3G82A

Complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with mant-itp and mn
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
189
structure length
189
Chain Sequence
MMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVREMTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLSYLNGDYEVEPGCGGERNAYLKEHSIETFLIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title 2',3'-(O)-(N-Methyl)anthraniloyl-inosine 5'-triphosphate is the Most Potent Adenylyl Cyclase 1 and 5 Inhibitor Known so far and Effectively Promotes Catalytic Subunit Assembly in the Absence of Forskolin
rcsb
molecule keywords Adenylate cyclase type 5
molecule tags Lyase/lyase inhibitor
source organism Canis lupus familiaris
total genus 57
structure length 189
sequence length 189
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2009-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 3g82A00
4CLWA 4CLKA 4OZ2A 3UVJA 1YK9A 4NI2B 4WP3A 3C15B 4OYOA 1WC3A 4OYBA 4OYWA 1CULB 3MAAB 4USTA 5D0RA 1CJUA 4OYPA 1CS4B 4P2XA 1CJTB 3G82A 4CLZA 1YBUA 4USUA 1TL7B 4OZ3A 1WC6A 4OYAA 2W01A 1AB8A 4CLSA 3C14A 2GVZA 3C16A 2QV6A 1CJVB 4CLUA 1FX2A 1U0HA 1WC0A 3ET6A 4USWA 1WC5A 4WP9A 3R5GA 2GVDB 1Y11A 1CJKB 1AZSB 2WZ1A 5IV4A 5D0EA 4NI2A 1YBTA 3C15A 4CM2A 1WC1A 4CLPA 1CULA 3MAAA 4USVA 4CLTA 5IV3A 1CS4A 4OYXA 1CJTA 1WC4A 3UVJB 4CLYA 1TL7A 1CJUB 3G82B 1FX4A 4CM0A 1Y10A 1CJVA 4CLFA 4WPAA 4P2FA 3C14B 5D15A 2GVZB 4OYIA 5D0GA 2GVDA 3C16B 1CJKA 3MR7A 4WP8A 1AZSA 4CLLA 1U0HB 3ET6B 2BW7A 4P2MA 4OYMA 5D0HA 4OYZA
chains in the Genus database with same CATH superfamily
1VQ7S 5KOWA 1X8DA 1WOSA 3DRPB 1RK8A 2OLWA 1UKUA 1B0VA 2XNRA 1CJUA 2JLFA 1LKZA 3JQKA 3ZZRA 2YVSA 3TEHB 4KGXB 4N41A 2MKHA 4MTPA 4OX9F 2BEFA 2BA9A 1OYDA 5AXNA 3H4BA 3FBCA 2Y1JA 1VISA 2DCUB 3MEEB 3NGDA 1KFDA 4URGA 4JYAJ 4PQUA 2OGUA 1Z1ZA 3NL0A 5G0RA 1P9YA 2C2RA 3L3CA 2DGQA 2YNFA 4ITSA 3KLEB 1S1WA 1V3ZA 2ZH2A 1JJHA 4N8NA 1EZZB 2FHMA 2YKOA 1UJ6A 1N54B 5FLXU 3CCQS 4ALZA 4W90B 3UDEA 2CXEA 3DDKA 3DLGA 5C24B 1K9MT 4EO8A 3MMAB 1K1QA 4DZDA 1FE4A 8AT1B 3ET6B 3HI9A 5F9LA 4YR3A 1DURA 4PWDA 2HWTA 2MB0B 4YHHJ 3DGPB 1RWXB 3AD8C 2ZBIA 2XY5A 4ED2A 1WSRA 5IWAF 4ICLB 1FRHA 1SC3B 4F4AA 2IYIA 4HEA9 2W7AA 1UZHA 2E9RX 2HAFA 3BO3A 3U1LA 2L9WA 4C8YA 2AU0A 2RRNA 3NCPA 3RAMA 3HHDA 2FHOB 3W8PA 2NXNA 4ANEA 3T9NA 3TAMB 3M2RA 4N56A 3NWGA 3CDAA 1FXDA 4CLPA 1FFSB 1JLGB 1HQEB 2HWHA 1H2VZ 1SB6A 1UP1A 2DNKA 3OXLA 4RUBA 2DRBA 2BE2A 5THWA 2BBEA 1KOHA 1RHMB 4A4JA 4GKJJ 2VBYA 4I6WA 4F4KA 1YJ9S 1NKBA 1YX2A 3F56A 1FJ7A 4DZ6A 4K7QA 1B70B 1VBZA 4IRDA 4PG4A 3KLFA 2J0SD 1Q0NA 2F40A 2V8GA 1CPZA 4RNOA 5H9EJ 1SV5B 2NSCA 2JEIA 1CVJA 4WZMA 4F7VA 1LWEA 1Z2LA 3I96A 4J9VA 2C2OB 5GAEI 1RADB 2V9WA 2DO0A 3MMBB 5ETNA 4MYTA 3H5XA 5LMUF 1U0HA 1FDAA 3CD0A 1FKOA 3NOGA 4LBHA 3HT3A 3DOMA 3CDEA 1BD6A 2VG6A 5J1PA 1SL1A 2J0WA 2RDJA 1AYEA 4M8LA 4KGKA 5F0WA 5ETLA 1VC5A 4OLPA 4FNIA 4B3OA 3BEGB 1M5PC 3RB3A 1PBAA 1S9EA 2QLJB 5LOQA 3PX4A 4NLXA 4A8SA 4F3QA 1MROA 1NSPA 2M70A 3N5FA 1F5AA 2GGPB 3TAPA 3BKFA 1N8RT 3CW2C 1FA0A 2ALZA 3VAIA 4DV0J 4IOCQ 2CPJA 1S79A 1T11A 2DHAA 2GHPA 4P2MA 4V1Ak 2FD2A 5M2PA 3M8QA 3V81B 4RU2A 3GV5B 2YWHA 4RW6A 2J9DE 3CE8A 3NAIA 3R8YA 2QEXS 4OHXA 4X62F 4G65A 3HFKA 2DCLA 1V9OA 2UXBJ 2ZDOA 6FD1A 1H3DA 2L48A 2Z58B 2J6UA 3UNGC 3QRPA 3DLJA 1VLYA 4KSEB 4ZLNA 3MF5A 3DLEB 3LP1B 2H9ZA 4I6AA 2QA4S 2KHCA 2QA2A 3TVKA 4O23A 4RNHA 3LP2A 3SYZA 1M0SA 4WXWA 3VGSA 4EU0A 1N6QB 4M5JA 1PJ5A 4P6QA 4C8MA 1H7WA 4NLWA 3LH2S 4YDDB 4A8OA 4NYPA 3H42A 2QA4G 3U02A 2UUWA 4NRUA 5AJ3F 4L72B 1CC7A 2FZKB 4ZVPB 5KFGA 1Y5LB 2I38A 1WEXA 5D0GA 3GFZA 1IVZA 3L7PA 2MY8A 4Y65A 1VK8A 3KFWX 4OX9J 1IKYA 2R7WA 1MMDA 3ZZYA 4K8RA 2AQ4A 2VKRA 2PI5A 1DBDA 3C15B 5GAGI 2CVEA 5CXTA 2DNPA 2KVIA 3A4TA 1DJ0A 3MTJA 1PILA 1RAHB 2MJUA 4ECTA 3NGTA 3SSRA 2Y9HA 1EKRA 2MQ8A 4L73A 1P8GA 3D0GE 1Z2ZA 3CT9A 4B9VA 2GC8A 4IDKB 4Q43A 5JXSA 3LP0A 4X4TA 1KHWA 3ZZUA 4AXIA 1P9QC 1VQ5S 2HBZB 1WF2A 1SJRA 4U6PA 3TWZA 5I3UA 4HH1A 1B3TA 1FFGB 3FGVA 3DMJB 3BPDA 5KT3A 3V4IA 3TJ9A 1SCJB 5BYSA 1Q78A 2Y8WA 1JB0C 1O5JA 3RTVA 1JMTA 2HFVA 1S0OA 3IWLA 2DISA 1TK8A 4OV6A 1PGZA 3NLCA 3DOKB 3L95X 1VOMA 2NXEA 4JI3F 2MLZA 3OJSA 5FD1A 1X4GA 1JQGA 2E1CA 4HT5A 2C2EA 4WWSA 4K59A 1J27A 3SI8A 1UA1A 5L8RC 4X4PA 1DZ5A 4OYWA 2WBRA 2W4PA 2LKZA 4BC9A 4PABA 3THVA 1X4HA 4XDDA 5CYMA 5C7PA 4OJ1A 1N0VC 2D1CA 3OHAA 4JP8A 5KG3A 5E0OA 2LXIA 1VI7A 2GIRA 3W61A 4CH7A 4NEZA 4I2PA 1VJWA 1IR2A 3MR2A 4UF4A 4IG0B 2IYGA 2F4FA 2FUG9 3MM9A 2RUSA 2WB1D 1MN9A 2V4JA 4F25A 5DGAA 1VBYA 4QWBA 1HWIA 4WIIA 4CCHA 3A3OB 5FLXY 4OHVA 3ONQA 1D8ZA 4NA1A 4JUZA 3SDEA 2IHR1 2KM8C 2ZBPA 1FO1A 1IJEB 2ACYA 4WP8A 5LMUJ 1HR0F 2IJFA 4H4KC 1IWGA 1FRKA 2RNEA 3JB9k 1HNWJ 4I2QA 4HLBA 2FGCA 2CJAA 2DNGA 1CULB 1NLKL 2Z57B 2KRRA 3QJLA 2BJ8A 3U1MA 2BW2A 1TR0A 3OFGA 1J5OA 1ZETA 2R9LA 2RRBA 5D4NA 3AAWB 3PEJA 1U0SA 4WP9A 1SH0A 3M6XA 5GAHI 4Z7YA 3NMAA 3R5BA 3GILA 1R3NA 4X66J 5HQLA 2H5IB 1WC1A 3AY0A 3D5MA 2VPZB 3BKUA 1UTAA 3RRHA 5CHCB 4LFCF 2NXJA 3CF5Q 5DLGA 3QMQA 4OI2A 3K2YA 4ZVSB 2KZZA 2VA2A 2HRYA 4J9LA 4X62J 1R0CB 2KXNB 3LAMA 4KYZA 3IR5B 2WVFA 3P49B 5M2UA 2WOMA 3M30A 1RWMB 3E3XA 1BLUA 3EVOA 1I94F 1IBLF 5HBMB 4F0KA 1KD1T 4UUWA 5KFIA 1FWKA 1NM2A 5K8MA 3ZC4A 2VODA 1UL3A 2GJIA 3MAHA 3W9JA 3VAGA 4DR1F 5AJ3J 4OLOA 3T5LA 4QIVA 4YR0A 2EC0A 1UETA 1KNZA 3I0SB 3W7BA 1S49A 2LFVA 2MLYA 1RCXB 3TR5A 5F8JA 3HXMA 5GMDA 5DJBA 6AT1B 3BR8A 3UWTA 1NPKA 3B78A 1DAXA 3MUMP 2JEFA 4UOFA 2G13A 3TVZA 4DS4A 3KJVB 4C9DA 3J7A1 3SCLE 3EDQB 2FC8A 3OV7A 1C0TA 3HM9A 4ECZA 2ILZA 4PEOA 3GSDA 3ZZOA 4ECQA 4MIWA 2X3GA 3IBWA 3K89A 3A12A 5GAEU 2FHJA 1IBMF 2KB2A 2QYGA 3DLLQ 2E5IA 2C42A 2EXUA 3H8YA 1JNRB 4R0JA 2C1EB 4UQTA 5KFHA 4ZLPA 4TU9A 1WD6A 2DEIA 4ES3A 3M8PB 2J8SA 3A1YG 5HROB 2R8HA 2B6AB 2LA4A 1X5OA 2HNZA 3CJ3A 2UVVA 4HH0A 3QGHA 2HRUA 4LIRA 2NXCA 1D8YA 2IC3B 1RT6B 2W9CA 3TX8A 1Q86T 1RTHB 4FF2A 3UI3A 3BGFA 2DBBA 4MIAA 3O1LA 3DU5A 2V67A 1VQPS 4J37A 2B0GA 3CSKA 3LWMA 3SXLA 2F5GA 2ABYA 1QY7A 4GRSA 1VS3A 3IS9A 2NPIA 3QZ8A 4K4SA 3QZ7A 3FEYB 4NOHA 1XR5A 1IKXA 1SQGA 3O5TB 3C2PA 2DNMA 4DFMA 5EN1A 3IG1A 4RUAA 3PX6A 2YQ1A 3PFOA 3T41A 2UUCF 2GVZB 3D6HB 3OBIA 1XIQA 4ZVGA 3GPAA 5SUHA 4Y2AA 2DR8A 2DGWA 4QR0A 1JLFA 2DH7A 2BQRA 1WHXA 3R5JB 1FHTA 4X4NA 4PPZA 3RU0A 1Q95G 1R27B 1W2BR 5F0UA 4RBVA 2HLUA 2KL8A 1IBCB 1VMBA 1VQ6S 3OXFA 2C3YA 1RA7A 2GW8A 2ZZMA 2ZH8A 2YKMA 4WYWA 2HWIA 3ITHA 2B51A 2IBOA 1RTIB 4PRFA 2M0GB 4QOTA 2G2OA 4CYUA 4JI4F 3QGGA 1PC5A 2UVWA 3KMSA 1LOUA 4LUBA 2FVQA 1OYEA 2R7QA 2ZVSA 2MKIA 5HLFB 4P10A 4LBIA 1OY9A 4ZPVR 3PW4A 4JI5F 3CCMS 2GFFA 2XC9A 4IKAA 1UFWA 5HMYA 4NLOA 1FT8A 1HNXF 2UVRA 4Q8FA 4ILRA 5ETPA 3R27A 4DUTA 2LEAA 2MQOA 5FJ4A 2XTJP 3UPFA 5CYQA 2C22A 4C6AA 4ECUA 3AA9A 3W60A 3RBDA 4O4GA 2RHQB 1YHQS 2GQQA 5KT2A 1FRLA 2DNQA 2OJ3A 1FNMA 3MTKA 1LEOA 4FF3A 4DOZA 2VPWB 2E7XA 5T7LA 4CH1A 1FD2A 3CO9A 3MPWA 2MHEA 4DI6A 3UN5A 4H4KA 4NA3A 1WC0A 4H4OA 3HVTB 2IM3A 4P71A 1HMVB 1U1MA 4QWAA 1NZ8A 2O1PA 4BCAA 2C2MB 3HJFA 1YBTA 1I94J 3IGVA 1IBLJ 2DHGA 5C2CA 3GE9A 4KFBB 5ETVA 2CWKA 3BR9A 4DR2F 1VCTA 1RJJA 2OFHX 1K1SA 3QT7A 5GVQA 5J2NB 3G82B 2RF2A 4DF8A 2GA7A 1N88A 3MURP 2Y3YA 4LF4J 1T02A 2P8IA 3R2CJ 1EP4A 1U1KA 4RX6A 1Q1KA 4ZPWR 2Q43A 2QLFB 1IM6A 5JUMA 4GKKF 2R4FA 1T3NA 1HWKA 3MECA 1GXTA 3RR8A 2WSCC 2X1FA 2RUGA 4CT9A 1FRMA 1KWMA 1UA0A 1N36J 4OI3A 2YNIA 3BN7A 3DI6B 1SBRA 3RW6A 3ZTSA 4F8RA 1BWEA 4LRCA 3BF4A 3H25A 2DEJA 3QAEA 1WC6A 3BYRA 3J81j 1G2EA 1KTVA 1ZAXA 3BYPA 3P5TL 1T7PA 4ETXA 4WK3A 3QGPA 3AJ1A 1IBMJ 1SI9A 5ETOA 1BMQB 1EX8A 4KO0B 2PMHA 3PCOB 2V4QA 2I5JB 1HNZF 2XS7A 2W2QP 2I2YA 1YSJA 2G2ZA 4RNFA 2AMCB 2KHDA 4CM0A 3FJ2A 5ETRA 3US5A 3GMGA 4ID5A 3QLHA 3GFYA 4YEAA 2YX1A 3R5DA 1DQAA 5D3GB 2A10A 2W24A 4QJVA 1AZSA 2FHJD 2F7VA 4YB5A 1RGVA 3B6BA 3VWSA 2LEBA 1SL2A 2JFDA 2C2ZB 3UDVA 4DN9A 1PG5B 2XMKA 2VUGA 1P27B 2PO4A 3MAAB 4YQWA 2ZKUA 1WF0A 4USTA 2HW3A 1LWFA 1YBUA 3QGIA 1VR6A 1S59A 3L7OA 3EDRB 2GIQA 3FUYA 3TW0A 3WQPA 2R7RA 4YN3B 3Q22A 1HYSA 3CO0P 5MAOA 4FVMA 1H2UX 2DXFA 4Q5VA 3I0RB 2WK4A 2UUCJ 2GNKA 4ZDNA 2B56A 5IT0A 1LW0A 2OPSA 4YR2A 1Y3JA 4OX6A 2HHHJ 4JI7F 2HK2A 1KONA 2DR5A 1RKIA 2Z30B 1NH8A 4KGZB 1HHTP 2OMOA 4DL4A 2J9EA 2PGCA 1HNVA 2CPIA 2CPEA 1N34F 1T9YA 4AD6A 1WI6A 5KFUA 1FEEA 4WPAA 2OUGA 1N4LA 3TO8A 2BQUA 1LXNA 2AX1A 3HHLC 2ZKTA 3CD7A 4B9MA 1BWVA 2YKPA 3AOBA 1U4BA 4FXDA 1G6BA 5I4MA 3HULA 4AXJA 1Z4UA 1R0AB 4JI4J 3CJRA 3WC0A 2CQ2A 1GXLA 3MD3A 2WONB 4LFAF 4LBPA 4R5PA 3FSIA 4A8FA 2CVIA 1TELA 4KBIA 1H6KX 2AGPA 4L6V3 3V6DB 1F9EB 2GZOA 3MEDA 2GAHC 4NZ6A 4JI5J 2OHDA 1S1TB 1ULRA 2AJFE 4FXWA 1QUPA 1E6YB 3GG1A 3FQKA 4E98A 3LUYA 3RJMB 1TKTA 2HEKA 3D3BJ 3C6TB 2QSFA 2E7VA 1AUDA 5DZ7A 2E9ZA 3UVJB 2CQIA 1DY3A 5IT4A 2MEWA 4Y34A 3H2UB 3FCHA 4Y3CA 3HFZB 1RAAB 2MZRA 1X4FA 4KPYA 4TY8A 2VU5A 3W2VB 4HYKA 3BKTA 1RT1A 4FZVA 2HFNA 3F44A 3DRSB 2IM1A 3G8QA 1IN0A 3CD6S 4QIFA 2H54B 2KXHA 1H38A 2AT1B 3DXBA 4MMOA 2HPUA 1FVSA 4FBUA 4FYXB 1RWWB 1X4CA 3F41A 4W4MA 3D68A 3N0VA 2H4YB 1NPRA 4GC7A 2JJ4D 3C14A 3FRZA 3N01A 4ZN3A 5J1EB 1Q7YT 2QA1A 4CLUA 5J2QA 2H5JB 1RTDB 1WTFA 1TMJA 1MLAA 4YOEA 4QU6A 1T9UA 3KDNA 5LJ5Y 2XEXA 3DLHA 4NCBA 5DRKA 1WHWA 5HQMA 2VKZG 2E1MC 3V2UC 2LECA 2CQGA 1WOOA 2UV8G 4FN5A 4UOCA 3CCWA 4J9RA 3SMZA 1QAXA 3KK3A 1SH3A 2V2VA 2GMHA 1HNIB 3W66A 2CYYA 4A47A 5L39A 3GLJA 3CC4S 2DGXA 2E5GA 3UDLA 1S1VB 2HZVA 3K7RA 2FY8A 5E33A 4UZBA 3MM6A 2PIIA 3JQMA 4RW4A 1H0HB 2V2ZA 3B4DA 4JI8F 1BQNB 2HVEA 4XDCA 2CRLA 3MEGA 4HDHA 3BGLA 1X0PA 1JLCB 4ZVHA 2IRYA 4CWBA 1K73T 4USIA 1HNZJ 3W5YA 2IFXA 4OI4A 4ZP9A 4NLDA 2YTCA 4IYQA 4CIOA 1FRIA 2XBPA 5KFKA 2BJ9A 1EB0A 5E41A 2ZE2A 4HDGA 4ECYA 1RT5A 3CMES 3V6JA 4M5HA 2EEYA 4RNMA 3MAQA 1E6VB 1BQMA 3ZTQA 4B3SF 1CJTA 1WG1A 5J2MB 1TKZA 1FJCA 3TNVA 3Q0AA 2P6SA 3DHWC 3H0PA 4F3OA 1FX4A 1VLOA 2CQ1A 3UW1A 2MQQA 7FDRA 1LXJA 3SEOA 2DB1A 3CCUS 3Q86A 2O5DA 4DV1F 2HAIA 1N33F 2EKYA 3ICLA 4F50A 4J9SA 5DDRC 1SJFA 1XMOJ 4K4YA 2JRSA 3I82A 5D0HA 3UN2A 3G6ES 3OTDA 1UW9A 4C3KA 1PC4A 2J5AA 4ES2A 3TYTA 1I3OB 3MCOA 5KG5A 3OL9A 1CS4B 4KGMA 4QBUA 2FIUA 1U1OA 2ZH9A 1NO8A 4OI6A 2AIRB 2UUBF 4GVBB 2QX0A 1N34J 5EWGA 3IR6B 3RBXA 1RAEB 3C16A 1XMBA 3MR5A 2AJQA 4L75A 2IA0A 3KK2B 1CJKB 1KDNA 2W2NP 4XAKA 2H5EA 1G3OA 5D4PA 3GSIA 2QLWA 3MWBA 3PNIA 2GV1A 1TAUA 3RW7A 4CP5A 4LFAJ 4PAAA 2R3VA 1TL7A 5A8RB 2JH3A 2HVHA 4M5KA 3MM5B 5E3AA 1NEEA 5J2PA 2GO8A 4IFYA 1OS5A 5KFDA 4KIAA 4BLGA 4FKYA 4CLLA 4WE1A 4O3NA 2WCXA 4FPRA 3NBPB 