3G82A

Complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with mant-itp and mn
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
189
structure length
189
Chain Sequence
MMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVREMTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLSYLNGDYEVEPGCGGERNAYLKEHSIETFLIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title 2',3'-(O)-(N-Methyl)anthraniloyl-inosine 5'-triphosphate is the Most Potent Adenylyl Cyclase 1 and 5 Inhibitor Known so far and Effectively Promotes Catalytic Subunit Assembly in the Absence of Forskolin
rcsb
source organism Canis lupus familiaris
molecule tags Lyase/lyase inhibitor
molecule keywords Adenylate cyclase type 5
total genus 57
structure length 189
sequence length 189
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2009-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 3g82A00
1CJTB 4OYAA 4OYOA 1YK9A 4OYMA 3ET6A 1Y11A 4CLUA 4CM0A 4WPAA 4CLSA 4WP8A 4P2MA 2WZ1A 1WC3A 4P2XA 3C15B 1CJUA 1TL7B 4CLLA 4CLFA 1U0HA 5D0GA 4USVA 1YBUA 1CJKB 1CS4B 1WC1A 4WP9A 1YBTA 4CLZA 5D15A 1CJVB 2GVZA 1CJVA 3C14B 1FX4A 3ET6B 2W01A 3UVJA 4OYIA 3C16A 1CULB 2GVDA 4NI2B 1WC4A 4WP3A 1WC6A 1CJTA 1AZSA 4USTA 4OZ2A 1TL7A 4CLKA 3G82B 3UVJB 4CLPA 4CLYA 5IV3A 4OYPA 3MR7A 1AZSB 4OYXA 4CM2A 1WC5A 1CJKA 3G82A 4CLWA 1WC0A 4OYZA 4P2FA 5D0EA 4OZ3A 4CLTA 4OYWA 2GVZB 4USWA 5IV4A 3C16B 5D0RA 1AB8A 3C14A 5D0HA 3C15A 1Y10A 3MAAB 1FX2A 4OYBA 4USUA 2BW7A 2QV6A 1CJUB 1CS4A 4NI2A 1CULA 2GVDB 3R5GA 3MAAA 1U0HB
chains in the Genus database with same CATH superfamily
3IWXA 2CADA 5DETA 3KLFA 2ZH6A 3LP1A 4X4UA 1F2HA 1MW7A 4WE1A 5KFXA 3MR3A 2QIFA 1QAXA 4TN2A 4OI2A 5ETNA 3OL7A 2UXBF 1I5OB 2FVSA 1CC7A 4NPOA 1U8SA 2JH3A 1XMQJ 4ZVHA 3W66A 3UPFA 1TK5A 2D9OA 3KNAA 5FIIA 3GQCA 2BJ8A 9RUBA 1S76D 1X60A 3GWCA 1BQXA 1OQ6A 1NHVA 3BQ2A 5L1KA 4A46A 1YJNS 3Q89A 2HNZA 4LRAA 2J0XA 2YKNB 2UUTA 3VF0B 3OTOF 3K59A 3D1QA 2JJ4D 4QCLA 3J81U 4ICLA 3ZZTA 2H48B 3UO0A 1VBZA 4F67A 4K2XA 4O23A 3D2WA 4F2RA 3M7VA 3MMAA 4YEAA 3G8SA 3SQOP 3ZZZA 2LFVA 3GIRA 3K89A 2ZM6F 2V6AA 1U2CA 4DBQA 1SUQA 3FC9A 4CO0A 3J7ZT 2JEGA 1JQGA 3BO4A 1NAQA 3QIPB 5A8RB 3MF5A 2KO1A 3HFZB 4B9UA 2CUYA 5DGAA 4BS2A 4WKRA 4CO1A 5A76A 2CG4A 4DUYF 1YBUA 2CQ3A 2XMUA 3GIJA 4QYZK 2J8AA 1RHKB 1ZAVA 3OL9A 1HNIB 1WI6A 3DDKA 4DPTA 1U1LA 2ZE2B 2C3OA 3NOCA 1SC6A 1IBKJ 3ILIA 2ZDPA 3DLGB 3MPVA 3PW7A 2Z2YB 3K5PA 2C2DA 4J7CA 1IQZA 4EBEA 2HYIB 4NE9C 3LF0A 5K8NA 2UUCJ 5THWA 4RW6B 3VGVA 3IFEA 4W92B 5EX3A 1EAYC 1X4EA 4H4OB 2VPZB 4Q2MA 3SCLE 1DRZA 2VBWA 1VQ8S 1C1BB 1A6LA 2MDAA 1EETB 1JIHA 2BKOA 4URGA 4DR7J 3CJ8A 4G6VB 5BXIA 1A9NB 2KXFA 2ZKUA 2A1BA 2DXDA 1B0TA 2B9YA 2BVZA 3VGSA 2E5IA 3FZ2A 3HHLA 5C24B 4RU9A 3H59A 1PILA 3MEKA 2W7PA 2RDJA 4JP8A 4B9MA 4LF4F 4OZ2A 2QMWA 1RAEB 4C0OC 2PO4A 5AXLA 3I0RB 3AB4B 4P75A 2MKJA 2XY6A 2COLA 4KYZA 4CLYA 5C2GA 5KFBA 2A2DA 4LF5J 5U47A 1XNQJ 2ACYA 1FVSA 1R6VA 4H4KA 4DV1J 3K8WA 3RB0A 5IT9U 2LQBA 3H8YA 1Q4RA 6FDRA 5IT0A 1FRLA 1FRMA 2ZH2A 2WW8A 4AL7A 1FWLA 2W4CA 4A8YA 1N88A 3PHEA 1UETA 2GA7A 2YQ0A 2IM1A 2ASJA 3CC7S 1YZ6A 2KI2A 3FCHA 5E3RA 2QRRA 5K8MA 1N5YB 4B3OA 1S1UB 4CO4A 2R8HA 7FDRA 3QRPA 2W9CA 3OL8A 5A2QU 2HHXA 2KZMA 2U1AA 3AA8A 4A8XA 2XS2A 3FNNA 2VQFF 1U25A 3KK2B 1IVZA 4EUVA 3IS9B 1LQ9A 1Z2ZA 1FTRA 2F3JA 3JTPA 3RW7A 2NLWA 4IDKA 2ZH7A 3HJVA 1WOSA 4DR3F 4UQGA 2UXDF 3X1LB 1AB8A 2R2SA 3DRSA 3IG1A 5A0YB 2J6UA 3ZNUA 4LR9A 3M9OB 4ZPVR 1FK9A 1BUXA 2F40A 4ZP8A 3OW2R 1LWCA 1X0PA 1ZPWX 4ZKAA 4X62F 4KGVB 3UCZP 3QRQA 1HWKA 5D3GA 2BW7A 1PG5B 4ED8A 3G8QA 3PACA 3R7SB 2PIIA 5ETOA 4B3SF 1HI1A 1B7YB 1HBNA 2OFHX 1N34F 2E9TA 1TL5A 3MR6A 3CDEA 2FGOA 4X84A 3J7A1 4OL8A 3EUNA 5C2CA 4F0KA 4RNHA 2RQCA 3GJRB 3TUJC 4K4TA 2V9WA 4DL4A 2VOPA 2NSCA 4HTJA 5LMUJ 1FD8A 1SL1A 1IKXA 3LGHA 4RUCA 4ECYA 3SMZA 1RWKB 2D9PA 1HARA 1KP6A 4OLPA 1T05B 3RR7A 1IKWA 1WTBA 4LF5F 1VQOS 1IR2A 4LF9J 4HKQA 1FCAA 2B5JB 2CQ2A 2I1RA 4DV6F 2BUNA 5EX0A 3UQSA 3D0HE 1UJ4A 2AGPA 2CFXA 1U26A 2HZVA 1RTDB 1WF0A 4MYUA 3VAGA 3UD3P 3RBZA 3HT0A 1TAUA 2QLWA 3GIIA 4UF4A 3J81Y 1TL7B 1PO6A 3DLHA 2EBGA 1U48A 4RW4B 4ZS6A 1FXDA 3BPSP 3E01A 1XR7A 3ISND 5DDPC 3BGRB 4DUYJ 4IQXA 2RVJA 3DXSX 1JLFA 3KUHA 3OSNA 2OKQA 3LH2S 4ZPAA 4QWAA 4DV5F 4KHPF 3ZFVA 4V19X 3C6UA 1FERA 2A6MA 3FEYB 2UV8G 4GO5X 2GZOA 4C11A 4F04B 4ECQA 3AQOA 1Q8KA 1RTZA 2DO0A 3T5JA 1JJCB 3N6MA 5GAHI 2XLJA 3VZHA 3N79A 3F73A 4B3MF 2V4JB 2VFRA 3C14B 2RF2B 3UDLA 1V3SA 3EVOA 4F4AA 3D67A 3T5LA 2IIHA 1ZYQA 4HACA 1FDBA 2O1PA 3OHAA 3W60A 1RLDA 3NXZA 1UWAA 4EBCA 1TVRA 1M90T 1BMQB 3MEGA 1Y0HA 3T1YF 5LSOA 1FWKA 1NPPA 2VDHA 3DMJB 5K8PA 2BANA 2CPFA 4ZVQB 2VIHA 3TW0A 1Y5IB 1UPMB 2YY3A 4OV6A 4N47A 1UW4A 2BE7D 3UVJB 2JL9A 2OPSA 4V1Ak 3VGTA 1XTZA 1OY8A 2HHTA 2MJNA 2DK2A 4PABA 5DZ6A 4QQBA 4ZVRB 3QIPA 4QPXA 4CYUB 2CJAA 2CKWA 4ZJLA 3ISNC 4OZ1A 3TWZA 4GKJF 3JYTA 1PKUA 2WVBA 2XNRA 1WC0A 1Q0NA 2DCLA 1EETA 1RISA 4YY3F 2BOAA 1UVMA 2BM1A 1WELA 4M5MA 2YKNA 4KO0B 4PWWA 4CYUA 1NPKA 1MSWD 3G96A 3ICLA 2WTFA 1EX8A 1IUJA 3PW4A 3D66A 1FTCA 3UN2A 2X3GA 4C98A 1NKEA 4R8UA 1QY7A 4DI6A 3FK4A 3K5LA 3J80Y 4BC9A 1ZA2B 3VQSA 5KG4A 4DSIA 4DV5J 3HLUA 5DM6Q 1LFPA 4R5PA 1HBUA 4ZOSA 2KXNB 4XDDA 2ERRA 1M1HA 3CWJA 3PKMA 2ZC3A 4UY85 2OPRA 3PKYA 3W65A 5J2MA 2IBKA 2ZBQA 1HWIA 2KM8C 3GFYA 4PWUA 2FVQA 4KKOB 2DNZA 3A3NB 1RQ0A 1VS3A 1IM4A 4FYXB 5IWAJ 3M9NB 4RWWA 4J9LA 1T05A 1YJWS 1RAGB 4OYOA 1AT1B 4OZ5A 1GXUA 2FPHX 4QR1A 4D3HA 2RRBA 3BJYA 1RBOB 3NEKA 4HHUA 2OI2A 1NRKA 1KC8T 3DLLQ 3C6TB 3PO4A 3T1HJ 4N77A 3I82A 3S01A 2OMOA 3M8QB 3W9IA 2D3ZA 3IAS9 3NKYA 3SDEA 4K4XA 5HL7Q 1G3OA 4WU2A 2FQQB 5EUHA 1KQFB 4F7VA 5HANA 2W7OA 2M3DA 1NHKL 1RWNB 4ECSA 1QM9A 1P6TA 1Y5LB 4ES3A 5L39A 3PY8A 4ECZA 4RKUC 2LYVA 2KB2A 3I0SB 4JBCA 1QVGR 1VR6A 2CQBA 5T7LA 4JV1A 2RDIA 3ZZYA 2V8DA 2YWWA 2J7UA 4FXVA 5KAKA 4M5LA 3T9NA 3HSDA 2FZKB 2YWEA 4ZVUB 1ACMB 3M8PB 1R43A 1WKLA 4AUKA 4ZMMA 2W9AA 2L3MA 4KQZA 2HIYA 2RSQA 4JV2A 4LF8J 5IC6B 3E8OA 3S7RA 3VZIA 3THPA 1L3KA 2V9KA 4QBUA 3GJSB 2W4DA 2WVFA 4WIQA 1REGX 1QVFR 4N7TA 2BZ2A 2NZ4A 3R97A 5HMWA 1Y3KA 4HYKA 1X5SA 2DGUA 4P71A 4ZLJA 3VVUA 3EVMA 2ILZA 4G65A 4O0NA 1CBKA 1DHMA 2AZ3A 4FF4A 2QLBB 3FCWA 3W9HA 3BYPA 4J9PA 1R31A 1QAYA 1UVJA 4KTQA 5DM7Q 2W01A 4HT5A 4AFFA 6FD1A 1R6YA 2KFZA 2IMOA 3SV3A 4DR2J 4C8NA 2VU5A 3MCSA 4WP3A 3CVKA 4YDDB 2M4MA 2GHVC 1MROB 1CJTA 1I51B 4ETXA 8RUCA 2UZAA 1RE1B 3Q86A 5B0GA 2QA4S 2CIMA 2WSEC 3NBPB 1LV5A 2MSSA 3BR9A 3FMWA 2J6TA 2MJUA 4M1KA 2CRLA 5L9NA 1IBMF 2IBOA 4DUTA 2MLZA 3G82B 4IDKB 4NMXA 3TX0A 5HQLA 1DAXA 2FY8A 3HFVA 4U96A 2F63A 4CO2A 2BDPA 2DGSA 1LW2B 2XMMA 1XNQF 1Q79A 3LAMA 4LRDA 2DHSA 1JJ2R 1WKJA 4ILLA 1PAUB 3TX8A 1S1XB 2VDIA 1TL4A 1X4FA 4DR5J 2KL8A 1KVJA 4DV4F 1S1UA 2RB7A 2XMWA 2V2QA 4M5HA 2JRSA 5DQGA 2NXUA 3G6ES 4I4BA 1RT1B 3H20A 1FE4A 2N3OA 2ASDA 5HMXA 1FD2A 3G82A 5KFRA 1FA0A 5I4MA 2A10A 5D77A 4P2FA 4DSFA 4YMEA 5F9NA 3UCUP 1O0PA 2X51A 3LANA 1Q53A 2K3KA 2HPUA 1F1BB 1S0MA 4NLDA 1VBKA 2IMWP 1BWEA 1KVKA 4F3QA 4K8RA 2CQ1A 1JNZB 4B3RJ 4FYYB 1D9FA 3OTDA 2VG5A 2WVEA 1RHRB 1YDLA 1Y4ZB 3CSKA 1URRA 1YJUA 3TJAA 3S1TA 5DG9A 4B9LA 1J5EF 1KVIA 4DR3J 2P9GA 3GG0A 3HFKA 4LFCF 4W4MA 1Y10A 1EP4A 4K5RA 4NL5A 3RG6A 3TZXA 4LJMA 4OX9J 2AJFE 2HHSA 1TZ0A 1CS4A 2DCUB 2QA1A 3N0VA 5CYQB 3MD1A 5DG8A 2LLZA 3QATA 3R27A 4CP5A 3MD3A 1IWAA 3H2VE 3J81j 3G8TA 3IRWP 2KYZA 5CABA 1SQGA 1RWWB 4QR0A 4IFVB 1S4FA 1F9FA 2GC8A 1H0HB 1UA0A 4A8OA 4F36A 3L3CA 2F65A 1U24A 1X5TA 1GH8A 4QWBA 5B0EA 1S6QA 3ZNJ1 4X66J 3TZYA 5B0DA 1HNZJ 1VFJA 1PC4A 3PTWA 4I68A 4NMLA 5L8RC 1YTYA 4JUZA 3MTJA 5IXUA 4NX9A 1Y11A 3ZTPA 4CLUA 2V8VA 1S57A 1FRJA 3P45B 3GIKA 4IR9A 2XO7A 1F6TA 4LF7J 3IR5B 2N82B 1NDPA 2XWXA 2CPJA 3KLFB 2RIJA 3TAMA 1DURA 4WPAA 3EX7B 4WZQA 2AYEA 2K06A 3G86A 2VA3A 2CDQA 2AJ1A 1GMWD 2YPYA 3CXCR 2BABA 4PQUB 2HNYA 4YB1P 4N56A 1P8GA 4WP8A 2FZCB 4OFZA 3TQEA 2J8SA 2DNYA 2WZ1A 3W8GA 2QT7A 3EPIA 1WG4A 1HPZB 3A8KA 2WVDA 3SXLA 1XJWB 2MKSA 3W2WA 1N8RT 2CQPA 2MPUA 1F5BA 1DBDA 3SFUA 2EC0A 2DR7A 1R89A 4J9RA 2F8HA 5CCMA 5KFEA 2YH1A 3DGPB 1NPRA 4EFAC 4JV5J 1RTHA 3AHPA 4USVA 1JKHA 1HQ2A 1XC9A 3ISZA 4FDFA 3HHLC 4Y6IA 2J9DA 1VQ5S 4JI5J 3RYLA 3AFGA 3KJQB 1PJ6A 2XHWA 2QX0A 1SI9A 3GYNA 3TZWA 5IFMA 2ZH9A 3ENAA 4WP9A 3KLHA 2XY7A 3NCPA 2VG7A 3A4TA 2DNMA 2GVZA 5KFCA 4IFYB 2DNQA 4DX5A 3OVBA 2ZITA 1XERA 2NSBA 2YX1A 4KAIA 2PFDA 3HPOA 1U02A 4U7UD 2VG6B 2HQ3A 2FD2A 3ELHA 3NRBA 4P2SA 1IJFB 1RB0A 4YR0A 3QLHB 4KT0C 2M2BA 1LOUA 4B17A 1JKHB 4OZLA 1N5QA 3PCOB 3D6TB 2V94A 2B9WA 4KO0A 1GNKA 4NLSA 2OEKA 3OFFA 3DGPA 4USJC 4CDIA 3EE3A 1HNVB 4B9SA 2G9OA 1U6FA 5JXSA 2JFKA 1Y7PA 2DRAA 2X7IA 4Z2XA 1OO0B 2H51B 3CD0A 3GILA 4KE5A 1RTDA 1H7XA 2EG2A 3R1HA 2OLWA 2MXYA 1OSDA 2WBRA 5L38A 1G6BA 2H9ZA 4DU7A 4W98A 3RU0A 3TEHB 3W2VA 4E8UA 4FBUA 3PM9A 4IO1A 1U1PA 1WG5A 2GCFA 1VYAA 4OI1A 1DARA 1I6JA 2JFDA 4OI4A 1IN0A 3HI9A 2QL7B 4E2FB 1PBAA 2KJVA 3G2XA 5HJYA 5AJ3F 4ATNA 5HLFB 1WACA 2VG5B 3I9ZA 4USMA 4DFKA 3V4IB 2K7KA 3LP0A 3HHNB 1O8BA 2ZH8A 2VJUA 2UVWA 3KJVA 3DRPB 3WX4A 4K0KF 3HHDA 4F0MA 2KT5A 3DGVA 3IBWA 1RT2B 1Q95G 2CWXA 2FC9A 2M8HA 2ROGA 3BYRA 1N0UA 2IAJB 4J9UE 4DQRA 1HD0A 4OYWA 2FLPA 3QAEA 5T41A 2DNKA 2IJNA 1H73A 2B56A 1VCTA 1VQSA 2FGCA 1NLKL 1XMOF 4PG5A 4RNOA 3T41A 1HR0J 2UU9J 3C46A 4YN3B 3C14A 2UUWA 4RR5A 1VK3A 4NZ6A 3T9ZA 1S1WA 2BJEA 2E5GA 3RJMB 1B4SA 1Y5NB 2AJ2A 1EP4B 4C48A 5LMNF 5AXMA 3UNYA 4XPEA 1MN7A 3RBDA 3K17A 1FX2A 5CYMA 2GO8A 4YQWA 1W2IA 4RBVA 2AGOA 3KHLA 2AQ4A 4F26A 1V6HA 3B4MA 3TRGA 5CYJA 2R2UA 1WWHA 3AD7C 4IG3A 3MAAA 4F4WA 4PYAA 2OO4A 2U2FA 2DNOA 3FBFA 2NYIA 1U1NA 1Q16B 1RT5B 3D7SB 3OR1B 1FESA 3HULA 1BWVA 4RW4A 3BO2A 3V81A 2ATLA 1SL0A 4NCGA 3OLBA 1K1QA 5DJBA 4MFBA 3VVTA 5F3ZA 1X4HA 4RNNA 1N5TA 1RAOA 3BGFA 3MCOA 3JTOA 3IN5A 3PX4A 3QYYA 2C22A 2ASLA 2BJ1A 2HVZA 1NXIA 2QSWA 3G4SS 1S1TA 5ITHA 2MQMA 4MMOA 2XSJB 4WFBQ 2Z0GA 4PG7A 3CTRA 3VAJA 5KFTA 1NK4A 3FCVA 2CPYA 2RQKA 1TL1A 2VD3A 4P10A 4S0MA 1IBMJ 4NA1A 2UVUA 5HQMA 1RKJA 1SPBP 2I38A 3Q8PB 2E7XA 4H4MB 1GEHA 1D9DA 2H5EA 3OR2A 1U45A 1RK8A 4PCQA 2AX1A 4UUWA 2I6WA 1RCXB 4KH0B 1NSAA 3L9ZA 4L72B 1IKVA 1CJUA 3GMGA 1WEYA 3MPWA 1KLMA 1R8PA 4NWBA 3UD5A 5F8IA 1WHXA 5KFPA 1NK6A 3UDCA 4F25A 4I67A 2DR6A 1CEZA 1YHQS 1BY9A 2ZC4A 4LFAF 1JXEA 1G2EA 4LBIA 3DYAA 5F0UA 1RHQB 4ZVFA 3IP0A 3N5BA 3FMBA 4LRBA 1SJ1A 2XYGB 4ECWA 1XMOJ 1HR0F 2OH2A 1EB0A 1FK9B 3I31A 5GAGI 4NXMF 3I87A 1VC5A 2HFVA 1FX4A 3AQPA 3P3DA 4FKYA 5FD1A 4ETZA 5MAOA 2MGZB 