;  4LF9 J;  1TK5 A;  4BS2 A;  1RT4 A;  3BH6 B;  1TKZ A;  3W5Y A;  4IO1 A;  3EXY A;  3UN2 A;  1YZ6 A;  3KDO A;  2DTJ A;  4H4M B;  3W8P A;  3RRK A;  4NLT A;  3OV7 A;  1N48 A;  3CCE S;  5IQQ A;  3MHY A;  4WBF A;  2CQB A;  1RU2 A;  4CLT A;  1Q79 A;  3LWM A;  1ZPV A;  4DSJ A;  2CJB A;  2N3L A;  4XO0 A;  2K7K A;  3GV7 B;  3SCL E;  1FVQ A;  2H48 B;  4JI6 F;  4B3T J;  3MUV P;  1DLO B;  4OHW A;  4Z7Y A;  2V9K A;  5D0G A;  1RT1 B;  3GFZ A;  3EXC X;  4TYA A;  3M8S A;  3G96 A;  2VIH A;  3QJL A;  4NAS A;  1IBL F;  3UD5 A;  4DR3 J;  4ES1 A;  2HKE A;  3Q2T C;  2GVD B;  2R3V A;  3HHD A;  4EGL A;  3VR1 A;  5B09 A;  1FTC A;  1N56 A;  3NAH A;  3KJF B;  1XMQ J;  2ACM A;  2QFJ A;  4I2P A;  1EKS A;  3HHL A;  4RW7 A;  3DOL A;  3R97 A;  1X4B A;  2HPU A;  4F50 A;  1OPZ A;  5KFZ A;  4DCO B;  3CDE A;  4RUA A;  3K2Y A;  2YQ0 A;  4RR5 A;  4AND A;  4NZ0 A;  4OYZ A;  4DL6 A;  1U26 A;  1WOS A;  2YQ3 A;  2HMI B;  3LGH A;  2B3T B;  2QMX A;  1SV5 B;  3PFO A;  2VA3 A;  3A4T A;  1QLN A;  5FDL B;  2QMU B;  1LW2 A;  4RJV A;  1SL1 A;  2KHD A;  1CUL B;  2B8P A;  2XY7 A;  4NLY A;  3KFW X;  4LUB A;  5F3T A;  1WWH A;  4Z2X A;  5KFC A;  2FHJ D;  2GML A;  4O4G A;  1X5P A;  4DPX A;  4OI2 A;  3AD7 C;  1NME B;  3OR1 B;  5IT9 Y;  3DC2 A;  1K47 A;  2MQ8 A;  4RW4 A;  2VA2 A;  3LGN A;  3T9Z A;  4E0D A;  1WEX A;  3A8J A;  1WEZ A;  2DH9 A;  4J9L A;  2V8H A;  2Z30 B;  4A8F A;  4EO6 A;  1RU1 A;  3QIP B;  1IVZ A;  2AYE A;  1O51 A;  3AOB A;  2FGC A;  3KMQ A;  1SKW A;  1NDC A;  2HQI A;  1RKJ A;  1SI9 A;  4TY8 B;  4C97 A;  2RHS B;  1QJH A;  2P9E A;  1WHY A;  2HIY A;  4A4J A;  1KD1 T;  4DSF A;  1XR5 A;  2CJY B;  4LF7 F;  1JLB B;  1F60 B;  3LA0 A;  3VAL A;  1QE1 A;  4QBU A;  4HAC A;  4YR3 A;  1F2H A;  4DV2 F;  3CCR S;  3HMJ G;  3JXO A;  3RW7 A;  2Y0B B;  3UW1 A;  2BKP A;  4YR0 A;  5C24 B;  3DI6 A;  4DS5 A;  1M1H A;  2VD3 A;  1WC0 A;  3JSB A;  4ZLJ A;  5HRO A;  2KVQ E;  1FFW B;  5HLF A;  1HQU A;  4N47 A;  5B0F A;  2U1A A;  3NGS A;  1O6X A;  4Q2L A;  3I4P A;  1Q53 A;  4LR7 A;  3RJM B;  1P6T A;  1Q81 T;  1SL0 A;  2ATL A;  4GKK J;  2UUB F;  3R5B A;  3QZ8 A;  1SC3 B;  3R2C J;  2RS2 A;  3GG0 A;  3EZU A;  4OJG A;  2HRT A;  2D41 A;  4V19 X;  4B9M A;  2IVM A;  3LP2 A;  4NLU A;  4IDK A;  4LFB F;  2MKY A;  4YB6 A;  1FKO B;  1X60 A;  2ZUG A;  3FSY A;  3UD3 P;  2MDA A;  2FGO A;  1U1L A;  3LW5 C;  5A8W A;  