1KVKA 3TEGA 3GR1A 2CPDA 7FD1A 4CTAA 1HBUB 1UZDA 3L4BC 4M63A 3KNAA 5KAKA 3NAHA 3H2VE 4LT6A 1ZM2A 5E5NA 4O44A 4CDIA 3POTA 3O2IA 4PXEA 4TU7A 3L09A 2M88A 2YWWA 4DQSA 3FBBA 4TXSA 2MKSA 2QSWA 3FC9A 3OVBA 1RT4B 2FVSA 2OPQA 5B09A 1C4AA 1RQ0A 1TUVA 4JI2F 3G87A 1S1UA 3BSNA 3GV8B 4A8XA 1RTJB 4C4WA 3HFVA 2LQ9A 3SSQA 4RUCA 2CQBA 1KVJA 1R8PA 1Q8IA 2EFNA 1ZZFA 3BGUA 2HNYB 2B9WA 3MM8A 2ZJQQ 1U1LA 1C1BA 1TUGB 4WFAQ 1U1QA 1QAYA 4MFBA 4I67A 2Z56B 1A6LA 3DKDA 2FJAB 4A46A 1M5SA 1M1KT 3CGIA 1YJUA 4G3IA 3HHKA 3SQGA 3CJ4A 4ZS6A 1U24A 2BVZA 3FVYA 2PFFB 2L9DA 2OAUA 1F6TA 1SXLA 1NDPA 1XBWA 5DS7A 2LU1A 2WRMA 2E44A 2CIMA 5H9EK 3DRPA 3HLUA 3VQTA 1WUUA 4KV8A 4JI8J 1LK5A 4ERDA 1Y0HA 3LPEA 2XI2A 4WF9Q 4LF5F 1HQ2A 4P2SA 2QJ3A 4TQSA 4PG6A 1VC6A 4LMZA 1KQSR 3U1NA 1R43A 2LXUA 2HFZA 3HDSA 3MEEA 4BBYA 3QPIA 5CZVA 3M2UB 4OQJA 2BE9B 3P4UB 5L9XA 3KLEA 4ZJOA 3W1YC 4B3SJ 3GJRB 2EFVA 4CNYA 2CWXA 3M8RA 5C24A 2BM0A 3MMAA 2EC2A 3ILLA 1RBLA 1CJVB 1UFLA 1AW0A 1VQOS 3ET6A 1GMWA 1Q7LB 3OVSA 1N33J 3SQOP 3DGPA 2Y8YA 4B9UA 1SJ1A 2IJRA 4L3KA 4BHQA 3D1OA 3MMCB 4ICLA 4F67A 1RU2A 1KLMB 3CCTA 4C3MA 2OFGX 4OYXA 1VRQC 2R8IA 2XLIA 5KFEA 1VQLS 2DNOA 1NK9A 5BXIA 1ZA2B 3KWMA 2B4VA 3NKYA 2X1AA 3OSNA 4U9RA 2BXJA 2N4CA 2UUBJ 3DOLB 3BJYA 2EWHA 2HIYA 1FXRA 2FY1A 2DH8A 2MTLA 4UOHA 3DLBA 5DO2A 3C46A 5D78A 5K5MA 2QMWA 3TAMA 2UUAF 2Q6BA 1JLGA 1UEVA 1HQEA 5IT9U 4C0OC 4EBEA 6FDRA 2CJYB 3G96A 4DR3J 3DFEA 3GIIA 3G6VA 4DR4F 1GTHA 1XNRF 1UJ5A 2XCPA 2KRBA 4OZ3A 2JOQA 3HMJG 2D9PA 2GX8A 2AV5A 2OPRB 1JXLA 4WCEQ 1JXEA 2DR6A 2XY7A 4Q8EA 2FJDB 4BWMA 2XYPB 5JVGQ 3NP5A 4OJGA 5KFXA 4NMXA 1UEKA 1PBUA 1FDDA 1CQMA 4RWXA 1G7CB 3VQSA 4B9NA 1ZM4A 2R2RA 1SV5A 2VBWA 2W2OP 3TUPA 3MHYA 3I56S 2XY6A 1REVA 5A76A 2JDJA 2P2CB 5KG0A 3MMBA 2MDAA 1HI0P 2W1BA 1CSJA 3I5CA 3TOQA 5C42B 2AJ0A 1K0TA 3HKZD 5BYRA 4ID8A 2LP4A 4PWWA 1NJYA 3M6VA 3AODA 4WFYA 1RKJA 2VJVA 1PYSB 2VQFF 2BOPA 2FVRA 1RXOB 3CCVS 3T1HJ 2FVPA 4JI2J 2J9DA 1O6XA 2GGPA 5AE3A 5DQGA 1T94A 3LF0A 3HSJA 2XYGB 1ACMB 4X65J 2A6OA 4O0NA 1UMJA 1LQ9A 3V81A 4UY85 1LV5A 5D0EA 5B08A 3C19A 3PJWA 4LVNP 3J7ZT 2V94A 2EK6A 1WELA 2Z2ZA 5EWEA 3T1AA 1VQ9S 3MMJA 1KP6A 3TJAA 5KG1A 3AB4B 1RT7B 4LSZB 1DQ8A 1F1BB 2OI2A 4WBFA 1QSLA 2ZUAA 1S4FA 4DDFA 3DLEA 3LP1A 1QLNA 2UP1A 4LF1A 2RE1A 1F60B 2J7UA 3GYGA 4QWCA 4OZ0A 4AL6A 2R8JA 1N6QA 1G4CA 2DNNA 1KN6A 3C6UB 3K57A 3NY0A 3IMQJ 3D66A 1F3FA 2JX2A 3IN5A 3Q8VA 1NSQA 4NCAA 1BHNA 4AT1B 5F8HA 2HK3A 2D3UA 3G6YA 4ZK7M 1CG2A 2RHSB 2QTWA 4LF5J 4Z37A 5DG9A 5E3CA 4USHA 3B4MA 2PE8A 1RT3B 1URNA 4DL0C 3IGNA 1S9GB 1VYAA 2MHNA 4ZPDA 2B9EA 3OSPA 1XERA 5KFNA 1JLAB 2BZ2A 1W2IA 5KFRA 3C15A 1YJVA 1YIJS 2IMWP 4C8KA 4K2XA 3NOCA 2UV8A 4CLYA 2LU2A 1KTQA 3A8IA 4DR5F 2DXEA 1EAYC 4MKAA 4DS5A 4ZPAA 2HZAA 1RWVB 5DLFA 2R2TA 1KQFB 4IDKA 1SJ4P 4I4BA 1XEZA 3AXMA 4XPCA 4K5SA 3CMQA 3M2VB 2JLEA 2XYHB 3SV4A 2FVCA 3DMJA 3CXCR 5B0CA 1NRKA 2PD1A 3I5AA 2D74B 4BS2A 4AL5A 4LF7F 2HHTA 1FK9B 3P45B 3FFIB 2XHCA 2CPXA 3FSYA 4PZVA 2CZVC 3DOKA 1GMWD 3IAM9 2KFZA 4DR6J 1R7IA 2CFXA 2GVDB 2MZJA 4F02A 3IRXB 2DRAA 1IM4A 4NPOA 2UUAJ 3W3SA 2DO4A 5T41A 1KQGB 1SKRA 1QSSA 2V5HG 4V19J 2B43A 3EGWB 3PW0A 4KQZA 4OI0A 4G1PA 4DR4J 1N5YB 1XNRJ 2MKYA 1NBEB 3UDCA 3OL6A 1NZAA 3MR7A 4KJIA 4IG0A 1URRA 2OEJA 4LJMA 2XMMA 3ZZPA 4IR9A 1NB2A 5KT5A 1T9VA 1EQMA 4DPXA 1PKUA 1NDKA 2J0QD 1O8BA 4X84A 5AE2A 3AD9C 4DV5F 1SL0A 4LQ3A 2ZWOA 4N47A 2QFJA 1ZM3A 4DPTA 1F9HA 4EWTA 4IOBA 5E7OB 1UVLA 1TKXA 2D7SA 3MM9B 3DN9A 2K1RB 2W7PA 1IWAA 2N4DA 1NK6A 5E3RA 4Q7AA 3B82A 2VIHA 3EWGA 4U67Q 1CULA 3M8YA 3V5RA 1RAFB 3KG1A 4ED0A 4LIWA 1WKJA 3R97A 2VQFJ 1X9MA 3FCVA 4TYAA 1FJEB 4EBCA 1RDRA 3N28A 5IFMA 4CH0S 1CLFA 4K2JA 1W26A 2EPIA 3HO1A 2IPOB 5IT9Y 3ZNJ1 4IG3B 4ANCA 2YX4A 1U02A 4B3TF 2MPUA 4AUKA 5HN0A 3HF5A 1LWCB 1R8BA 2QL9B 3DM2B 2P9GA 4B9LA 5K8PA 8ATCB 1RSCA 4DV3F 3GB0A 3OR1B 2DHHA 2CQHA 3D6MB 2O3DA 1DLOB 5ETMA 4WU2A 3JS9A 1OQ6A 5HBMA 2PT0A 1G1XA 4KTQA 3D2WA 5BYQA 5MLCV 1REGX 1B4SA 4ZJQA 2CJ9A 1Y9OA 3T3FA 4NLGA 2PSZA 2MSSA 2QFIA 2ROEA 1JXVA 3PZPA 4ZVRB 2C2NA 1VC0A 5HATA 5IQQA 5ETQA 3R3TA 2G0JA 1KS2A 4NXNF 4QIEA 3RGIA 5GADI 4PUOB 3I0SA 4KB7A 1KC8T 3NMRA 4FKXA 2KYXA 5D15A 3TANA 3NWRA 4KC5A 3R1HA 2PA3A 4JI6F 4QYZJ 4Y0FA 4P75A 2ASLA 5H1SV 2AX0A 2QGFB 4K0KF 5LXYA 3VR1A 3KJVA 1F3VA 3PX0A 3BN4A 3U27A 3M9MB 1YJTA 2RMLA 3CJKB 2IM2A 3DDNA 2C3MA 4UW2A 2XZDB 1F0XA 4HHUA 4EZ6A 2R2UA 1N5QA 2MZQA 5F41A 1JKHB 4KY3A 4N8OA 3MPUB 2LXFA 4NMLA 5L38A 5HQ8A 2HQIA 4JV5F 3TA1A 1RAGB 3CB4A 4ED1A 3KOAA 4NLSA 1VFJA 2YY3A 4J9QA 3DDIA 3M9NB 4CM2A 1VHFA 1UCNA 3H90A 2XB2D 1YWXA 3M8PA 4UZCA 5HROA 2B6AA 3BSOA 4Q45A 4HVZA 4HACB 2R7VA 1U48A 2IC3A 1RT6A 4M94A 8RUCA 4LF7J 4CLFA 1DTQB 3BREA 1IR0A 2FPHX 1M5HA 3ENVA 5AXKA 4KE5A 4N5SA 3IRWP 5B0FA 2VFVA 3VVUA 3VV2B 5GMEA 2ZH3A 1S1XB 1YRXA 2ZJRQ 3TI0A 3ZO7A 1RI7A 1D9FA 1K44A 2HRTA 1S77D 2UU9F 3PR4A 2K7JA 5LSLA 4Z2XA 4CZCA 4DR7F 3P96A 3KLGB 2DT9A 2DY9A 4RLEA 2D3ZA 4WFZA 3NXZA 2GVZA 2V8PA 3BM7A 3RAXA 2XG8A 1TVRB 1T9WA 2ZC4A 2BOAA 1TL3B 4Y2CA 1IJFB 4EMDA 3VAHA 4CQ1A 4ZPTR 3Q8SB 4RZRA 1BQXA 1X0FA 1I5OB 4KHRA 4J9NA 4E8UA 3M1VB 3W2WB 2APOA 2R7OA 4F4ZA 3BDEA 4TU8A 2HQGA 1TL4A 1A9NB 2QO3A 3BSAA 1S9FA 1HL6A 1W7WA 3IXQA 1HW9A 3CTRA 2HBQB 1Y10A 3IA0A 2K7KA 1JLFB 4DV5J 1CBKA 1RTIA 1X5TA 3LA0A 2PA8D 4P74A 4P72A 3ZNUA 1S7IA 1OPZA 3UD3P 1IKWB 4MKVA 2JVOA 1S6QB 3RZAA 4MKYA 1MMLA 4DPUA 1TL1B 3PW7A 4CO5A 3DYAB 3RBZA 2XLJA 5HLFA 1LW2B 3O6QA 1IQZA 2ZM6F 2V4RA 2Z2YB 3NS6A 5KG2A 2J0XA 5IS2A 4OL8A 2PFDA 1FE0A 2F3JA 1MWYA 3EGVA 3JSRA 5E3PA 1S72S 4LFBF 4QQBA 1KSPA 3E51A 5K14B 2EG2A 2WZ1A 4ED5A 1HBMB 2HS4A 3TZYA 1AXQA 2GHWA 4Y2KA 1AT1B 4B3TJ 3HVRA 3D7SB 1L3VA 4GMKA 2PI4A 5CZXA 9ATCB 4QU7A 2UZAA 4DV3J 2JWNA 1WI8A 3NGRA 1BGXT 4PQAA 2IA6A 3HVTA 4QR1A 1HMVA 3KLIB 1ZBTA 1T8EA 2VPXB 4CRJA 1WDDA 3E01B 3QWPA 4FXVA 3NS7B 5CABA 2JHEA 1UWBB 2D9OA 2J7KA 5JMNA 2KM8B 3OTCA 3PV8A 2X51A 5J2NA 3G82A 2J6SA 2R7UA 3N6LA 2VOPA 1L5UA 4QZVB 4RW9B 1ICEB 1HLWA 4NXNJ 3LAKA 2RU9A 2QV6A 5AXMA 4ED3A 3FRYA 1TK0A 4AQYF 3D3CJ 3DCAA 3GONA 3PACA 3BO2A 3EZOA 4JI6J 1BY9A 3LQVA 4RW8B 3CDWA 2DGOA 1FD8A 1I6JA 1Q81T 2ACMA 1UVMA 4URSA 3DI6A 4K0KJ 4RW7B 1YRTA 2NZ4A 5EWFA 1QAIA 4YS2A 4CO2A 4YFUA 4NX9A 1N0UA 2HMIB 4A8QA 3FDSA 3LGMA 3GJSB 5M2RA 2W9BB 3T5KA 2XWYA 3AT1B 2DKOB 4JV5J 1RB0A 2C2DA 4TN2A 1NDCA 4KO0A 3BO4A 3DRYA 2I5JA 3ZZZA 2BUNA 1S0NA 2MJNA 1B0PA 1HI1A 3RBEA 1VQ4S 3VGUA 3CJ5A 3GIJA 1OY6A 4P73A 2KYZA 5E2QA 3UE2A 4RBTA 4FF4A 4L3NA 5DETA 2ILYA 2QC3A 4OI1A 4MIBA 5D3GA 1S0VA 1RHUB 2G4BA 3PFEA 4EO6A 2ZHBA 3AH6A 2OKQA 2EFPA 2RU3A 3H4DA 2C28A 2HVDA 3KK1B 4PXDA 3KNGA 1VJQA 3CJ2A 2LYVA 1NDLA 4HTIA 1Q16B 1WORA 5DZ6A 4U96A 2GHVC 3HZGA 3MAAA 4C97A 2YKAA 3Q23A 1GAOA 4CT8A 4DEZA 2YX7A 1VQYA 2UU9J 5U47A 2VC0A 4DR7J 2IAJB 4C8ZA 1NHVA 2COLA 4HTJA 3I0RA 1EIYB 2YH1A 3IP0A 1HD0A 3OTBA 5B0GA 1V3RA 5HL7Q 4ILLA 3OXGA 1VQSA 4WU3A 2VZ9A 3MUVP 3W5XA 2F4VF 1WG4A 3BDPA 1FNXH 1LFPA 2IDLA 1C1CB 4J5OA 5A0YB 4ZOSA 2W4CA 1MNEA 5KG7A 4FNHA 2Y0BB 2VDIA 2BMBA 2BQ3A 3HSGA 4FYWB 3GTYX 1FKAF 3IC1A 5JVHQ 3O44A 5GADU 2EFGA 5IWAJ 1YTYA 1R0AA 1HW8A 1FF2A 4DPWA 1PYTA 5JJBA 2ZH7A 2WONA 3RB6A 1APSA 1YDLA 5HAOA 3F73A 3DXSX 2R7SA 2ASYA 2ZZNA 3V6DA 5KFQA 2ZM6J 2IRUA 2ZH1A 4B02A 2C3UA 3HHLD 2B7CB 2YNGB 2CJBA 1S1TA 3GJQB 3VGTA 3TX0A 1Q79A 4LSNB 2AYGA 1E6YA 4U7UD 5H9FJ 4K4VA 4KGVB 4CO0A 2LQJA 5HP1B 2IIHA 3C6TA 2XGPA 4LFBJ 4TQRA 1A7GE 3VCDA 3UVJA 1NJZA 4WKYA 4OYBA 2MKKA 5L1LA 2W4DA 2BANB 1I51B 4P2XA 5I3PA 3ZFVA 2XM3A 4MJKA 3W64A 1D09B 3W9IA 1RUSA 1TMMA 3QFWA 3CCRS 3UR3C 2ZVIA 1L3UA 1GNKA 2ROPA 1Y5NB 5CH7B 3W2VA 2QZ8A 1JJ4A 2GS8A 4DQRA 2GAGC 3OR2B 3DRSA 2EBEA 1S6PB 1EETB 2CA9A 3PJXA 4KT0C 3PR5B 3PYEA 4DV6F 3E2EA 3K8VA 2HHUA 1NXIA 4DV2F 7AT1B 4ZJLA 2F8MA 3CC7S 3NNCA 3BBBA 2E1PA 2DTJA 2LDYA 5J1EA 1QAJA 3DRRB 4I64A 4RNNA 1LWXA 1N48A 1RTDA 4RPFA 4XPEA 4QWEA 1WKLA 4IUFA 2PEHA 4ELTA 2ZNYA 3MCSA 2OO4A 4AQYJ 2BW7A 2CJXB 3T9ZA 2B4UA 2Y1LB 1NKEA 1MG7A 2ZH5A 1F2HA 3R6LB 2N3LA 4WP3A 1TU0B 1NAQA 1U09A 3JSMB 4W98A 1FRJA 4HHJA 1MWZA 1HBNB 2XZTB 1XJWB 3J7AN 2VASA 2NUUG 1HNIA 5J2QB 4ECXA 2RKIB 4F3MA 2WTFA 3GWCA 1S1VA 4RBUA 4OJHA 3JYTB 2WVDA 2Q6CA 1WKKA 2RD5C 3UFCX 4NLRA 1BQNA 1GQEA 2ZZTA 5EX0A 2BR0A 1U8SA 1JLBB 1SUQB 2MLXA 1JLCA 1IXKA 1P1LA 3QFHA 1PO6A 3MD1A 3OFHA 3AFGA 4TY9A 1YRUA 2DGVA 3UD4P 4H54A 1M1HA 1RLCL 3M05A 1HQUB 4DCPB 3H40A 4ZP8A 4ZKAA 4OYIA 2QRRA 2ZD1B 2F9JA 4A8KA 4C48A 1NH7A 3DRXA 1E6VA 2G0CA 3M32B 1AFIA 4R8UB 4PR6A 3OLBA 4NI2B 5J2MA 3ZTPA 3OUYB 2BYCA 2P5VA 2YKNB 1RP5A 4CNZA 2FB0A 1OQ3A 2ZE2B 1NHKL 3MPDA 2G1HA 5IQ6A 2IDEA 4JYAF 3W63A 2IY5B 3WBZA 2W01A 4DL3A 4FP9A 1T95A 3V4MA 4DL2A 3TARA 3OQ2A 1RAJA 4G1QB 5BJRA 2F8HA 3PM9A 4IRCA 4JI1F 1N52B 3D1HA 3BGRB 1NJXA 1TFWA 2F4VJ 4BWJA 3T5JA 1ZS6A 1CS4A 2W8LA 2FLPA 1DQ9A 3S01A 3AQPA 3F0NA 2W8KA 4GVBA 1HPZB 3H5YA 3GU0A 4YHHF 2DIVA 4X2BA 1JX4A 1JNZB 2HURA 4DSKA 4C11B 2KG0A 3KK2A 3D1QA 1U45A 3VALA 4J9UE 3D0IE 1CJKA 1S97A 1N5SA 3MPVA 3SCIE 2MQMA 2HGLA 2Z8QA 4JOUA 4ED7A 2DGTA 1K8AT 5D8HB 1X31C 1XQIA 2LCWA 1MN7A 4LF9F 2RT3A 5EDWA 2AGOA 4X4SA 3BB5A 5A8RA 1GX6A 2ATCB 3MM5A 1HKAA 1U2CA 3KUGA 4JI3J 2OP5A 4C98A 2VBZA 2ZOFA 1VQKS 1FX2A 3M6UA 1VRTB 3J81U 5L1JA 2OELA 5I42B 3PO4A 3NBPA 1O0PA 4P7VA 3K58A 2KJWA 3TVYA 4UQGA 3SIPB 1HBUA 2RQMA 4GKJF 4UTGA 5LSRA 2POKA 3DLKB 1T9XA 2M7SA 3PHTA 4O3PA 1XTZA 2CG8A 3G4SS 1C2PA 3ISZA 4F2SA 3VAMA 1Q4RA 4CO3A 2JL9A 2OSRA 1S99A 3RAQA 3DC2A 3Q8YA 3IBFB 1RAOA 2AF6A 1YITS 4ZCKA 2AYMA 3PO5A 1QD1A 1QM9A 1ZZNA 1RT4A 3I5BA 2VD3A 2VG5B 3ETOA 1YK9A 2K3IA 5F8NA 5HANA 2LDIA 2CDRB 3HHLB 4E0DA 1S12A 4DV6J 4R25A 1RAIB 3CJ0A 3KDOA 3EXCX 2XS5A 1N32F 4CO1A 1HBOB 3SBMA 3E8OA 4DV2J 1RTJA 1HR0J 3LTOA 2KDOA 2HNYA 2GQ2A 1EHWA 5KG4A 4YUDA 3J80U 5A2QU 2KO1A 5ETSA 5C25B 1WTBA 4NCGA 5GAGU 2M8HA 3D6TB 4C2MA 4Q0BB 1AA1B 4EZ9A 1JLEA 1C0UB 3KJQB 2HHVA 4DV0F 5LMNF 4E2FB 5IM0A 2J76E 3LGNA 5DDQC 2FC9A 1ZPVA 2G0IA 3TRGA 2LA6A 3H7HB 4TLQA 4TYBA 3RG6A 1KKHA 3PKMA 4PPDA 3TA2A 4M5IA 4LFCJ 3IM8A 3TUJC 1U25A 3MUTP 2OPPB 4CLKA 1UW4A 3IFEA 4O3QA 1VQMS 2YXLA 3QO9B 2MSTA 3S1TA 4H4MB 2CADA 3WIUA 2ZNZA 2V8VA 1OSDA 3TZZA 4M5DB 3ILIA 4C8NA 4ZP7A 1DFDA 2UUTA 4PYDA 3M2UA 3PW2A 4KV8B 2MGZB 4KKOA 4BC7A 5DGBA 2P9EA 1R8CA 2VG7B 2CUYA 1V6HA 1YJNS 2EBGA 1EJ7L 3KHRA 3TJ8A 3V6HA 4DR1J 2ROGA 2I6WA 2U2FA 3ENAA 2YWKA 3EPIA 2JLGA 5K8OA 1RACB 4ZITA 1ZPWX 2F1FA 3AD7C 5FIIA 1XR7A 1WEYA 1CJVA 3P8BB 1JIHA 4KHMA 4FS1A 2L3MA 1V5VA 1LK7A 1KQKA 5B0DA 4B9TA 2BM1A 2J6TA 