2IHR1 5B09A 3PIPQ 4DL2A 2HHVA 1KQSR 1WHVA 4DL7A 2OD4A 2G0CA 5D4PA 5KFGA 5H1SV 1VQ7S 1MMNA 4KPCA 4F2SA 2HFUA 1HQUA 5GADU 5KFVA 5M2RA 2XY5A 3GR0A 4XO0A 3PV8A 2ZD1B 2HQIA 2HQCA 1N6QA 1JLBB 1SQEA 1SC3B 1VRUA 2ABYA 2DBBA 3HVWA 4GC7A 1EJ7L 1R0AA 1NK8A 2W2NP 4LUBA 3FSXA 4LF4J 3ILLA 2OPQB 4O4RA 4USHA 4XTTA 1KQGB 3WZ0A 3MTKA 1IKYB 2HVEA 2L9DA 3T1AA 3BO3A 1F3FA 3I5CA 3DI6B 1Q81T 4YR2A 3C3LA 2RJZA 3DU6A 3LO3A 2DKOB 2BXJA 3RAQA 1JWWA 4PUOA 4OYXA 3CUNA 1CPZA 3SYZA 2GGPB 2ZBPA 4ED0A 1X4GA 3AJDA 2WSCC 5CZVA 1YKWA 8ATCB 4B9NA 1REVB 4J9SA 1X5OA 3E51A 3HZEA 2KJWA 4FXWA 3CIZA 1AUSL 5F8HA 5EDWA 3TANA 2ADCA 4NCAA 3TUPA 4UOFA 4F02A 4ZVSB 3ZZPA 4B9TA 2CPIA 3CW2C 2HHHJ 3QQCD 5DDOC 4X2BA 3J80U 3ILJA 2IVYA 2CJKA 3GIMA 1KDNA 4L3NA 2MZRA 2Z2MA 2F7VA 4Y65A 4ZIWA 2HS0A 3A8JA 1C1BA 4NLQA 3SZ2A 3Q0AA 1GTEA 5GAGU 1HWJA 4ELTA 1EKSA 4TXSA 5KFZA 2WHOA 1U49A 3FQKA 1B99A 1A0OB 2B4UA 3SBMA 3WQPA 1B3TA 5HROA 1KRPA 4DV2J 1TKZA 3HSZA 2YWHA 1NO8A 2DO4A 1RT3A 4HI2A 4MIBA 4M5DA 4TQRA 3Q22A 3CD6S 3V6DB 2J7KA 3PYEA 1K1SA 1S7IA 3CD5A 3M1VA 4E98A 5GADI 2CQ0A 1HNIA 2CPHA 1K0VA 1NH8A 2O66A 1DJ0A 1D3WA 1S12A 3CO0P 2MLXA 5ETVA 4X4PA 1S48A 3PIOQ 4DFJA 3MCMA 4G3IA 2B4PA 1MG7A 2Q3PA 2E1MC 3HCXA 5A8RA 1UEVA 3U27A 1CSJA 1UP1A 2AP6A 4LIWA 2R7XA 1SUQB 4DX6A 1HYSA 1FDAA 4A8WA 1B0PA 1U09A 4XK8C 3GTYX 3OLAA 1MMLA 1UA1A 2FVPA 3VHQA 2RQ4A 2PGCA 4JI0F 4TU8A 4OI0A 3FSYA 5ETQA 3QFWA 4OZJA 2R7RA 1HBOA 3D54A 2HK2A 2F8MA 2Q79A 3MMBB 5K5MA 4IRCA 2OEMA 4EEYA 1T9TA 3QJLA 4DL6A 4RU2A 4DN0A 3HKZD 3R6GB 5EWFA 2MMYA 2DIUA 3GYGA 3KFWX 3W7BA 3UR0A 1NJXA 4FXDA 3OUYB 3PYFA 1ZAXA 3UNGC 3IC1A 3CF5Q 2RMLA 4CRJA 4DPXA 3IO1A 4PQAA 2CA9A 4HHHA 5AXKA 5HMZA 2BKNA 1NEEA 3E01B 3TO8A 1H72C 4AL6A 4UW2A 2E7VA 1DLOA 5KT3A 2MKIA 4YB6A 5KOWA 5J1EB 2LEBA 3D6FB 4EK2A 3MEEB 1W7WA 3AAWB 3TI0A 4WFXA 3CPWR 4KFBA 2K7JA 3W62A 2QO3A 1UW9A 5BYSA 2AJQA 1LEOA 2PEHA 1U0HA 3IWLA 4FZVA 4RW8B 4JV5F 4ZPDA 1S1VA 4Q8FA 2I0XA 4Z37A 3LALA 5CA5A 2R2TA 3CCJS 3ZZ0A 1E6VB 5CQGA 5KTQA 1U1KA 2OMLA 1FT8A 4KV8A 3BGUA 5D15A 1FJ7A 1GAOA 4ZDNA 3RB4A 1B7FA 2B3TB 2ZNZA 2VQFJ 2ILYA 3KKFA 3QGHA 3PXGa 5KG5A 2B4OA 1WUUA 4J37A 3P5TL 5M2UA 4NI2B 1Y3JA 4FNIA 5GMEA 2APOA 2HVIA 3LWMA 3GB0A 1NU4A 3HDSA 1WC6A 4CH0S 3U1LA 3KHGA 4Q7AA 3GP9A 4O44A 3QT7A 1UWBA 1AZSA 3TR5A 4MK9A 2RD5C 2Z4PA 3BQ0A 2FY1A 1DFDA 4M63A 1TL7A 3FSIA 4DSEA 3NMAA 2L9WA 2Y1RI 1FFGB 1VIXA 3IM8A 4L76A 5KFNA 5H9EJ 2AYBA 3L95X 4JI1J 1UWBB 2EKYA 1WDDA 3C8YA 1PSDA 3D0GE 4HI1A 2M5YA 1ZM9A 3I5BA 4NLOA 4TY8A 3D3BJ 4WCEQ 2QFJA 2I2YA 2QTWA 2WVCA 3OFEA 4JI8F 1NK7A 3FQLA 3PX6A 1EKRA 2B5JA 4ED2A 2B6AB 1N6QB 4QU6A 4CM2A 2CXEA 1VBYA 4B3MJ 1UFLA 3KG4A 2KG0A 2EFQA 2RILA 3LUYA 4M5JA 2XMAA 2XULA 2R4FA 3OVAA 3PRBA 2HRTA 3PG9A 1SV5B 1T94A 2DHXA 2E44A 4UY8T 4XIUA 4WK1A 6AT1B 3K7RA 2EK1A 5C42A 1TL3B 3GG1A 1ZBTA 2V0NA 4WBFA 5LXYA 1RT4A 2CZ4A 3G87A 3VALA 1KOHA 2XM3A 4EYIB 2R7TA 3TVKA 2AWZA 1PYTA 1NDCA 3FJ2A 3LOUA 5D8HB 5HBMA 3ONQA 2LEPA 3GYXB 1QUPA 4BHQA 4OHXA 2ZHOA 3TQ1A 4DL5A 2EG1A 4UOHA 1ULRA 4PEOA 3TYTA 1IJEB 2CJXB 4P52A 1LWCB 4O44B 3V2UC 3HT3A 2V69A 1QD1A 4L75A 1C4AA 5JVGQ 4PKDB 1IQTA 2ZH3A 4MKVA 3R8YA 1CJUB 5B0BA 2ZH1A 5AE3A 1FDNA 4NI2A 3MPUB 2XCPA 5KT6A 1C1CA 2OSRA 2EKNA 2JLEA 5K8OA 4NLPA 2QYGA 2E1PA 1UAWA 2J76E 4H54A 3ENQA 1G4CA 1IR0A 2QMXA 2DJWA 4RW7A 4PXDA 2PT0A 4OYMA 5H9FJ 1TL1B 3BBCA 3D1OA 2DY1A 2HIQA 4FNHA 4LREA 3THTA 4DX8H 1J2VA 3NS7B 3TARA 2CPXA 3M6UA 2DGXA 5KFYA 1HYSB 2ZKTA 3POTA 1S1VB 1HHTP 4URQU 4NXNF 1B70B 3J7YU 2AJ4A 2NS1B 1JX4A 4RW8A 5ETMA 4RUAA 4OI6A 4F3MA 4KFBB 4R5PB 1Q7YT 1NUEA 4CLSA 3V81B 4ECUA 2CNNB 3EDQB 1LWFB 2C2KB 2LA4A 3OR1A 4LR8A 5HAOA 5KG2A 3ITHA 3OBIA 3Q23A 5LMNJ 1SJQA 3D1HA 1T03A 1QUVA 3KJFB 3NS6A 1RT3B 4OHVA 3OJSA 2X1GA 4LRCA 3QGGA 4DX7A 4NA3A 4X4RA 4DR7F 1I94J 4Y34A 2FHKA 2P9CA 2EFNA 2CJBA 2UU9F 3CJ0A 3GONA 1N0VC 1DTTA 2G2ZA 2SXLA 4DG1B 3PRVA 1FNOA 1T0TV 2Z57B 2MQPA 5EN1A 3I56S 2E5LF 2GIRA 2EWHA 4ITSA 5AXNA 3RBXA 3F41A 4G1IA 4NCBA 2LVWA 1UCNA 5D6GA 3P8BB 3UD4P 4HR2A 3UFCX 5J2QA 2VONA 2JEIA 2XSFA 3H4BA 3NY0A 1H38A 3MPYA 2F5GA 3DFEA 4PG4A 2GHWA 4U8YA 1C0TB 1KTVA 3TP2A 2EI5A 3SI8A 4EO6A 2BOPA 4GKJJ 3GLJA 1FKPB 2HFSA 3AA9A 1JLAA 3CCZA 2AEJA 2VQEF 1WKKA 1F0XA 1SH0A 4MTPA 3C16A 4ANDA 2GVDA 1VRQC 3MWBA 4IH5A 4TLRA 1WC4A 4B3TJ 4PUOB 2KTQA 2EEYA 3V6DA 4ZJQA 2M88A 3LP1B 3MR2A 5SZTA 5KG0A 2BRKA 1NB2A 1IKYA 5HROB 4Y2CA 3RRHA 1JLCB 2OAUA 2N7YA 2DIVA 1VQMS 2HGMA 1GX5A 3GCXP 2VODA 2KN4A 3DHXA 4EGLA 4RLEA 4U6PA 2VOOA 2G4BA 5IV3A 2XCAA 3N9UC 4WKYA 4OYPA 3IAM9 3FFIB 2V4JA 2YKAA 4TYAA 3TEGA 1UFKA 1FF2A 3I9V9 3MMAB 4QWDA 1W2BR 1HI0P 3MM5B 1L5UA 2V8PA 5IS2A 1OMSA 3QPIA 4HTIA 1HNZF 1UFWA 3IGVA 3Q2SC 3KTQA 1LFWA 3OTBA 5DLGA 1XMQF 1YJ7A 3JAMY 4WFNQ 2XI2A 3MFIA 1N32J 2WONA 4WK3A 1KEKA 1WC5A 2K3IA 1CJKA 1RU1A 2LCWA 2GAGC 3JS9A 4UZBA 5A6WA 1JLQA 2EFOA 3GV5B 4JI6J 3E2EA 4FS2A 4I1TA 4OZ3A 4CLTA 3T5KA 2NR0A 1TQLA 2XMKA 4DSJA 2ZBRA 4JI5F 5I42A 2GVZB 1YIJS 1N36J 2DGQA 3DM2B 3NGKA 3AB2B 3D3CJ 4Q2LA 4QR2A 2NPFA 5HSPA 4I69A 3GV8B 4DV2F 1TFYA 4B02A 3A13A 1MNEA 1X9SA 4FN5A 2D3OR 2E29A 1X31C 5D0HA 1VRUB 3D9BA 3UN3A 3CJTA 1S49A 2MQOA 2D3O1 1RT7A 2BE9B 2PSZA 1X0FA 3SCKE 1TK8A 4J91A 3M05A 2HVHA 1YBAA 4FYVB 3NGUA 5ETTA 2V63A 2XEXA 2A6OA 2HHHF 4OX6A 4K4SA 5CZXA 3MFHA 5F3TA 2GJFA 1RWOB 3PR5B 1F9EB 1O51A 1S59A 3HZGA 3V4MA 1Q86T 1J5OB 3AT1B 1OWXA 2QSFA 3VAHA 4DV4J 1RACB 4A4JA 3G6VA 1Q82T 1VGYA 2IJRA 2LQ8A 2C2MB 3FKBA 3DOLB 4MIAA 3FRYA 3ZZOA 3CJRA 3X3UA 1S6UA 1URNA 5M2PA 3BSAA 3BKFA 3IGNA 1HQEA 1SIWB 4X4OA 4NXNJ 1D8ZA 2RKIB 2V67A 4HVZA 4KHMA 1CVJA 2ZZNA 1KLMB 1UVKA 4IO9Q 4QIGA 5B0FA 2JZ5A 3U7JA 2GV1A 3CC4S 4NA2A 1RP5A 3H42A 1K8AT 1DTQA 1SKUB 3GU0A 2DXEA 2DITA 4OJ3A 2IA0A 4PG6A 2OTJS 4QIWD 5GAEI 2GIQA 2VKRA 1Q5YA 3IS9A 2Q43A 1UPPA 1VQYA 3HF5A 3WIUA 2J0QD 4QWCA 1K9MT 3HHEA 5E3QA 3KK2A 3TVZA 3QJJA 4RW9B 3TNVA 2LKZA 1TELA 1RYSA 1RZMA 3MHYA 1JLEA 4RW7B 4CLLA 5LXRA 4ILMA 4JI4J 5I3PA 4O3OA 2FLNA 4B3RF 5HVHA 3PR4A 5A2QY 5CHCB 2MQLA 1OJ4A 4LMZA 1NB7A 3P96A 1KHVA 2B7BB 2DRDA 3DRRB 4JOUA 3W64A 2R8GA 3NNAA 2IAJA 4YR3A 2VJVA 4PPDA 3NBPA 3MAHA 3MM9A 1H2UX 2VZ9A 3EGZA 3KK1A 3DLEB 3FBBA 3KJVB 1SJ4P 1S6PA 3I5AA 1YGYA 5IC4B 1KONA 2LXFA 1QAIA 4RO0A 4WWSA 1VC6A 3BR8A 1C4CA 3B82A 3M9MB 1HNWF 3HM9A 1SBRA 3K8VA 3KMSA 3OFGA 1CULB 2NZCA 2MHEA 2WRMA 3DRRA 3HJFA 4ID5A 5F0WA 2E1AA 2YNGA 2H5JB 3BM7A 4IOCQ 3CCWA 1BC6A 3V6JA 2BM0A 1OPIA 1RWMB 1YX2A 2MLYA 4RWXA 4ZPCA 3VAFA 1EIYB 3R5JB 3VTIA 2EBEA 4JYAF 2OSQA 1SV5A 4C8YA 1ZZFA 1FRXA 1T02A 1VHFA 3WX8A 4K7QA 3BZQA 1OYEA 1HWUA 3TAQA 3OSPA 4F3OA 2L08A 4NLUA 2DGWA 1PBUA 4ED5A 4M95A 3M8PA 2G1HA 2C28A 2R8IA 2M0GB 5L9XA 3HHLD 1FJGJ 1GT8A 4C0BA 1RBAA 2C1EB 2HW3A 2MY7A 2QLFB 1MROA 3GJQB 2RU3A 2DISA 2OEJA 1QAJA 2CJQA 3GFHA 4I2QB 3QBCA 3CD7A 3ZTSA 1RI7A 3PNIA 1GTHA 4IH6A 1K0TA 1VLOA 5KG6A 4AE5A 2OELA 3SDEB 2AF6A 5LT5A 3OV7A 2JC1A 1AA1B 1RTIB 1VRTB 3R5AA 3CCTA 4USWA 5HO4A 2ZHBA 1QSYA 3SEOA 1RAAB 2QMUB 2E5HA 3DDIA 3K5NA 3IR6B 4EBDA 1VDHA 2DVIA 3N6LA 2NPIA 2UUCF 4JI4F 5LL6d 1WOPA 4DSKA 2R7QA 4O3QA 3MMCA 3U1NA 2G13A 4I6AA 2HBYB 2KU7A 2G2OA 3BS9A 3IRXB 4LSLB 2KZZA 3MM5A 5FLXU 1VQ4S 4QYRA 2KHDA 2Y8YA 1BQNB 1XEZA 3EM1A 3N6NA 2J7WA 3FFIA 1L3UA 1TUGB 1WSRA 3KG1A 3L09A 1QSSA 3KK3A 2MYFA 2DGTA 2V50A 3H90A 2RQMA 2PDAA 3CJKA 3VR1A 3P6YC 1WDTA 1VK8A 3R5GA 4DR6F 1FKAF 2ALYB 1U0HB 2Y0BB 3JSRA 2YNHB 2IC3B 2J5AA 4WE1B 3MEEA 2HNDA 1S6OA 3N01A 3RUBL 4HEA9 4WYLA 2Z56B 1DLOB 2EFPA 2QC3A 2CJ9A 3KLEB 2DRBA 4UTGA 2DXFA 3CJKB 1GMUA 1RBLA 2K2PA 4J9QA 4BDPA 1M5KC 3EXCX 4CCHA 1KN6A 1U4BA 1WNEA 3OHBA 2W9BB 1D8YA 4LFBF 2ZVSA 1WSVA 3H40A 2PD1A 5F9LA 1QTMA 1WOOA 4P2MA 3HMJG 2C2NA 4P2XA 3W61A 3WIVA 2EPIA 4FF3A 2ZEJA 4YP3A 3MEDB 1SL2A 4V19J 2H4YB 4GO7X 2AYGA 4WTYA 2XS5A 2QYCA 2ZZMA 4DR6J 4PWDA 4PG8A 2HFZA 4NYOA 3UW1A 4LRFA 4TKTA 4ZHRA 4F50A 4IRKA 3BBFA 3P4UB 2DB1A 4LQ9A 3CMAS 2GJ2A 1RSCA 2FJWA 1SVDA 1V3ZA 3M30B 4O3PA 4RJVA 4IYQA 4R8UB 3JQMA 1ZTWA 1U1QA 3V5RA 3TJ9A 4URSA 4ZVPB 2MQQA 1T9UA 1NDLA 4TNOA 3EYZA 1C0TA 3SV4A 4IFVA 2HWTA 4ANEA 1RA6A 3QNWB 5LJ5Y 5HI7A 2FVRA 1WTFA 3O1LA 5KG7A 2FJXA 2I5JA 1QDUB 1QE1A 3HVAA 1H74A 3R6LB 2AIRB 2YQ3A 4CO5A 2L41A 3KHRA 4ERDA 4DF8A 4JI3F 1UEKA 2HS3A 4R0JA 1NCLA 3QSYB 3LAKA 4M94A 2FJAB 1REVA 3BSOA 2PA3A 2VBZA 2G2YA 2W25A 2OTLS 1KTQA 3FRZA 4CNYA 1HA1A 2AT1B 1B64A 2HG4A 3SFGA 3MM6A 5KFLA 2P5VA 2GIFA 3OFHA 3GSDA 5HMYA 5IM0B 3KK1B 4B3TF 5HBMB 2NQPA 4LR7A 2PMZD 3CCVS 2ACMA 2UP1A 4ECXA 2UUBJ 1VISA 4ECTA 4KJIA 2CNLB 4FYWB 2H3EB 2M7SA 4P7VA 1FWPA 4IOBA 2DNHA 1QLNA 3HK2A 2YWFA 3R7NB 2DNPA 4CT8A 1YJVA 2VC1A 5DRKA 4ZVGA 2EW9A 1L3TA 2Y8WA 4OHZA 3A8IA 4Y3CA 1HNWJ 4Q5VA 4MK8A 5K14B 1XBWA 3NGTA 4LF6J 1RAHB 1M5OC 1HQUB 1PYOB 3H5XA 2F4VF 4GC6A 3LPYA 5K9FA 1UKUA 2FHJA 3T19A 2BE2B 3QO9B 3VQTA 2MGZA 1C1CB 2C3UA 4I6WA 2HHUA 3M2UA 4WFYA 5HP1A 1I94F 2NUUG 1KOOA 1JXVA 5LJ3Y 3ETOA 4LVOP 2HAIA 3S8SA 2OHDA 4K4WA 4ZLLA 4DHVA 5DDRC 1RADB 4X4TA 3RB6A 1AUDA 5E7OB 2RH3A 2CQCA 5GMKa 1BGXT 1HQEB 2MZ1A 3TA0A 1WG1A 5HK4A 2I8EA 3AY0A 1FRKA 4L73A 2VC0A 2EC2A 1LWXA 2X3DA 2P2CB 3QSIA 4ZJOA 3DOKA 3Q8SB 1VOMA 1SC4B 4OV1A 4AQYJ 4PYDA 2CG8A 4QZVB 5C42B 2DT9A 3IWNC 4GKKF 3C6TA 4USKA 1NK9A 4CH1A 1BE4A 1IM6A 4ALZA 2BE2A 3QO9A 1KBRA 3OR2B 4ELVA 1HD1A 1QJHA 3RW6A 1LXNA 1WF1A 2HMIA 3DHWC 2C2ZB 4NASA 2FB0A 3MZIA 2MKYA 2D1CA 3L4BC 1P27B 4KKOA 1MLAA 2YNIB 5LSLA 2E66A 5T14A 3LA0A 2VPXB 3CJ4A 3WDOA 4MJKA 3UDVA 3A1YG 4O4GB 1MU2B 1DQAA 2GNKA 2V2ZA 3CEDA 5FDLA 5CAAA 3F44A 2AU0A 1VLYA 3CJQA 2B9XA 5DQIA 3BKUA 1PGZA 5H9FK 5J1EA 4WU3A 3MM6B 3Q8UA 1LK7A 2CVEA 1NJWA 4HDGA 2CJYB 3CO9A 1G7CB 4HDHA 4KGKA 4YHHF 1VQKS 1VQNS 2XTJP 1NSPA 5DGBA 4OMFG 1ELOA 4DQSA 3NNCA 1CJKB 4QJVA 1WC1A 2OUGA 2AEFA 3M2UB 4JI2J 2FHOB 3PYGA 3CCQS 2WOMA 5CYMB 1EARA 5DO2A 4WFAQ 1H2TZ 3AODA 1LW0B 3NCRA 3NWRA 2GX8A 3MM8B 4ID8A 2V5HG 4HH0A 4Y2KA 5MLCV 4K0KJ 3HVRA 1NKBA 3LTOA 2KYXA 4LVNP 4IR1A 5K14A 1QE1B 2XHCA 3M8SA 4I2PB 2UUBF 4Y2MA 3QIDA 5AJ3J 5CH7B 2ZHAA 2YBVA 3T6JA 1M5HA 4G1QB 4HHJA 4I7FB 2W2OP 3MR5A 4LFBJ 1M5VC 2Z2ZA 4K4YA 2R7VA 5IZHA 1LKZA 4CTAA 2ZDOA 1ROFA 4HT7A 2W8KA 1Y9OA 5ETKA 1S5ZA 3T1HF 3CJ5A 4E0DA 3CMQA 2WSFC 4K5SA 2XBPA 3LQVA 4OZNA 2ALZA 2YVSA 3R3TA 3FUYA 3EZUA 4ELUA 1N48A 1TTHB 4DV7F 3O3LA 1Q78A 2IRYA 3JAMU 3QZ8A 3S6EA 2X1AA 1H6KX 4LF1A 3EZ5A 3OUYA 3M6WA 4LBHA 1FEEA 3FBEA 3NAHA 3CIMA 1PAEX 4NYZA 4ZHRB 3AH6A 4YFUA 3WC2A 5KFAA 1PC5A 1NDKA 2MEWA 2YKMB 2WB1D 1HBOB 2A3JA 2CQ4A 3NP5A 1F60B 2HQGA 4F0HA 2F8EX 