4K7Q A;  2N4D A;  1HBM B;  1U7L A;  2OIH A;  5A76 A;  3T6B A;  4C48 A;  2YNG B;  3H25 A;  1TK8 A;  4ZCL A;  1ZPW X;  2OFG X;  3NOG A;  5A8K A;  1KQS R;  1TAQ A;  2DVI A;  2DT9 A;  3PV8 A;  4CTA B;  4R5P B;  1HI8 A;  1SUQ B;  1WG4 A;  2K7J A;  3CJR A;  4TLQ A;  1U48 A;  4DV7 J;  3DCA A;  1FDB A;  1PAU B;  1FWL A;  4C8O A;  2VQE F;  1UEU A;  2HFN A;  5GAD I;  4HDG A;  2B6A A;  2BJE A;  5E2Q A;  1SH2 A;  1ZA1 B;  4J9N A;  1IKX B;  3M9O B;  3PRD A;  3IM9 A;  4QW8 A;  4QWB A;  4B9V A;  2P9C A;  4DV6 F;  2VFT A;  4CLF A;  3PDN A;  4LF5 F;  4DCP B;  1JWW A;  1LOU A;  3R9L A;  1KLM A;  1UFK A;  1TV6 A;  3QT6 A;  3J81 Y;  4AL5 A;  4UW2 A;  3MFI A;  2PFF B;  1KLN A;  2DCL A;  5DLG A;  1NKE A;  1HHS A;  3KK3 A;  3DXS X;  2H1Y A;  2A6M A;  1S6U A;  3EVM A;  3V2U C;  3RBZ A;  4W90 B;  2ATC B;  4ZLL A;  3RAM A;  2YKQ A;  2ZH4 A;  2R42 A;  3PRB A;  4WFX A;  2MKS A;  2MKH A;  1N34 J;  1X4D A;  4UTG A;  4O3S A;  2MZS A;  5L46 A;  4ZKA A;  4PWD B;  4J9P A;  4DV4 J;  2VFS A;  5MLC V;  1BWE A;  4KV8 A;  2AGQ A;  4YR2 A;  4LF6 J;  3ZTS A;  2XNR A;  2KHC A;  3M4X A;  2VIC A;  2BAB A;  1VRT A;  3AA9 A;  3DLH A;  4RWX A;  2E5J A;  1S1W B;  3TX8 A;  2BM1 A;  4JB8 B;  3ILJ A;  2Z58 B;  3NXZ A;  2VV5 A;  1T95 A;  2FHM A;  4LFA F;  3P5T L;  4CT8 A;  2J9D E;  4X4U A;  1Q82 T;  1Y5L B; 
#chains in the Genus database with same CATH homology
 3C16 A;  1CUL A;  4OYO A;  1CJV A;  3UVJ B;  4CM0 A;  3C14 A;  4NI2 B;  1WC5 A;  4CLU A;  5IV4 A;  4WP3 A;  4CM2 A;  1TL7 A;  4CLL A;  1YK9 A;  1CS4 B;  1FX2 A;  2GVD A;  1CJU B;  4OYA A;  4WP9 A;  4OYI A;  1WC1 A;  4USU A;  3MAA A;  3ET6 A;  3C15 B;  4P2M A;  4USW A;  4OYZ A;  5D0H A;  3G82 A;  4WP8 A;  4USV A;  4OZ3 A;  1CJK A;  5D15 A;  3MR7 A;  4P2F A;  4CLW A;  1WC0 A;  1WC4 A;  4OYP A;  1CJT A;  3R5G A;  1U0H A;  1TL7 B;  4UST A;  3C16 B;  1AZS A;  1CUL B;  4CLP A;  1CJV B;  4OYB A;  2BW7 A;  2GVZ A;  3C14 B;  4WPA A;  4CLT A;  3UVJ A;  1AB8 A;  1Y10 A;  2QV6 A;  4CLY A;  4NI2 A;  4CLZ A;  4OYX A;  5IV3 A;  1WC6 A;  1CS4 A;  1Y11 A;  3MAA B;  3ET6 B;  4OYM A;  1CJU A;  1FX4 A;  4OZ2 A;  1YBT A;  5D0G A;  1WC3 A;  3G82 B;  3C15 A;  4P2X A;  1YBU A;  1CJK B;  5D0R A;  5D0E A;  4CLF A;  4OYW A;  4CLS A;  2WZ1 A;  1CJT B;  1U0H B;  2GVD B;  4CLK A;  1AZS B;  2W01 A;  2GVZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...