2VB6A 1RHJB 3HD1A 2O67A 4ZPCA 2BJ3A 2ADCA 2BJDA 5CYJA 1TUWA 2CAJA 3NCQA 3MMCA 3V6KA 1NSKL 1KLMA 3K5NA 4CLWA 1HA1A 1RCOB 5KT4A 4JI1J 4ZP6A 2AGQA 2BRKA 5A8KB 1S57A 2PMWA 2JEJA 5HJYA 2XMWA 4ETZA 1WF1A 1HIYA 3DOLA 1AB8A 3H5UA 5L1IA 1UVNA 3R5GA 1RBOB 5F9NA 3GCWP 2EFOA 5LSOA 2FJEB 4ZVEA 5A6WA 2A2DA 2RS2A 3ZTRA 2HQDA 4LF9J 1C4CA 2CQCA 2PDAA 3CUNA 4IQMA 2DHXA 5CA5A 1VRUB 1U1PA 4D3GA 4EGLA 1NNDA 2RQ4A 3ENWA 2OPRA 3A3NB 2BDPA 4YMEA 3BZQA 5GAHU 1R8HA 4G1IA 3CDBA 2UVUA 4DCJB 3EE3A 4OHYA 2OTJS 1SKWA 1RHRB 2RJZA 3WZ0A 1TZ0A 3MI7X 3HSDA 4WTYA 1NJIT 3QIDA 5I3QA 2DITA 2BKPA 1YKWA 1GXUA 3IM9A 5C42A 1IQTA 1X4DA 2JSXA 3IBCB 3JXOA 1QE1B 2L08A 4OZLA 2VONA 3K5LA 1DTTB 3OD2A 3KUEA 1OPIA 4QYRA 3PYDA 3FNNA 2ALYB 1REVB 1UVKA 3P5BP 4OHZA 2CQ0A 2EG1A 2VFSA 4DG1B 5C5JA 4TNOA 2FJWA 1HNWF 3KLHB 1N32J 3N79A 1R31A 3VGVA 5KFAA 2XZWA 1ZM9A 4J9KA 4RJVA 2KT2A 2R8GA 3ULHA 2RAQA 4ZCLA 2HFOA 3L9ZA 4I7FB 1NMEB 1L3TA 1OY8A 3SZ2A 3QT8A 2FJXA 4EBDA 1VBKA 1X7VA 3K5PA 4S0MA 1RT7A 2WVCA 2MQPA 1HNXJ 5LMNJ 4K4ZA 4X66F 1LNQA 3OVAA 4A48A 4USUA 5ADZA 1K47A 3GIMA 3RUBL 4QR2A 2KI2A 3G6XA 3J81Y 2WVBA 2NLWA 1X4AA 5HSPA 3I9ZA 3AHPA 1XWLA 3LO3A 1T03B 4OFZA 3RB4A 4DL5A 1K0VA 2U1AA 4P7TA 1XN9A 3C6UA 3W65A 3BQ1A 4DV7F 1R8AA 2N82B 3PY8A 1QTNB 4KR0B 3PIPQ 2E29A 1Y3KA 4J9OA 2NUHA 3I31A 2XNQA 1RT3A 2F9DA 2MMYA 2OH2A 5KOXA 2XSJB 2BJEA 1S9GA 2LVWA 1TV6B 3PIOQ 2XI3A 3LOUA 2RVJA 1JLAA 4DR2J 5DG8A 2ASJA 3T6JA 2XMVA 4EYHB 2ZOMA 1WG5A 2OEMA 1UAWA 3ETMA 2QLBB 1D9DA 4NZ7A 2DNRA 3MCMA 4ZVTB 3I9V9 2JC0A 4XK8C 2HHPA 3HJVA 1Q5VA 2AJ2A 5A8WB 3ILJA 1T3OA 2NYHA 4GKKJ 3QIPB 1QJHA 4FBTA 1WEZA 2OIHA 3J80Y 5A2QY 2BRLA 2FHKA 3L7UA 3M2VA 1RABB 2V9KA 4B17A 1FESA 4F0HA 3SCJE 1U2FA 3K8WA 3KLVA 2XO6A 3Q89A 1FKPB 3M7VA 4NYZA 3OJUA 5IZHA 4I69A 1FK9A 3FFIA 2HG4A 1NHUA 3IO1A 3PXGa 3ISND 1OJ4A 2JFKA 2HHXA 1NK4A 3QAUA 3MPYA 4U7CA 2CQ3A 2QN6B 2GVDA 3IRXA 2AP6A 1PIEA 4M5GA 4I68A 1TL5A 4OYMA 4F4XA 4FS2A 3TUIC 1PSDA 5HK4A 2L41A 4EEYA 2LLZA 2XS2A 3ILOA 3IWNC 1QVFR 2DNHA 1N5YA 2QL7B 5DQHA 4QYZK 1ZTWA 2ZUGA 1YJWS 4EFAC 4NA2A 4USWA 2YNHB 1BXNA 1S6OA 1WHYA 1ZTTA 4R0EA 3UO0A 1F2GA 5SZTA 1HHSA 3HHEA 3H5SA 2OTLS 3EX7B 4WKRA 4B3RF 3GV7B 1SKSA 2YQ0A 3PDNA 4QIWD 4ZHRB 4KAIA 2NREA 2Q66A 2B7BB 2B9XA 2QYCA 4IFVB 2ZBQA 4JI7J 4DV4F 2ZH6A 2K1RA 1YQHA 3PYFA 4EUVA 3FMBA 4M95A 2DNYA 1SJQA 2HNDB 5FDLB 3PKYA 4WZQA 5CCLA 3AOCA 2RIJA 2XMJA 4PG5A 4ZVFA 1U8WA 2GJFA 3QT6A 3MR3A 5F8MA 1T05B 2DR7A 3RRKA 3OPKA 4GO7X 4DBQA 4WYLA 4WJBA 4MK9A 1TKXB 1QDUB 1RZMA 5HVGA 3HK2A 4ZCIA 1UPPA 2RDDA 2H51B 3OFEA 2DIUA 4IG3A 2AWZA 2NS1B 1X4EA 4NE9C 1UVIA 3MR6A 4DF4A 1L3SA 3RR7A 2M9KA 1LWCA 2XWXA 2B5JB 1QVGR 2O66A 3PJ9A 3DM2A 2FJVA 2LQ5A 3K17A 4J90A 4LSLB 4B3MF 3A8EA 1U49A 3OR1A 4M5LA 2ZBCA 1IKVB 3QQCD 2E66A 1DLOA 2XQCA 4IO1A 1X4BA 4K50A 4PYAA 2G2YA 1FDBA 2R7TA 3MM7B 4D3HA 3ZXWA 2ASDA 2V0NA 3R7NB 4DCOB 3PHEA 2JZ5A 5KFPA 3BQ0A 1KLNA 4DV7J 1N56A 5ITHA 3RB0A 1RWUA 1M5KC 5DM6Q 2ATLA 1NK7A 4WFBQ 1GX5A 4CLZA 4PUOA 2GMLA 3HCXA 1MU2B 3T19A 4DUZF 1CQNA 5KG6A 5EUHA 1V5IB 4OMFG 2H65B 3S7RA 1BUXA 1IR1A 2MYFA 3ZZ0A 3OL8A 4LF4F 3GP9A 1BC6A 3VZIA 4ZVOB 3QT5A 4WIQA 1TKDA 3CJKA 2VJUA 2E5LF 3OFFA 5CD4H 3NCRA 4MH8A 3CCES 3EVMA 2CPFA 1YBAA 1JKHA 3UCGA 3OTOF 2D3O1 1N36F 1P6TA 1NUEA 1U1NA 1QTMA 4GC6A 2HQCA 2NZCA 3CCSS 3HZEA 3BQ2A 3OTEA 1HFEL 4QW9A 2XHWA 4EI2A 1M1GA 4DQQA 4OJ3A 4HACA 1FWPA 3SCKE 1B7FA 1R89A 1X9WA 2WSEC 1JLQB 4PXCA 4Z7CA 2HS3A 1DTQA 3LALA 1NU4A 2MKJA 3CJ8A 3R9LA 4DPYA 1Q8BA 3SSSA 1KHVA 3NS5A 5EGYA 2KFYA 2D41A 1S1XA 1U6ZA 3J7YI 2E5HA 2ZH4A 4NZ0A 2OSQA 1RT2B 4AFFA 4USKA 1EQ0A 1VDHA 3KLGA 4PKDB 2CQ4A 1FFWB 1XK8A 2M5YA 1CJUB 3K5OA 1TVRA 4DX7A 4X4RA 2H3EB 1Q8LA 1XNQF 1TL3A 3LW5C 4UY8T 1D3WA 2QMUB 5KT6A 2KU7A 3MZIA 3VAJA 2BKOA 5DM7Q 3M1VA 4FDFA 2VFRA 2XMTA 4QW8A 3W2WA 3RRGA 3MOJB 3NGSA 1WC3A 1NB7A 4PQUB 5G0RB 4DV1J 4DL6A 2XMAA 1X60A 2HHHF 4B3RJ 3HKWA 2YNFB 4YB1P 1S1WB 4WK1A 2CPYA 4TVAB 1WDTA 2CNLB 4ILMA 3SFGA 4OV1A 1W25A 3H20A 2ZDPA 3DLGB 1IKWA 1NK0A 2VOOA 4DV4J 1S6QA 2HIQA 1M5OC 2E5JA 3W5ZA 4GVLA 1TL1A 4KRWA 3KMQA 3DYAA 3TQEA 3R7BB 1U7LA 4IH7A 2ZWPA 1LW2A 4PWDB 9RUBA 2N3OA 4TKTA 2DXDA 4RWWA 4FYYB 1SQEA 2K3KA 1S48A 4ZIVA 3NRBA 2K8GA 1IUJA 3GYXB 3G8TA 3DNCA 1R6YA 3B8HA 2IVMA 3CNQP 4L74A 5K14A 1RYSA 2Q1LA 1HBMA 1WNEA 4QCLA 2M52A 2KTQA 2BX6A 2VH7A 1GH8A 2IVFB 2EI5A 1B99A 3M2RB 2CNOB 3HHNB 4Q44A 4Q2MA 3N5BA 4B3MJ 2KN4A 4I0WA 2RB7A 3EPGA 3NEKA 2NSBA 3SFUA 2P6TA 2BE2B 5F3TA 3I4PA 2EK1A 3KLIA 2YH0A 3E01A 2X1BA 5KFOA 3IR7B 4OZ1A 2WBMA 2ZFHA 4AE5A 3HVWA 2DH9A 1UWBA 2VFUA 2AEJA 2E7WA 1ZH5A 4IQXA 4USVA 2VHGA 4K4UA 1FXLA 3M6WA 2Y1RI 3KLFB 1ELOA 1D0EA 4RW9A 3TUZC 2DNLA 3JSYA 2CJQA 2RILA 4DLGA 4K4WA 1PJ7A 1LWEB 5KFZA 1B0TA 3JAMU 4DUZJ 4KH0B 1RLDA 5DG7A 1F9FA 2FQQB 4RW8A 1U0HB 4NXMF 1FKOB 4KPCA 2QE5A 4LF2A 4O0IA 3DOMB 2VG6B 4LRFA 4RW7A 4M5MA 2A3JA 2W25A 2LEPA 1YI2S 2GIFA 5D0RA 4B3OB 3D6FB 2E5LJ 5B7WA 5H9FK 2HMIA 1S9EB 3T1YF 2AYEA 2VF3A 2W9BA 3WIVA 1MROB 3OTOJ 4C3LA 2HYIB 4YDXA 2XSFA 1NCLA 4ZVQB 1T0TV 3I4HX 2I1RA 4I56A 3S8SA 1X9SA 1AUSL 4IH6A 4ELUA 5D4OA 3M8QB 2G9OA 3LANA 4RW6B 4L76A 1XC9A 2YPYA 4U95A 4DL7A 2D3OR 3BGOP 4OZJA 4J91A 3TAQA 3UCZP 3D67A 3BH7B 1VIOA 2VC1A 4G6VB 4BDPA 4F36A 2I8EA 1S7HA 1VK3A 3KK1A 2AYBA 4RKUC 1TAQA 4ED6A 3JTPA 3LP2B 5RUBA 2HZCA 3EZUA 4O4RA 4A8WA 3VAKA 1SC1B 4F4YA 2IAJA 3TZWA 3ELHA 4Y2IA 1CC8A 4CLSA 4HT7A 4NWBA 1XNQJ 5HJXA 3C3LA 1A0OB 1IKYB 2O01C 1FI4A 1NK5A 2CPHA 2FZCB 1C1CA 4IOAQ 5A0YA 4OZNA 1FDNA 1XMOF 2BJ7A 3A3PB 3PEHA 2HLTA 3CPWR 1S5ZA 4NLUA 2XULA 2Q79A 2DJWA 1JK9B 3H59A 3A8KA 1SPBP 4NEYA 1FRXA 4CO4A 1UVJA 5HVHA 2DRDA 3LP0B 2NPFA 4DPOA 2IBKA 4PCQA 1SKUB 5I3UB 2K2PA 1VHIA 1UFKA 1HWUA 4MKBA 2YNGA 3V4IB 4C8LA 4N76A 4ANDA 3D28A 4X4UA 4LSNA 4RR5A 4B08A 3HSZA 3KG4A 2WW8A 1N5VA 2CQPA 4HI1A 5HP1A 2NCKL 2A1BA 3WHIA 1YLXA 2CG4A 3I87A 3Q8UA 4RU9A 5CQGA 3VF0B 2BANA 5IV3A 3OHBA 5L1KA 2E1RA 1YG0A 1X5SA 1AFJA 2C2KB 4QIGA 3BSCA 3NNAA 5T14A 1H74A 4YB6A 1U47A 2V63A 1NSAA 4MAKA 1GMVA 5CYMB 3R7SB 4ECVA 3ENQA 3EZ5A 2UXDF 3OR2A 2LMIA 1S6PA 1EETA 3BH6B 4LRBA 4HR2A 2N7CA 2QG9B 4I2PB 3D4JA 1SVDA 2QMXA 1EKSA 2AHOB 3VAFA 3J7YU 1TFYA 5IC6B 2FTRA 3DRRA 2V4JB 4HHHA 2VV5A 1M90T 2CZ4A 4P9SA 2VFTA 4OYAA 3WX8A 3M8SA 4CI0B 1RWPB 3P6YC 3CULA 3KHHA 5ETKA 1ZYQA 2A18A 3SDEB 4C8OA 4YY3F 3R2DJ 1J2VA 3K0JA 4NXMJ 1FEHA 1U6BA 3JSMA 3CIZA 4LR8A 1HBNA 4I2QB 3CDUA 5AXLA 2MKCA 4OX7A 5HVFA 2W7OA 4X4QA 2IMOA 3CCZA 2RKIA 2H1YA 3EM1A 3MEKA 4LF8F 3BS9A 3JYTA 3T1YJ 2CNKB 3G8SA 1J5OB 1VQNS 5BR8F 1PYOB 4N77A 1JLBA 1SUQA 2J7WA 3EMTA 4MK8A 4IH5A 2DGSA 2Y1IA 3IWXA 1XR6A 3CCLS 5DDPC 5LL6d 4Y6IA 1VBXA 4DU8A 3GYNA 4NYOA 4X4OA 1RU1A 2WSFC 1HQUA 2RDIA 2YKQA 3JQJA 2Z0GA 3HX9A 3A8JA 2ZD1A 3CIMA 3CJSA 3Q2SC 2HQ3A 2WOMB 3M30B 1DARA 1D1UA 4FPIA 3M32A 1H98A 4R8UA 5KFCA 5DQIA 1OMSA 4NI2A 4ZMMA 3OUYA 5GMKa 5J1NA 2YKNA 1IBKF 3TP2A 4ATNA 1ZA1B 1M5VC 3GIKA 2B9YA 3PW5A 3EJMA 3BPSP 4GO5X 1RYRA 3QJJA 3FEXB 1SIWB 3C66A 1H7XA 3QNWB 3JAMY 3CJQA 2W9AA 4P2FA 1S0MA 3G86A 4G1QA 2OD6A 3MXHP 2M4MA 2EFQA 2M3DA 2DK2A 2KT3A 4DR5J 3BGRA 3B54A 2BJ1A 3Q24A 1RTZA 1YZ7A 1F5CA 3UN3A 1HPZA 2GQCA 2KJVA 3G71S 3QSYB 1NPPA 3NNHA 2HHQA 4PWUA 4ZIWA 1DRZA 5KFBA 4O3SA 1C0TB 4C11A 3THPA 2KKHA 1P1TA 2E1AA 4ECSA 2FLOA 5F8LA 1JJ2R 3PVXA 4ED4A 5IV4A 2DNZA 3LPYA 3C8YA 1RTHA 5L9NA 4ZCMA 5KFJA 2ZITA 3KKFA 1WC4A 3QWUA 3WX4A 1Y4ZB 2SXLA 4OIXA 1UEUA 3FMWA 2PMZD 1H73A 3OL7A 1MSWD 4JI0F 2IRXA 3JTNA 1VRTA 2HNZB 4DR3F 4NLQA 3O8WA 3KHLA 5I42A 3G2XA 4RO0A 3Q8RB 2OMLA 2PC6A 2W9CB 4IR1A 2F8EX 4OZ5A 3BBFA 1PAUB 1WJ9A 4DSFA 4Q2LA 5F3ZA 2H4WB 3SV3A 3DLKA 4PG7A 3ZTOA 2RH3A 4OYOA 1MW7A 1H72C 2YWFA 2YBVA 2RQCA 3IS9B 3VHQA 3EVWA 3QRRA 1IKXB 3Q2TC 4NL5A 1KBRA 1TTHB 2MZTA 3AJDA 2AKWB 1HWLA 3IG1B 2CZ9A 1FVQA 4WFXA 2ZC3A 2UXDJ 2XCAA 4C7QA 1RISA 2VG5A 2ZHOA 4DLEA 4Y00A 3DGVA 1S4EA 1YVFA 1KOOA 3HHLA 1AROP 4DMZA 1HBOA 2OD4A 4ECWA 1X5PA 2HQFA 3HPOA 2F65A 1N5TA 2NQPA 3CC2S 4K5RA 1DHMA 2RRAA 3GG0A 2J8AA 2WHOA 1YGYA 3M4XA 2AW0A 2HVZA 4LF6F 3T1HF 5C25A 2Z4PA 5KFLA 2AJ4A 3GCXP 2YKMB 4Q0BA 3QATA 3ITHB 1R6VA 1C0UA 1VGYA 4OYZA 2B4OA 4YY3J 4CYUB 2I9SA 5EHHA 1WWHA 1YZ6A 4X65F 2HHWA 2C3PA 5D4LA 2VA3A 4P52A 3QRQA 2PEBA 3M8ZA 3FSXA 4XTTA 3CVKA 1WSVA 3FZ2A 4NRTA 4URQU 5LT5A 3OW2R 4NCGB 2KFNA 3GFXA 1JLEB 4DU7A 4LF8J 2JC1A 1B64A 4WXOA 4IRKA 5IM0B 2OPPA 5BR8J 1FCAA 5CYQB 3QO9A 2UXCF 2WW4A 5LJ3Y 3AJ2A 4YP3A 2OEKA 2VQEF 4O4GB 4EK2A 4H4MA 5F8IA 5CAAA 2X1GA 3M8WA 5IC4B 5B0EA 3O3LA 2HGMA 4ZLLA 4KFBA 1Y7PA 4V19X 4M5DA 3CJTA 2MGZA 5ETTA 1SJ3P 4I6YA 5T7LB 5F8GA 1BE4A 1PJ6A 5LXRA 2VG7A 4H4OB 4C0BA 4FVCA 2GO9A 4F4WA 2FLNA 4LVOP 1FWLA 1YJ7A 3R1LA 3GQCA 2WAQD 2W2PP 3PYGA 4DQIA 4HL9A 2XO7A 1IBKJ 3K59A 1WOPA 5AT1B 1J5EF 3VTIA 3D0HE 2KZMA 3QYYA 4FF1A 3FK4A 4J9PA 1F5BA 4KKOB 1B7YB 3FEZA 2RF2B 2V2QA 2R7XA 1GEHA 2BV3A 5KFYA 3CCJS 1EP4B 5CCMA 2MQNA 2RSQA 4MYUA 2YWGA 3MECB 3GR0A 2FYXA 5A8KA 3W62A 4FYDA 4HI2A 1RA6A 2KXFA 2YNIB 2LQBA 4PG8A 1ITPA 3CD5A 5KFFA 4WTOB 4I1TA 3KG0A 1U2RA 2A0FB 3OLAA 4UUXA 3EGNA 3KTQA 3HT0A 3GIRA 3Q8QB 1ZOTA 2HBRB 1NJWA 4DR6F 1YJRA 4UT4A 2Y0SD 4OYPA 1VRUA 2KVQE 1U1RA 2DPJA 5HMWA 5EX3A 4OHWA 3X3UA 3K5MA 2KG1A 2VICA 1SH2A 1S10A 2BABA 1QUVA 4JI0J 4ELVA 4DN0A 2CNNB 4ES1A 4ID5B 3R5AA 3EUNA 3QLHB 2XGQA 3UD5A 1AZSB 2DD8S 2FLLA 3M9OB 3AOAA 1Q82T 1VQ8S 1KFSA 2JVRA 4PXBA 3T5HA 4K4TA 4DUYF 3FZBA 1VIXA 4A8YA 4NLTA 1RWNB 4QWDA 4ECRA 1WACA 4J7CA 1L3KA 2DHSA 1TQLA 2X3DA 2M8DB 3WDOA 1Q53A 4KHPF 1LWFB 3D9BA 1XMQF 4ED8A 4WFNQ 4DHVA 4F26A 3KHGA 3G9CA 2G1DA 1HHQA 2J9CA 2V68A 2VPYB 1HYSB 1QE1A 4JV0A 3WC2A 1DTTA 2V8HA 2DVIA 2IVYA 3Q8PB 2DYAA 3LWLA 1LW0B 3LGHA 2OPSB 3N6MA 3QJPA 2BE7D 4DG1A 4ZPBA 2KH9A 3KLHA 4EYIB 1UPMB 4U7UK 4QPTA 3CMAS 3MCNA 1HNVB 4YB7A 4I7FA 3W8GA 1D9AA 1OIAA 3PTWA 2HS0A 4LF6J 2P9CA 3FQLA 4ENOA 2V6AA 3NGUA 3QBCA 1MMNA 5L46A 2MQLA 3UCUP 3GZ7A 3W9HA 4DFKA 1R0BG 2AZ3A 4IO9Q 4LR7A 5LM7E 4CLTA 2EVZA 4C0HA 2Z2MA 2E9TA 2HHSA 2D69A 5HMZA 3UQSA 3UR0A 4R5PB 1KR4A 3N6NA 2M2BA 2RS8A 2B8QA 1T03A 3MEDB 2L9NA 4RUHA 2RQKA 4ZA1A 3R6GB 2EW9A 2B8PA 4X64F 5HMXA 1Q8KA 1KEKA 2GMJA 2HBYB 4OZ2A 1GMUA 1CEZA 3EXYA 4J9MA 1OSCA 3CWJA 1TKTB 2UXCJ 3A13A 2AEFA 1FJGF 2VQEJ 3PRVA 3S6EA 2XSJA 1TV6A 5KFTA 5KT7A 1EARA 1SQFA 4OX8A 4DSEA 3UNYA 2DY1A 1MWQA 4TY8B 2CPZA 1Y11A 2YQ3A 4LQ9A 4DX6A 5A6PA 3H2LA 3GJTB 1RT1B 3DU6A 5KFSA 3H98A 3AXKA 3FKBA 1JJCB 3EYZA 4NLVA 4XIUA 5A8WA 4O3RA 2JNJA 4JV1A 1GFWB 3Q83A 3QIPA 5K20B 1J5EJ 3EGZA 2A6MA 1UJ4A 2XMUA 1PCAA 3MOZA 3C14B 2QLXA 4NLYA 4DSIA 2BACA 1HI8A 4DWIA 1FKPA 4DFPA 4DXLA 2F63A 2FJBB 3KJNB 1HD1A 2HSEB 3ISNC 1GK8A 5K8NA 3HVAA 2LQ8A 5HO4A 2B3TB 1Y5IB 2ZBRA 2YWEA 3CEDA 4F04B 3KK3B 2ZOGA 4USMA 1RWOB 2MZSA 3DHXA 5K9FA 2B4PA 2AEMA 1S76D 3D54A 3MDFA 5KFMA 2V69A 1ZAWA 3ADAC 2ERRA 5D6GA 4TLRA 2CDQA 3MM6B 4RW4B 3R5CA 3TQ1A 3IAS9 4DSJA 3MEGB 2HGNA 1QSYA 3I6PA 1H2TZ 5B0BA 4N7TA 3RYLA 2QL5B 1FNOA 2V8DA 4JV2A 2GCFA 3I32A 3KYLA 2QIFA 4AL7A 2YNHA 2AD9A 2N7YA 2ZEJA 3THTA 1RT5B 2AJ1A 1TP7A 2VBXA 2Z2LA 3X1LB 5DDOC 1TK5A 2FZGB 3PRDA 4DX8H 4X4VA 2JEGA 2V50A 1GTEA 2CJKA 2XLKA 4F2RA 2X7IA 2ZHAA 5IXUA 3AQOA 3J7Z5 2R2SA 1BQMB 1CJTB 4DUYJ 4ZHRA 1TKZB 2W2MP 3VZHA 4IFVA 3TZXA 3OT9A 4KHPJ 3AA8A 2PN6A 1XMQJ 1SIZA 2H48B 4AYBD 2V34A 2HNDA 5FDLA 2KT5A 4HKQA 3BBCA 1FTRA 4A8MP 2MZ1A 3HD2A 1T05A 2HKEA 4MT1A 1WHVA 4DX5A 2IJNA 4LREA 1JWWA 4O3OA 2MY7A 1HWJA 1O51A 2IM0A 3C16B 1FERA 2ADBA 2BKNA 2B5JA 1GT8A 1OWXA 4LSLA 1PAEX 4QPXA 1KVIA 3FBFA 1IKVA 5E3QA 4DSLA 3FCWA 2HVIA 5KFWA 2K06A 1TL7B 1KRPA 4NASA 3MM7A 2R42A 4F0MA 1SC4B 5KFVA 3PG9A 5J2PB 1RWKB 1WC5A 4IFYB 5HI7A 2CKWA 4U8YA 5IOLA 4Y28C 3JTOA 1UWAA 1NKCA 1S6UA 4WE1B 2NYIA 1V3SA 3BV8A 2DGUA 4X64J 4RL1A 1T9TA 4MK7A 2NR0A 2WB4A 1U26A 4CTAB 1U6FA 5G4DA 3ZZTA 1MU2A 1RHKB 3I55S 4M1KA 4ZVUB 1FJGJ 4Y2MA 3T6BA 4O44B 4K4XA 4DFJA 2VL1A 2HFUA 3POTB 1ROFA 1ZAVA 4NLPA 5AE1A 2WVEA 3P3DA 2AZ1A 3N9UC 3KJFB 2V2KA 2I0XA 2HFSA 2MXYA 3AB2B 5C2GA 2OPQB 3HP6A 3FBEA 4M5NA 4KH1B 3MFIA 3VVTA 1LFWA 1Q5YA 4XO0A 1S1UB 2FDNA 3GFHA 3JSBA 2VDHA 3KUHA 4LRDA 3TA0A 3PRBA 5B0AA 5CD4A 3U7JA 4W92B 3MGJA 3MM8B 2DPIA 1SC6A 2C3OA 1C1BB 3MFHA 4ER8A 4B9SA 1HARA 2FGOA 2R8KA 4MFBB 4JB8B 3NGKA 4FYVB 4UOGA 1Y00A 4LR9A 4ZN1A 3N4WA 3KXDA 2YPZA 1JLQA 3EICA 5KTQA 5D77A 2QT7A 2UXBF 2A2CA 4USJC 1FTCA 2NXUA 1RHQB 2ZJPQ 2DR9A 3SQGB 4DJBA 4U8VA 2EKNA 4ZLJA 1I1GA 2GJ2A 3NG8A 2CQDA 1NK8A 1RE1B 4LRAA 4JBCA 2Q3PA 3QSIA 1OO0B 4DQPA 1RBAA 1RT2A
chains in the Genus database with same CATH topology
4CLWA 4CLKA 4OZ2A 3UVJA 1YK9A 4NI2B 4WP3A 3C15B 4OYOA 1WC3A 4OYBA 4OYWA 1CULB 3MAAB 4USTA 5D0RA 1CJUA 4OYPA 1CS4B 4P2XA 1CJTB 3G82A 4CLZA 1YBUA 4USUA 1TL7B 4OZ3A 1WC6A 4OYAA 2W01A 1AB8A 4CLSA 3C14A 2GVZA 3C16A 2QV6A 1CJVB 4CLUA 1FX2A 1U0HA 1WC0A 3ET6A 4USWA 1WC5A 4WP9A 3R5GA 2GVDB 1Y11A 1CJKB 1AZSB 2WZ1A 5IV4A 5D0EA 4NI2A 1YBTA 3C15A 4CM2A 1WC1A 4CLPA 1CULA 3MAAA 4USVA 4CLTA 5IV3A 1CS4A 4OYXA 1CJTA 1WC4A 3UVJB 4CLYA 1TL7A 1CJUB 3G82B 1FX4A 4CM0A 1Y10A 1CJVA 4CLFA 4WPAA 4P2FA 3C14B 5D15A 2GVZB 4OYIA 5D0GA 2GVDA 3C16B 1CJKA 3MR7A 4WP8A 1AZSA 4CLLA 1U0HB 3ET6B 2BW7A 4P2MA 4OYMA 5D0HA 4OYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CLW A;  4CLK A;  4OZ2 A;  3UVJ A;  1YK9 A;  4NI2 B;  4WP3 A;  3C15 B;  4OYO A;  1WC3 A;  4OYB A;  4OYW A;  1CUL B;  3MAA B;  4UST A;  5D0R A;  1CJU A;  4OYP A;  1CS4 B;  4P2X A;  1CJT B;  3G82 A;  4CLZ A;  1YBU A;  4USU A;  1TL7 B;  4OZ3 A;  1WC6 A;  4OYA A;  2W01 A;  1AB8 A;  4CLS A;  3C14 A;  2GVZ A;  3C16 A;  2QV6 A;  1CJV B;  4CLU A;  1FX2 A;  1U0H A;  1WC0 A;  3ET6 A;  4USW A;  1WC5 A;  4WP9 A;  3R5G A;  2GVD B;  1Y11 A;  1CJK B;  1AZS B;  2WZ1 A;  5IV4 A;  5D0E A;  4NI2 A;  1YBT A;  3C15 A;  4CM2 A;  1WC1 A;  4CLP A;  1CUL A;  3MAA A;  4USV A;  4CLT A;  5IV3 A;  1CS4 A;  4OYX A;  1CJT A;  1WC4 A;  3UVJ B;  4CLY A;  1TL7 A;  1CJU B;  3G82 B;  1FX4 A;  4CM0 A;  1Y10 A;  1CJV A;  4CLF A;  4WPA A;  4P2F A;  3C14 B;  5D15 A;  2GVZ B;  4OYI A;  5D0G A;  2GVD A;  3C16 B;  1CJK A;  3MR7 A;  4WP8 A;  1AZS A;  4CLL A;  1U0H B;  3ET6 B;  2BW7 A;  4P2M A;  4OYM A;  5D0H A;  4OYZ A; 
#chains in the Genus database with same CATH topology
 1VQ7 S;  5KOW A;  1X8D A;  1WOS A;  3DRP B;  1RK8 A;  2OLW A;  1UKU A;  1B0V A;  2XNR A;  1CJU A;  2JLF A;  1LKZ A;  3JQK A;  3ZZR A;  2YVS A;  3TEH B;  4KGX B;  4N41 A;  2MKH A;  4MTP A;  4OX9 F;  2BEF A;  2BA9 A;  1OYD A;  5AXN A;  3H4B A;  3FBC A;  2Y1J A;  1VIS A;  2DCU B;  3MEE B;  3NGD A;  1KFD A;  4URG A;  4JYA J;  4PQU A;  2OGU A;  1Z1Z A;  3NL0 A;  5G0R A;  1P9Y A;  2C2R A;  3L3C A;  2DGQ A;  2YNF A;  4ITS A;  3KLE B;  1S1W A;  1V3Z A;  2ZH2 A;  1JJH A;  4N8N A;  1EZZ B;  2FHM A;  2YKO A;  1UJ6 A;  1N54 B;  5FLX U;  3CCQ S;  4ALZ A;  4W90 B;  3UDE A;  2CXE A;  3DDK A;  3DLG A;  5C24 B;  1K9M T;  4EO8 A;  3MMA B;  1K1Q A;  4DZD A;  1FE4 A;  8AT1 B;  3ET6 B;  3HI9 A;  5F9L A;  4YR3 A;  1DUR A;  4PWD A;  2HWT A;  2MB0 B;  4YHH J;  3DGP B;  1RWX B;  3AD8 C;  2ZBI A;  2XY5 A;  4ED2 A;  1WSR A;  5IWA F;  4ICL B;  1FRH A;  1SC3 B;  4F4A A;  2IYI A;  4HEA 9;  2W7A A;  1UZH A;  2E9R X;  2HAF A;  3BO3 A;  3U1L A;  2L9W A;  4C8Y A;  2AU0 A;  2RRN A;  3NCP A;  3RAM A;  3HHD A;  2FHO B;  3W8P A;  2NXN A;  4ANE A;  3T9N A;  3TAM B;  3M2R A;  4N56 A;  3NWG A;  3CDA A;  1FXD A;  4CLP A;  1FFS B;  1JLG B;  1HQE B;  2HWH A;  1H2V Z;  1SB6 A;  1UP1 A;  2DNK A;  3OXL A;  4RUB A;  2DRB A;  2BE2 A;  5THW A;  2BBE A;  1KOH A;  1RHM B;  4A4J A;  4GKJ J;  2VBY A;  4I6W A;  4F4K A;  1YJ9 S;  1NKB A;  1YX2 A;  3F56 A;  1FJ7 A;  4DZ6 A;  4K7Q A;  1B70 B;  1VBZ A;  4IRD A;  4PG4 A;  3KLF A;  2J0S D;  1Q0N A;  2F40 A;  2V8G A;  1CPZ A;  4RNO A;  5H9E J;  1SV5 B;  2NSC A;  2JEI A;  1CVJ A;  4WZM A;  4F7V A;  1LWE A;  1Z2L A;  3I96 A;  4J9V A;  2C2O B;  5GAE I;  1RAD B;  2V9W A;  2DO0 A;  3MMB B;  5ETN A;  4MYT A;  3H5X A;  5LMU F;  1U0H A;  1FDA A;  3CD0 A;  1FKO A;  3NOG A;  4LBH A;  3HT3 A;  3DOM A;  3CDE A;  1BD6 A;  2VG6 A;  5J1P A;  1SL1 A;  2J0W A;  2RDJ A;  1AYE A;  4M8L A;  4KGK A;  5F0W A;  5ETL A;  1VC5 A;  4OLP A;  4FNI A;  4B3O A;  3BEG B;  1M5P C;  3RB3 A;  1PBA A;  1S9E A;  2QLJ B;  5LOQ A;  3PX4 A;  4NLX A;  4A8S A;  4F3Q A;  1MRO A;  1NSP A;  2M70 A;  3N5F A;  1F5A A;  2GGP B;  3TAP A;  3BKF A;  1N8R T;  3CW2 C;  1FA0 A;  2ALZ A;  3VAI A;  4DV0 J;  4IOC Q;  2CPJ A;  1S79 A;  1T11 A;  2DHA A;  2GHP A;  4P2M A;  4V1A k;  2FD2 A;  5M2P A;  3M8Q A;  3V81 B;  4RU2 A;  3GV5 B;  2YWH A;  4RW6 A;  2J9D E;  3CE8 A;  3NAI A;  3R8Y A;  2QEX S;  4OHX A;  4X62 F;  4G65 A;  3HFK A;  2DCL A;  1V9O A;  2UXB J;  2ZDO A;  6FD1 A;  1H3D A;  2L48 A;  2Z58 B;  2J6U A;  3UNG C;  3QRP A;  3DLJ A;  1VLY A;  4KSE B;  4ZLN A;  3MF5 A;  3DLE B;  3LP1 B;  2H9Z A;  4I6A A;  2QA4 S;  2KHC A;  2QA2 A;  3TVK A;  4O23 A;  4RNH A;  3LP2 A;  3SYZ A;  1M0S A;  4WXW A;  3VGS A;  4EU0 A;  1N6Q B;  4M5J A;  1PJ5 A;  4P6Q A;  4C8M A;  1H7W A;  4NLW A;  3LH2 S;  4YDD B;  4A8O A;  4NYP A;  3H42 A;  2QA4 G;  3U02 A;  2UUW A;  4NRU A;  5AJ3 F;  4L72 B;  1CC7 A;  2FZK B;  4ZVP B;  5KFG A;  1Y5L B;  2I38 A;  1WEX A;  5D0G A;  3GFZ A;  1IVZ A;  3L7P A;  2MY8 A;  4Y65 A;  1VK8 A;  3KFW X;  4OX9 J;  1IKY A;  2R7W A;  1MMD A;  3ZZY A;  4K8R A;  2AQ4 A;  2VKR A;  2PI5 A;  1DBD A;  3C15 B;  5GAG I;  2CVE A;  5CXT A;  2DNP A;  2KVI A;  3A4T A;  1DJ0 A;  3MTJ A;  1PIL A;  1RAH B;  2MJU A;  4ECT A;  3NGT A;  3SSR A;  2Y9H A;  1EKR A;  2MQ8 A;  4L73 A;  1P8G A;  3D0G E;  1Z2Z A;  3CT9 A;  4B9V A;  2GC8 A;  4IDK B;  4Q43 A;  5JXS A;  3LP0 A;  4X4T A;  1KHW A;  3ZZU A;  4AXI A;  1P9Q C;  1VQ5 S;  2HBZ B;  1WF2 A;  1SJR A;  4U6P A;  3TWZ A;  5I3U A;  4HH1 A;  1B3T A;  1FFG B;  3FGV A;  3DMJ B;  3BPD A;  5KT3 A;  3V4I A;  3TJ9 A;  1SCJ B;  5BYS A;  1Q78 A;  2Y8W A;  1JB0 C;  1O5J A;  3RTV A;  1JMT A;  2HFV A;  1S0O A;  3IWL A;  2DIS A;  1TK8 A;  4OV6 A;  1PGZ A;  3NLC A;  3DOK B;  3L95 X;  1VOM A;  2NXE A;  4JI3 F;  2MLZ A;  3OJS A;  5FD1 A;  1X4G A;  1JQG A;  2E1C A;  4HT5 A;  2C2E A;  4WWS A;  4K59 A;  1J27 A;  3SI8 A;  1UA1 A;  5L8R C;  4X4P A;  1DZ5 A;  4OYW A;  2WBR A;  2W4P A;  2LKZ A;  4BC9 A;  4PAB A;  3THV A;  1X4H A;  4XDD A;  5CYM A;  5C7P A;  4OJ1 A;  1N0V C;  2D1C A;  3OHA A;  4JP8 A;  5KG3 A;  5E0O A;  2LXI A;  1VI7 A;  2GIR A;  3W61 A;  4CH7 A;  4NEZ A;  4I2P A;  1VJW A;  1IR2 A;  3MR2 A;  4UF4 A;  4IG0 B;  2IYG A;  2F4F A;  2FUG 9;  3MM9 A;  2RUS A;  2WB1 D;  1MN9 A;  2V4J A;  4F25 A;  5DGA A;  1VBY A;  4QWB A;  1HWI A;  4WII A;  4CCH A;  3A3O B;  5FLX Y;  4OHV A;  3ONQ A;  1D8Z A;  4NA1 A;  4JUZ A;  3SDE A;  2IHR 1;  2KM8 C;  2ZBP A;  1FO1 A;  1IJE B;  2ACY A;  4WP8 A;  5LMU J;  1HR0 F;  2IJF A;  4H4K C;  1IWG A;  1FRK A;  2RNE A;  3JB9 k;  1HNW J;  4I2Q A;  4HLB A;  2FGC A;  2CJA A;  2DNG A;  1CUL B;  1NLK L;  2Z57 B;  2KRR A;  3QJL A;  2BJ8 A;  3U1M A;  2BW2 A;  1TR0 A;  3OFG A;  1J5O A;  1ZET A;  2R9L A;  2RRB A;  5D4N A;  3AAW B;  3PEJ A;  1U0S A;  4WP9 A;  1SH0 A;  3M6X A;  5GAH I;  4Z7Y A;  3NMA A;  3R5B A;  3GIL A;  1R3N A;  4X66 J;  5HQL A;  2H5I B;  1WC1 A;  3AY0 A;  3D5M A;  2VPZ B;  3BKU A;  1UTA A;  3RRH A;  5CHC B;  4LFC F;  2NXJ A;  3CF5 Q;  5DLG A;  3QMQ A;  4OI2 A;  3K2Y A;  4ZVS B;  2KZZ A;  2VA2 A;  2HRY A;  4J9L A;  4X62 J;  1R0C B;  2KXN B;  3LAM A;  4KYZ A;  3IR5 B;  2WVF A;  3P49 B;  5M2U A;  2WOM A;  3M30 A;  1RWM B;  3E3X A;  1BLU A;  3EVO A;  1I94 F;  1IBL F;  5HBM B;  4F0K A;  1KD1 T;  4UUW A;  5KFI A;  1FWK A;  1NM2 A;  5K8M A;  3ZC4 A;  2VOD A;  1UL3 A;  2GJI A;  3MAH A;  3W9J A;  3VAG A;  4DR1 F;  5AJ3 J;  4OLO A;  3T5L A;  4QIV A;  4YR0 A;  2EC0 A;  1UET A;  1KNZ A;  3I0S B;  3W7B A;  1S49 A;  2LFV A;  2MLY A;  1RCX B;  3TR5 A;  5F8J A;  3HXM A;  5GMD A;  5DJB A;  6AT1 B;  3BR8 A;  3UWT A;  1NPK A;  3B78 A;  1DAX A;  3MUM P;  2JEF A;  4UOF A;  2G13 A;  3TVZ A;  4DS4 A;  3KJV B;  4C9D A;  3J7A 1;  3SCL E;  3EDQ B;  2FC8 A;  3OV7 A;  1C0T A;  3HM9 A;  4ECZ A;  2ILZ A;  4PEO A;  3GSD A;  3ZZO A;  4ECQ A;  4MIW A;  2X3G A;  3IBW A;  3K89 A;  3A12 A;  5GAE U;  2FHJ A;  1IBM F;  2KB2 A;  2QYG A;  3DLL Q;  2E5I A;  2C42 A;  2EXU A;  3H8Y A;  1JNR B;  4R0J A;  2C1E B;  4UQT A;  5KFH A;  4ZLP A;  4TU9 A;  1WD6 A;  2DEI A;  4ES3 A;  3M8P B;  2J8S A;  3A1Y G;  5HRO B;  2R8H A;  2B6A B;  2LA4 A;  1X5O A;  2HNZ A;  3CJ3 A;  2UVV A;  4HH0 A;  3QGH A;  2HRU A;  4LIR A;  2NXC A;  1D8Y A;  2IC3 B;  1RT6 B;  2W9C A;  3TX8 A;  1Q86 T;  1RTH B;  4FF2 A;  3UI3 A;  3BGF A;  2DBB A;  4MIA A;  3O1L A;  3DU5 A;  2V67 A;  1VQP S;  4J37 A;  2B0G A;  3CSK A;  3LWM A;  3SXL A;  2F5G A;  2ABY A;  1QY7 A;  4GRS A;  1VS3 A;  3IS9 A;  2NPI A;  3QZ8 A;  4K4S A;  3QZ7 A;  3FEY B;  4NOH A;  1XR5 A;  1IKX A;  1SQG A;  3O5T B;  3C2P A;  2DNM A;  4DFM A;  5EN1 A;  3IG1 A;  4RUA A;  3PX6 A;  2YQ1 A;  3PFO A;  3T41 A;  2UUC F;  2GVZ B;  3D6H B;  3OBI A;  1XIQ A;  4ZVG A;  3GPA A;  5SUH A;  4Y2A A;  2DR8 A;  2DGW A;  4QR0 A;  1JLF A;  2DH7 A;  2BQR A;  1WHX A;  3R5J B;  1FHT A;  4X4N A;  4PPZ A;  3RU0 A;  1Q95 G;  1R27 B;  1W2B R;  5F0U A;  4RBV A;  2HLU A;  2KL8 A;  1IBC B;  1VMB A;  1VQ6 S;  3OXF A;  2C3Y A;  1RA7 A;  2GW8 A;  2ZZM A;  2ZH8 A;  2YKM A;  4WYW A;  2HWI A;  3ITH A;  2B51 A;  2IBO A;  1RTI B;  4PRF A;  2M0G B;  4QOT A;  2G2O A;  4CYU A;  4JI4 F;  3QGG A;  1PC5 A;  2UVW A;  3KMS A;  1LOU A;  4LUB A;  2FVQ A;  1OYE A;  2R7Q A;  2ZVS A;  2MKI A;  5HLF B;  4P10 A;  4LBI A;  1OY9 A;  4ZPV R;  3PW4 A;  4JI5 F;  3CCM S;  2GFF A;  2XC9 A;  4IKA A;  1UFW A;  5HMY A;  4NLO A;  1FT8 A;  1HNX F;  2UVR A;  4Q8F A;  4ILR A;  5ETP A;  3R27 A;  4DUT A;  2LEA A;  2MQO A;  5FJ4 A;  2XTJ P;  3UPF A;  5CYQ A;  2C22 A;  4C6A A;  4ECU A;  3AA9 A;  3W60 A;  3RBD A;  4O4G A;  2RHQ B;  1YHQ S;  2GQQ A;  5KT2 A;  1FRL A;  2DNQ A;  2OJ3 A;  1FNM A;  3MTK A;  1LEO A;  4FF3 A;  4DOZ A;  2VPW B;  2E7X A;  5T7L A;  4CH1 A;  1FD2 A;  3CO9 A;  3MPW A;  2MHE A;  4DI6 A;  3UN5 A;  4H4K A;  4NA3 A;  1WC0 A;  4H4O A;  3HVT B;  2IM3 A;  4P71 A;  1HMV B;  1U1M A;  4QWA A;  1NZ8 A;  2O1P A;  4BCA A;  2C2M B;  3HJF A;  1YBT A;  1I94 J;  3IGV A;  1IBL J;  2DHG A;  5C2C A;  3GE9 A;  4KFB B;  5ETV A;  2CWK A;  3BR9 A;  4DR2 F;  1VCT A;  1RJJ A;  2OFH X;  1K1S A;  3QT7 A;  5GVQ A;  5J2N B;  3G82 B;  2RF2 A;  4DF8 A;  2GA7 A;  1N88 A;  3MUR P;  2Y3Y A;  4LF4 J;  1T02 A;  2P8I A;  3R2C J;  1EP4 A;  1U1K A;  4RX6 A;  1Q1K A;  4ZPW R;  2Q43 A;  2QLF B;  1IM6 A;  5JUM A;  4GKK F;  2R4F A;  1T3N A;  1HWK A;  3MEC A;  1GXT A;  3RR8 A;  2WSC C;  2X1F A;  2RUG A;  4CT9 A;  1FRM A;  1KWM A;  1UA0 A;  1N36 J;  4OI3 A;  2YNI A;  3BN7 A;  3DI6 B;  1SBR A;  3RW6 A;  3ZTS A;  4F8R A;  1BWE A;  4LRC A;  3BF4 A;  3H25 A;  2DEJ A;  3QAE A;  1WC6 A;  3BYR A;  3J81 j;  1G2E A;  1KTV A;  1ZAX A;  3BYP A;  3P5T L;  1T7P A;  4ETX A;  4WK3 A;  3QGP A;  3AJ1 A;  1IBM J;  1SI9 A;  5ETO A;  1BMQ B;  1EX8 A;  4KO0 B;  2PMH A;  3PCO B;  2V4Q A;  2I5J B;  1HNZ F;  2XS7 A;  2W2Q P;  2I2Y A;  1YSJ A;  2G2Z A;  4RNF A;  2AMC B;  2KHD A;  4CM0 A;  3FJ2 A;  5ETR A;  3US5 A;  3GMG A;  4ID5 A;  3QLH A;  3GFY A;  4YEA A;  2YX1 A;  3R5D A;  1DQA A;  5D3G B;  2A10 A;  2W24 A;  4QJV A;  1AZS A;  2FHJ D;  2F7V A;  4YB5 A;  1RGV A;  3B6B A;  3VWS A;  2LEB A;  1SL2 A;  2JFD A;  2C2Z B;  3UDV A;  4DN9 A;  1PG5 B;  2XMK A;  2VUG A;  1P27 B;  2PO4 A;  3MAA B;  4YQW A;  2ZKU A;  1WF0 A;  4UST A;  2HW3 A;  1LWF A;  1YBU A;  3QGI A;  1VR6 A;  1S59 A;  3L7O A;  3EDR B;  2GIQ A;  3FUY A;  3TW0 A;  3WQP A;  2R7R A;  4YN3 B;  3Q22 A;  1HYS A;  3CO0 P;  5MAO A;  4FVM A;  1H2U X;  2DXF A;  4Q5V A;  3I0R B;  2WK4 A;  2UUC J;  2GNK A;  4ZDN A;  2B56 A;  5IT0 A;  1LW0 A;  2OPS A;  4YR2 A;  1Y3J A;  4OX6 A;  2HHH J;  4JI7 F;  2HK2 A;  1KON A;  2DR5 A;  1RKI A;  2Z30 B;  1NH8 A;  4KGZ B;  1HHT P;  2OMO A;  4DL4 A;  2J9E A;  2PGC A;  1HNV A;  2CPI A;  2CPE A;  1N34 F;  1T9Y A;  4AD6 A;  1WI6 A;  5KFU A;  1FEE A;  4WPA A;  2OUG A;  1N4L A;  3TO8 A;  2BQU A;  1LXN A;  2AX1 A;  3HHL C;  2ZKT A;  3CD7 A;  4B9M A;  1BWV A;  2YKP A;  3AOB A;  1U4B A;  4FXD A;  1G6B A;  5I4M A;  3HUL A;  4AXJ A;  1Z4U A;  1R0A B;  4JI4 J;  3CJR A;  3WC0 A;  2CQ2 A;  1GXL A;  3MD3 A;  2WON B;  4LFA F;  4LBP A;  4R5P A;  3FSI A;  4A8F A;  2CVI A;  1TEL A;  4KBI A;  1H6K X;  2AGP A;  4L6V 3;  3V6D B;  1F9E B;  2GZO A;  3MED A;  2GAH C;  4NZ6 A;  4JI5 J;  2OHD A;  1S1T B;  1ULR A;  2AJF E;  4FXW A;  1QUP A;  1E6Y B;  3GG1 A;  3FQK A;  4E98 A;  3LUY A;  3RJM B;  1TKT A;  2HEK A;  3D3B J;  3C6T B;  2QSF A;  2E7V A;  1AUD A;  5DZ7 A;  2E9Z A;  3UVJ B;  2CQI A;  1DY3 A;  5IT4 A;  2MEW A;  4Y34 A;  3H2U B;  3FCH A;  4Y3C A;  3HFZ B;  1RAA B;  2MZR A;  1X4F A;  4KPY A;  4TY8 A;  2VU5 A;  3W2V B;  4HYK A;  3BKT A;  1RT1 A;  4FZV A;  2HFN A;  3F44 A;  3DRS B;  2IM1 A;  3G8Q A;  1IN0 A;  3CD6 S;  4QIF A;  2H54 B;  2KXH A;  1H38 A;  2AT1 B;  3DXB A;  4MMO A;  2HPU A;  1FVS A;  4FBU A;  4FYX B;  1RWW B;  1X4C A;  3F41 A;  4W4M A;  3D68 A;  3N0V A;  2H4Y B;  1NPR A;  4GC7 A;  2JJ4 D;  3C14 A;  3FRZ A;  3N01 A;  4ZN3 A;  5J1E B;  1Q7Y T;  2QA1 A;  4CLU A;  5J2Q A;  2H5J B;  1RTD B;  1WTF A;  1TMJ A;  1MLA A;  4YOE A;  4QU6 A;  1T9U A;  3KDN A;  5LJ5 Y;  2XEX A;  3DLH A;  4NCB A;  5DRK A;  1WHW A;  5HQM A;  2VKZ G;  2E1M C;  3V2U C;  2LEC A;  2CQG A;  1WOO A;  2UV8 G;  4FN5 A;  4UOC A;  3CCW A;  4J9R A;  3SMZ A;  1QAX A;  3KK3 A;  1SH3 A;  2V2V A;  2GMH A;  1HNI B;  3W66 A;  2CYY A;  4A47 A;  5L39 A;  3GLJ A;  3CC4 S;  2DGX A;  2E5G A;  3UDL A;  1S1V B;  2HZV A;  3K7R A;  2FY8 A;  5E33 A;  4UZB A;  3MM6 A;  2PII A;  3JQM A;  4RW4 A;  1H0H B;  2V2Z A;  3B4D A;  4JI8 F;  1BQN B;  2HVE A;  4XDC A;  2CRL A;  3MEG A;  4HDH A;  3BGL A;  1X0P A;  1JLC B;  4ZVH A;  2IRY A;  4CWB A;  1K73 T;  4USI A;  1HNZ J;  3W5Y A;  2IFX A;  4OI4 A;  4ZP9 A;  4NLD A;  2YTC A;  4IYQ A;  4CIO A;  1FRI A;  2XBP A;  5KFK A;  2BJ9 A;  1EB0 A;  5E41 A;  2ZE2 A;  4HDG A;  4ECY A;  1RT5 A;  3CME S;  3V6J A;  4M5H A;  2EEY A;  4RNM A;  3MAQ A;  1E6V B;  1BQM A;  3ZTQ A;  4B3S F;  1CJT A;  1WG1 A;  5J2M B;  1TKZ A;  1FJC A;  3TNV A;  3Q0A A;  2P6S A;  3DHW C;  3H0P A;  4F3O A;  1FX4 A;  1VLO A;  2CQ1 A;  3UW1 A;  2MQQ A;  7FDR A;  1LXJ A;  3SEO A;  2DB1 A;  3CCU S;  3Q86 A;  2O5D A;  4DV1 F;  2HAI A;  1N33 F;  2EKY A;  3ICL A;  4F50 A;  4J9S A;  5DDR C;  1SJF A;  1XMO J;  4K4Y A;  2JRS A;  3I82 A;  5D0H A;  3UN2 A;  3G6E S;  3OTD A;  1UW9 A;  4C3K A;  1PC4 A;  2J5A A;  4ES2 A;  3TYT A;  1I3O B;  3MCO A;  5KG5 A;  3OL9 A;  1CS4 B;  4KGM A;  4QBU A;  2FIU A;  1U1O A;  2ZH9 A;  1NO8 A;  4OI6 A;  2AIR B;  2UUB F;  4GVB B;  2QX0 A;  1N34 J;  5EWG A;  3IR6 B;  3RBX A;  1RAE B;  3C16 A;  1XMB A;  3MR5 A;  2AJQ A;  4L75 A;  2IA0 A;  3KK2 B;  1CJK B;  1KDN A;  2W2N P;  4XAK A;  2H5E A;  1G3O A;  5D4P A;  3GSI A;  2QLW A;  3MWB A;  3PNI A;  2GV1 A;  1TAU A;  3RW7 A;  4CP5 A;  4LFA J;  4PAA A;  2R3V A;  1TL7 A;  5A8R B;  2JH3 A;  2HVH A;  4M5K A;  3MM5 B;  5E3A A;  1NEE A;  5J2P A;  2GO8 A;  4IFY A;  1OS5 A;  5KFD A;  4KIA A;  4BLG A;  4FKY A;  4CLL A;  4WE1 A;  4O3N A;  2WCX A;  4FPR A;  3NBP B;  1KVK A;  3TEG A;  3GR1 A;  2CPD A;  7FD1 A;  4CTA A;  1HBU B;  1UZD A;  3L4B C;  4M63 A;  3KNA A;  5KAK A;  3NAH A;  3H2V E;  4LT6 A;  1ZM2 A;  5E5N A;  4O44 A;  4CDI A;  3POT A;  3O2I A;  4PXE A;  4TU7 A;  3L09 A;  2M88 A;  2YWW A;  4DQS A;  3FBB A;  4TXS A;  2MKS A;  2QSW A;  3FC9 A;  3OVB A;  1RT4 B;  2FVS A;  2OPQ A;  5B09 A;  1C4A A;  1RQ0 A;  1TUV A;  4JI2 F;  3G87 A;  1S1U A;  3BSN A;  3GV8 B;  4A8X A;  1RTJ B;  4C4W A;  3HFV A;  2LQ9 A;  3SSQ A;  4RUC A;  2CQB A;  1KVJ A;  1R8P A;  1Q8I A;  2EFN A;  1ZZF A;  3BGU A;  2HNY B;  2B9W A;  3MM8 A;  2ZJQ Q;  1U1L A;  1C1B A;  1TUG B;  4WFA Q;  1U1Q A;  1QAY A;  4MFB A;  4I67 A;  2Z56 B;  1A6L A;  3DKD A;  2FJA B;  4A46 A;  1M5S A;  1M1K T;  3CGI A;  1YJU A;  4G3I A;  3HHK A;  3SQG A;  3CJ4 A;  4ZS6 A;  1U24 A;  2BVZ A;  3FVY A;  2PFF B;  2L9D A;  2OAU A;  1F6T A;  1SXL A;  1NDP A;  1XBW A;  5DS7 A;  2LU1 A;  2WRM A;  2E44 A;  2CIM A;  5H9E K;  3DRP A;  3HLU A;  3VQT A;  1WUU A;  4KV8 A;  4JI8 J;  1LK5 A;  4ERD A;  1Y0H A;  3LPE A;  2XI2 A;  4WF9 Q;  4LF5 F;  1HQ2 A;  4P2S A;  2QJ3 A;  4TQS A;  4PG6 A;  1VC6 A;  4LMZ A;  1KQS R;  3U1N A;  1R43 A;  2LXU A;  2HFZ A;  3HDS A;  3MEE A;  4BBY A;  3QPI A;  5CZV A;  3M2U B;  4OQJ A;  2BE9 B;  3P4U B;  5L9X A;  3KLE A;  4ZJO A;  3W1Y C;  4B3S J;  3GJR B;  2EFV A;  4CNY A;  2CWX A;  3M8R A;  5C24 A;  2BM0 A;  3MMA A;  2EC2 A;  3ILL A;  1RBL A;  1CJV B;  1UFL A;  1AW0 A;  1VQO S;  3ET6 A;  1GMW A;  1Q7L B;  3OVS A;  1N33 J;  3SQO P;  3DGP A;  2Y8Y A;  4B9U A;  1SJ1 A;  2IJR A;  4L3K A;  4BHQ A;  3D1O A;  3MMC B;  4ICL A;  4F67 A;  1RU2 A;  1KLM B;  3CCT A;  4C3M A;  2OFG X;  4OYX A;  1VRQ C;  2R8I A;  2XLI A;  5KFE A;  1VQL S;  2DNO A;  1NK9 A;  5BXI A;  1ZA2 B;  3KWM A;  2B4V A;  3NKY A;  2X1A A;  3OSN A;  4U9R A;  2BXJ A;  2N4C A;  2UUB J;  3DOL B;  3BJY A;  2EWH A;  2HIY A;  1FXR A;  2FY1 A;  2DH8 A;  2MTL A;  4UOH A;  3DLB A;  5DO2 A;  3C46 A;  5D78 A;  5K5M A;  2QMW A;  3TAM A;  2UUA F;  2Q6B A;  1JLG A;  1UEV A;  1HQE A;  5IT9 U;  4C0O C;  4EBE A;  6FDR A;  2CJY B;  3G96 A;  4DR3 J;  3DFE A;  3GII A;  3G6V A;  4DR4 F;  1GTH A;  1XNR F;  1UJ5 A;  2XCP A;  2KRB A;  4OZ3 A;  2JOQ A;  3HMJ G;  2D9P A;  2GX8 A;  2AV5 A;  2OPR B;  1JXL A;  4WCE Q;  1JXE A;  2DR6 A;  2XY7 A;  4Q8E A;  2FJD B;  4BWM A;  2XYP B;  5JVG Q;  3NP5 A;  4OJG A;  5KFX A;  4NMX A;  1UEK A;  1PBU A;  1FDD A;  1CQM A;  4RWX A;  1G7C B;  3VQS A;  4B9N A;  1ZM4 A;  2R2R A;  1SV5 A;  2VBW A;  2W2O P;  3TUP A;  3MHY A;  3I56 S;  2XY6 A;  1REV A;  5A76 A;  2JDJ A;  2P2C B;  5KG0 A;  3MMB A;  2MDA A;  1HI0 P;  2W1B A;  1CSJ A;  3I5C A;  3TOQ A;  5C42 B;  2AJ0 A;  1K0T A;  3HKZ D;  5BYR A;  4ID8 A;  2LP4 A;  4PWW A;  1NJY A;  3M6V A;  3AOD A;  4WFY A;  1RKJ A;  2VJV A;  1PYS B;  2VQF F;  2BOP A;  2FVR A;  1RXO B;  3CCV S;  3T1H J;  2FVP A;  4JI2 J;  2J9D A;  1O6X A;  2GGP A;  5AE3 A;  5DQG A;  1T94 A;  3LF0 A;  3HSJ A;  2XYG B;  1ACM B;  4X65 J;  2A6O A;  4O0N A;  1UMJ A;  1LQ9 A;  3V81 A;  4UY8 5;  1LV5 A;  5D0E A;  5B08 A;  3C19 A;  3PJW A;  4LVN P;  3J7Z T;  2V94 A;  2EK6 A;  1WEL A;  2Z2Z A;  5EWE A;  3T1A A;  1VQ9 S;  3MMJ A;  1KP6 A;  3TJA A;  5KG1 A;  3AB4 B;  1RT7 B;  4LSZ B;  1DQ8 A;  1F1B B;  2OI2 A;  4WBF A;  1QSL A;  2ZUA A;  1S4F A;  4DDF A;  3DLE A;  3LP1 A;  1QLN A;  2UP1 A;  4LF1 A;  2RE1 A;  1F60 B;  2J7U A;  3GYG A;  4QWC A;  4OZ0 A;  4AL6 A;  2R8J A;  1N6Q A;  1G4C A;  2DNN A;  1KN6 A;  3C6U B;  3K57 A;  3NY0 A;  3IMQ J;  3D66 A;  1F3F A;  2JX2 A;  3IN5 A;  3Q8V A;  1NSQ A;  4NCA A;  1BHN A;  4AT1 B;  5F8H A;  2HK3 A;  2D3U A;  3G6Y A;  4ZK7 M;  1CG2 A;  2RHS B;  2QTW A;  4LF5 J;  4Z37 A;  5DG9 A;  5E3C A;  4USH A;  3B4M A;  2PE8 A;  1RT3 B;  1URN A;  4DL0 C;  3IGN A;  1S9G B;  1VYA A;  2MHN A;  4ZPD A;  2B9E A;  3OSP A;  1XER A;  5KFN A;  1JLA B;  2BZ2 A;  1W2I A;  5KFR A;  3C15 A;  1YJV A;  