2VPWB 5ETRA 5H9EK 1F2GA 1NBEB 3KDOA 4LBPA 1KQKA 4ICLB 5DQHA 3CB4A 3D4JA 1UEUA 1IBKF 1LW0A 1SH2A 4H4OA 4N8NA 3ULHA 4ZCIA 2PFFB 1TV6A 4OLOA 5A8KB 1U0SA 2YKQA 4X64F 2J9EA 4EWTA 2CQIA 4I0WA 2JEFA 4DFMA 2LMIA 1Q8LA 3WBZA 1S7HA 2LXUA 5HVGA 2ZUAA 2ZE2A 5GAHU 3M1VB 3PEHA 3M30A 4JI2F 2ZM6J 1FXRA 4IG0B 2BX6A 2YNHA 3DMJA 2E5LJ 2KT3A 4M5DB 5J1PA 3BDPA 1X4DA 2HRUA 3H7HB 3CNQP 4CTAB 3KLHB 1CQNA 3DU5A 1TR0A 1GMVA 4WIIA 4X64J 4PWDB 2DD8S 3POTB 4HACB 4CWBA 5K20B 3GV7B 1RGVA 1SKRA 4DUZF 2RF2A 2J0SD 3MMJA 4I2PA 4DR1J 4YOEA 2IRUA 2HBZB 2JNJA 2N7CA 2UUAJ 3I96A 4Y2AA 3ZZRA 4CO3A 5KFJA 5HVFA 3RRKA 2XYHB 2HMIB 4PXBA 3GR1A 4ED4A 1X4BA 3C6UB 3MAQA 2HNZB 3ET6A 5ETSA 2P6TA 3RAXA 3H98A 4K4ZA 3W5YA 1S97A 1XR6A 3TZZA 3T1YJ 2DHHA 2FDNA 4UOGA 3OL6A 1U8WA 4PQUA 5I3QA 1N33F 4DU8A 4M5GA 2IYGA 1V9OA 3I32A 1HNXJ 1X5PA 1WI8A 2HQFA 3DXBA 4ES2A 4ED6A 3PW2A 2DHGA 2DGVA 4DEZA 2K8GA 1D0EA 2QEXS 4EYHB 8AT1B 3VAKA 1WC3A 3VAIA 1YZ7A 2XLIA 5HQ8A 2DR8A 4N76A 3DOMB 2Z2LA 3B4DA 2ZVIA 3EMTA 5A0YA 3KK3B 4C8LA 2Y9HA 1XNRF 1T9XA 3K5OA 2O3DA 5E0OA 3FVYA 4O0IA 3R1LA 3L7UA 2VASA 2B43A 4DS4A 5E5NA 2M9KA 1IKXB 1CS4B 1PJ7A 2FYXA 1RAFB 2KG1A 3J7AN 3VGUA 4WXWA 4CIOA 3AD8C 1YBTA 4HH1A 2W9CB 5I3UB 2BW2A 1DQ8A 1VQ9S 4CLZA 2D7SA 4A8FA 2NCKL 1VJWA 4MKBA 4TU9A 1CJVA 2CZ9A 5F8NA 1S1TB 2HGNA 5ETLA 5FLXY 2F9JA 2HBQB 1F9HA 4DR5F 3BH6B 2HHQA 2JOQA 2VHGA 3MUMP 3QZ7A 2IDLA 4Z7YA 4N5SA 4NLWA 1SC1B 2O5DA 3BB5A 4NOHA 4EU0A 5IQ6A 4TU7A 2IY5B 4IG3B 2MZJA 5IT4A 4C8KA 2QFIA 3R5DA 4ZPWR 2W2MP 4AXJA 2XLKA 2QLXA 2FTRA 2C3YA 1RT6B 2ZOFA 5CCLA 5E41A 2DH8A 1HHQA 2JVRA 3CJSA 2ZH4A 2PI4A 1TKDA 2CZVC 4AT1B 4H4MA 4ZN1A 4TQSA 2Z58B 1X8DA 3R2DJ 2IM0A 1S1WB 2XMJA 3P5BP 2RDDA 2GW8A 4KV8B 3MURP 4UUXA 1FO1A 1O6XA 1ZETA 4Q44A 2MQ8A 4K50A 2OD6A 4F8RA 2GQ2A 4JI7J 4Q0BB 2P6SA 4ECRA 1RT6A 4RW6A 2DNLA 4RZRA 4P72A 4C3MA 3DRXA 1JJHA 2PEBA 3DLGA 2LQJA 2OP5A 2DY9A 3GSIA 2YX4A 3Q83A 1RWUA 5SUHA 4DCPB 1T3OA 1OS5A 5IM0A 3NGDA 2JLGA 4FYDA 1MWQA 4ZP7A 5BJRA 4DLGA 1NH7A 3MGJA 3V4IA 1TK0A 2DR5A 2XGPA 1WEZA 2QN6B 2OFGX 4PXCA 1KS2A 4LIRA 5D0RA 3HVTA 2NXJA 1FFWB 1BD6A 3J7Z5 3NNHA 4ZLPA 1FVQA 4R25A 1W26A 2K1RA 1JNRB 2CAJA 3KDNA 3CDAA 3MM7B 4WJBA 2W4PA 2ZBCA 5C24A 3RZAA 3T6BA 3SSRA 4C3LA 4DV0J 3GFXA 3M4XA 3HD2A 1O5JA 3F56A 4ZPTR 2RHSB 3Q8RB 2LU1A 2H54B 4LSNB 2EXUA 5IOLA 4C97A 2JHEA 4QU7A 2CQGA 1U1RA 1AFIA 4F4ZA 2BJ3A 3K5MA 1HNVA 1N33J 3R2CJ 1VMBA 1X4AA 1N4LA 4WTOB 4BC7A 2HK3A 4GVBB 1GQEA 3QLHA 5KFHA 1FKOB 1BHNA 3AJ1A 4BLGA 5L1LA 1U1OA 3HX9A 2PI5A 1RT2A 3NMRA 2RKIA 3TA2A 2YTCA 5F8GA 2MHNA 3DM2A 4JI0J 4DR4J 1SIZA 2VG7B 3CGIA 2KHCA 1T9YA 1UZDA 1FJCA 3N5FA 3QGPA 3QT8A 1S10A 1JLQB 5G4DA 2O01C 5BR8F 1WD6A 4FS1A 4J9VA 2HLUA 3CCLS 3GJTB 2EFVA 5AT1B 4EMDA 1RTHB 2WBMA 2YXLA 4OHWA 4IH7A 4ZPBA 2WK4A 2WCXA 4PR6A 5G0RA 1KSPA 1P1LA 2QJ3A 3DLJA 5KG3A 3US5A 1FJEB 4IQMA 5CD4A 5CD4H 3VAMA 1HPZA 1M1GA 1RAIB 2HEKA 2IJFA 3KJNB 4ZVOB 3JQJA 3KYLA 3LWLA 1RA7A 1T7PA 1YVFA 1R0BG 2FHJD 1SJFA 4LQ3A 2FJDB 4C0HA 3EJMA 4OQJA 3AOAA 1J5EJ 4YS2A 2JC0A 3O6QA 3I6PA 5J2MB 2ZWPA 1TKXA 1K73T 1IBCB 3B6BA 4ZCKA 1RWPB 3LW5C 3K2YA 3UN5A 1HBUB 4N41A 1YQHA 3TJ8A 2MQNA 2POKA 3F0NA 3H5SA 9ATCB 1S0VA 3KMQA 3BDEA 3I4HX 1Q8BA 3CJ2A 3ENVA 2OGUA 1N32F 5FJ4A 2BJDA 2OPQA 3NGSA 2R7OA 1S9EA 1JLGA 4NLYA 5KT2A 1R8CA 1OYDA 1ZM3A 5E2QA 1C2PA 4A8MP 1WJ9A 4F4XA 1JLBA 3NOGA 1OY9A 1PCAA 2IVMA 2P8IA 3EICA 2WONB 5LOQA 3KHHA 5J2NB 2F1FA 2AD9A 2HWIA 3OTCA 3VV2B 1HI8A 2NREA 4X66F 3H2UB 2XYPB 2E1RA 3O8WA 4PXEA 1FEHA 1R3NA 4FKXA 1S9GB 4ZP6A 3K58A 4A8SA 2M70A 3W1YC 4C6AA 1RWVB 4DG1A 1N5SA 2NXNA 4RBUA 1FFSB 3CJ3A 1X4CA 2K1RB 4IUFA 1VQPS 3MR7A 5LMUF 1RTIA 3KLIA 1KWMA 2DH9A 5DZ7A 2G0IA 2AEMA 1NJZA 1JB0C 3KLGB 4DZ6A 4X65J 3FEXB 1C0UB 2V34A 3IM9A 3ITHB 1U2RA 1S6PB 1F5AA 1N56A 1IWGA 3B8HA 4C8ZA 1HFEL 2E7WA 1UTAA 1S6QB 3PHTA 3MM9B 1FKPA 1YI2S 1S9FA 1OY6A 3NS5A 1GX6A 2XO6A 1R0CB 2R7WA 4GVBA 3NWGA 3PX0A 1U1MA 2UXCF 2HWHA 1EQ0A 4F4KA 4UZCA 4IKAA 1KFSA 4Q0BA 1WEXA 1GMWA 1CLFA 5J1NA 2MZQA 4G1QA 1HBMA 2J0WA 4I7FA 4MT1A 5LM7E 5KT4A 2ADBA 3IMQJ 3C2PA 1R27B 4AL5A 3IR7B 4UQTA 3OXLA 3NL0A 3Q8YA 4RW9A 2UXDJ 1CC8A 2Y0SD 2Q6BA 3LGMA 4X4SA 4CH7A 3BEGB 7FD1A 2XS7A 3NAIA 5BR8J 1RYRA 1K47A 1ZPVA 2YNGB 3JQKA 1HHSA 2QV6A 4OYBA 1ZM2A 3R9LA 4CZCA 3OVSA 3DRYA 4C9DA 1CULA 3SCJE 1JLFB 1YRUA 3N28A 2YNFB 4C7QA 2BEFA 2VPYB 4DR4F 4MFBB 1GXTA 1KKHA 1YJRA 1T03B 5KFFA 1CJTB 2VB6A 3W5XA 2CWKA 4OYAA 3JXOA 3PDNA 2QLJB 5ADZA 2BQRA 2E9ZA 2MKCA 4PRFA 2RRAA 1R8AA 2HAFA 2IDEA 3MCNA 5E3AA 4ZITA 5BYRA 1UVNA 3BREA 1MU2A 4CT9A 1NJIT 3W9JA 3JSMA 1WHYA 5HATA 3UCGA 3ZC4A 2D3UA 3WC0A 4CI0B 1U7LA 4DPWA 2J6SA 2YNIA 2J9DE 4DR2F 4MK7A 2HHWA 2KFNA 2X1BA 3O44A 1S1XA 5F8MA 3ZO7A 2L9NA 2OJ3A 2GFFA 4G1PA 1TUVA 1XN9A 3BF4A 1N52B 5L1IA 5KFWA 4NXMJ 1UL3A 3Q2TC 2UUAF 4AQYF 3EGVA 2OPPA 2MZTA 3CULA 1MN9A 1RKIA 5F8LA 2PN6A 5IWAF 2LDIA 3M8ZA 1H2VZ 1HWLA 5A8WB 1X9WA 3FZBA 3MECB 4DPOA 1FRHA 2AZ1A 2BQ3A 2FJEB 2NYHA 3M2VA 2UVRA 4NLGA 4I6YA 4QIEA 5D4LA 1TU0B 3PFEA 3ILOA 2IM3A 4FVMA 5EWEA 2ASYA 1AYEA 3LP0B 4QIVA 1C0UA 2VL1A 4PZVA 5I42B 2C42A 2GJIA 3RTVA 1S79A 1L3SA 5HLFA 3HD1A 1H98A 1RT4B 1DQ9A 1OSCA 3KLIB 4FP9A 3RBEA 1YITS 1CJVB 2M52A 2YWGA 3W63A 4U7CA 3T5HA 4J9OA 2J9CA 3DRSB 3IG1B 5KFOA 2IRXA 1UJ6A 3MPDA 3J7YI 1R7IA 2RS8A 3ET6B 1G1XA 1XNRJ 5KFDA 4OYIA 4BBYA 3DDNA 4JI8J 5B7WA 2GMHA 1HW9A 2LDYA 3EDRB 1TKTA 2Y3YA 4JI6F 3UWTA 1NHUA 4U7UK 5CXTA 3Q8VA 1KR4A 3M8RA 4OIXA 4K4VA 2QE5A 1DZ5A 4Z7CA 2CPEA 2KVIA 5J2NA 2AGQA 2GQCA 4ZVEA 2DPIA 1APSA 5EHHA 2DNGA 2Z30B 1PIEA 1NKCA 3JSYA 2HZAA 3BPDA 3D68A 3M8WA 4OJHA 4J9MA 1S9EB 4JI3J 1U6BA 5RUBA 4DL0C 1CQMA 1QSLA 1HKAA 1XIQA 4O3NA 4H4KC 4MIWA 1HIYA 5J2QB 5DS7A 4YB5A 4R0EA 1AZSB 1S72S 1TKXB 2YWKA 2HLTA 1KFDA 1JLAB 1VIOA 2LXIA 3PEJA 2W2QP 3FDSA 3SCIE 3SSQA 4AYBD 4RNFA 2ZJQQ 1LNQA 3E3XA 3I0RA 4DR1F 4UT4A 1NJYA 3G6XA 1Q1KA 4DQQA 2FLLA 3EXYA 1ZM4A 4HL9A 2MTLA 2DHAA 1S99A 3ZTQA 1TP7A 3BKTA 2ZZTA 3HHLB 3MMBA 1ZS6A 4KHRA 4NZ0A 5B0AA 5C25A 4MKYA 1ITPA 1HMVB 3ENWA 4I64A 5G0RB 1Z4UA 1OQ3A 2KRBA 2PE8A 2XNQA 3DN9A 3M8YA 5HJXA 2ATCB 2PA8D 2V2KA 2UV8A 2H1YA 3KG0A 3DLKB 2VFTA 1BQMA 2BJ9A 2VFVA 4ZK7M 1IBLF 2RE1A 2YKMA 2HNYB 3EZOA 4DDFA 2X1FA 2Y1LB 3BBBA 4KHPJ 2ZWOA 1T3NA 3B78A 2L48A 3QJPA 2VICA 3TAMB 4TVAB 5F8JA 1EQMA 2W8LA 1SKWA 5DG7A 2W24A 4A48A 2RRNA 3OXFA 3A8EA 2C2RA 1IR1A 2GVDB 2VV5A 4C3KA 2BJ7A 3H5UA 3NCQA 3KUEA 3G9CA 3MXHP 1PJ5A 2BANB 3D0IE 1RHUB 4YY3J 2D69A 3JB9k 3GPAA 3BN7A 2VH7A 3TAPA 4Y28C 3CE8A 3LP2A 2KT2A 5D4OA 1SQFA 4DV7J 3Q24A 3QRRA 2BV3A 2HURA 2RUGA 1BXNA 2ZUGA 5GMDA 4QWEA 3MEDA 3CCMS 4DFPA 4DF4A 3SQGA 3DLKA 4WF9Q 1HL6A 2YKPA 5JMNA 3BGOP 5L1JA 2C3PA 1NZ8A 2D74B 1NSQA 3SQGB 2XGQA 1FE0A 3MM8A 3JYTB 2R9LA 3PO5A 1DTTB 1KNZA 4W90B 3KUGA 1RUSA 1ZZNA 2MB0B 2RAQA 1NMEB 2QA4G 4Y0FA 5KFKA 4JYAJ 4DPYA 4GKKJ 3D6MB 1XK8A 3N4WA 4QIFA 4DV0F 2HRYA 1Z2LA 2OPSB 3CCRS 3R7BB 1LWFA 1YRXA 3DNCA 4YDXA 3C15B 2ZFHA 4DWIA 5GAEU 1J27A 3O2IA 5C7PA 3AD9C 2QGFB 5KFUA 3UE2A 2V8HA 2IC3A 4ZCMA 5DDQC 4CLFA 3FGVA 2EVZA 1RLCL 3MEGB 5C5JA 2HFNA 4J5OA 2V4QA 5A6PA 3IBCB 2BA9A 1JK9B 3O5TB 3IA0A 1D1UA 1QTNB 3BQ1A 1R0AB 1KLNA 1FRIA 1S4EA 1NM2A 1IKWB 2YPZA 5LSRA 3SIPB 4RBTA 4BWJA 3PJWA 1D9AA 2MSTA 2F4VJ 2B8QA 3HO1A 2AV5A 1TKTB 7AT1B 4DLEA 4JI7F 4FPRA 3JTNA 4MAKA 4LF6F 3CDWA 4OX7A 2UXBJ 4ZLNA 4DMZA 1RTJB 1F3VA 2CQHA 2B6AA 4DJBA 1GXLA 3VCDA 1S0NA 2ZBIA 3BGRA 3LGNA 4J9NA 2FUG9 2A2CA 2VA2A 2HHPA 5J2PB 2WB4A 2BQUA 1VQLS 2IA6A 1FHTA 4M5NA 1UZHA 4TLQA 4USTA 3V6KA 3A12A 3PW5A 3KLGA 1FNXH 4AD6A 1P9YA 4CLKA 1LXJA 2FHMA 3DCAA 3DI6A 4LF9F 4WZMA 4I2QA 4CLPA 2DTJA 4K2JA 5FDLB 2DYAA 2FC8A 2WW4A 2AJ0A 3BV8A 5DLFA 3PVXA 1U47A 1TL3A 3H0PA 2ZOGA 3MECA 4KH1B 2Q1LA 1LWEA 1RHMB 3M2RA 2BMBA 2C3MA 4NZ7A 2NXCA 3GE9A 3G71S 4KGMA 4ED3A 4RX6A 2CYYA 2FZGB 4PPZA 2KFYA 1A7GE 3QT6A 1NNDA 1D09B 2EFGA 2IVFB 5KOXA 1RHJB 2B0GA 2AKWB 2H4WB 2PC6A 1Z1ZA 2ROPA 2RU9A 3WHIA 4DN9A 2HSEB 5F41A 4OYZA 4LFCJ 2JEJA 4L6V3 3PZPA 1FJGF 3UDEA 2YKOA 5JJBA 3Q8QB 2XZTB 1E6YB 2DH7A 1LWEB 3OJUA 1RABB 4IRDA 4OJGA 1V5VA 2XSJA 4ED1A 1T95A 1WF2A 4TY8B 4LT6A 4D3GA 4DPUA 4Q43A 1YRTA 3DOKB 4K4UA 2QG9B 2C2OB 2VKZG 4UOCA 5T7LB 4A47A 4AXIA 3I0SA 4GVLA 1HBNB 4J9KA 5E3CA 2Y1JA 4EZ6A 3SSSA 2IPOB 1SJRA 3IBFB 3G6YA 3P49B 1M1KT 3HKWA 2E5JA 3C15A 4KSEB 5D3GB 2W7AA 3HSJA 4TY9A 3DLEA 2GMLA 5J2PA 1KD1T 1M0SA 4HLBA 5KG1A 1HW8A 2PMWA 2RNEA 2HFOA 3GCWP 3MAAB 4DL3A 4LF8F 4JV0A 1N54B 2YX7A 3PFOA 4KIAA 1HNXF 1RTJA 3CDUA 4QYZJ 2WAQD 1H7WA 3MUVP 4F4YA 2DEIA 3R5CA 3VWSA 1U2FA 3NLCA 3L7PA 1FNMA 3H4DA 1YK9A 3CT9A 2I5JB 2XG8A 1MMDA 4A8KA 4ECVA 1E6VA 4OHYA 3GZ7A 5IT9Y 4KC5A 2GQQA 2JVOA 1WORA 2HQDA 3C19A 4CQ1A 3H2LA 2OPRB 4DV1F 3OXGA 2MKKA 3OD2A 1Q8IA 4NRUA 2V8GA 1N5VA 4CM0A 3EWGA 2XWYA 4USIA 5B08A 2KM8B 4FBTA 4IG0A 1ZOTA 4KR0B 4NCGB 1FDDA 2Q6CA 4ZA1A 4U67Q 3OQ2A 3CDBA 2CDRB 2DNNA 4KB7A 4U8VA 4X62J 1B0VA 1RT5A 4NEYA 2R2RA 4L3KA 3D6HB 4MYTA 5JVHQ 4O3RA 4DOZA 3OPKA 1RCOB 1XQIA 4XAKA 1TV6B 2GAHC 3B54A 5A8KA 4XPCA 3BSNA 2P9EA 2BR0A 4LF2A 1TMJA 4EI2A 5D0GA 4YUDA 1AW0A 2N4DA 2VBYA 5E33A 1P9QC 5GVQA 2FLOA 5IQQA 4RNMA 2QL5B 3M6XA 2GO9A 2JDJA 3MI7X 2JX2A 1HMVA 2A18A 1I1GA 2QZ8A 2ZJRQ 2Y1IA 3THVA 4OZ0A 4X4NA 4NYPA 2LQ5A 4FPIA 2W9BA 3CCSS 3D5MA 3EVWA 1RT7B 2R3VA 3LP2B 2KVQE 1PYSB 3FBCA 2GS8A 2F9DA 4ZCLA 4X65F 5HN0A 3HP6A 1N36F 2KH9A 3C66A 3L7OA 2V2VA 2G1DA 1RDRA 4K59A 3PYDA 3BN4A 5KT7A 3KLEA 3UVJA 3QT5A 4KY3A 3BGLA 2V4RA 3DRPA 1MWZA 2VFUA 3KNGA 3H5YA 4FF2A 4LF7F 1XWLA 1AXQA 2IM2A 2MY8A 2Z8QA 3M32A 4LSZB 3IXQA 4MH8A 4M5IA 1I3OB 1T9WA 2RS2A 1S77D 1TKZB 5JUMA 5KFMA 1W25A 2H65B 2R7UA 1VJQA 2HVDA 2B51A 3RR8A 4YB7A 4ER8A 1TVRB 2HS4A 2KXHA 2FJVA 1NK5A 1YJTA 4ED7A 3AXMA 3W2VB 1X9MA 3DKDA 5KFQA 1BQMB 2CPZA 2LP4A 2ZD1A 1U6ZA 4M8LA 1YJ9S 3ETMA 4Q45A 4DUZJ 3MOJB 1RXOB 3IRXA 4WXOA 5D78A 5C25B 1YWXA 1TUWA 1VC0A 2VQEJ 2HKEA 2JLFA 2R8JA 3MMCB 3NG8A 4OX9F 2I9SA 4JB8B 2WOMB 4KRWA 5KFSA 4C11B 4C2MA 2RT3A 3M6VA 3QMQA 4RL1A 3QWUA 3W8PA 3ZZUA 1GK8A 2A0FB 3CCUS 1K44A 3JSBA 4CLWA 2N3LA 1ZTTA 2AMCB 2LA6A 1VRTA 1FI4A 3ADAC 4PAAA 2GGPA 4U95A 5KT5A 1JMTA 2E9RX 2B9EA 1IBLJ 2AHOB 2ZH5A 4CNZA 2N4CA 2G0JA 4IFYA 2HNDB 3I4PA 3DYAB 5ETPA 1T9VA 2ROEA 4ANCA 3M32B 4P73A 4DQPA 1AROP 1NZAA 2PMHA 1ZH5A 3A3PB 2V68A 4O4GA 3C16B 1WHWA 3JSMB 4Q8EA 1L3VA 5BYQA 1AFJA 1YSJA 1XR5A 1FKOA 2O67A 2VBXA 2XZWA 5A8WA 2VUGA 4DS5A 1IKVB 1OIAA 3K57A 4LFAJ 5AE1A 4FF1A 1EHWA 4P6QA 3QGIA 1BQNA 3TOQA 1LK5A 2OPPB 1Y00A 4FVCA 3RB3A 1VQ6S 1JJ4A 2B4VA 4DXLA 1TAQA 2LU2A 1CG2A 4LSLA 4P74A 4YHHJ 3H25A 1NK0A 4L74A 2HGLA 5CYQA 3PJ9A 4LSNA 4QOTA 2R42A 3W5ZA 2LEAA 3GFZA 2GMJA 1ZAWA 4B08A 2XMVA 3DLBA 4DZDA 3ZXWA 1R8BA 3MM7A 4NLRA 3EGNA 4XDCA 2EK6A 4ID5B 4KGXB 1FXLA 3HVTB 2FVCA 4DCJB 2QA2A 1VBXA 3OT9A 2BACA 2VF3A 1SB6A 4WYWA 4DV3F 4I56A 1SKSA 2RHQB 2AYMA 3LPEA 4P7TA 1VI7A 5E3PA 3EGWB 3U1MA 3MUTP 2AX0A 4IOAQ 3M2VB 4ILRA 5L46A 2YNFA 3UR3C 1ZA1B 2IFXA 3V6HA 1MWYA 1NSKL 4ENOA 2CNOB 2YH0A 2YQ1A 3QWPA 2XC9A 2IYIA 5HP1B 1T8EA 2B7CB 1RT1A 2CPDA 4X4QA 2GHPA 2BBEA 1UMJA 1VHIA 3HXMA 1M5PC 2FIUA 3OTEA 2OIHA 1F5CA 2DEJA 4NLTA 1SJ3P 4B3SJ 2KKHA 5EGYA 4ZP9A 2DPJA 3CMES 5KFIA 3PJXA 2MZSA 1ICEB 1RAJA 2D41A 4J90A 1N5YA 2HZCA 2RUSA 4B3OB 2CQDA 4OX8A 4DSLA 4BWMA 2LQ9A 4KGZB 2R8KA 3W3SA 4ZIVA 4C4WA 3CCES 1TMMA 2W1BA 4OI3A 4O3SA 4N8OA 1UVIA 1KHWA 4NLVA 3U02A 3TA1A 4NRTA 4QPTA 2ZNYA 3QAUA 3AXKA 4WFZA 2Q66A 2NUHA 3DOLA 4DV6J 2XZDB 3ZTOA 2M8DB 1YG0A 1T11A 4C8MA 1RU2A 4A8QA 1JXLA 4DQIA 4KBIA 2H5IB 1OPZA 1E6YA 1SH3A 4DV3J 3AJ2A 5D4NA 4KPYA 3HHKA 1S0OA 1UVLA 1JLEB 1XMBA 1X7VA 2E1CA 2BYCA 4X4VA 2KDOA 1LW2A 1DY3A 2HBRB 2VFSA 1HBMB 4U9RA 1R8HA 4Y2IA 1SCJB 2F4FA 4GMKA 1SXLA 1DTQB 1H3DA 1N34J 3M2RB 5AE2A 4JI1F 3K0JA 3T3FA 3HSGA 1RJJA 3DOMA 1V3RA 2XI3A 2QL9B 3D28A 2DR9A 1Q7LB 2LECA 3MOZA 2BRLA 2XMTA 2ZOMA 4RUHA 2BKPA 2CVIA 3QFHA 1M5SA 2KRRA 3KWMA 5EWGA 2NXEA 3CC2S 1V5IB 2AW0A 3TVYA 3BSCA 3DC2A 3PRDA 4GRSA 2DNRA 1YLXA 1HLWA 2DGOA 2W2PP 5D0EA 4BCAA 3RRGA 2MKHA 2CNKB 3TUIC 4P9SA 3M8QA 1UJ5A 3BH7B 3MDFA 4NLXA 4ES1A 1EZZB 3AOBA 1IXKA 4QW8A 2C2EA 5I3UA 4TYBA 1J5OA 4C8OA 1BLUA 3RGIA 2XQCA 5IV4A 2UXCJ 2XB2D 1S9GA 3R5BA 4RUBA 3KLVA 2FJBB 3NGRA 4EZ9A 2JSXA 3FEZA 3RAMA 4M5KA 4EO8A 4Y00A 4ZN3A 1RWXB 3I55S 3AOCA 4MKAA 4OJ1A 4RPFA 3W2WB 3PW0A 1TFWA 1P1TA 3UI3A 5B0CA 1GFWB 4USUA 2JWNA 2UVVA 3EPGA 4B9VA 3ZTRA 2B8PA 1JLGB 3KXDA 3KOAA 2VG6A 3A3OB 1Q5VA 4ZVTB 1JLCA 4DCOB 3OTOJ 2ZJPQ 2R7SA 3TUZC 4QW9A 4NEZA
chains in the Genus database with same CATH topology
1CJTB 4OYAA 4OYOA 1YK9A 4OYMA 3ET6A 1Y11A 4CLUA 4CM0A 4WPAA 4CLSA 4WP8A 4P2MA 2WZ1A 1WC3A 4P2XA 3C15B 1CJUA 1TL7B 4CLLA 4CLFA 1U0HA 5D0GA 4USVA 1YBUA 1CJKB 1CS4B 1WC1A 4WP9A 1YBTA 4CLZA 5D15A 1CJVB 2GVZA 1CJVA 3C14B 1FX4A 3ET6B 2W01A 3UVJA 4OYIA 3C16A 1CULB 2GVDA 4NI2B 1WC4A 4WP3A 1WC6A 1CJTA 1AZSA 4USTA 4OZ2A 1TL7A 4CLKA 3G82B 3UVJB 4CLPA 4CLYA 5IV3A 4OYPA 3MR7A 1AZSB 4OYXA 4CM2A 1WC5A 1CJKA 3G82A 4CLWA 1WC0A 4OYZA 4P2FA 5D0EA 4OZ3A 4CLTA 4OYWA 2GVZB 4USWA 5IV4A 3C16B 5D0RA 1AB8A 3C14A 5D0HA 3C15A 1Y10A 3MAAB 1FX2A 4OYBA 4USUA 2BW7A 2QV6A 1CJUB 1CS4A 4NI2A 1CULA 2GVDB 3R5GA 3MAAA 1U0HB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CJT B;  4OYA A;  4OYO A;  1YK9 A;  4OYM A;  3ET6 A;  1Y11 A;  4CLU A;  4CM0 A;  4WPA A;  4CLS A;  4WP8 A;  4P2M A;  2WZ1 A;  1WC3 A;  4P2X A;  3C15 B;  1CJU A;  1TL7 B;  4CLL A;  4CLF A;  1U0H A;  5D0G A;  4USV A;  1YBU A;  1CJK B;  1CS4 B;  1WC1 A;  4WP9 A;  1YBT A;  4CLZ A;  5D15 A;  1CJV B;  2GVZ A;  1CJV A;  3C14 B;  1FX4 A;  3ET6 B;  2W01 A;  3UVJ A;  4OYI A;  3C16 A;  1CUL B;  2GVD A;  4NI2 B;  1WC4 A;  4WP3 A;  1WC6 A;  1CJT A;  1AZS A;  4UST A;  4OZ2 A;  1TL7 A;  4CLK A;  3G82 B;  3UVJ B;  4CLP A;  4CLY A;  5IV3 A;  4OYP A;  3MR7 A;  1AZS B;  4OYX A;  4CM2 A;  1WC5 A;  1CJK A;  3G82 A;  4CLW A;  1WC0 A;  4OYZ A;  4P2F A;  5D0E A;  4OZ3 A;  4CLT A;  4OYW A;  2GVZ B;  4USW A;  5IV4 A;  3C16 B;  5D0R A;  1AB8 A;  3C14 A;  5D0H A;  3C15 A;  1Y10 A;  3MAA B;  1FX2 A;  4OYB A;  4USU A;  2BW7 A;  2QV6 A;  1CJU B;  1CS4 A;  4NI2 A;  1CUL A;  2GVD B;  3R5G A;  3MAA A;  1U0H B; 
#chains in the Genus database with same CATH topology
 3IWX A;  2CAD A;  5DET A;  3KLF A;  2ZH6 A;  3LP1 A;  4X4U A;  1F2H A;  1MW7 A;  4WE1 A;  5KFX A;  3MR3 A;  2QIF A;  1QAX A;  4TN2 A;  4OI2 A;  5ETN A;  3OL7 A;  2UXB F;  1I5O B;  2FVS A;  1CC7 A;  4NPO A;  1U8S A;  2JH3 A;  1XMQ J;  4ZVH A;  3W66 A;  3UPF A;  1TK5 A;  2D9O A;  3KNA A;  5FII A;  3GQC A;  2BJ8 A;  9RUB A;  1S76 D;  1X60 A;  3GWC A;  1BQX A;  1OQ6 A;  1NHV A;  3BQ2 A;  5L1K A;  4A46 A;  1YJN S;  3Q89 A;  2HNZ A;  4LRA A;  2J0X A;  2YKN B;  2UUT A;  3VF0 B;  3OTO F;  3K59 A;  3D1Q A;  2JJ4 D;  4QCL A;  3J81 U;  4ICL A;  3ZZT A;  2H48 B;  3UO0 A;  1VBZ A;  4F67 A;  4K2X A;  4O23 A;  3D2W A;  4F2R A;  3M7V A;  3MMA A;  4YEA A;  3G8S A;  3SQO P;  3ZZZ A;  2LFV A;  3GIR A;  3K89 A;  2ZM6 F;  2V6A A;  1U2C A;  4DBQ A;  1SUQ A;  3FC9 A;  4CO0 A;  3J7Z T;  2JEG A;  1JQG A;  3BO4 A;  1NAQ A;  3QIP B;  5A8R B;  3MF5 A;  2KO1 A;  3HFZ B;  4B9U A;  2CUY A;  5DGA A;  4BS2 A;  4WKR A;  4CO1 A;  5A76 A;  2CG4 A;  4DUY F;  1YBU A;  2CQ3 A;  2XMU A;  3GIJ A;  4QYZ K;  2J8A A;  1RHK B;  1ZAV A;  3OL9 A;  1HNI B;  1WI6 A;  3DDK A;  4DPT A;  1U1L A;  2ZE2 B;  2C3O A;  3NOC A;  1SC6 A;  1IBK J;  3ILI A;  2ZDP A;  3DLG B;  3MPV A;  3PW7 A;  2Z2Y B;  3K5P A;  2C2D A;  4J7C A;  1IQZ A;  4EBE A;  2HYI B;  4NE9 C;  3LF0 A;  5K8N A;  2UUC J;  5THW A;  4RW6 B;  3VGV A;  3IFE A;  4W92 B;  5EX3 A;  1EAY C;  1X4E A;  4H4O B;  2VPZ B;  4Q2M A;  3SCL E;  1DRZ A;  2VBW A;  1VQ8 S;  1C1B B;  1A6L A;  2MDA A;  1EET B;  1JIH A;  2BKO A;  4URG A;  4DR7 J;  3CJ8 A;  4G6V B;  5BXI A;  1A9N B;  2KXF A;  2ZKU A;  2A1B A;  2DXD A;  1B0T A;  2B9Y A;  2BVZ A;  3VGS A;  2E5I A;  3FZ2 A;  3HHL A;  5C24 B;  4RU9 A;  3H59 A;  1PIL A;  3MEK A;  2W7P A;  2RDJ A;  4JP8 A;  4B9M A;  4LF4 F;  4OZ2 A;  2QMW A;  1RAE B;  4C0O C;  2PO4 A;  5AXL A;  3I0R B;  3AB4 B;  4P75 A;  2MKJ A;  2XY6 A;  2COL A;  4KYZ A;  4CLY A;  5C2G A;  5KFB A;  2A2D A;  4LF5 J;  5U47 A;  1XNQ J;  2ACY A;  1FVS A;  1R6V A;  4H4K A;  4DV1 J;  3K8W A;  3RB0 A;  5IT9 U;  2LQB A;  3H8Y A;  1Q4R A;  6FDR A;  5IT0 A;  1FRL A;  1FRM A;  2ZH2 A;  2WW8 A;  4AL7 A;  1FWL A;  2W4C A;  4A8Y A;  1N88 A;  3PHE A;  1UET A;  2GA7 A;  2YQ0 A;  2IM1 A;  2ASJ A;  3CC7 S;  1YZ6 A;  2KI2 A;  3FCH A;  5E3R A;  2QRR A;  5K8M A;  1N5Y B;  4B3O A;  1S1U B;  4CO4 A;  2R8H A;  7FDR A;  3QRP A;  2W9C A;  3OL8 A;  5A2Q U;  2HHX A;  2KZM A;  2U1A A;  3AA8 A;  4A8X A;  2XS2 A;  3FNN A;  2VQF F;  1U25 A;  3KK2 B;  1IVZ A;  4EUV A;  3IS9 B;  1LQ9 A;  1Z2Z A;  1FTR A;  2F3J A;  3JTP A;  3RW7 A;  2NLW A;  4IDK A;  2ZH7 A;  3HJV A;  1WOS A;  4DR3 F;  4UQG A;  2UXD F;  3X1L B;  1AB8 A;  2R2S A;  3DRS A;  3IG1 A;  5A0Y B;  2J6U A;  3ZNU A;  4LR9 A;  3M9O B;  4ZPV R;  1FK9 A;  1BUX A;  2F40 A;  4ZP8 A;  3OW2 R;  1LWC A;  1X0P A;  1ZPW X;  4ZKA A;  4X62 F;  4KGV B;  3UCZ P;  3QRQ A;  1HWK A;  5D3G A;  2BW7 A;  1PG5 B;  4ED8 A;  3G8Q A;  3PAC A;  3R7S B;  2PII A;  5ETO A;  4B3S F;  1HI1 A;  1B7Y B;  1HBN A;  2OFH X;  1N34 F;  2E9T A;  1TL5 A;  3MR6 A;  3CDE A;  2FGO A;  4X84 A;  3J7A 1;  4OL8 A;  3EUN A;  5C2C A;  4F0K A;  4RNH A;  2RQC A;  3GJR B;  3TUJ C;  4K4T A;  2V9W A;  4DL4 A;  2VOP A;  2NSC A;  4HTJ A;  5LMU J;  1FD8 A;  1SL1 A;  1IKX A;  3LGH A;  4RUC A;  4ECY A;  3SMZ A;  1RWK B;  2D9P A;  1HAR A;  1KP6 A;  4OLP A;  1T05 B;  3RR7 A;  1IKW A;  1WTB A;  4LF5 F;  1VQO S;  1IR2 A;  4LF9 J;  4HKQ A;  1FCA A;  2B5J B;  2CQ2 A;  2I1R A;  4DV6 F;  2BUN A;  5EX0 A;  3UQS A;  3D0H E;  1UJ4 A;  2AGP A;  2CFX A;  1U26 A;  2HZV A;  1RTD B;  1WF0 A;  4MYU A;  3VAG A;  3UD3 P;  3RBZ A;  3HT0 A;  1TAU A;  2QLW A;  3GII A;  4UF4 A;  3J81 Y;  1TL7 B;  1PO6 A;  3DLH A;  2EBG A;  1U48 A;  4RW4 B;  4ZS6 A;  1FXD A;  3BPS P;  3E01 A;  1XR7 A;  3ISN D;  5DDP C;  3BGR B;  4DUY J;  4IQX A;  2RVJ A;  3DXS X;  1JLF A;  3KUH A;  3OSN A;  2OKQ A;  3LH2 S;  4ZPA A;  4QWA A;  4DV5 F;  4KHP F;  3ZFV A;  4V19 X;  3C6U A;  1FER A;  2A6M A;  3FEY B;  2UV8 G;  4GO5 X;  2GZO A;  4C11 A;  4F04 B;  4ECQ A;  3AQO A;  1Q8K A;  1RTZ A;  2DO0 A;  3T5J A;  1JJC B;  3N6M A;  5GAH I;  2XLJ A;  3VZH A;  3N79 A;  3F73 A;  4B3M F;  2V4J B;  2VFR A;  3C14 B;  2RF2 B;  3UDL A;  1V3S A;  3EVO A;  4F4A A;  3D67 A;  3T5L A;  2IIH A;  1ZYQ A;  4HAC A;  1FDB A;  2O1P A;  3OHA A;  3W60 A;  1RLD A;  3NXZ A;  1UWA A;  4EBC A;  1TVR A;  1M90 T;  1BMQ B;  3MEG A;  1Y0H A;  3T1Y F;  5LSO A;  1FWK A;  1NPP A;  2VDH A;  3DMJ B;  5K8P A;  2BAN A;  2CPF A;  4ZVQ B;  2VIH A;  3TW0 A;  1Y5I B;  1UPM B;  2YY3 A;  4OV6 A;  4N47 A;  1UW4 A;  2BE7 D;  3UVJ B;  2JL9 A;  2OPS A;  4V1A k;  3VGT A;  1XTZ A;  1OY8 A;  2HHT A;  2MJN A;  2DK2 A;  4PAB A;  5DZ6 A;  4QQB A;  4ZVR B;  3QIP A;  4QPX A;  4CYU B;  2CJA A;  2CKW A;  4ZJL A;  3ISN C;  4OZ1 A;  3TWZ A;  4GKJ F;  3JYT A;  1PKU A;  2WVB A;  2XNR A;  1WC0 A;  1Q0N A;  2DCL A;  1EET A;  1RIS A;  4YY3 F;  2BOA A;  1UVM A;  2BM1 A;  1WEL A;  4M5M A;  2YKN A;  4KO0 B;  4PWW A;  4CYU A;  1NPK A;  1MSW D;  3G96 A;  3ICL A;  2WTF A;  1EX8 A;  1IUJ A;  3PW4 A;  3D66 A;  1FTC A;  3UN2 A;  2X3G A;  4C98 A;  1NKE A;  4R8U A;  1QY7 A;  4DI6 A;  3FK4 A;  3K5L A;  3J80 Y;  4BC9 A;  1ZA2 B;  3VQS A;  5KG4 A;  4DSI A;  4DV5 J;  3HLU A;  5DM6 Q;  1LFP A;  4R5P A;  1HBU A;  4ZOS A;  2KXN B;  4XDD A;  2ERR A;  1M1H A;  3CWJ A;  3PKM A;  2ZC3 A;  4UY8 5;  2OPR A;  3PKY A;  3W65 A;  5J2M A;  2IBK A;  2ZBQ A;  1HWI A;  2KM8 C;  3GFY A;  4PWU A;  2FVQ A;  4KKO B;  2DNZ A;  3A3N B;  1RQ0 A;  1VS3 A;  1IM4 A;  4FYX B;  5IWA J;  3M9N B;  4RWW A;  4J9L A;  1T05 A;  1YJW S;  1RAG B;  4OYO A;  1AT1 B;  4OZ5 A;  1GXU A;  2FPH X;  4QR1 A;  4D3H A;  2RRB A;  3BJY A;  1RBO B;  3NEK A;  4HHU A;  2OI2 A;  1NRK A;  1KC8 T;  3DLL Q;  3C6T B;  3PO4 A;  3T1H J;  4N77 A;  3I82 A;  3S01 A;  2OMO A;  3M8Q B;  3W9I A;  2D3Z A;  3IAS 9;  3NKY A;  3SDE A;  4K4X A;  5HL7 Q;  1G3O A;  4WU2 A;  2FQQ B;  5EUH A;  1KQF B;  4F7V A;  5HAN A;  2W7O A;  2M3D A;  1NHK L;  1RWN B;  4ECS A;  1QM9 A;  1P6T A;  1Y5L B;  4ES3 A;  5L39 A;  3PY8 A;  4ECZ A;  4RKU C;  2LYV A;  2KB2 A;  3I0S B;  4JBC A;  1QVG R;  1VR6 A;  2CQB A;  5T7L A;  4JV1 A;  2RDI A;  3ZZY A;  2V8D A;  2YWW A;  2J7U A;  4FXV A;  5KAK A;  4M5L A;  3T9N A;  3HSD A;  2FZK B;  2YWE A;  4ZVU B;  1ACM B;  3M8P B;  1R43 A;  1WKL A;  4AUK A;  4ZMM A;  2W9A A;  2L3M A;  4KQZ A;  2HIY A;  2RSQ A;  4JV2 A;  4LF8 J;  5IC6 B;  3E8O A;  3S7R A;  3VZI A;  3THP A;  1L3K A;  2V9K A;  4QBU A;  3GJS B;  2W4D A;  2WVF A;  4WIQ A;  1REG X;  1QVF R;  4N7T A;  2BZ2 A;  2NZ4 A;  3R97 A;  5HMW A;  1Y3K A;  4HYK A;  1X5S A;  2DGU A;  4P71 A;  4ZLJ A;  3VVU A;  3EVM A;  2ILZ A;  4G65 A;  4O0N A;  1CBK A;  1DHM A;  2AZ3 A;  4FF4 A;  2QLB B;  3FCW A;  3W9H A;  3BYP A;  4J9P A;  1R31 A;  1QAY A;  1UVJ A;  4KTQ A;  5DM7 Q;  2W01 A;  4HT5 A;  4AFF A;  6FD1 A;  1R6Y A;  2KFZ A;  2IMO A;  3SV3 A;  4DR2 J;  4C8N A;  2VU5 A;  3MCS A;  4WP3 A;  3CVK A;  4YDD B;  2M4M A;  2GHV C;  1MRO B;  1CJT A;  1I51 B;  4ETX A;  8RUC A;  2UZA A;  1RE1 B;  3Q86 A;  5B0G A;  2QA4 S;  2CIM A;  2WSE C;  3NBP B;  1LV5 A;  2MSS A;  3BR9 A;  3FMW A;  2J6T A;  2MJU A;  4M1K A;  2CRL A;  5L9N A;  1IBM F;  2IBO A;  4DUT A;  2MLZ A;  3G82 B;  4IDK B;  4NMX A;  3TX0 A;  5HQL A;  1DAX A;  2FY8 A;  3HFV A;  4U96 A;  2F63 A;  4CO2 A;  2BDP A;  2DGS A;  1LW2 B;  2XMM A;  1XNQ F;  1Q79 A;  3LAM A;  4LRD A;  2DHS A;  1JJ2 R;  1WKJ A;  4ILL A;  1PAU B;  3TX8 A;  1S1X B;  2VDI A;  1TL4 A;  1X4F A;  4DR5 J;  2KL8 A;  1KVJ A;  4DV4 F;  1S1U A;  2RB7 A;  2XMW A;  2V2Q A;  4M5H A;  2JRS A;  5DQG A;  2NXU A;  3G6E S;  4I4B A;  1RT1 B;  3H20 A;  1FE4 A;  2N3O A;  2ASD A;  5HMX A;  1FD2 A;  3G82 A;  5KFR A;  1FA0 A;  5I4M A;  2A10 A;  5D77 A;  4P2F A;  4DSF A;  4YME A;  5F9N A;  3UCU P;  1O0P A;  2X51 A;  3LAN A;  1Q53 A;  2K3K A;  2HPU A;  1F1B B;  1S0M A;  4NLD A;  1VBK A;  2IMW P;  1BWE A;  1KVK A;  4F3Q A;  4K8R A;  2CQ1 A;  1JNZ B;  4B3R J;  4FYY B;  1D9F A;  3OTD A;  2VG5 A;  2WVE A;  1RHR B;  1YDL A;  1Y4Z B;  3CSK A;  1URR A;  1YJU A;  3TJA A;  3S1T A;  5DG9 A;  4B9L A;  1J5E F;  1KVI A;  4DR3 J;  2P9G A;  3GG0 A;  3HFK A;  4LFC F;  4W4M A;  1Y10 A;  1EP4 A;  4K5R A;  4NL5 A;  3RG6 A;  3TZX A;  4LJM A;  4OX9 J;  2AJF E;  2HHS A;  1TZ0 A;  1CS4 A;  2DCU B;  2QA1 A;  3N0V A;  5CYQ B;  3MD1 A;  5DG8 A;  2LLZ A;  3QAT A;  3R27 A;  4CP5 A;  3MD3 A;  1IWA A;  3H2V E;  3J81 j;  3G8T A;  3IRW P;  2KYZ A;  5CAB A;  1SQG A;  1RWW B;  4QR0 A;  4IFV B;  1S4F A;  1F9F A;  2GC8 A;  1H0H B;  1UA0 A;  4A8O A;  4F36 A;  3L3C A;  2F65 A;  1U24 A;  1X5T A;  1GH8 A;  4QWB A;  5B0E A;  1S6Q A;  3ZNJ 1;  4X66 J;  3TZY A;  5B0D A;  1HNZ J;  1VFJ A;  1PC4 A;  3PTW A;  4I68 A;  4NML A;  5L8R C;  1YTY A;  4JUZ A;  3MTJ A;  5IXU A;  4NX9 A;  1Y11 A;  3ZTP A;  4CLU A;  2V8V A;  1S57 A;  1FRJ A;  3P45 B;  3GIK A;  4IR9 A;  2XO7 A;  1F6T A;  4LF7 J;  3IR5 B;  2N82 B;  1NDP A;  2XWX A;  2CPJ A;  3KLF B;  2RIJ A;  3TAM A;  1DUR A;  4WPA A;  3EX7 B;  4WZQ A;  2AYE A;  2K06 A;  3G86 A;  2VA3 A;  2CDQ A;  2AJ1 A;  1GMW D;  2YPY A;  3CXC R;  2BAB A;  4PQU B;  2HNY A;  4YB1 P;  4N56 A;  1P8G A;  4WP8 A;  2FZC B;  4OFZ A;  3TQE A;  2J8S A;  2DNY A;  2WZ1 A;  3W8G A;  2QT7 A;  3EPI A;  1WG4 A;  1HPZ B;  3A8K A;  2WVD A;  3SXL A;  1XJW B;  2MKS A;  3W2W A;  1N8R T;  2CQP A;  2MPU A;  1F5B A;  1DBD A;  3SFU A;  2EC0 A;  2DR7 A;  1R89 A;  4J9R A;  2F8H A;  5CCM A;  5KFE A;  2YH1 A;  3DGP B;  1NPR A;  4EFA C;  4JV5 J;  1RTH A;  3AHP A;  4USV A;  1JKH A;  1HQ2 A;  1XC9 A;  3ISZ A;  4FDF A;  3HHL C;  4Y6I A;  2J9D A;  1VQ5 S;  4JI5 J;  3RYL A;  3AFG A;  3KJQ B;  1PJ6 A;  2XHW A;  2QX0 A;  1SI9 A;  3GYN A;  3TZW A;  5IFM A;  2ZH9 A;  3ENA A;  4WP9 A;  3KLH A;  2XY7 A;  3NCP A;  2VG7 A;  3A4T A;  2DNM A;  2GVZ A;  5KFC A;  4IFY B;  2DNQ A;  4DX5 A;  3OVB A;  2ZIT A;  1XER A;  2NSB A;  2YX1 A;  4KAI A;  2PFD A;  3HPO A;  1U02 A;  4U7U D;  2VG6 B;  2HQ3 A;  2FD2 A;  3ELH A;  3NRB A;  4P2S A;  1IJF B;  1RB0 A;  4YR0 A;  3QLH B;  4KT0 C;  2M2B A;  1LOU A;  4B17 A;  1JKH B;  4OZL A;  1N5Q A;  3PCO B;  3D6T B;  2V94 A;  2B9W A;  4KO0 A;  1GNK A;  4NLS A;  2OEK A;  3OFF A;  3DGP A;  4USJ C;  4CDI A;  3EE3 A;  1HNV B;  4B9S A;  2G9O A;  1U6F A;  5JXS A;  2JFK A;  1Y7P A;  2DRA A;  2X7I A;  4Z2X A;  1OO0 B;  2H51 B;  3CD0 A;  3GIL A;  4KE5 A;  1RTD A;  1H7X A;  2EG2 A;  3R1H A;  2OLW A;  2MXY A;  1OSD A;  2WBR A;  5L38 A;  1G6B A;  2H9Z A;  4DU7 A;  4W98 A;  3RU0 A;  3TEH B;  3W2V A;  4E8U A;  4FBU A;  3PM9 A;  4IO1 A;  1U1P A;  1WG5 A;  2GCF A;  1VYA A;  4OI1 A;  1DAR A;  1I6J A;  2JFD A;  4OI4 A;  1IN0 A;  3HI9 A;  2QL7 B;  4E2F B;  1PBA A;  2KJV A;  3G2X A;  5HJY A;  5AJ3 F;  4ATN A;  5HLF B;  1WAC A;  2VG5 B;  3I9Z A;  4USM A;  4DFK A;  3V4I B;  2K7K A;  3LP0 A;  3HHN B;  1O8B A;  2ZH8 A;  2VJU A;  2UVW A;  3KJV A;  3DRP B;  3WX4 A;  4K0K F;  3HHD A;  4F0M A;  2KT5 A;  3DGV A;  3IBW A;  1RT2 B;  1Q95 G;  2CWX A;  2FC9 A;  2M8H A;  2ROG A;  3BYR A;  1N0U A;  2IAJ B;  4J9U E;  4DQR A;  1HD0 A;  4OYW A;  2FLP A;  3QAE A;  5T41 A;  2DNK A;  2IJN A;  1H73 A;  2B56 A;  1VCT A;  1VQS A;  2FGC A;  1NLK L;  1XMO F;  4PG5 A;  4RNO A;  3T41 A;  1HR0 J;  2UU9 J;  3C46 A;  4YN3 B;  3C14 A;  2UUW A;  4RR5 A;  1VK3 A;  4NZ6 A;  3T9Z A;  1S1W A;  2BJE A;  2E5G A;  3RJM B;  1B4S A;  1Y5N B;  2AJ2 A;  1EP4 B;  4C48 A;  5LMN F;  5AXM A;  3UNY A;  4XPE A;  1MN7 A;  3RBD A;  3K17 A;  1FX2 A;  5CYM A;  2GO8 A;  4YQW A;  1W2I A;  4RBV A;  2AGO A;  3KHL A;  2AQ4 A;  4F26 A;  1V6H A;  3B4M A;  3TRG A;  5CYJ A;  2R2U A;  1WWH A;  3AD7 C;  4IG3 A;  3MAA A;  4F4W A;  4PYA A;  2OO4 A;  2U2F A;  2DNO A;  3FBF A;  2NYI A;  1U1N A;  1Q16 B;  1RT5 B;  3D7S B;  3OR1 B;  1FES A;  3HUL A;  1BWV A;  4RW4 A;  3BO2 A;  3V81 A;  2ATL A;  1SL0 A;  4NCG A;  3OLB A;  1K1Q A;  5DJB A;  4MFB A;  3VVT A;  5F3Z A;  1X4H A;  4RNN A;  1N5T A;  1RAO A;  3BGF A;  3MCO A;  3JTO A;  3IN5 A;  3PX4 A;  3QYY A;  2C22 A;  2ASL A;  2BJ1 A;  2HVZ A;  1NXI A;  2QSW A;  3G4S S;  1S1T A;  5ITH A;  2MQM A;  4MMO A;  2XSJ B;  4WFB Q;  2Z0G A;  4PG7 A;  3CTR A;  3VAJ A;  5KFT A;  1NK4 A;  3FCV A;  2CPY A;  2RQK A;  1TL1 A;  2VD3 A;  4P10 A;  4S0M A;  1IBM J;  4NA1 A;  2UVU A;  5HQM A;  1RKJ A;  1SPB P;  2I38 A;  3Q8P B;  2E7X A;  4H4M B;  1GEH A;  1D9D A;  2H5E A;  3OR2 A;  1U45 A;  1RK8 A;  4PCQ A;  2AX1 A;  4UUW A;  2I6W A;  1RCX B;  4KH0 B;  1NSA A;  3L9Z A;  4L72 B;  1IKV A;  1CJU A;  3GMG A;  1WEY A;  3MPW A;  1KLM A;  1R8P A;  4NWB A;  3UD5 A;  5F8I A;  1WHX A;  5KFP A;  1NK6 A;  3UDC A;  4F25 A;  4I67 A;  2DR6 A;  1CEZ A;  1YHQ S;  1BY9 A;  2ZC4 A;  4LFA F;  1JXE A;  1G2E A;  4LBI A;  3DYA A;  5F0U A;  1RHQ B;  4ZVF A;  3IP0 A;  3N5B A;  3FMB A;  4LRB A;  1SJ1 A;  2XYG B;  4ECW A;  1XMO J;  1HR0 F;  2OH2 A;  1EB0 A;  1FK9 B;  3I31 A;  5GAG I;  4NXM F;  3I87 A;  1VC5 A;  2HFV A;  1FX4 A;  3AQP A;  3P3D A;  4FKY A;  5FD1 A;  4ETZ A;  5MAO A;  2MGZ B;  2IHR 1;  5B09 A;  3PIP Q;  4DL2 A;  2HHV A;  1KQS R;  1WHV A;  4DL7 A;  2OD4 A;  2G0C A;  5D4P A;  5KFG A;  5H1S V;  1VQ7 S;  1MMN A;  4KPC A;  4F2S A;  2HFU A;  1HQU A;  5GAD U;  5KFV A;  5M2R A;  2XY5 A;  3GR0 A;  4XO0 A;  3PV8 A;  2ZD1 B;  2HQI A;  2HQC A;  1N6Q A;  1JLB B;  1SQE A;  1SC3 B;  1VRU A;  2ABY A;  2DBB A;  3HVW A;  4GC7 A;  1EJ7 L;  1R0A A;  1NK8 A;  2W2N P;  4LUB A;  3FSX A;  4LF4 J;  3ILL A;  2OPQ B;  4O4R A;  4USH A;  4XTT A;  1KQG B;  3WZ0 A;  3MTK A;  1IKY B;  2HVE A;  2L9D A;  3T1A A;  3BO3 A;  1F3F A;  3I5C A;  3DI6 B;  1Q81 T;  4YR2 A;  3C3L A;  2RJZ A;  3DU6 A;  3LO3 A;  2DKO B;  2BXJ A;  3RAQ A;  1JWW A;  4PUO A;  4OYX A;  3CUN A;  1CPZ A;  3SYZ A;  2GGP B;  2ZBP A;  4ED0 A;  1X4G A;  3AJD A;  2WSC C;  5CZV A;  1YKW A;  8ATC B;  4B9N A;  1REV B;  4J9S A;  1X5O A;  3E51 A;  3HZE A;  2KJW A;  4FXW A;  3CIZ A;  1AUS L;  5F8H A;  5EDW A;  3TAN A;  2ADC A;  4NCA A;  3TUP A;  4UOF A;  4F02 A;  4ZVS B;  3ZZP A;  4B9T A;  2CPI A;  3CW2 C;  2HHH J;  3QQC D;  5DDO C;  4X2B A;  3J80 U;  3ILJ A;  2IVY A;  2CJK A;  3GIM A;  1KDN A;  4L3N A;  2MZR A;  2Z2M A;  2F7V A;  4Y65 A;  4ZIW A;  2HS0 A;  3A8J A;  1C1B A;  4NLQ A;  3SZ2 A;  3Q0A A;  1GTE A;  5GAG U;  1HWJ A;  4ELT A;  1EKS A;  4TXS A;  5KFZ A;  2WHO A;  1U49 A;  3FQK A;  1B99 A;  1A0O B;  2B4U A;  3SBM A;  3WQP A;  1B3T A;  5HRO A;  1KRP A;  4DV2 J;  1TKZ A;  3HSZ A;  2YWH A;  1NO8 A;  2DO4 A;  1RT3 A;  4HI2 A;  4MIB A;  4M5D A;  4TQR A;  3Q22 A;  3CD6 S;  3V6D B;  2J7K A;  3PYE A;  1K1S A;  1S7I A;  3CD5 A;  3M1V A;  4E98 A;  5GAD I;  2CQ0 A;  1HNI A;  2CPH A;  1K0V A;  1NH8 A;  2O66 A;  1DJ0 A;  1D3W A;  1S12 A;  3CO0 P;  2MLX A;  5ETV A;  4X4P A;  1S48 A;  3PIO Q;  4DFJ A;  3MCM A;  4G3I A;  2B4P A;  1MG7 A;  2Q3P A;  2E1M C;  3HCX A;  5A8R A;  1UEV A;  3U27 A;  1CSJ A;  1UP1 A;  2AP6 A;  4LIW A;  2R7X A;  1SUQ B;  4DX6 A;  1HYS A;  1FDA A;  4A8W A;  1B0P A;  1U09 A;  4XK8 C;  3GTY X;  3OLA A;  1MML A;  1UA1 A;  2FVP A;  3VHQ A;  2RQ4 A;  2PGC A;  4JI0 F;  4TU8 A;  4OI0 A;  3FSY A;  5ETQ A;  3QFW A;  4OZJ A;  2R7R A;  1HBO A;  3D54 A;  2HK2 A;  2F8M A;  2Q79 A;  3MMB B;  5K5M A;  4IRC A;  2OEM A;  4EEY A;  1T9T A;  3QJL A;  4DL6 A;  4RU2 A;  4DN0 A;  3HKZ D;  3R6G B;  5EWF A;  2MMY A;  2DIU A;  3GYG A;  3KFW X;  3W7B A;  3UR0 A;  1NJX A;  4FXD A;  3OUY B;  3PYF A;  1ZAX A;  3UNG C;  3IC1 A;  3CF5 Q;  2RML A;  4CRJ A;  4DPX A;  3IO1 A;  4PQA A;  2CA9 A;  4HHH A;  5AXK A;  5HMZ A;  2BKN A;  1NEE A;  3E01 B;  3TO8 A;  1H72 C;  4AL6 A;  4UW2 A;  2E7V A;  1DLO A;  5KT3 A;  2MKI A;  4YB6 A;  5KOW A;  5J1E B;  2LEB A;  3D6F B;  4EK2 A;  3MEE B;  1W7W A;  3AAW B;  3TI0 A;  4WFX A;  3CPW R;  4KFB A;  2K7J A;  3W62 A;  2QO3 A;  1UW9 A;  5BYS A;  2AJQ A;  1LEO A;  2PEH A;  1U0H A;  3IWL A;  4FZV A;  4RW8 B;  4JV5 F;  4ZPD A;  1S1V A;  4Q8F A;  2I0X A;  4Z37 A;  3LAL A;  5CA5 A;  2R2T A;  3CCJ S;  3ZZ0 A;  1E6V B;  5CQG A;  5KTQ A;  1U1K A;  2OML A;  1FT8 A;  4KV8 A;  3BGU A;  5D15 A;  1FJ7 A;  1GAO A;  4ZDN A;  3RB4 A;  1B7F A;  2B3T B;  2ZNZ A;  2VQF J;  2ILY A;  3KKF A;  3QGH A;  3PXG a;  5KG5 A;  2B4O A;  1WUU A;  4J37 A;  3P5T L;  5M2U A;  4NI2 B;  1Y3J A;  4FNI A;  5GME A;  2APO A;  2HVI A;  3LWM A;  3GB0 A;  1NU4 A;  3HDS A;  1WC6 A;  4CH0 S;  3U1L A;  3KHG A;  4Q7A A;  3GP9 A;  4O44 A;  3QT7 A;  1UWB A;  1AZS A;  3TR5 A;  4MK9 A;  2RD5 C;  2Z4P A;  3BQ0 A;  2FY1 A;  1DFD A;  4M63 A;  1TL7 A;  3FSI A;  4DSE A;  3NMA A;  2L9W A;  2Y1R I;  1FFG B;  1VIX A;  3IM8 A;  4L76 A;  5KFN A;  5H9E J;  2AYB A;  3L95 X;  4JI1 J;  1UWB B;  2EKY A;  1WDD A;  3C8Y A;  1PSD A;  3D0G E;  4HI1 A;  2M5Y A;  1ZM9 A;  3I5B A;  4NLO A;  4TY8 A;  3D3B J;  4WCE Q;  2QFJ A;  2I2Y A;  2QTW A;  2WVC A;  3OFE A;  4JI8 F;  1NK7 A;  3FQL A;  3PX6 A;  1EKR A;  2B5J A;  4ED2 A;  2B6A B;  1N6Q B;  4QU6 A;  4CM2 A;  2CXE A;  1VBY A;  