1YIJ S;  2IMW P;  4C8K A;  4K2X A;  3NOC A;  2UV8 A;  4CLY A;  2LU2 A;  1KTQ A;  3A8I A;  4DR5 F;  2DXE A;  1EAY C;  4MKA A;  4DS5 A;  4ZPA A;  2HZA A;  1RWV B;  5DLF A;  2R2T A;  1KQF B;  4IDK A;  1SJ4 P;  4I4B A;  1XEZ A;  3AXM A;  4XPC A;  4K5S A;  3CMQ A;  3M2V B;  2JLE A;  2XYH B;  3SV4 A;  2FVC A;  3DMJ A;  3CXC R;  5B0C A;  1NRK A;  2PD1 A;  3I5A A;  2D74 B;  4BS2 A;  4AL5 A;  4LF7 F;  2HHT A;  1FK9 B;  3P45 B;  3FFI B;  2XHC A;  2CPX A;  3FSY A;  4PZV A;  2CZV C;  3DOK A;  1GMW D;  3IAM 9;  2KFZ A;  4DR6 J;  1R7I A;  2CFX A;  2GVD B;  2MZJ A;  4F02 A;  3IRX B;  2DRA A;  1IM4 A;  4NPO A;  2UUA J;  3W3S A;  2DO4 A;  5T41 A;  1KQG B;  1SKR A;  1QSS A;  2V5H G;  4V19 J;  2B43 A;  3EGW B;  3PW0 A;  4KQZ A;  4OI0 A;  4G1P A;  4DR4 J;  1N5Y B;  1XNR J;  2MKY A;  1NBE B;  3UDC A;  3OL6 A;  1NZA A;  3MR7 A;  4KJI A;  4IG0 A;  1URR A;  2OEJ A;  4LJM A;  2XMM A;  3ZZP A;  4IR9 A;  1NB2 A;  5KT5 A;  1T9V A;  1EQM A;  4DPX A;  1PKU A;  1NDK A;  2J0Q D;  1O8B A;  4X84 A;  5AE2 A;  3AD9 C;  4DV5 F;  1SL0 A;  4LQ3 A;  2ZWO A;  4N47 A;  2QFJ A;  1ZM3 A;  4DPT A;  1F9H A;  4EWT A;  4IOB A;  5E7O B;  1UVL A;  1TKX A;  2D7S A;  3MM9 B;  3DN9 A;  2K1R B;  2W7P A;  1IWA A;  2N4D A;  1NK6 A;  5E3R A;  4Q7A A;  3B82 A;  2VIH A;  3EWG A;  4U67 Q;  1CUL A;  3M8Y A;  3V5R A;  1RAF B;  3KG1 A;  4ED0 A;  4LIW A;  1WKJ A;  3R97 A;  2VQF J;  1X9M A;  3FCV A;  4TYA A;  1FJE B;  4EBC A;  1RDR A;  3N28 A;  5IFM A;  4CH0 S;  1CLF A;  4K2J A;  1W26 A;  2EPI A;  3HO1 A;  2IPO B;  5IT9 Y;  3ZNJ 1;  4IG3 B;  4ANC A;  2YX4 A;  1U02 A;  4B3T F;  2MPU A;  4AUK A;  5HN0 A;  3HF5 A;  1LWC B;  1R8B A;  2QL9 B;  3DM2 B;  2P9G A;  4B9L A;  5K8P A;  8ATC B;  1RSC A;  4DV3 F;  3GB0 A;  3OR1 B;  2DHH A;  2CQH A;  3D6M B;  2O3D A;  1DLO B;  5ETM A;  4WU2 A;  3JS9 A;  1OQ6 A;  5HBM A;  2PT0 A;  1G1X A;  4KTQ A;  3D2W A;  5BYQ A;  5MLC V;  1REG X;  1B4S A;  4ZJQ A;  2CJ9 A;  1Y9O A;  3T3F A;  4NLG A;  2PSZ A;  2MSS A;  2QFI A;  2ROE A;  1JXV A;  3PZP A;  4ZVR B;  2C2N A;  1VC0 A;  5HAT A;  5IQQ A;  5ETQ A;  3R3T A;  2G0J A;  1KS2 A;  4NXN F;  4QIE A;  3RGI A;  5GAD I;  4PUO B;  3I0S A;  4KB7 A;  1KC8 T;  3NMR A;  4FKX A;  2KYX A;  5D15 A;  3TAN A;  3NWR A;  4KC5 A;  3R1H A;  2PA3 A;  4JI6 F;  4QYZ J;  4Y0F A;  4P75 A;  2ASL A;  5H1S V;  2AX0 A;  2QGF B;  4K0K F;  5LXY A;  3VR1 A;  3KJV A;  1F3V A;  3PX0 A;  3BN4 A;  3U27 A;  3M9M B;  1YJT A;  2RML A;  3CJK B;  2IM2 A;  3DDN A;  2C3M A;  4UW2 A;  2XZD B;  1F0X A;  4HHU A;  4EZ6 A;  2R2U A;  1N5Q A;  2MZQ A;  5F41 A;  1JKH B;  4KY3 A;  4N8O A;  3MPU B;  2LXF A;  4NML A;  5L38 A;  5HQ8 A;  2HQI A;  4JV5 F;  3TA1 A;  1RAG B;  3CB4 A;  4ED1 A;  3KOA A;  4NLS A;  1VFJ A;  2YY3 A;  4J9Q A;  3DDI A;  3M9N B;  4CM2 A;  1VHF A;  1UCN A;  3H90 A;  2XB2 D;  1YWX A;  3M8P A;  4UZC A;  5HRO A;  2B6A A;  3BSO A;  4Q45 A;  4HVZ A;  4HAC B;  2R7V A;  1U48 A;  2IC3 A;  1RT6 A;  4M94 A;  8RUC A;  4LF7 J;  4CLF A;  1DTQ B;  3BRE A;  1IR0 A;  2FPH X;  1M5H A;  3ENV A;  5AXK A;  4KE5 A;  4N5S A;  3IRW P;  5B0F A;  2VFV A;  3VVU A;  3VV2 B;  5GME A;  2ZH3 A;  1S1X B;  1YRX A;  2ZJR Q;  3TI0 A;  3ZO7 A;  1RI7 A;  1D9F A;  1K44 A;  2HRT A;  1S77 D;  2UU9 F;  3PR4 A;  2K7J A;  5LSL A;  4Z2X A;  4CZC A;  4DR7 F;  3P96 A;  3KLG B;  2DT9 A;  2DY9 A;  4RLE A;  2D3Z A;  4WFZ A;  3NXZ A;  2GVZ A;  2V8P A;  3BM7 A;  3RAX A;  2XG8 A;  1TVR B;  1T9W A;  2ZC4 A;  2BOA A;  1TL3 B;  4Y2C A;  1IJF B;  4EMD A;  3VAH A;  4CQ1 A;  4ZPT R;  3Q8S B;  4RZR A;  1BQX A;  1X0F A;  1I5O B;  4KHR A;  4J9N A;  4E8U A;  3M1V B;  3W2W B;  2APO A;  2R7O A;  4F4Z A;  3BDE A;  4TU8 A;  2HQG A;  1TL4 A;  1A9N B;  2QO3 A;  3BSA A;  1S9F A;  1HL6 A;  1W7W A;  3IXQ A;  1HW9 A;  3CTR A;  2HBQ B;  1Y10 A;  3IA0 A;  2K7K A;  1JLF B;  4DV5 J;  1CBK A;  1RTI A;  1X5T A;  3LA0 A;  2PA8 D;  4P74 A;  4P72 A;  3ZNU A;  1S7I A;  1OPZ A;  3UD3 P;  1IKW B;  4MKV A;  2JVO A;  1S6Q B;  3RZA A;  4MKY A;  1MML A;  4DPU A;  1TL1 B;  3PW7 A;  4CO5 A;  3DYA B;  3RBZ A;  2XLJ A;  5HLF A;  1LW2 B;  3O6Q A;  1IQZ A;  2ZM6 F;  2V4R A;  2Z2Y B;  3NS6 A;  5KG2 A;  2J0X A;  5IS2 A;  4OL8 A;  2PFD A;  1FE0 A;  2F3J A;  1MWY A;  3EGV A;  3JSR A;  5E3P A;  1S72 S;  4LFB F;  4QQB A;  1KSP A;  3E51 A;  5K14 B;  2EG2 A;  2WZ1 A;  4ED5 A;  1HBM B;  2HS4 A;  3TZY A;  1AXQ A;  2GHW A;  4Y2K A;  1AT1 B;  4B3T J;  3HVR A;  3D7S B;  1L3V A;  4GMK A;  2PI4 A;  5CZX A;  9ATC B;  4QU7 A;  2UZA A;  4DV3 J;  2JWN A;  1WI8 A;  3NGR A;  1BGX T;  4PQA A;  2IA6 A;  3HVT A;  4QR1 A;  1HMV A;  3KLI B;  1ZBT A;  1T8E A;  2VPX B;  4CRJ A;  1WDD A;  3E01 B;  3QWP A;  4FXV A;  3NS7 B;  5CAB A;  2JHE A;  1UWB B;  2D9O A;  2J7K A;  5JMN A;  2KM8 B;  3OTC A;  3PV8 A;  2X51 A;  5J2N A;  3G82 A;  2J6S A;  2R7U A;  3N6L A;  2VOP A;  1L5U A;  4QZV B;  4RW9 B;  1ICE B;  1HLW A;  4NXN J;  3LAK A;  2RU9 A;  2QV6 A;  5AXM A;  4ED3 A;  3FRY A;  1TK0 A;  4AQY F;  3D3C J;  3DCA A;  3GON A;  3PAC A;  3BO2 A;  3EZO A;  4JI6 J;  1BY9 A;  3LQV A;  4RW8 B;  3CDW A;  2DGO A;  1FD8 A;  1I6J A;  1Q81 T;  2ACM A;  1UVM A;  4URS A;  3DI6 A;  4K0K J;  4RW7 B;  1YRT A;  2NZ4 A;  5EWF A;  1QAI A;  4YS2 A;  4CO2 A;  4YFU A;  4NX9 A;  1N0U A;  2HMI B;  4A8Q A;  3FDS A;  3LGM A;  3GJS B;  5M2R A;  2W9B B;  3T5K A;  2XWY A;  3AT1 B;  2DKO B;  4JV5 J;  1RB0 A;  2C2D A;  4TN2 A;  1NDC A;  4KO0 A;  3BO4 A;  3DRY A;  2I5J A;  3ZZZ A;  2BUN A;  1S0N A;  2MJN A;  1B0P A;  1HI1 A;  3RBE A;  1VQ4 S;  3VGU A;  3CJ5 A;  3GIJ A;  1OY6 A;  4P73 A;  2KYZ A;  5E2Q A;  3UE2 A;  4RBT A;  4FF4 A;  4L3N A;  5DET A;  2ILY A;  2QC3 A;  4OI1 A;  4MIB A;  5D3G A;  1S0V A;  1RHU B;  2G4B A;  3PFE A;  4EO6 A;  2ZHB A;  3AH6 A;  2OKQ A;  2EFP A;  2RU3 A;  3H4D A;  2C28 A;  2HVD A;  3KK1 B;  4PXD A;  3KNG A;  1VJQ A;  3CJ2 A;  2LYV A;  1NDL A;  4HTI A;  1Q16 B;  1WOR A;  5DZ6 A;  4U96 A;  2GHV C;  3HZG A;  3MAA A;  4C97 A;  2YKA A;  3Q23 A;  1GAO A;  4CT8 A;  4DEZ A;  2YX7 A;  1VQY A;  2UU9 J;  5U47 A;  2VC0 A;  4DR7 J;  2IAJ B;  4C8Z A;  1NHV A;  2COL A;  4HTJ A;  3I0R A;  1EIY B;  2YH1 A;  3IP0 A;  1HD0 A;  3OTB A;  5B0G A;  1V3R A;  5HL7 Q;  4ILL A;  3OXG A;  1VQS A;  4WU3 A;  2VZ9 A;  3MUV P;  3W5X A;  2F4V F;  1WG4 A;  3BDP A;  1FNX H;  1LFP A;  2IDL A;  1C1C B;  4J5O A;  5A0Y B;  4ZOS A;  2W4C A;  1MNE A;  5KG7 A;  4FNH A;  2Y0B B;  2VDI A;  2BMB A;  2BQ3 A;  3HSG A;  4FYW B;  3GTY X;  1FKA F;  3IC1 A;  5JVH Q;  3O44 A;  5GAD U;  2EFG A;  5IWA J;  1YTY A;  1R0A A;  1HW8 A;  1FF2 A;  4DPW A;  1PYT A;  5JJB A;  2ZH7 A;  2WON A;  3RB6 A;  1APS A;  1YDL A;  5HAO A;  3F73 A;  3DXS X;  2R7S A;  2ASY A;  2ZZN A;  3V6D A;  5KFQ A;  2ZM6 J;  2IRU A;  2ZH1 A;  4B02 A;  2C3U A;  3HHL D;  2B7C B;  2YNG B;  2CJB A;  1S1T A;  3GJQ B;  3VGT A;  3TX0 A;  1Q79 A;  4LSN B;  2AYG A;  1E6Y A;  4U7U D;  5H9F J;  4K4V A;  4KGV B;  4CO0 A;  2LQJ A;  5HP1 B;  2IIH A;  3C6T A;  2XGP A;  4LFB J;  4TQR A;  1A7G E;  3VCD A;  3UVJ A;  1NJZ A;  4WKY A;  4OYB A;  2MKK A;  5L1L A;  2W4D A;  2BAN B;  1I51 B;  4P2X A;  5I3P A;  3ZFV A;  2XM3 A;  4MJK A;  3W64 A;  1D09 B;  3W9I A;  1RUS A;  1TMM A;  3QFW A;  3CCR S;  3UR3 C;  2ZVI A;  1L3U A;  1GNK A;  2ROP A;  1Y5N B;  5CH7 B;  3W2V A;  2QZ8 A;  1JJ4 A;  2GS8 A;  4DQR A;  2GAG C;  3OR2 B;  3DRS A;  2EBE A;  1S6P B;  1EET B;  2CA9 A;  3PJX A;  4KT0 C;  3PR5 B;  3PYE A;  4DV6 F;  3E2E A;  3K8V A;  2HHU A;  1NXI A;  4DV2 F;  7AT1 B;  4ZJL A;  2F8M A;  3CC7 S;  3NNC A;  3BBB A;  2E1P A;  2DTJ A;  2LDY A;  5J1E A;  1QAJ A;  3DRR B;  4I64 A;  4RNN A;  1LWX A;  1N48 A;  1RTD A;  4RPF A;  4XPE A;  4QWE A;  1WKL A;  4IUF A;  2PEH A;  4ELT A;  2ZNY A;  3MCS A;  2OO4 A;  4AQY J;  2BW7 A;  2CJX B;  3T9Z A;  2B4U A;  2Y1L B;  1NKE A;  1MG7 A;  2ZH5 A;  1F2H A;  3R6L B;  2N3L A;  4WP3 A;  1TU0 B;  1NAQ A;  1U09 A;  3JSM B;  4W98 A;  1FRJ A;  4HHJ A;  1MWZ A;  1HBN B;  2XZT B;  1XJW B;  3J7A N;  2VAS A;  2NUU G;  1HNI A;  5J2Q B;  4ECX A;  2RKI B;  4F3M A;  2WTF A;  3GWC A;  1S1V A;  4RBU A;  4OJH A;  3JYT B;  2WVD A;  2Q6C A;  1WKK A;  2RD5 C;  3UFC X;  4NLR A;  1BQN A;  1GQE A;  2ZZT A;  5EX0 A;  2BR0 A;  1U8S A;  1JLB B;  1SUQ B;  2MLX A;  1JLC A;  1IXK A;  1P1L A;  3QFH A;  1PO6 A;  3MD1 A;  3OFH A;  3AFG A;  4TY9 A;  1YRU A;  2DGV A;  3UD4 P;  4H54 A;  1M1H A;  1RLC L;  3M05 A;  1HQU B;  4DCP B;  3H40 A;  4ZP8 A;  4ZKA A;  4OYI A;  2QRR A;  2ZD1 B;  2F9J A;  4A8K A;  4C48 A;  1NH7 A;  3DRX A;  1E6V A;  2G0C A;  3M32 B;  1AFI A;  4R8U B;  4PR6 A;  3OLB A;  4NI2 B;  5J2M A;  3ZTP A;  3OUY B;  2BYC A;  2P5V A;  2YKN B;  1RP5 A;  4CNZ A;  2FB0 A;  1OQ3 A;  2ZE2 B;  1NHK L;  3MPD A;  2G1H A;  5IQ6 A;  2IDE A;  4JYA F;  3W63 A;  2IY5 B;  3WBZ A;  2W01 A;  4DL3 A;  4FP9 A;  1T95 A;  3V4M A;  4DL2 A;  3TAR A;  3OQ2 A;  1RAJ A;  4G1Q B;  5BJR A;  2F8H A;  3PM9 A;  4IRC A;  4JI1 F;  1N52 B;  3D1H A;  3BGR B;  1NJX A;  1TFW A;  2F4V J;  4BWJ A;  3T5J A;  1ZS6 A;  1CS4 A;  2W8L A;  2FLP A;  1DQ9 A;  3S01 A;  3AQP A;  3F0N A;  2W8K A;  4GVB A;  1HPZ B;  3H5Y A;  3GU0 A;  4YHH F;  2DIV A;  4X2B A;  1JX4 A;  1JNZ B;  2HUR A;  4DSK A;  4C11 B;  2KG0 A;  3KK2 A;  3D1Q A;  1U45 A;  3VAL A;  4J9U E;  3D0I E;  1CJK A;  1S97 A;  1N5S A;  3MPV A;  3SCI E;  2MQM A;  2HGL A;  2Z8Q A;  4JOU A;  4ED7 A;  2DGT A;  1K8A T;  5D8H B;  1X31 C;  1XQI A;  2LCW A;  1MN7 A;  4LF9 F;  2RT3 A;  5EDW A;  2AGO A;  4X4S A;  3BB5 A;  5A8R A;  1GX6 A;  2ATC B;  3MM5 A;  1HKA A;  1U2C A;  3KUG A;  4JI3 J;  2OP5 A;  4C98 A;  2VBZ A;  2ZOF A;  1VQK S;  1FX2 A;  3M6U A;  1VRT B;  3J81 U;  5L1J A;  2OEL A;  5I42 B;  3PO4 A;  3NBP A;  1O0P A;  4P7V A;  3K58 A;  2KJW A;  3TVY A;  4UQG A;  3SIP B;  1HBU A;  2RQM A;  4GKJ F;  4UTG A;  5LSR A;  2POK A;  3DLK B;  1T9X A;  2M7S A;  3PHT A;  4O3P A;  1XTZ A;  2CG8 A;  3G4S S;  1C2P A;  3ISZ A;  4F2S A;  3VAM A;  1Q4R A;  4CO3 A;  2JL9 A;  2OSR A;  1S99 A;  3RAQ A;  3DC2 A;  3Q8Y A;  3IBF B;  1RAO A;  2AF6 A;  1YIT S;  4ZCK A;  2AYM A;  3PO5 A;  1QD1 A;  1QM9 A;  1ZZN A;  1RT4 A;  3I5B A;  2VD3 A;  2VG5 B;  3ETO A;  1YK9 A;  2K3I A;  5F8N A;  5HAN A;  2LDI A;  2CDR B;  3HHL B;  4E0D A;  1S12 A;  4DV6 J;  4R25 A;  1RAI B;  3CJ0 A;  3KDO A;  3EXC X;  2XS5 A;  1N32 F;  