4B3M J;  1UFL A;  3KG4 A;  2KG0 A;  2EFQ A;  2RIL A;  3LUY A;  4M5J A;  2XMA A;  2XUL A;  2R4F A;  3OVA A;  3PRB A;  2HRT A;  3PG9 A;  1SV5 B;  1T94 A;  2DHX A;  2E44 A;  4UY8 T;  4XIU A;  4WK1 A;  6AT1 B;  3K7R A;  2EK1 A;  5C42 A;  1TL3 B;  3GG1 A;  1ZBT A;  2V0N A;  4WBF A;  5LXY A;  1RT4 A;  2CZ4 A;  3G87 A;  3VAL A;  1KOH A;  2XM3 A;  4EYI B;  2R7T A;  3TVK A;  2AWZ A;  1PYT A;  1NDC A;  3FJ2 A;  3LOU A;  5D8H B;  5HBM A;  3ONQ A;  2LEP A;  3GYX B;  1QUP A;  4BHQ A;  4OHX A;  2ZHO A;  3TQ1 A;  4DL5 A;  2EG1 A;  4UOH A;  1ULR A;  4PEO A;  3TYT A;  1IJE B;  2CJX B;  4P52 A;  1LWC B;  4O44 B;  3V2U C;  3HT3 A;  2V69 A;  1QD1 A;  4L75 A;  1C4A A;  5JVG Q;  4PKD B;  1IQT A;  2ZH3 A;  4MKV A;  3R8Y A;  1CJU B;  5B0B A;  2ZH1 A;  5AE3 A;  1FDN A;  4NI2 A;  3MPU B;  2XCP A;  5KT6 A;  1C1C A;  2OSR A;  2EKN A;  2JLE A;  5K8O A;  4NLP A;  2QYG A;  2E1P A;  1UAW A;  2J76 E;  4H54 A;  3ENQ A;  1G4C A;  1IR0 A;  2QMX A;  2DJW A;  4RW7 A;  4PXD A;  2PT0 A;  4OYM A;  5H9F J;  1TL1 B;  3BBC A;  3D1O A;  2DY1 A;  2HIQ A;  4FNH A;  4LRE A;  3THT A;  4DX8 H;  1J2V A;  3NS7 B;  3TAR A;  2CPX A;  3M6U A;  2DGX A;  5KFY A;  1HYS B;  2ZKT A;  3POT A;  1S1V B;  1HHT P;  4URQ U;  4NXN F;  1B70 B;  3J7Y U;  2AJ4 A;  2NS1 B;  1JX4 A;  4RW8 A;  5ETM A;  4RUA A;  4OI6 A;  4F3M A;  4KFB B;  4R5P B;  1Q7Y T;  1NUE A;  4CLS A;  3V81 B;  4ECU A;  2CNN B;  3EDQ B;  1LWF B;  2C2K B;  2LA4 A;  3OR1 A;  4LR8 A;  5HAO A;  5KG2 A;  3ITH A;  3OBI A;  3Q23 A;  5LMN J;  1SJQ A;  3D1H A;  1T03 A;  1QUV A;  3KJF B;  3NS6 A;  1RT3 B;  4OHV A;  3OJS A;  2X1G A;  4LRC A;  3QGG A;  4DX7 A;  4NA3 A;  4X4R A;  4DR7 F;  1I94 J;  4Y34 A;  2FHK A;  2P9C A;  2EFN A;  2CJB A;  2UU9 F;  3CJ0 A;  3GON A;  1N0V C;  1DTT A;  2G2Z A;  2SXL A;  4DG1 B;  3PRV A;  1FNO A;  1T0T V;  2Z57 B;  2MQP A;  5EN1 A;  3I56 S;  2E5L F;  2GIR A;  2EWH A;  4ITS A;  5AXN A;  3RBX A;  3F41 A;  4G1I A;  4NCB A;  2LVW A;  1UCN A;  5D6G A;  3P8B B;  3UD4 P;  4HR2 A;  3UFC X;  5J2Q A;  2VON A;  2JEI A;  2XSF A;  3H4B A;  3NY0 A;  1H38 A;  3MPY A;  2F5G A;  3DFE A;  4PG4 A;  2GHW A;  4U8Y A;  1C0T B;  1KTV A;  3TP2 A;  2EI5 A;  3SI8 A;  4EO6 A;  2BOP A;  4GKJ J;  3GLJ A;  1FKP B;  2HFS A;  3AA9 A;  1JLA A;  3CCZ A;  2AEJ A;  2VQE F;  1WKK A;  1F0X A;  1SH0 A;  4MTP A;  3C16 A;  4AND A;  2GVD A;  1VRQ C;  3MWB A;  4IH5 A;  4TLR A;  1WC4 A;  4B3T J;  4PUO B;  2KTQ A;  2EEY A;  3V6D A;  4ZJQ A;  2M88 A;  3LP1 B;  3MR2 A;  5SZT A;  5KG0 A;  2BRK A;  1NB2 A;  1IKY A;  5HRO B;  4Y2C A;  3RRH A;  1JLC B;  2OAU A;  2N7Y A;  2DIV A;  1VQM S;  2HGM A;  1GX5 A;  3GCX P;  2VOD A;  2KN4 A;  3DHX A;  4EGL A;  4RLE A;  4U6P A;  2VOO A;  2G4B A;  5IV3 A;  2XCA A;  3N9U C;  4WKY A;  4OYP A;  3IAM 9;  3FFI B;  2V4J A;  2YKA A;  4TYA A;  3TEG A;  1UFK A;  1FF2 A;  3I9V 9;  3MMA B;  4QWD A;  1W2B R;  1HI0 P;  3MM5 B;  1L5U A;  2V8P A;  5IS2 A;  1OMS A;  3QPI A;  4HTI A;  1HNZ F;  1UFW A;  3IGV A;  3Q2S C;  3KTQ A;  1LFW A;  3OTB A;  5DLG A;  1XMQ F;  1YJ7 A;  3JAM Y;  4WFN Q;  2XI2 A;  3MFI A;  1N32 J;  2WON A;  4WK3 A;  1KEK A;  1WC5 A;  2K3I A;  1CJK A;  1RU1 A;  2LCW A;  2GAG C;  3JS9 A;  4UZB A;  5A6W A;  1JLQ A;  2EFO A;  3GV5 B;  4JI6 J;  3E2E A;  4FS2 A;  4I1T A;  4OZ3 A;  4CLT A;  3T5K A;  2NR0 A;  1TQL A;  2XMK A;  4DSJ A;  2ZBR A;  4JI5 F;  5I42 A;  2GVZ B;  1YIJ S;  1N36 J;  2DGQ A;  3DM2 B;  3NGK A;  3AB2 B;  3D3C J;  4Q2L A;  4QR2 A;  2NPF A;  5HSP A;  4I69 A;  3GV8 B;  4DV2 F;  1TFY A;  4B02 A;  3A13 A;  1MNE A;  1X9S A;  4FN5 A;  2D3O R;  2E29 A;  1X31 C;  5D0H A;  1VRU B;  3D9B A;  3UN3 A;  3CJT A;  1S49 A;  2MQO A;  2D3O 1;  1RT7 A;  2BE9 B;  2PSZ A;  1X0F A;  3SCK E;  1TK8 A;  4J91 A;  3M05 A;  2HVH A;  1YBA A;  4FYV B;  3NGU A;  5ETT A;  2V63 A;  2XEX A;  2A6O A;  2HHH F;  4OX6 A;  4K4S A;  5CZX A;  3MFH A;  5F3T A;  2GJF A;  1RWO B;  3PR5 B;  1F9E B;  1O51 A;  1S59 A;  3HZG A;  3V4M A;  1Q86 T;  1J5O B;  3AT1 B;  1OWX A;  2QSF A;  3VAH A;  4DV4 J;  1RAC B;  4A4J A;  3G6V A;  1Q82 T;  1VGY A;  2IJR A;  2LQ8 A;  2C2M B;  3FKB A;  3DOL B;  4MIA A;  3FRY A;  3ZZO A;  3CJR A;  3X3U A;  1S6U A;  1URN A;  5M2P A;  3BSA A;  3BKF A;  3IGN A;  1HQE A;  1SIW B;  4X4O A;  4NXN J;  1D8Z A;  2RKI B;  2V67 A;  4HVZ A;  4KHM A;  1CVJ A;  2ZZN A;  1KLM B;  1UVK A;  4IO9 Q;  4QIG A;  5B0F A;  2JZ5 A;  3U7J A;  2GV1 A;  3CC4 S;  4NA2 A;  1RP5 A;  3H42 A;  1K8A T;  1DTQ A;  1SKU B;  3GU0 A;  2DXE A;  2DIT A;  4OJ3 A;  2IA0 A;  4PG6 A;  2OTJ S;  4QIW D;  5GAE I;  2GIQ A;  2VKR A;  1Q5Y A;  3IS9 A;  2Q43 A;  1UPP A;  1VQY A;  3HF5 A;  3WIU A;  2J0Q D;  4QWC A;  1K9M T;  3HHE A;  5E3Q A;  3KK2 A;  3TVZ A;  3QJJ A;  4RW9 B;  3TNV A;  2LKZ A;  1TEL A;  1RYS A;  1RZM A;  3MHY A;  1JLE A;  4RW7 B;  4CLL A;  5LXR A;  4ILM A;  4JI4 J;  5I3P A;  4O3O A;  2FLN A;  4B3R F;  5HVH A;  3PR4 A;  5A2Q Y;  5CHC B;  2MQL A;  1OJ4 A;  4LMZ A;  1NB7 A;  3P96 A;  1KHV A;  2B7B B;  2DRD A;  3DRR B;  4JOU A;  3W64 A;  2R8G A;  3NNA A;  2IAJ A;  4YR3 A;  2VJV A;  4PPD A;  3NBP A;  3MAH A;  3MM9 A;  1H2U X;  2VZ9 A;  3EGZ A;  3KK1 A;  3DLE B;  3FBB A;  3KJV B;  1SJ4 P;  1S6P A;  3I5A A;  1YGY A;  5IC4 B;  1KON A;  2LXF A;  1QAI A;  4RO0 A;  4WWS A;  1VC6 A;  3BR8 A;  1C4C A;  3B82 A;  3M9M B;  1HNW F;  3HM9 A;  1SBR A;  3K8V A;  3KMS A;  3OFG A;  1CUL B;  2NZC A;  2MHE A;  2WRM A;  3DRR A;  3HJF A;  4ID5 A;  5F0W A;  2E1A A;  2YNG A;  2H5J B;  3BM7 A;  4IOC Q;  3CCW A;  1BC6 A;  3V6J A;  2BM0 A;  1OPI A;  1RWM B;  1YX2 A;  2MLY A;  4RWX A;  4ZPC A;  3VAF A;  1EIY B;  3R5J B;  3VTI A;  2EBE A;  4JYA F;  2OSQ A;  1SV5 A;  4C8Y A;  1ZZF A;  1FRX A;  1T02 A;  1VHF A;  3WX8 A;  4K7Q A;  3BZQ A;  1OYE A;  1HWU A;  3TAQ A;  3OSP A;  4F3O A;  2L08 A;  4NLU A;  2DGW A;  1PBU A;  4ED5 A;  4M95 A;  3M8P A;  2G1H A;  2C28 A;  2R8I A;  2M0G B;  5L9X A;  3HHL D;  1FJG J;  1GT8 A;  4C0B A;  1RBA A;  2C1E B;  2HW3 A;  2MY7 A;  2QLF B;  1MRO A;  3GJQ B;  2RU3 A;  2DIS A;  2OEJ A;  1QAJ A;  2CJQ A;  3GFH A;  4I2Q B;  3QBC A;  3CD7 A;  3ZTS A;  1RI7 A;  3PNI A;  1GTH A;  4IH6 A;  1K0T A;  1VLO A;  5KG6 A;  4AE5 A;  2OEL A;  3SDE B;  2AF6 A;  5LT5 A;  3OV7 A;  2JC1 A;  1AA1 B;  1RTI B;  1VRT B;  3R5A A;  3CCT A;  4USW A;  5HO4 A;  2ZHB A;  1QSY A;  3SEO A;  1RAA B;  2QMU B;  2E5H A;  3DDI A;  3K5N A;  3IR6 B;  4EBD A;  1VDH A;  2DVI A;  3N6L A;  2NPI A;  2UUC F;  4JI4 F;  5LL6 d;  1WOP A;  4DSK A;  2R7Q A;  4O3Q A;  3MMC A;  3U1N A;  2G13 A;  4I6A A;  2HBY B;  2KU7 A;  2G2O A;  3BS9 A;  3IRX B;  4LSL B;  2KZZ A;  3MM5 A;  5FLX U;  1VQ4 S;  4QYR A;  2KHD A;  2Y8Y A;  1BQN B;  1XEZ A;  3EM1 A;  3N6N A;  2J7W A;  3FFI A;  1L3U A;  1TUG B;  1WSR A;  3KG1 A;  3L09 A;  1QSS A;  3KK3 A;  2MYF A;  2DGT A;  2V50 A;  3H90 A;  2RQM A;  2PDA A;  3CJK A;  3VR1 A;  3P6Y C;  1WDT A;  1VK8 A;  3R5G A;  4DR6 F;  1FKA F;  2ALY B;  1U0H B;  2Y0B B;  3JSR A;  2YNH B;  2IC3 B;  2J5A A;  4WE1 B;  3MEE A;  2HND A;  1S6O A;  3N01 A;  3RUB L;  4HEA 9;  4WYL A;  2Z56 B;  1DLO B;  2EFP A;  2QC3 A;  2CJ9 A;  3KLE B;  2DRB A;  4UTG A;  2DXF A;  3CJK B;  1GMU A;  1RBL A;  2K2P A;  4J9Q A;  4BDP A;  1M5K C;  3EXC X;  4CCH A;  1KN6 A;  1U4B A;  1WNE A;  3OHB A;  2W9B B;  1D8Y A;  4LFB F;  2ZVS A;  1WSV A;  3H40 A;  2PD1 A;  5F9L A;  1QTM A;  1WOO A;  4P2M A;  3HMJ G;  2C2N A;  4P2X A;  3W61 A;  3WIV A;  2EPI A;  4FF3 A;  2ZEJ A;  4YP3 A;  3MED B;  1SL2 A;  4V19 J;  2H4Y B;  4GO7 X;  2AYG A;  4WTY A;  2XS5 A;  2QYC A;  2ZZM A;  4DR6 J;  4PWD A;  4PG8 A;  2HFZ A;  4NYO A;  3UW1 A;  4LRF A;  4TKT A;  4ZHR A;  4F50 A;  4IRK A;  3BBF A;  3P4U B;  2DB1 A;  4LQ9 A;  3CMA S;  2GJ2 A;  1RSC A;  2FJW A;  1SVD A;  1V3Z A;  3M30 B;  4O3P A;  4RJV A;  4IYQ A;  4R8U B;  3JQM A;  1ZTW A;  1U1Q A;  3V5R A;  3TJ9 A;  4URS A;  4ZVP B;  2MQQ A;  1T9U A;  1NDL A;  4TNO A;  3EYZ A;  1C0T A;  3SV4 A;  4IFV A;  2HWT A;  4ANE A;  1RA6 A;  3QNW B;  5LJ5 Y;  5HI7 A;  2FVR A;  1WTF A;  3O1L A;  5KG7 A;  2FJX A;  2I5J A;  1QDU B;  1QE1 A;  3HVA A;  1H74 A;  3R6L B;  2AIR B;  2YQ3 A;  4CO5 A;  2L41 A;  3KHR A;  4ERD A;  4DF8 A;  4JI3 F;  1UEK A;  2HS3 A;  4R0J A;  1NCL A;  3QSY B;  3LAK A;  4M94 A;  2FJA B;  1REV A;  3BSO A;  2PA3 A;  2VBZ A;  2G2Y A;  2W25 A;  2OTL S;  1KTQ A;  3FRZ A;  4CNY A;  1HA1 A;  2AT1 B;  1B64 A;  2HG4 A;  3SFG A;  3MM6 A;  5KFL A;  2P5V A;  2GIF A;  3OFH A;  3GSD A;  5HMY A;  5IM0 B;  3KK1 B;  4B3T F;  5HBM B;  2NQP A;  4LR7 A;  2PMZ D;  3CCV S;  2ACM A;  2UP1 A;  4ECX A;  2UUB J;  1VIS A;  4ECT A;  4KJI A;  2CNL B;  4FYW B;  2H3E B;  2M7S A;  4P7V A;  1FWP A;  4IOB A;  2DNH A;  1QLN A;  3HK2 A;  2YWF A;  3R7N B;  2DNP A;  4CT8 A;  1YJV A;  2VC1 A;  5DRK A;  4ZVG A;  2EW9 A;  1L3T A;  2Y8W A;  4OHZ A;  3A8I A;  4Y3C A;  1HNW J;  4Q5V A;  4MK8 A;  5K14 B;  1XBW A;  3NGT A;  4LF6 J;  1RAH B;  1M5O C;  1HQU B;  1PYO B;  3H5X A;  2F4V F;  4GC6 A;  3LPY A;  5K9F A;  1UKU A;  2FHJ A;  3T19 A;  2BE2 B;  3QO9 B;  3VQT A;  2MGZ A;  1C1C B;  2C3U A;  4I6W A;  2HHU A;  3M2U A;  4WFY A;  5HP1 A;  1I94 F;  2NUU G;  1KOO A;  1JXV A;  5LJ3 Y;  3ETO A;  4LVO P;  2HAI A;  3S8S A;  2OHD A;  4K4W A;  4ZLL A;  4DHV A;  5DDR C;  1RAD B;  4X4T A;  3RB6 A;  1AUD A;  5E7O B;  2RH3 A;  2CQC A;  5GMK a;  1BGX T;  1HQE B;  2MZ1 A;  3TA0 A;  1WG1 A;  5HK4 A;  2I8E A;  3AY0 A;  1FRK A;  4L73 A;  2VC0 A;  2EC2 A;  1LWX A;  2X3D A;  2P2C B;  3QSI A;  4ZJO A;  3DOK A;  3Q8S B;  1VOM A;  1SC4 B;  4OV1 A;  4AQY J;  4PYD A;  2CG8 A;  4QZV B;  5C42 B;  2DT9 A;  3IWN C;  4GKK F;  3C6T A;  4USK A;  1NK9 A;  4CH1 A;  1BE4 A;  1IM6 A;  4ALZ A;  2BE2 A;  3QO9 A;  1KBR A;  3OR2 B;  4ELV A;  1HD1 A;  1QJH A;  3RW6 A;  1LXN A;  1WF1 A;  2HMI A;  3DHW C;  2C2Z B;  4NAS A;  2FB0 A;  3MZI A;  2MKY A;  2D1C A;  3L4B C;  1P27 B;  4KKO A;  1MLA A;  2YNI B;  5LSL A;  2E66 A;  5T14 A;  3LA0 A;  2VPX B;  3CJ4 A;  3WDO A;  4MJK A;  3UDV A;  3A1Y G;  4O4G B;  1MU2 B;  1DQA A;  2GNK A;  2V2Z A;  3CED A;  5FDL A;  5CAA A;  3F44 A;  2AU0 A;  1VLY A;  3CJQ A;  2B9X A;  5DQI A;  3BKU A;  1PGZ A;  5H9F K;  5J1E A;  4WU3 A;  3MM6 B;  3Q8U A;  1LK7 A;  2CVE A;  1NJW A;  4HDG A;  2CJY B;  3CO9 A;  1G7C B;  4HDH A;  4KGK A;  4YHH F;  1VQK S;  1VQN S;  2XTJ P;  1NSP A;  5DGB A;  4OMF G;  1ELO A;  4DQS A;  3NNC A;  1CJK B;  4QJV A;  1WC1 A;  2OUG A;  2AEF A;  3M2U B;  4JI2 J;  2FHO B;  3PYG A;  3CCQ S;  2WOM A;  5CYM B;  1EAR A;  5DO2 A;  4WFA Q;  1H2T Z;  3AOD A;  1LW0 B;  3NCR A;  3NWR A;  2GX8 A;  3MM8 B;  4ID8 A;  2V5H G;  4HH0 A;  4Y2K A;  5MLC V;  4K0K J;  3HVR A;  1NKB A;  3LTO A;  2KYX A;  4LVN P;  4IR1 A;  5K14 A;  1QE1 B;  2XHC A;  3M8S A;  4I2P B;  2UUB F;  4Y2M A;  3QID A;  5AJ3 J;  5CH7 B;  2ZHA A;  2YBV A;  3T6J A;  1M5H A;  4G1Q B;  4HHJ A;  4I7F B;  2W2O P;  3MR5 A;  4LFB J;  1M5V C;  2Z2Z A;  4K4Y A;  2R7V A;  5IZH A;  1LKZ A;  4CTA A;  2ZDO A;  1ROF A;  4HT7 A;  2W8K A;  1Y9O A;  5ETK A;  1S5Z A;  3T1H F;  3CJ5 A;  4E0D A;  3CMQ A;  2WSF C;  4K5S A;  2XBP A;  3LQV A;  4OZN A;  2ALZ A;  2YVS A;  3R3T A;  3FUY A;  3EZU A;  4ELU A;  1N48 A;  1TTH B;  4DV7 F;  3O3L A;  1Q78 A;  2IRY A;  3JAM U;  3QZ8 A;  3S6E A;  2X1A A;  1H6K X;  4LF1 A;  3EZ5 A;  3OUY A;  3M6W A;  4LBH A;  1FEE A;  3FBE A;  3NAH A;  3CIM A;  1PAE X;  4NYZ A;  4ZHR B;  3AH6 A;  4YFU A;  3WC2 A;  5KFA A;  1PC5 A;  1NDK A;  2MEW A;  2YKM B;  2WB1 D;  1HBO B;  2A3J A;  2CQ4 A;  3NP5 A;  1F60 B;  2HQG A;  4F0H A;  2F8E X;  2VPW B;  5ETR A;  5H9E K;  1F2G A;  1NBE B;  3KDO A;  4LBP A;  1KQK A;  4ICL B;  5DQH A;  3CB4 A;  3D4J A;  1UEU A;  1IBK F;  1LW0 A;  1SH2 A;  4H4O A;  4N8N A;  3ULH A;  4ZCI A;  2PFF B;  1TV6 A;  4OLO A;  5A8K B;  1U0S A;  2YKQ A;  4X64 F;  2J9E A;  4EWT A;  2CQI A;  4I0W A;  2JEF A;  4DFM A;  2LMI A;  1Q8L A;  3WBZ A;  1S7H A;  2LXU A;  5HVG A;  2ZUA A;  2ZE2 A;  5GAH U;  3M1V B;  3PEH A;  3M30 A;  4JI2 F;  2ZM6 J;  1FXR A;  4IG0 B;  2BX6 A;  2YNH A;  3DMJ A;  2E5L J;  2KT3 A;  4M5D B;  5J1P A;  3BDP A;  1X4D A;  2HRU A;  3H7H B;  3CNQ P;  4CTA B;  3KLH B;  1CQN A;  3DU5 A;  1TR0 A;  1GMV A;  4WII A;  4X64 J;  4PWD B;  2DD8 S;  3POT B;  4HAC B;  4CWB A;  5K20 B;  3GV7 B;  1RGV A;  1SKR A;  4DUZ F;  2RF2 A;  2J0S D;  3MMJ A;  4I2P A;  4DR1 J;  4YOE A;  2IRU A;  2HBZ B;  2JNJ A;  2N7C A;  2UUA J;  3I96 A;  4Y2A A;  3ZZR A;  4CO3 A;  5KFJ A;  5HVF A;  3RRK A;  2XYH B;  2HMI B;  4PXB A;  3GR1 A;  4ED4 A;  1X4B A;  3C6U B;  3MAQ A;  2HNZ B;  3ET6 A;  5ETS A;  2P6T A;  3RAX A;  3H98 A;  4K4Z A;  3W5Y A;  1S97 A;  1XR6 A;  3TZZ A;  3T1Y J;  2DHH A;  2FDN A;  4UOG A;  3OL6 A;  1U8W A;  4PQU A;  5I3Q A;  1N33 F;  4DU8 A;  4M5G A;  2IYG A;  1V9O A;  3I32 A;  1HNX J;  1X5P A;  1WI8 A;  2HQF A;  3DXB A;  4ES2 A;  4ED6 A;  3PW2 A;  2DHG A;  2DGV A;  4DEZ A;  2K8G A;  1D0E A;  2QEX S;  4EYH B;  8AT1 B;  3VAK A;  1WC3 A;  3VAI A;  1YZ7 A;  2XLI A;  5HQ8 A;  2DR8 A;  4N76 A;  3DOM B;  2Z2L A;  3B4D A;  2ZVI A;  3EMT A;  5A0Y A;  3KK3 B;  4C8L A;  2Y9H A;  1XNR F;  1T9X A;  3K5O A;  2O3D A;  5E0O A;  3FVY A;  4O0I A;  3R1L A;  3L7U A;  2VAS A;  2B43 A;  4DS4 A;  5E5N A;  2M9K A;  1IKX B;  1CS4 B;  1PJ7 A;  2FYX A;  1RAF B;  2KG1 A;  3J7A N;  3VGU A;  4WXW A;  4CIO A;  3AD8 C;  1YBT A;  4HH1 A;  2W9C B;  5I3U B;  2BW2 A;  1DQ8 A;  1VQ9 S;  4CLZ A;  2D7S A;  4A8F A;  2NCK L;  1VJW A;  4MKB A;  4TU9 A;  1CJV A;  2CZ9 A;  5F8N A;  1S1T B;  2HGN A;  5ETL A;  5FLX Y;  2F9J A;  2HBQ B;  1F9H A;  4DR5 F;  3BH6 B;  2HHQ A;  2JOQ A;  2VHG A;  3MUM P;  3QZ7 A;  2IDL A;  4Z7Y A;  4N5S A;  4NLW A;  1SC1 B;  2O5D A;  3BB5 A;  4NOH A;  4EU0 A;  5IQ6 A;  4TU7 A;  2IY5 B;  4IG3 B;  2MZJ A;  5IT4 A;  4C8K A;  2QFI A;  3R5D A;  4ZPW R;  2W2M P;  4AXJ A;  2XLK A;  2QLX A;  2FTR A;  2C3Y A;  1RT6 B;  2ZOF A;  5CCL A;  5E41 A;  2DH8 A;  1HHQ A;  2JVR A;  3CJS A;  2ZH4 A;  2PI4 A;  1TKD A;  2CZV C;  4AT1 B;  4H4M A;  4ZN1 A;  4TQS A;  2Z58 B;  1X8D A;  3R2D J;  2IM0 A;  1S1W B;  2XMJ A;  3P5B P;  2RDD A;  2GW8 A;  4KV8 B;  3MUR P;  4UUX A;  1FO1 A;  1O6X A;  1ZET A;  4Q44 A;  2MQ8 A;  4K50 A;  2OD6 A;  4F8R A;  2GQ2 A;  4JI7 J;  4Q0B B;  2P6S A;  4ECR A;  1RT6 A;  4RW6 A;  2DNL A;  4RZR A;  4P72 A;  4C3M A;  3DRX A;  1JJH A;  2PEB A;  3DLG A;  2LQJ A;  2OP5 A;  2DY9 A;  3GSI A;  2YX4 A;  3Q83 A;  1RWU A;  5SUH A;  4DCP B;  1T3O A;  1OS5 A;  5IM0 A;  3NGD A;  2JLG A;  4FYD A;  1MWQ A;  4ZP7 A;  5BJR A;  4DLG A;  1NH7 A;  3MGJ A;  3V4I A;  1TK0 A;  2DR5 A;  2XGP A;  1WEZ A;  2QN6 B;  2OFG X;  4PXC A;  1KS2 A;  4LIR A;  5D0R A;  3HVT A;  2NXJ A;  1FFW B;  1BD6 A;  3J7Z 5;  3NNH A;  4ZLP A;  1FVQ A;  4R25 A;  1W26 A;  2K1R A;  1JNR B;  2CAJ A;  3KDN A;  3CDA A;  3MM7 B;  4WJB A;  2W4P A;  2ZBC A;  5C24 A;  3RZA A;  3T6B A;  3SSR A;  4C3L A;  4DV0 J;  3GFX A;  3M4X A;  3HD2 A;  1O5J A;  3F56 A;  4ZPT R;  2RHS B;  3Q8R B;  2LU1 A;  2H54 B;  4LSN B;  2EXU A;  5IOL A;  4C97 A;  2JHE A;  4QU7 A;  2CQG A;  1U1R A;  1AFI A;  4F4Z A;  2BJ3 A;  3K5M A;  1HNV A;  1N33 J;  3R2C J;  1VMB A;  1X4A A;  1N4L A;  4WTO B;  4BC7 A;  2HK3 A;  4GVB B;  1GQE A;  3QLH A;  5KFH A;  1FKO B;  1BHN A;  3AJ1 A;  4BLG A;  5L1L A;  1U1O A;  3HX9 A;  2PI5 A;  1RT2 A;  3NMR A;  2RKI A;  3TA2 A;  2YTC A;  5F8G A;  2MHN A;  3DM2 A;  4JI0 J;  4DR4 J;  1SIZ A;  2VG7 B;  3CGI A;  2KHC A;  1T9Y A;  1UZD A;  1FJC A;  3N5F A;  3QGP A;  3QT8 A;  1S10 A;  1JLQ B;  5G4D A;  2O01 C;  5BR8 F;  1WD6 A;  4FS1 A;  4J9V A;  2HLU A;  3CCL S;  3GJT B;  2EFV A;  5AT1 B;  4EMD A;  1RTH B;  2WBM A;  2YXL A;  4OHW A;  4IH7 A;  4ZPB A;  2WK4 A;  2WCX A;  4PR6 A;  5G0R A;  1KSP A;  1P1L A;  2QJ3 A;  3DLJ A;  5KG3 A;  3US5 A;  1FJE B;  4IQM A;  5CD4 A;  5CD4 H;  3VAM A;  1HPZ A;  1M1G A;  1RAI B;  2HEK A;  2IJF A;  3KJN B;  4ZVO B;  3JQJ A;  3KYL A;  3LWL A;  1RA7 A;  1T7P A;  1YVF A;  1R0B G;  2FHJ D;  1SJF A;  4LQ3 A;  2FJD B;  4C0H A;  3EJM A;  4OQJ A;  3AOA A;  1J5E J;  4YS2 A;  2JC0 A;  3O6Q A;  3I6P A;  5J2M B;  2ZWP A;  1TKX A;  1K73 T;  1IBC B;  3B6B A;  4ZCK A;  1RWP B;  3LW5 C;  3K2Y A;  3UN5 A;  1HBU B;  4N41 A;  1YQH A;  3TJ8 A;  2MQN A;  2POK A;  3F0N A;  3H5S A;  9ATC B;  1S0V A;  3KMQ A;  3BDE A;  3I4H X;  1Q8B A;  3CJ2 A;  3ENV A;  2OGU A;  1N32 F;  5FJ4 A;  2BJD A;  2OPQ A;  3NGS A;  2R7O A;  1S9E A;  1JLG A;  4NLY A;  5KT2 A;  1R8C A;  1OYD A;  1ZM3 A;  5E2Q A;  1C2P A;  4A8M P;  1WJ9 A;  4F4X A;  1JLB A;  3NOG A;  1OY9 A;  1PCA A;  2IVM A;  2P8I A;  3EIC A;  2WON B;  5LOQ A;  3KHH A;  5J2N B;  2F1F A;  2AD9 A;  2HWI A;  3OTC A;  3VV2 B;  1HI8 A;  2NRE A;  4X66 F;  3H2U B;  2XYP B;  2E1R A;  3O8W A;  4PXE A;  1FEH A;  1R3N A;  4FKX A;  1S9G B;  4ZP6 A;  3K58 A;  4A8S A;  2M70 A;  3W1Y C;  4C6A A;  1RWV B;  4DG1 A;  1N5S A;  2NXN A;  4RBU A;  1FFS B;  3CJ3 A;  1X4C A;  2K1R B;  4IUF A;  1VQP S;  3MR7 A;  5LMU F;  1RTI A;  3KLI A;  1KWM A;  2DH9 A;  5DZ7 A;  2G0I A;  2AEM A;  1NJZ A;  1JB0 C;  3KLG B;  4DZ6 A;  4X65 J;  3FEX B;  1C0U B;  2V34 A;  3IM9 A;  3ITH B;  1U2R A;  1S6P B;  1F5A A;  1N56 A;  1IWG A;  3B8H A;  4C8Z A;  1HFE L;  2E7W A;  1UTA A;  1S6Q B;  3PHT A;  3MM9 B;  1FKP A;  1YI2 S;  1S9F A;  1OY6 A;  3NS5 A;  1GX6 A;  2XO6 A;  1R0C B;  2R7W A;  4GVB A;  3NWG A;  3PX0 A;  1U1M A;  2UXC F;  2HWH A;  1EQ0 A;  4F4K A;  4UZC A;  4IKA A;  1KFS A;  4Q0B A;  1WEX A;  1GMW A;  1CLF A;  5J1N A;  2MZQ A;  4G1Q A;  1HBM A;  2J0W A;  4I7F A;  4MT1 A;  5LM7 E;  5KT4 A;  2ADB A;  3IMQ J;  3C2P A;  1R27 B;  4AL5 A;  3IR7 B;  4UQT A;  3OXL A;  3NL0 A;  3Q8Y A;  4RW9 A;  2UXD J;  1CC8 A;  2Y0S D;  2Q6B A;  3LGM A;  4X4S A;  4CH7 A;  3BEG B;  7FD1 A;  2XS7 A;  3NAI A;  5BR8 J;  1RYR A;  1K47 A;  1ZPV A;  2YNG B;  3JQK A;  1HHS A;  2QV6 A;  4OYB A;  1ZM2 A;  3R9L A;  4CZC A;  3OVS A;  3DRY A;  4C9D A;  1CUL A;  3SCJ E;  1JLF B;  1YRU A;  3N28 A;  2YNF B;  4C7Q A;  2BEF A;  2VPY B;  4DR4 F;  4MFB B;  1GXT A;  1KKH A;  1YJR A;  1T03 B;  5KFF A;  1CJT B;  2VB6 A;  3W5X A;  2CWK A;  4OYA A;  3JXO A;  3PDN A;  2QLJ B;  5ADZ A;  2BQR A;  2E9Z A;  2MKC A;  4PRF A;  2RRA A;  1R8A A;  2HAF A;  2IDE A;  3MCN A;  5E3A A;  4ZIT A;  5BYR A;  1UVN A;  3BRE A;  1MU2 A;  4CT9 A;  1NJI T;  3W9J A;  3JSM A;  1WHY A;  5HAT A;  3UCG A;  3ZC4 A;  2D3U A;  3WC0 A;  4CI0 B;  1U7L A;  4DPW A;  2J6S A;  2YNI A;  2J9D E;  4DR2 F;  4MK7 A;  2HHW A;  2KFN A;  2X1B A;  3O44 A;  1S1X A;  5F8M A;  3ZO7 A;  2L9N A;  2OJ3 A;  2GFF A;  4G1P A;  1TUV A;  1XN9 A;  3BF4 A;  1N52 B;  5L1I A;  5KFW A;  4NXM J;  1UL3 A;  3Q2T C;  2UUA F;  4AQY F;  3EGV A;  2OPP A;  2MZT A;  3CUL A;  1MN9 A;  1RKI A;  5F8L A;  2PN6 A;  5IWA F;  2LDI A;  3M8Z A;  1H2V Z;  1HWL A;  5A8W B;  1X9W A;  3FZB A;  3MEC B;  4DPO A;  1FRH A;  2AZ1 A;  2BQ3 A;  2FJE B;  2NYH A;  3M2V A;  2UVR A;  4NLG A;  4I6Y A;  4QIE A;  5D4L A;  1TU0 B;  3PFE A;  3ILO A;  2IM3 A;  4FVM A;  5EWE A;  2ASY A;  1AYE A;  3LP0 B;  4QIV A;  1C0U A;  2VL1 A;  4PZV A;  5I42 B;  2C42 A;  2GJI A;  3RTV A;  1S79 A;  1L3S A;  5HLF A;  3HD1 A;  1H98 A;  1RT4 B;  1DQ9 A;  1OSC A;  3KLI B;  4FP9 A;  3RBE A;  1YIT S;  1CJV B;  2M52 A;  2YWG A;  3W63 A;  4U7C A;  3T5H A;  4J9O A;  2J9C A;  3DRS B;  3IG1 B;  5KFO A;  2IRX A;  1UJ6 A;  3MPD A;  3J7Y I;  1R7I A;  2RS8 A;  3ET6 B;  1G1X A;  1XNR J;  5KFD A;  4OYI A;  4BBY A;  3DDN A;  4JI8 J;  5B7W A;  2GMH A;  1HW9 A;  2LDY A;  3EDR B;  1TKT A;  2Y3Y A;  4JI6 F;  3UWT A;  1NHU A;  4U7U K;  5CXT A;  3Q8V A;  1KR4 A;  3M8R A;  4OIX A;  4K4V A;  2QE5 A;  1DZ5 A;  4Z7C A;  2CPE A;  2KVI A;  5J2N A;  2AGQ A;  2GQC A;  4ZVE A;  2DPI A;  1APS A;  5EHH A;  2DNG A;  2Z30 B;  1PIE A;  1NKC A;  3JSY A;  2HZA A;  3BPD A;  3D68 A;  3M8W A;  4OJH A;  4J9M A;  1S9E B;  4JI3 J;  1U6B A;  5RUB A;  4DL0 C;  1CQM A;  1QSL A;  1HKA A;  1XIQ A;  4O3N A;  4H4K C;  4MIW A;  1HIY A;  5J2Q B;  5DS7 A;  4YB5 A;  4R0E A;  1AZS B;  1S72 S;  1TKX B;  2YWK A;  2HLT A;  1KFD A;  1JLA B;  1VIO A;  2LXI A;  3PEJ A;  2W2Q P;  3FDS A;  3SCI E;  3SSQ A;  4AYB D;  4RNF A;  2ZJQ Q;  1LNQ A;  3E3X A;  3I0R A;  4DR1 F;  4UT4 A;  1NJY A;  3G6X A;  1Q1K A;  4DQQ A;  2FLL A;  3EXY A;  1ZM4 A;  4HL9 A;  2MTL A;  2DHA A;  1S99 A;  3ZTQ A;  1TP7 A;  3BKT A;  2ZZT A;  3HHL B;  3MMB A;  1ZS6 A;  4KHR A;  4NZ0 A;  5B0A A;  5C25 A;  4MKY A;  1ITP A;  1HMV B;  3ENW A;  4I64 A;  5G0R B;  1Z4U A;  1OQ3 A;  2KRB A;  2PE8 A;  2XNQ A;  3DN9 A;  3M8Y A;  5HJX A;  2ATC B;  2PA8 D;  2V2K A;  2UV8 A;  2H1Y A;  3KG0 A;  3DLK B;  2VFT A;  1BQM A;  2BJ9 A;  2VFV A;  4ZK7 