4CO1 A;  1HBO B;  3SBM A;  3E8O A;  4DV2 J;  1RTJ A;  1HR0 J;  3LTO A;  2KDO A;  2HNY A;  2GQ2 A;  1EHW A;  5KG4 A;  4YUD A;  3J80 U;  5A2Q U;  2KO1 A;  5ETS A;  5C25 B;  1WTB A;  4NCG A;  5GAG U;  2M8H A;  3D6T B;  4C2M A;  4Q0B B;  1AA1 B;  4EZ9 A;  1JLE A;  1C0U B;  3KJQ B;  2HHV A;  4DV0 F;  5LMN F;  4E2F B;  5IM0 A;  2J76 E;  3LGN A;  5DDQ C;  2FC9 A;  1ZPV A;  2G0I A;  3TRG A;  2LA6 A;  3H7H B;  4TLQ A;  4TYB A;  3RG6 A;  1KKH A;  3PKM A;  4PPD A;  3TA2 A;  4M5I A;  4LFC J;  3IM8 A;  3TUJ C;  1U25 A;  3MUT P;  2OPP B;  4CLK A;  1UW4 A;  3IFE A;  4O3Q A;  1VQM S;  2YXL A;  3QO9 B;  2MST A;  3S1T A;  4H4M B;  2CAD A;  3WIU A;  2ZNZ A;  2V8V A;  1OSD A;  3TZZ A;  4M5D B;  3ILI A;  4C8N A;  4ZP7 A;  1DFD A;  2UUT A;  4PYD A;  3M2U A;  3PW2 A;  4KV8 B;  2MGZ B;  4KKO A;  4BC7 A;  5DGB A;  2P9E A;  1R8C A;  2VG7 B;  2CUY A;  1V6H A;  1YJN S;  2EBG A;  1EJ7 L;  3KHR A;  3TJ8 A;  3V6H A;  4DR1 J;  2ROG A;  2I6W A;  2U2F A;  3ENA A;  2YWK A;  3EPI A;  2JLG A;  5K8O A;  1RAC B;  4ZIT A;  1ZPW X;  2F1F A;  3AD7 C;  5FII A;  1XR7 A;  1WEY A;  1CJV A;  3P8B B;  1JIH A;  4KHM A;  4FS1 A;  2L3M A;  1V5V A;  1LK7 A;  1KQK A;  5B0D A;  4B9T A;  2BM1 A;  2J6T A;  2VB6 A;  1RHJ B;  3HD1 A;  2O67 A;  4ZPC A;  2BJ3 A;  2ADC A;  2BJD A;  5CYJ A;  1TUW A;  2CAJ A;  3NCQ A;  3MMC A;  3V6K A;  1NSK L;  1KLM A;  3K5N A;  4CLW A;  1HA1 A;  1RCO B;  5KT4 A;  4JI1 J;  4ZP6 A;  2AGQ A;  2BRK A;  5A8K B;  1S57 A;  2PMW A;  2JEJ A;  5HJY A;  2XMW A;  4ETZ A;  1WF1 A;  1HIY A;  3DOL A;  1AB8 A;  3H5U A;  5L1I A;  1UVN A;  3R5G A;  1RBO B;  5F9N A;  3GCW P;  2EFO A;  5LSO A;  2FJE B;  4ZVE A;  5A6W A;  2A2D A;  2RS2 A;  3ZTR A;  2HQD A;  4LF9 J;  1C4C A;  2CQC A;  2PDA A;  3CUN A;  4IQM A;  2DHX A;  5CA5 A;  1VRU B;  1U1P A;  4D3G A;  4EGL A;  1NND A;  2RQ4 A;  3ENW A;  2OPR A;  3A3N B;  2BDP A;  4YME A;  3BZQ A;  5GAH U;  1R8H A;  4G1I A;  3CDB A;  2UVU A;  4DCJ B;  3EE3 A;  4OHY A;  2OTJ S;  1SKW A;  1RHR B;  2RJZ A;  3WZ0 A;  1TZ0 A;  3MI7 X;  3HSD A;  4WTY A;  1NJI T;  3QID A;  5I3Q A;  2DIT A;  2BKP A;  1YKW A;  1GXU A;  3IM9 A;  5C42 A;  1IQT A;  1X4D A;  2JSX A;  3IBC B;  3JXO A;  1QE1 B;  2L08 A;  4OZL A;  2VON A;  3K5L A;  1DTT B;  3OD2 A;  3KUE A;  1OPI A;  4QYR A;  3PYD A;  3FNN A;  2ALY B;  1REV B;  1UVK A;  3P5B P;  4OHZ A;  2CQ0 A;  2EG1 A;  2VFS A;  4DG1 B;  5C5J A;  4TNO A;  2FJW A;  1HNW F;  3KLH B;  1N32 J;  3N79 A;  1R31 A;  3VGV A;  5KFA A;  2XZW A;  1ZM9 A;  4J9K A;  4RJV A;  2KT2 A;  2R8G A;  3ULH A;  2RAQ A;  4ZCL A;  2HFO A;  3L9Z A;  4I7F B;  1NME B;  1L3T A;  1OY8 A;  3SZ2 A;  3QT8 A;  2FJX A;  4EBD A;  1VBK A;  1X7V A;  3K5P A;  4S0M A;  1RT7 A;  2WVC A;  2MQP A;  1HNX J;  5LMN J;  4K4Z A;  4X66 F;  1LNQ A;  3OVA A;  4A48 A;  4USU A;  5ADZ A;  1K47 A;  3GIM A;  3RUB L;  4QR2 A;  2KI2 A;  3G6X A;  3J81 Y;  2WVB A;  2NLW A;  1X4A A;  5HSP A;  3I9Z A;  3AHP A;  1XWL A;  3LO3 A;  1T03 B;  4OFZ A;  3RB4 A;  4DL5 A;  1K0V A;  2U1A A;  4P7T A;  1XN9 A;  3C6U A;  3W65 A;  3BQ1 A;  4DV7 F;  1R8A A;  2N82 B;  3PY8 A;  1QTN B;  4KR0 B;  3PIP Q;  2E29 A;  1Y3K A;  4J9O A;  2NUH A;  3I31 A;  2XNQ A;  1RT3 A;  2F9D A;  2MMY A;  2OH2 A;  5KOX A;  2XSJ B;  2BJE A;  1S9G A;  2LVW A;  1TV6 B;  3PIO Q;  2XI3 A;  3LOU A;  2RVJ A;  1JLA A;  4DR2 J;  5DG8 A;  2ASJ A;  3T6J A;  2XMV A;  4EYH B;  2ZOM A;  1WG5 A;  2OEM A;  1UAW A;  3ETM A;  2QLB B;  1D9D A;  4NZ7 A;  2DNR A;  3MCM A;  4ZVT B;  3I9V 9;  2JC0 A;  4XK8 C;  2HHP A;  3HJV A;  1Q5V A;  2AJ2 A;  5A8W B;  3ILJ A;  1T3O A;  2NYH A;  4GKK J;  3QIP B;  1QJH A;  4FBT A;  1WEZ A;  2OIH A;  3J80 Y;  5A2Q Y;  2BRL A;  2FHK A;  3L7U A;  3M2V A;  1RAB B;  2V9K A;  4B17 A;  1FES A;  4F0H A;  3SCJ E;  1U2F A;  3K8W A;  3KLV A;  2XO6 A;  3Q89 A;  1FKP B;  3M7V A;  4NYZ A;  3OJU A;  5IZH A;  4I69 A;  1FK9 A;  3FFI A;  2HG4 A;  1NHU A;  3IO1 A;  3PXG a;  3ISN D;  1OJ4 A;  2JFK A;  2HHX A;  1NK4 A;  3QAU A;  3MPY A;  4U7C A;  2CQ3 A;  2QN6 B;  2GVD A;  3IRX A;  2AP6 A;  1PIE A;  4M5G A;  4I68 A;  1TL5 A;  4OYM A;  4F4X A;  4FS2 A;  3TUI C;  1PSD A;  5HK4 A;  2L41 A;  4EEY A;  2LLZ A;  2XS2 A;  3ILO A;  3IWN C;  1QVF R;  2DNH A;  1N5Y A;  2QL7 B;  5DQH A;  4QYZ K;  1ZTW A;  2ZUG A;  1YJW S;  4EFA C;  4NA2 A;  4USW A;  2YNH B;  1BXN A;  1S6O A;  1WHY A;  1ZTT A;  4R0E A;  3UO0 A;  1F2G A;  5SZT A;  1HHS A;  3HHE A;  3H5S A;  2OTL S;  3EX7 B;  4WKR A;  4B3R F;  3GV7 B;  1SKS A;  2YQ0 A;  3PDN A;  4QIW D;  4ZHR B;  4KAI A;  2NRE A;  2Q66 A;  2B7B B;  2B9X A;  2QYC A;  4IFV B;  2ZBQ A;  4JI7 J;  4DV4 F;  2ZH6 A;  2K1R A;  1YQH A;  3PYF A;  4EUV A;  3FMB A;  4M95 A;  2DNY A;  1SJQ A;  2HND B;  5FDL B;  3PKY A;  4WZQ A;  5CCL A;  3AOC A;  2RIJ A;  2XMJ A;  4PG5 A;  4ZVF A;  1U8W A;  2GJF A;  3QT6 A;  3MR3 A;  5F8M A;  1T05 B;  2DR7 A;  3RRK A;  3OPK A;  4GO7 X;  4DBQ A;  4WYL A;  4WJB A;  4MK9 A;  1TKX B;  1QDU B;  1RZM A;  5HVG A;  3HK2 A;  4ZCI A;  1UPP A;  2RDD A;  2H51 B;  3OFE A;  2DIU A;  4IG3 A;  2AWZ A;  2NS1 B;  1X4E A;  4NE9 C;  1UVI A;  3MR6 A;  4DF4 A;  1L3S A;  3RR7 A;  2M9K A;  1LWC A;  2XWX A;  2B5J B;  1QVG R;  2O66 A;  3PJ9 A;  3DM2 A;  2FJV A;  2LQ5 A;  3K17 A;  4J90 A;  4LSL B;  4B3M F;  3A8E A;  1U49 A;  3OR1 A;  4M5L A;  2ZBC A;  1IKV B;  3QQC D;  2E66 A;  1DLO A;  2XQC A;  4IO1 A;  1X4B A;  4K50 A;  4PYA A;  2G2Y A;  1FDB A;  2R7T A;  3MM7 B;  4D3H A;  3ZXW A;  2ASD A;  2V0N A;  3R7N B;  4DCO B;  3PHE A;  2JZ5 A;  5KFP A;  3BQ0 A;  1KLN A;  4DV7 J;  1N56 A;  5ITH A;  3RB0 A;  1RWU A;  1M5K C;  5DM6 Q;  2ATL A;  1NK7 A;  4WFB Q;  1GX5 A;  4CLZ A;  4PUO A;  2GML A;  3HCX A;  1MU2 B;  3T19 A;  4DUZ F;  1CQN A;  5KG6 A;  5EUH A;  1V5I B;  4OMF G;  2H65 B;  3S7R A;  1BUX A;  1IR1 A;  2MYF A;  3ZZ0 A;  3OL8 A;  4LF4 F;  3GP9 A;  1BC6 A;  3VZI A;  4ZVO B;  3QT5 A;  4WIQ A;  1TKD A;  3CJK A;  2VJU A;  2E5L F;  3OFF A;  5CD4 H;  3NCR A;  4MH8 A;  3CCE S;  3EVM A;  2CPF A;  1YBA A;  1JKH A;  3UCG A;  3OTO F;  2D3O 1;  1N36 F;  1P6T A;  1NUE A;  1U1N A;  1QTM A;  4GC6 A;  2HQC A;  2NZC A;  3CCS S;  3HZE A;  3BQ2 A;  3OTE A;  1HFE L;  4QW9 A;  2XHW A;  4EI2 A;  1M1G A;  4DQQ A;  4OJ3 A;  4HAC A;  1FWP A;  3SCK E;  1B7F A;  1R89 A;  1X9W A;  2WSE C;  1JLQ B;  4PXC A;  4Z7C A;  2HS3 A;  1DTQ A;  3LAL A;  1NU4 A;  2MKJ A;  3CJ8 A;  3R9L A;  4DPY A;  1Q8B A;  3SSS A;  1KHV A;  3NS5 A;  5EGY A;  2KFY A;  2D41 A;  1S1X A;  1U6Z A;  3J7Y I;  2E5H A;  2ZH4 A;  4NZ0 A;  2OSQ A;  1RT2 B;  4AFF A;  4USK A;  1EQ0 A;  1VDH A;  3KLG A;  4PKD B;  2CQ4 A;  1FFW B;  1XK8 A;  2M5Y A;  1CJU B;  3K5O A;  1TVR A;  4DX7 A;  4X4R A;  2H3E B;  1Q8L A;  1XNQ F;  1TL3 A;  3LW5 C;  4UY8 T;  1D3W A;  2QMU B;  5KT6 A;  2KU7 A;  3MZI A;  3VAJ A;  2BKO A;  5DM7 Q;  3M1V A;  4FDF A;  2VFR A;  2XMT A;  4QW8 A;  3W2W A;  3RRG A;  3MOJ B;  3NGS A;  1WC3 A;  1NB7 A;  4PQU B;  5G0R B;  4DV1 J;  4DL6 A;  2XMA A;  1X60 A;  2HHH F;  4B3R J;  3HKW A;  2YNF B;  4YB1 P;  1S1W B;  4WK1 A;  2CPY A;  4TVA B;  1WDT A;  2CNL B;  4ILM A;  3SFG A;  4OV1 A;  1W25 A;  3H20 A;  2ZDP A;  3DLG B;  1IKW A;  1NK0 A;  2VOO A;  4DV4 J;  1S6Q A;  2HIQ A;  1M5O C;  2E5J A;  3W5Z A;  4GVL A;  1TL1 A;  4KRW A;  3KMQ A;  3DYA A;  3TQE A;  3R7B B;  1U7L A;  4IH7 A;  2ZWP A;  1LW2 A;  4PWD B;  9RUB A;  2N3O A;  4TKT A;  2DXD A;  4RWW A;  4FYY B;  1SQE A;  2K3K A;  1S48 A;  4ZIV A;  3NRB A;  2K8G A;  1IUJ A;  3GYX B;  3G8T A;  3DNC A;  1R6Y A;  3B8H A;  2IVM A;  3CNQ P;  4L74 A;  5K14 A;  1RYS A;  2Q1L A;  1HBM A;  1WNE A;  4QCL A;  2M52 A;  2KTQ A;  2BX6 A;  2VH7 A;  1GH8 A;  2IVF B;  2EI5 A;  1B99 A;  3M2R B;  2CNO B;  3HHN B;  4Q44 A;  4Q2M A;  3N5B A;  4B3M J;  2KN4 A;  4I0W A;  2RB7 A;  3EPG A;  3NEK A;  2NSB A;  3SFU A;  2P6T A;  2BE2 B;  5F3T A;  3I4P A;  2EK1 A;  3KLI A;  2YH0 A;  3E01 A;  2X1B A;  5KFO A;  3IR7 B;  4OZ1 A;  2WBM A;  2ZFH A;  4AE5 A;  3HVW A;  2DH9 A;  1UWB A;  2VFU A;  2AEJ A;  2E7W A;  1ZH5 A;  4IQX A;  4USV A;  2VHG A;  4K4U A;  1FXL A;  3M6W A;  2Y1R I;  3KLF B;  1ELO A;  1D0E A;  4RW9 A;  3TUZ C;  2DNL A;  3JSY A;  2CJQ A;  2RIL A;  4DLG A;  4K4W A;  1PJ7 A;  1LWE B;  5KFZ A;  1B0T A;  3JAM U;  4DUZ J;  4KH0 B;  1RLD A;  5DG7 A;  1F9F A;  2FQQ B;  4RW8 A;  1U0H B;  4NXM F;  1FKO B;  4KPC A;  2QE5 A;  4LF2 A;  4O0I A;  3DOM B;  2VG6 B;  4LRF A;  4RW7 A;  4M5M A;  2A3J A;  2W25 A;  2LEP A;  1YI2 S;  2GIF A;  5D0R A;  4B3O B;  3D6F B;  2E5L J;  5B7W A;  5H9F K;  2HMI A;  1S9E B;  3T1Y F;  2AYE A;  2VF3 A;  2W9B A;  3WIV A;  1MRO B;  3OTO J;  4C3L A;  2HYI B;  4YDX A;  2XSF A;  1NCL A;  4ZVQ B;  1T0T V;  3I4H X;  2I1R A;  4I56 A;  3S8S A;  1X9S A;  1AUS L;  4IH6 A;  4ELU A;  5D4O A;  3M8Q B;  2G9O A;  3LAN A;  4RW6 B;  4L76 A;  1XC9 A;  2YPY A;  4U95 A;  4DL7 A;  2D3O R;  3BGO P;  4OZJ A;  4J91 A;  3TAQ A;  3UCZ P;  3D67 A;  3BH7 B;  1VIO A;  2VC1 A;  4G6V B;  4BDP A;  4F36 A;  2I8E A;  1S7H A;  1VK3 A;  3KK1 A;  2AYB A;  4RKU C;  1TAQ A;  4ED6 A;  3JTP A;  3LP2 B;  5RUB A;  2HZC A;  3EZU A;  4O4R A;  4A8W A;  3VAK A;  1SC1 B;  4F4Y A;  2IAJ A;  3TZW A;  3ELH A;  4Y2I A;  1CC8 A;  4CLS A;  4HT7 A;  4NWB A;  1XNQ J;  5HJX A;  3C3L A;  1A0O B;  1IKY B;  2O01 C;  1FI4 A;  1NK5 A;  2CPH A;  2FZC B;  1C1C A;  4IOA Q;  5A0Y A;  4OZN A;  1FDN A;  1XMO F;  2BJ7 A;  3A3P B;  3PEH A;  2HLT A;  3CPW R;  1S5Z A;  4NLU A;  2XUL A;  2Q79 A;  2DJW A;  1JK9 B;  3H59 A;  3A8K A;  1SPB P;  4NEY A;  1FRX A;  4CO4 A;  1UVJ A;  5HVH A;  2DRD A;  3LP0 B;  2NPF A;  4DPO A;  2IBK A;  4PCQ A;  1SKU B;  5I3U B;  2K2P A;  1VHI A;  1UFK A;  1HWU A;  4MKB A;  2YNG A;  3V4I B;  4C8L A;  4N76 A;  4AND A;  3D28 A;  4X4U A;  4LSN A;  4RR5 A;  4B08 A;  3HSZ A;  3KG4 A;  2WW8 A;  1N5V A;  2CQP A;  4HI1 A;  5HP1 A;  2NCK L;  2A1B A;  3WHI A;  1YLX A;  2CG4 A;  3I87 A;  3Q8U A;  4RU9 A;  5CQG A;  3VF0 B;  2BAN A;  5IV3 A;  3OHB A;  5L1K A;  2E1R A;  1YG0 A;  1X5S A;  1AFJ A;  2C2K B;  4QIG A;  3BSC A;  3NNA A;  5T14 A;  1H74 A;  4YB6 A;  1U47 A;  2V63 A;  1NSA A;  4MAK A;  1GMV A;  5CYM B;  3R7S B;  4ECV A;  3ENQ A;  3EZ5 A;  2UXD F;  3OR2 A;  2LMI A;  1S6P A;  1EET A;  3BH6 B;  4LRB A;  4HR2 A;  2N7C A;  2QG9 B;  4I2P B;  3D4J A;  1SVD A;  2QMX A;  1EKS A;  2AHO B;  3VAF