M;  1IBL F;  2RE1 A;  2YKM A;  2HNY B;  3EZO A;  4DDF A;  2X1F A;  2Y1L B;  3BBB A;  4KHP J;  2ZWO A;  1T3N A;  3B78 A;  2L48 A;  3QJP A;  2VIC A;  3TAM B;  4TVA B;  5F8J A;  1EQM A;  2W8L A;  1SKW A;  5DG7 A;  2W24 A;  4A48 A;  2RRN A;  3OXF A;  3A8E A;  2C2R A;  1IR1 A;  2GVD B;  2VV5 A;  4C3K A;  2BJ7 A;  3H5U A;  3NCQ A;  3KUE A;  3G9C A;  3MXH P;  1PJ5 A;  2BAN B;  3D0I E;  1RHU B;  4YY3 J;  2D69 A;  3JB9 k;  3GPA A;  3BN7 A;  2VH7 A;  3TAP A;  4Y28 C;  3CE8 A;  3LP2 A;  2KT2 A;  5D4O A;  1SQF A;  4DV7 J;  3Q24 A;  3QRR A;  2BV3 A;  2HUR A;  2RUG A;  1BXN A;  2ZUG A;  5GMD A;  4QWE A;  3MED A;  3CCM S;  4DFP A;  4DF4 A;  3SQG A;  3DLK A;  4WF9 Q;  1HL6 A;  2YKP A;  5JMN A;  3BGO P;  5L1J A;  2C3P A;  1NZ8 A;  2D74 B;  1NSQ A;  3SQG B;  2XGQ A;  1FE0 A;  3MM8 A;  3JYT B;  2R9L A;  3PO5 A;  1DTT B;  1KNZ A;  4W90 B;  3KUG A;  1RUS A;  1ZZN A;  2MB0 B;  2RAQ A;  1NME B;  2QA4 G;  4Y0F A;  5KFK A;  4JYA J;  4DPY A;  4GKK J;  3D6M B;  1XK8 A;  3N4W A;  4QIF A;  4DV0 F;  2HRY A;  1Z2L A;  2OPS B;  3CCR S;  3R7B B;  1LWF A;  1YRX A;  3DNC A;  4YDX A;  3C15 B;  2ZFH A;  4DWI A;  5GAE U;  1J27 A;  3O2I A;  5C7P A;  3AD9 C;  2QGF B;  5KFU A;  3UE2 A;  2V8H A;  2IC3 A;  4ZCM A;  5DDQ C;  4CLF A;  3FGV A;  2EVZ A;  1RLC L;  3MEG B;  5C5J A;  2HFN A;  4J5O A;  2V4Q A;  5A6P A;  3IBC B;  2BA9 A;  1JK9 B;  3O5T B;  3IA0 A;  1D1U A;  1QTN B;  3BQ1 A;  1R0A B;  1KLN A;  1FRI A;  1S4E A;  1NM2 A;  1IKW B;  2YPZ A;  5LSR A;  3SIP B;  4RBT A;  4BWJ A;  3PJW A;  1D9A A;  2MST A;  2F4V J;  2B8Q A;  3HO1 A;  2AV5 A;  1TKT B;  7AT1 B;  4DLE A;  4JI7 F;  4FPR A;  3JTN A;  4MAK A;  4LF6 F;  3CDW A;  4OX7 A;  2UXB J;  4ZLN A;  4DMZ A;  1RTJ B;  1F3V A;  2CQH A;  2B6A A;  4DJB A;  1GXL A;  3VCD A;  1S0N A;  2ZBI A;  3BGR A;  3LGN A;  4J9N A;  2FUG 9;  2A2C A;  2VA2 A;  2HHP A;  5J2P B;  2WB4 A;  2BQU A;  1VQL S;  2IA6 A;  1FHT A;  4M5N A;  1UZH A;  4TLQ A;  4UST A;  3V6K A;  3A12 A;  3PW5 A;  3KLG A;  1FNX H;  4AD6 A;  1P9Y A;  4CLK A;  1LXJ A;  2FHM A;  3DCA A;  3DI6 A;  4LF9 F;  4WZM A;  4I2Q A;  4CLP A;  2DTJ A;  4K2J A;  5FDL B;  2DYA A;  2FC8 A;  2WW4 A;  2AJ0 A;  3BV8 A;  5DLF A;  3PVX A;  1U47 A;  1TL3 A;  3H0P A;  2ZOG A;  3MEC A;  4KH1 B;  2Q1L A;  1LWE A;  1RHM B;  3M2R A;  2BMB A;  2C3M A;  4NZ7 A;  2NXC A;  3GE9 A;  3G71 S;  4KGM A;  4ED3 A;  4RX6 A;  2CYY A;  2FZG B;  4PPZ A;  2KFY A;  1A7G E;  3QT6 A;  1NND A;  1D09 B;  2EFG A;  2IVF B;  5KOX A;  1RHJ B;  2B0G A;  2AKW B;  2H4W B;  2PC6 A;  1Z1Z A;  2ROP A;  2RU9 A;  3WHI A;  4DN9 A;  2HSE B;  5F41 A;  4OYZ A;  4LFC J;  2JEJ A;  4L6V 3;  3PZP A;  1FJG F;  3UDE A;  2YKO A;  5JJB A;  3Q8Q B;  2XZT B;  1E6Y B;  2DH7 A;  1LWE B;  3OJU A;  1RAB B;  4IRD A;  4OJG A;  1V5V A;  2XSJ A;  4ED1 A;  1T95 A;  1WF2 A;  4TY8 B;  4LT6 A;  4D3G A;  4DPU A;  4Q43 A;  1YRT A;  3DOK B;  4K4U A;  2QG9 B;  2C2O B;  2VKZ G;  4UOC A;  5T7L B;  4A47 A;  4AXI A;  3I0S A;  4GVL A;  1HBN B;  4J9K A;  5E3C A;  2Y1J A;  4EZ6 A;  3SSS A;  2IPO B;  1SJR A;  3IBF B;  3G6Y A;  3P49 B;  1M1K T;  3HKW A;  2E5J A;  3C15 A;  4KSE B;  5D3G B;  2W7A A;  3HSJ A;  4TY9 A;  3DLE A;  2GML A;  5J2P A;  1KD1 T;  1M0S A;  4HLB A;  5KG1 A;  1HW8 A;  2PMW A;  2RNE A;  2HFO A;  3GCW P;  3MAA B;  4DL3 A;  4LF8 F;  4JV0 A;  1N54 B;  2YX7 A;  3PFO A;  4KIA A;  1HNX F;  1RTJ A;  3CDU A;  4QYZ J;  2WAQ D;  1H7W A;  3MUV P;  4F4Y A;  2DEI A;  3R5C A;  3VWS A;  1U2F A;  3NLC A;  3L7P A;  1FNM A;  3H4D A;  1YK9 A;  3CT9 A;  2I5J B;  2XG8 A;  1MMD A;  4A8K A;  4ECV A;  1E6V A;  4OHY A;  3GZ7 A;  5IT9 Y;  4KC5 A;  2GQQ A;  2JVO A;  1WOR A;  2HQD A;  3C19 A;  4CQ1 A;  3H2L A;  2OPR B;  4DV1 F;  3OXG A;  2MKK A;  3OD2 A;  1Q8I A;  4NRU A;  2V8G A;  1N5V A;  4CM0 A;  3EWG A;  2XWY A;  4USI A;  5B08 A;  2KM8 B;  4FBT A;  4IG0 A;  1ZOT A;  4KR0 B;  4NCG B;  1FDD A;  2Q6C A;  4ZA1 A;  4U67 Q;  3OQ2 A;  3CDB A;  2CDR B;  2DNN A;  4KB7 A;  4U8V A;  4X62 J;  1B0V A;  1RT5 A;  4NEY A;  2R2R A;  4L3K A;  3D6H B;  4MYT A;  5JVH Q;  4O3R A;  4DOZ A;  3OPK A;  1RCO B;  1XQI A;  4XAK A;  1TV6 B;  2GAH C;  3B54 A;  5A8K A;  4XPC A;  3BSN A;  2P9E A;  2BR0 A;  4LF2 A;  1TMJ A;  4EI2 A;  5D0G A;  4YUD A;  1AW0 A;  2N4D A;  2VBY A;  5E33 A;  1P9Q C;  5GVQ A;  2FLO A;  5IQQ A;  4RNM A;  2QL5 B;  3M6X A;  2GO9 A;  2JDJ A;  3MI7 X;  2JX2 A;  1HMV A;  2A18 A;  1I1G A;  2QZ8 A;  2ZJR Q;  2Y1I A;  3THV A;  4OZ0 A;  4X4N A;  4NYP A;  2LQ5 A;  4FPI A;  2W9B A;  3CCS S;  3D5M A;  3EVW A;  1RT7 B;  2R3V A;  3LP2 B;  2KVQ E;  1PYS B;  3FBC A;  2GS8 A;  2F9D A;  4ZCL A;  4X65 F;  5HN0 A;  3HP6 A;  1N36 F;  2KH9 A;  3C66 A;  3L7O A;  2V2V A;  2G1D A;  1RDR A;  4K59 A;  3PYD A;  3BN4 A;  5KT7 A;  3KLE A;  3UVJ A;  3QT5 A;  4KY3 A;  3BGL A;  2V4R A;  3DRP A;  1MWZ A;  2VFU A;  3KNG A;  3H5Y A;  4FF2 A;  4LF7 F;  1XWL A;  1AXQ A;  2IM2 A;  2MY8 A;  2Z8Q A;  3M32 A;  4LSZ B;  3IXQ A;  4MH8 A;  4M5I A;  1I3O B;  1T9W A;  2RS2 A;  1S77 D;  1TKZ B;  5JUM A;  5KFM A;  1W25 A;  2H65 B;  2R7U A;  1VJQ A;  2HVD A;  2B51 A;  3RR8 A;  4YB7 A;  4ER8 A;  1TVR B;  2HS4 A;  2KXH A;  2FJV A;  1NK5 A;  1YJT A;  4ED7 A;  3AXM A;  3W2V B;  1X9M A;  3DKD A;  5KFQ A;  1BQM B;  2CPZ A;  2LP4 A;  2ZD1 A;  1U6Z A;  4M8L A;  1YJ9 S;  3ETM A;  4Q45 A;  4DUZ J;  3MOJ B;  1RXO B;  3IRX A;  4WXO A;  5D78 A;  5C25 B;  1YWX A;  1TUW A;  1VC0 A;  2VQE J;  2HKE A;  2JLF A;  2R8J A;  3MMC B;  3NG8 A;  4OX9 F;  2I9S A;  4JB8 B;  2WOM B;  4KRW A;  5KFS A;  4C11 B;  4C2M A;  2RT3 A;  3M6V A;  3QMQ A;  4RL1 A;  3QWU A;  3W8P A;  3ZZU A;  1GK8 A;  2A0F B;  3CCU S;  1K44 A;  3JSB A;  4CLW A;  2N3L A;  1ZTT A;  2AMC B;  2LA6 A;  1VRT A;  1FI4 A;  3ADA C;  4PAA A;  2GGP A;  4U95 A;  5KT5 A;  1JMT A;  2E9R X;  2B9E A;  1IBL J;  2AHO B;  2ZH5 A;  4CNZ A;  2N4C A;  2G0J A;  4IFY A;  2HND B;  3I4P A;  3DYA B;  5ETP A;  1T9V A;  2ROE A;  4ANC A;  3M32 B;  4P73 A;  4DQP A;  1ARO P;  1NZA A;  2PMH A;  1ZH5 A;  3A3P B;  2V68 A;  4O4G A;  3C16 B;  1WHW A;  3JSM B;  4Q8E A;  1L3V A;  5BYQ A;  1AFJ A;  1YSJ A;  1XR5 A;  1FKO A;  2O67 A;  2VBX A;  2XZW A;  5A8W A;  2VUG A;  4DS5 A;  1IKV B;  1OIA A;  3K57 A;  4LFA J;  5AE1 A;  4FF1 A;  1EHW A;  4P6Q A;  3QGI A;  1BQN A;  3TOQ A;  1LK5 A;  2OPP B;  1Y00 A;  4FVC A;  3RB3 A;  1VQ6 S;  1JJ4 A;  2B4V A;  4DXL A;  1TAQ A;  2LU2 A;  1CG2 A;  4LSL A;  4P74 A;  4YHH J;  3H25 A;  1NK0 A;  4L74 A;  2HGL A;  5CYQ A;  3PJ9 A;  4LSN A;  4QOT A;  2R42 A;  3W5Z A;  2LEA A;  3GFZ A;  2GMJ A;  1ZAW A;  4B08 A;  2XMV A;  3DLB A;  4DZD A;  3ZXW A;  1R8B A;  3MM7 A;  4NLR A;  3EGN A;  4XDC A;  2EK6 A;  4ID5 B;  4KGX B;  1FXL A;  3HVT B;  2FVC A;  4DCJ B;  2QA2 A;  1VBX A;  3OT9 A;  2BAC A;  2VF3 A;  1SB6 A;  4WYW A;  4DV3 F;  4I56 A;  1SKS A;  2RHQ B;  2AYM A;  3LPE A;  4P7T A;  1VI7 A;  5E3P A;  3EGW B;  3U1M A;  3MUT P;  2AX0 A;  4IOA Q;  3M2V B;  4ILR A;  5L46 A;  2YNF A;  3UR3 C;  1ZA1 B;  2IFX A;  3V6H A;  1MWY A;  1NSK L;  4ENO A;  2CNO B;  2YH0 A;  2YQ1 A;  3QWP A;  2XC9 A;  2IYI A;  5HP1 B;  1T8E A;  2B7C B;  1RT1 A;  2CPD A;  4X4Q A;  2GHP A;  2BBE A;  1UMJ A;  1VHI A;  3HXM A;  1M5P C;  2FIU A;  3OTE A;  2OIH A;  1F5C A;  2DEJ A;  4NLT A;  1SJ3 P;  4B3S J;  2KKH A;  5EGY A;  4ZP9 A;  2DPJ A;  3CME S;  5KFI A;  3PJX A;  2MZS A;  1ICE B;  1RAJ A;  2D41 A;  4J90 A;  1N5Y A;  2HZC A;  2RUS A;  4B3O B;  2CQD A;  4OX8 A;  4DSL A;  4BWM A;  2LQ9 A;  4KGZ B;  2R8K A;  3W3S A;  4ZIV A;  4C4W A;  3CCE S;  1TMM A;  2W1B A;  4OI3 A;  4O3S A;  4N8O A;  1UVI A;  1KHW A;  4NLV A;  3U02 A;  3TA1 A;  4NRT A;  4QPT A;  2ZNY A;  3QAU A;  3AXK A;  4WFZ A;  2Q66 A;  2NUH A;  3DOL A;  4DV6 J;  2XZD B;  3ZTO A;  2M8D B;  1YG0 A;  1T11 A;  4C8M A;  1RU2 A;  4A8Q A;  1JXL A;  4DQI A;  4KBI A;  2H5I B;  1OPZ A;  1E6Y A;  1SH3 A;  4DV3 J;  3AJ2 A;  5D4N A;  4KPY A;  3HHK A;  1S0O A;  1UVL A;  1JLE B;  1XMB A;  1X7V A;  2E1C A;  2BYC A;  4X4V A;  2KDO A;  1LW2 A;  1DY3 A;  2HBR B;  2VFS A;  1HBM B;  4U9R A;  1R8H A;  4Y2I A;  1SCJ B;  2F4F A;  4GMK A;  1SXL A;  1DTQ B;  1H3D A;  1N34 J;  3M2R B;  5AE2 A;  4JI1 F;  3K0J A;  3T3F A;  3HSG A;  1RJJ A;  3DOM A;  1V3R A;  2XI3 A;  2QL9 B;  3D28 A;  2DR9 A;  1Q7L B;  2LEC A;  3MOZ A;  2BRL A;  2XMT A;  2ZOM A;  4RUH A;  2BKP A;  2CVI A;  3QFH A;  1M5S A;  2KRR A;  3KWM A;  5EWG A;  2NXE A;  3CC2 S;  1V5I B;  2AW0 A;  3TVY A;  3BSC A;  3DC2 A;  3PRD A;  4GRS A;  2DNR A;  1YLX A;  1HLW A;  2DGO A;  2W2P P;  5D0E A;  4BCA A;  3RRG A;  2MKH A;  2CNK B;  3TUI C;  4P9S A;  3M8Q A;  1UJ5 A;  3BH7 B;  3MDF A;  4NLX A;  4ES1 A;  1EZZ B;  3AOB A;  1IXK A;  4QW8 A;  2C2E A;  5I3U A;  4TYB A;  1J5O A;  4C8O A;  1BLU A;  3RGI A;  2XQC A;  5IV4 A;  2UXC J;  2XB2 D;  1S9G A;  3R5B A;  4RUB A;  3KLV A;  2FJB B;  3NGR A;  4EZ9 A;  2JSX A;  3FEZ A;  3RAM A;  4M5K A;  4EO8 A;  4Y00 A;  4ZN3 A;  1RWX B;  3I55 S;  3AOC A;  4MKA A;  4OJ1 A;  4RPF A;  3W2W B;  3PW0 A;  1TFW A;  1P1T A;  3UI3 A;  5B0C A;  1GFW B;  4USU A;  2JWN A;  2UVV A;  3EPG A;  4B9V A;  3ZTR A;  2B8P A;  1JLG B;  3KXD A;  3KOA A;  2VG6 A;  3A3O B;  1Q5V A;  4ZVT B;  1JLC A;  4DCO B;  3OTO J;  2ZJP Q;  2R7S A;  3TUZ C;  4QW9 A;  4NEZ A; 
#chains in the Genus database with same CATH homology
 1CJT B;  4OYA A;  4OYO A;  1YK9 A;  4OYM A;  3ET6 A;  1Y11 A;  4CLU A;  4CM0 A;  4WPA A;  4CLS A;  4WP8 A;  4P2M A;  2WZ1 A;  1WC3 A;  4P2X A;  3C15 B;  1CJU A;  1TL7 B;  4CLL A;  4CLF A;  1U0H A;  5D0G A;  4USV A;  1YBU A;  1CJK B;  1CS4 B;  1WC1 A;  4WP9 A;  1YBT A;  4CLZ A;  5D15 A;  1CJV B;  2GVZ A;  1CJV A;  3C14 B;  1FX4 A;  3ET6 B;  2W01 A;  3UVJ A;  4OYI A;  3C16 A;  1CUL B;  2GVD A;  4NI2 B;  1WC4 A;  4WP3 A;  1WC6 A;  1CJT A;  1AZS A;  4UST A;  4OZ2 A;  1TL7 A;  4CLK A;  3G82 B;  3UVJ B;  4CLP A;  4CLY A;  5IV3 A;  4OYP A;  3MR7 A;  1AZS B;  4OYX A;  4CM2 A;  1WC5 A;  1CJK A;  3G82 A;  4CLW A;  1WC0 A;  4OYZ A;  4P2F A;  5D0E A;  4OZ3 A;  4CLT A;  4OYW A;  2GVZ B;  4USW A;  5IV4 A;  3C16 B;  5D0R A;  1AB8 A;  3C14 A;  5D0H A;  3C15 A;  1Y10 A;  3MAA B;  1FX2 A;  4OYB A;  4USU A;  2BW7 A;  2QV6 A;  1CJU B;  1CS4 A;  4NI2 A;  1CUL A;  2GVD B;  3R5G A;  3MAA A;  1U0H B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...