A;  3J7Y U;  1TFY A;  5IC6 B;  2FTR A;  3DRR A;  2V4J B;  4HHH A;  2VV5 A;  1M90 T;  2CZ4 A;  4P9S A;  2VFT A;  4OYA A;  3WX8 A;  3M8S A;  4CI0 B;  1RWP B;  3P6Y C;  3CUL A;  3KHH A;  5ETK A;  1ZYQ A;  2A18 A;  3SDE B;  4C8O A;  4YY3 F;  3R2D J;  1J2V A;  3K0J A;  4NXM J;  1FEH A;  1U6B A;  3JSM A;  3CIZ A;  4LR8 A;  1HBN A;  4I2Q B;  3CDU A;  5AXL A;  2MKC A;  4OX7 A;  5HVF A;  2W7O A;  4X4Q A;  2IMO A;  3CCZ A;  2RKI A;  2H1Y A;  3EM1 A;  3MEK A;  4LF8 F;  3BS9 A;  3JYT A;  3T1Y J;  2CNK B;  3G8S A;  1J5O B;  1VQN S;  5BR8 F;  1PYO B;  4N77 A;  1JLB A;  1SUQ A;  2J7W A;  3EMT A;  4MK8 A;  4IH5 A;  2DGS A;  2Y1I A;  3IWX A;  1XR6 A;  3CCL S;  5DDP C;  5LL6 d;  4Y6I A;  1VBX A;  4DU8 A;  3GYN A;  4NYO A;  4X4O A;  1RU1 A;  2WSF C;  1HQU A;  2RDI A;  2YKQ A;  3JQJ A;  2Z0G A;  3HX9 A;  3A8J A;  2ZD1 A;  3CIM A;  3CJS A;  3Q2S C;  2HQ3 A;  2WOM B;  3M30 B;  1DAR A;  1D1U A;  4FPI A;  3M32 A;  1H98 A;  4R8U A;  5KFC A;  5DQI A;  1OMS A;  4NI2 A;  4ZMM A;  3OUY A;  5GMK a;  5J1N A;  2YKN A;  1IBK F;  3TP2 A;  4ATN A;  1ZA1 B;  1M5V C;  3GIK A;  2B9Y A;  3PW5 A;  3EJM A;  3BPS P;  4GO5 X;  1RYR A;  3QJJ A;  3FEX B;  1SIW B;  3C66 A;  1H7X A;  3QNW B;  3JAM Y;  3CJQ A;  2W9A A;  4P2F A;  1S0M A;  3G86 A;  4G1Q A;  2OD6 A;  3MXH P;  2M4M A;  2EFQ A;  2M3D A;  2DK2 A;  2KT3 A;  4DR5 J;  3BGR A;  3B54 A;  2BJ1 A;  3Q24 A;  1RTZ A;  1YZ7 A;  1F5C A;  3UN3 A;  1HPZ A;  2GQC A;  2KJV A;  3G71 S;  3QSY B;  1NPP A;  3NNH A;  2HHQ A;  4PWU A;  4ZIW A;  1DRZ A;  5KFB A;  4O3S A;  1C0T B;  4C11 A;  3THP A;  2KKH A;  1P1T A;  2E1A A;  4ECS A;  2FLO A;  5F8L A;  1JJ2 R;  3PVX A;  4ED4 A;  5IV4 A;  2DNZ A;  3LPY A;  3C8Y A;  1RTH A;  5L9N A;  4ZCM A;  5KFJ A;  2ZIT A;  3KKF A;  1WC4 A;  3QWU A;  3WX4 A;  1Y4Z B;  2SXL A;  4OIX A;  1UEU A;  3FMW A;  2PMZ D;  1H73 A;  3OL7 A;  1MSW D;  4JI0 F;  2IRX A;  3JTN A;  1VRT A;  2HNZ B;  4DR3 F;  4NLQ A;  3O8W A;  3KHL A;  5I42 A;  3G2X A;  4RO0 A;  3Q8R B;  2OML A;  2PC6 A;  2W9C B;  4IR1 A;  2F8E X;  4OZ5 A;  3BBF A;  1PAU B;  1WJ9 A;  4DSF A;  4Q2L A;  5F3Z A;  2H4W B;  3SV3 A;  3DLK A;  4PG7 A;  3ZTO A;  2RH3 A;  4OYO A;  1MW7 A;  1H72 C;  2YWF A;  2YBV A;  2RQC A;  3IS9 B;  3VHQ A;  3EVW A;  3QRR A;  1IKX B;  3Q2T C;  4NL5 A;  1KBR A;  1TTH B;  2MZT A;  3AJD A;  2AKW B;  1HWL A;  3IG1 B;  2CZ9 A;  1FVQ A;  4WFX A;  2ZC3 A;  2UXD J;  2XCA A;  4C7Q A;  1RIS A;  2VG5 A;  2ZHO A;  4DLE A;  4Y00 A;  3DGV A;  1S4E A;  1YVF A;  1KOO A;  3HHL A;  1ARO P;  4DMZ A;  1HBO A;  2OD4 A;  4ECW A;  1X5P A;  2HQF A;  3HPO A;  2F65 A;  1N5T A;  2NQP A;  3CC2 S;  4K5R A;  1DHM A;  2RRA A;  3GG0 A;  2J8A A;  2WHO A;  1YGY A;  3M4X A;  2AW0 A;  2HVZ A;  4LF6 F;  3T1H F;  5C25 A;  2Z4P A;  5KFL A;  2AJ4 A;  3GCX P;  2YKM B;  4Q0B A;  3QAT A;  3ITH B;  1R6V A;  1C0U A;  1VGY A;  4OYZ A;  2B4O A;  4YY3 J;  4CYU B;  2I9S A;  5EHH A;  1WWH A;  1YZ6 A;  4X65 F;  2HHW A;  2C3P A;  5D4L A;  2VA3 A;  4P52 A;  3QRQ A;  2PEB A;  3M8Z A;  3FSX A;  4XTT A;  3CVK A;  1WSV A;  3FZ2 A;  4NRT A;  4URQ U;  5LT5 A;  3OW2 R;  4NCG B;  2KFN A;  3GFX A;  1JLE B;  4DU7 A;  4LF8 J;  2JC1 A;  1B64 A;  4WXO A;  4IRK A;  5IM0 B;  2OPP A;  5BR8 J;  1FCA A;  5CYQ B;  3QO9 A;  2UXC F;  2WW4 A;  5LJ3 Y;  3AJ2 A;  4YP3 A;  2OEK A;  2VQE F;  4O4G B;  4EK2 A;  4H4M A;  5F8I A;  5CAA A;  2X1G A;  3M8W A;  5IC4 B;  5B0E A;  3O3L A;  2HGM A;  4ZLL A;  4KFB A;  1Y7P A;  4V19 X;  4M5D A;  3CJT A;  2MGZ A;  5ETT A;  1SJ3 P;  4I6Y A;  5T7L B;  5F8G A;  1BE4 A;  1PJ6 A;  5LXR A;  2VG7 A;  4H4O B;  4C0B A;  4FVC A;  2GO9 A;  4F4W A;  2FLN A;  4LVO P;  1FWL A;  1YJ7 A;  3R1L A;  3GQC A;  2WAQ D;  2W2P P;  3PYG A;  4DQI A;  4HL9 A;  2XO7 A;  1IBK J;  3K59 A;  1WOP A;  5AT1 B;  1J5E F;  3VTI A;  3D0H E;  2KZM A;  3QYY A;  4FF1 A;  3FK4 A;  4J9P A;  1F5B A;  4KKO B;  1B7Y B;  3FEZ A;  2RF2 B;  2V2Q A;  2R7X A;  1GEH A;  2BV3 A;  5KFY A;  3CCJ S;  1EP4 B;  5CCM A;  2MQN A;  2RSQ A;  4MYU A;  2YWG A;  3MEC B;  3GR0 A;  2FYX A;  5A8K A;  3W62 A;  4FYD A;  4HI2 A;  1RA6 A;  2KXF A;  2YNI B;  2LQB A;  4PG8 A;  1ITP A;  3CD5 A;  5KFF A;  4WTO B;  4I1T A;  3KG0 A;  1U2R A;  2A0F B;  3OLA A;  4UUX A;  3EGN A;  3KTQ A;  3HT0 A;  3GIR A;  3Q8Q B;  1ZOT A;  2HBR B;  1NJW A;  4DR6 F;  1YJR A;  4UT4 A;  2Y0S D;  4OYP A;  1VRU A;  2KVQ E;  1U1R A;  2DPJ A;  5HMW A;  5EX3 A;  4OHW A;  3X3U A;  3K5M A;  2KG1 A;  2VIC A;  1SH2 A;  1S10 A;  2BAB A;  1QUV A;  4JI0 J;  4ELV A;  4DN0 A;  2CNN B;  4ES1 A;  4ID5 B;  3R5A A;  3EUN A;  3QLH B;  2XGQ A;  3UD5 A;  1AZS B;  2DD8 S;  2FLL A;  3M9O B;  3AOA A;  1Q82 T;  1VQ8 S;  1KFS A;  2JVR A;  4PXB A;  3T5H A;  4K4T A;  4DUY F;  3FZB A;  1VIX A;  4A8Y A;  4NLT A;  1RWN B;  4QWD A;  4ECR A;  1WAC A;  4J7C A;  1L3K A;  2DHS A;  1TQL A;  2X3D A;  2M8D B;  3WDO A;  1Q53 A;  4KHP F;  1LWF B;  3D9B A;  1XMQ F;  4ED8 A;  4WFN Q;  4DHV A;  4F26 A;  3KHG A;  3G9C A;  2G1D A;  1HHQ A;  2J9C A;  2V68 A;  2VPY B;  1HYS B;  1QE1 A;  4JV0 A;  3WC2 A;  1DTT A;  2V8H A;  2DVI A;  2IVY A;  3Q8P B;  2DYA A;  3LWL A;  1LW0 B;  3LGH A;  2OPS B;  3N6M A;  3QJP A;  2BE7 D;  4DG1 A;  4ZPB A;  2KH9 A;  3KLH A;  4EYI B;  1UPM B;  4U7U K;  4QPT A;  3CMA S;  3MCN A;  1HNV B;  4YB7 A;  4I7F A;  3W8G A;  1D9A A;  1OIA A;  3PTW A;  2HS0 A;  4LF6 J;  2P9C A;  3FQL A;  4ENO A;  2V6A A;  3NGU A;  3QBC A;  1MMN A;  5L46 A;  2MQL A;  3UCU P;  3GZ7 A;  3W9H A;  4DFK A;  1R0B G;  2AZ3 A;  4IO9 Q;  4LR7 A;  5LM7 E;  4CLT A;  2EVZ A;  4C0H A;  2Z2M A;  2E9T A;  2HHS A;  2D69 A;  5HMZ A;  3UQS A;  3UR0 A;  4R5P B;  1KR4 A;  3N6N A;  2M2B A;  2RS8 A;  2B8Q A;  1T03 A;  3MED B;  2L9N A;  4RUH A;  2RQK A;  4ZA1 A;  3R6G B;  2EW9 A;  2B8P A;  4X64 F;  5HMX A;  1Q8K A;  1KEK A;  2GMJ A;  2HBY B;  4OZ2 A;  1GMU A;  1CEZ A;  3EXY A;  4J9M A;  1OSC A;  3CWJ A;  1TKT B;  2UXC J;  3A13 A;  2AEF A;  1FJG F;  2VQE J;  3PRV A;  3S6E A;  2XSJ A;  1TV6 A;  5KFT A;  5KT7 A;  1EAR A;  1SQF A;  4OX8 A;  4DSE A;  3UNY A;  2DY1 A;  1MWQ A;  4TY8 B;  2CPZ A;  1Y11 A;  2YQ3 A;  4LQ9 A;  4DX6 A;  5A6P A;  3H2L A;  3GJT B;  1RT1 B;  3DU6 A;  5KFS A;  3H98 A;  3AXK A;  3FKB A;  1JJC B;  3EYZ A;  4NLV A;  4XIU A;  5A8W A;  4O3R A;  2JNJ A;  4JV1 A;  1GFW B;  3Q83 A;  3QIP A;  5K20 B;  1J5E J;  3EGZ A;  2A6M A;  1UJ4 A;  2XMU A;  1PCA A;  3MOZ A;  3C14 B;  2QLX A;  4NLY A;  4DSI A;  2BAC A;  1HI8 A;  4DWI A;  1FKP A;  4DFP A;  4DXL A;  2F63 A;  2FJB B;  3KJN B;  1HD1 A;  2HSE B;  3ISN C;  1GK8 A;  5K8N A;  3HVA A;  2LQ8 A;  5HO4 A;  2B3T B;  1Y5I B;  2ZBR A;  2YWE A;  3CED A;  4F04 B;  3KK3 B;  2ZOG A;  4USM A;  1RWO B;  2MZS A;  3DHX A;  5K9F A;  2B4P A;  2AEM A;  1S76 D;  3D54 A;  3MDF A;  5KFM A;  2V69 A;  1ZAW A;  3ADA C;  2ERR A;  5D6G A;  4TLR A;  2CDQ A;  3MM6 B;  4RW4 B;  3R5C A;  3TQ1 A;  3IAS 9;  4DSJ A;  3MEG B;  2HGN A;  1QSY A;  3I6P A;  1H2T Z;  5B0B A;  4N7T A;  3RYL A;  2QL5 B;  1FNO A;  2V8D A;  4JV2 A;  2GCF A;  3I32 A;  3KYL A;  2QIF A;  4AL7 A;  2YNH A;  2AD9 A;  2N7Y A;  2ZEJ A;  3THT A;  1RT5 B;  2AJ1 A;  1TP7 A;  2VBX A;  2Z2L A;  3X1L B;  5DDO C;  1TK5 A;  2FZG B;  3PRD A;  4DX8 H;  4X4V A;  2JEG A;  2V50 A;  1GTE A;  2CJK A;  2XLK A;  4F2R A;  2X7I A;  2ZHA A;  5IXU A;  3AQO A;  3J7Z 5;  2R2S A;  1BQM B;  1CJT B;  4DUY J;  4ZHR A;  1TKZ B;  2W2M P;  3VZH A;  4IFV A;  3TZX A;  3OT9 A;  4KHP J;  3AA8 A;  2PN6 A;  1XMQ J;  1SIZ A;  2H48 B;  4AYB D;  2V34 A;  2HND A;  5FDL A;  2KT5 A;  4HKQ A;  3BBC A;  1FTR A;  4A8M P;  2MZ1 A;  3HD2 A;  1T05 A;  2HKE A;  4MT1 A;  1WHV A;  4DX5 A;  2IJN A;  4LRE A;  1JWW A;  4O3O A;  2MY7 A;  1HWJ A;  1O51 A;  2IM0 A;  3C16 B;  1FER A;  2ADB A;  2BKN A;  2B5J A;  1GT8 A;  1OWX A;  4LSL A;  1PAE X;  4QPX A;  1KVI A;  3FBF A;  1IKV A;  5E3Q A;  4DSL A;  3FCW A;  2HVI A;  5KFW A;  2K06 A;  1TL7 B;  1KRP A;  4NAS A;  3MM7 A;  2R42 A;  4F0M A;  1SC4 B;  5KFV A;  3PG9 A;  5J2P B;  1RWK B;  1WC5 A;  4IFY B;  5HI7 A;  2CKW A;  4U8Y A;  5IOL A;  4Y28 C;  3JTO A;  1UWA A;  1NKC A;  1S6U A;  4WE1 B;  2NYI A;  1V3S A;  3BV8 A;  2DGU A;  4X64 J;  4RL1 A;  1T9T A;  4MK7 A;  2NR0 A;  2WB4 A;  1U26 A;  4CTA B;  1U6F A;  5G4D A;  3ZZT A;  1MU2 A;  1RHK B;  3I55 S;  4M1K A;  4ZVU B;  1FJG J;  4Y2M A;  3T6B A;  4O44 B;  4K4X A;  4DFJ A;  2VL1 A;  2HFU A;  3POT B;  1ROF A;  1ZAV A;  4NLP A;  5AE1 A;  2WVE A;  3P3D A;  2AZ1 A;  3N9U C;  3KJF B;  2V2K A;  2I0X A;  2HFS A;  2MXY A;  3AB2 B;  5C2G A;  2OPQ B;  3HP6 A;  3FBE A;  4M5N A;  4KH1 B;  3MFI A;  3VVT A;  1LFW A;  1Q5Y A;  4XO0 A;  1S1U B;  2FDN A;  3GFH A;  3JSB A;  2VDH A;  3KUH A;  4LRD A;  3TA0 A;  3PRB A;  5B0A A;  5CD4 A;  3U7J A;  4W92 B;  3MGJ A;  3MM8 B;  2DPI A;  1SC6 A;  2C3O A;  1C1B B;  3MFH A;  4ER8 A;  4B9S A;  1HAR A;  2FGO A;  2R8K A;  4MFB B;  4JB8 B;  3NGK A;  4FYV B;  4UOG A;  1Y00 A;  4LR9 A;  4ZN1 A;  3N4W A;  3KXD A;  2YPZ A;  1JLQ A;  3EIC A;  5KTQ A;  5D77 A;  2QT7 A;  2UXB F;  2A2C A;  4USJ C;  1FTC A;  2NXU A;  1RHQ B;  2ZJP Q;  2DR9 A;  3SQG B;  4DJB A;  4U8V A;  2EKN A;  4ZLJ A;  1I1G A;  2GJ2 A;  3NG8 A;  2CQD A;  1NK8 A;  1RE1 B;  4LRA A;  4JBC A;  2Q3P A;  3QSI A;  1OO0 B;  4DQP A;  1RBA A;  1RT2 A; 
#chains in the Genus database with same CATH homology
 4CLW A;  4CLK A;  4OZ2 A;  3UVJ A;  1YK9 A;  4NI2 B;  4WP3 A;  3C15 B;  4OYO A;  1WC3 A;  4OYB A;  4OYW A;  1CUL B;  3MAA B;  4UST A;  5D0R A;  1CJU A;  4OYP A;  1CS4 B;  4P2X A;  1CJT B;  3G82 A;  4CLZ A;  1YBU A;  4USU A;  1TL7 B;  4OZ3 A;  1WC6 A;  4OYA A;  2W01 A;  1AB8 A;  4CLS A;  3C14 A;  2GVZ A;  3C16 A;  2QV6 A;  1CJV B;  4CLU A;  1FX2 A;  1U0H A;  1WC0 A;  3ET6 A;  4USW A;  1WC5 A;  4WP9 A;  3R5G A;  2GVD B;  1Y11 A;  1CJK B;  1AZS B;  2WZ1 A;  5IV4 A;  5D0E A;  4NI2 A;  1YBT A;  3C15 A;  4CM2 A;  1WC1 A;  4CLP A;  1CUL A;  3MAA A;  4USV A;  4CLT A;  5IV3 A;  1CS4 A;  4OYX A;  1CJT A;  1WC4 A;  3UVJ B;  4CLY A;  1TL7 A;  1CJU B;  3G82 B;  1FX4 A;  4CM0 A;  1Y10 A;  1CJV A;  4CLF A;  4WPA A;  4P2F A;  3C14 B;  5D15 A;  2GVZ B;  4OYI A;  5D0G A;  2GVD A;  3C16 B;  1CJK A;  3MR7 A;  4WP8 A;  1AZS A;  4CLL A;  1U0H B;  3ET6 B;  2BW7 A;  4P2M A;  4OYM A;  5D0H A;  4OYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...