3G85A

Crystal structure of laci family transcription regulator from clostridium acetobutylicum
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
270
structure length
270
Chain Sequence
KPTIALYWSSDISVNIISRFLRGLQSKLAKQNYNYNVVICPYKTDCLHLEKGISKENSFDAAIIANISNYDLEYLNKASLTLPIILFNRLSNKYSSVNVDNYKMGEKASLLFAKKRYKSAAAILTESLNDAMDNRNKGFIETCHKNGIKISENHIIAAENSIHGGVDAAKKLMKLKNTPKALFCNSDSIALGVISVLNKRQISIPDDIEIVAIGMNDREYTEFSTPPVTIVDIPIEEMAGTCISLVEKLINRDIENPTSILFDGPLILRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of LacI family transcription regulator from Clostridium acetobutylicum
rcsb
source organism Clostridium acetobutylicum atcc 824
molecule tags Transcription regulator
molecule keywords Transcriptional regulator (LacI family)
total genus 91
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2009-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3g85A01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3g85A02
3RVQA 3QLTA 4G97A 4WUTA 4WWHA 1TJYA 3KHTA 4F12A 1U2QA 1P6QA 3C97A 1W9HA 1A0OA 3KJXA 1YMUA 1MB3A 3JTEA 5TQ0B 4TLMB 2FTKE 2PL9A 3O74A 3RQIA 3RVJA 3MM4A 3C3MA 3TD9A 4O1IA 4MYRA 1AB5A 1ISRA 2X7XA 3NNDA 2VUIB 4MLCA 1ABFA 5BR1A 5FWYA 4RY9A 1NXPA 1DZ3A 5KWSA 2VYCA 2GWRA 1Y1LA 1U2PA 4XAQA 4XFKA 4Z0NA 2ZWMA 4G0PA 3LUHA 2DRIA 1LBHA 1NXOA 1W25A 2GBPA 2PUBA 3BRQA 1PEYA 4ZMSA 2JBAB 2E4XA 2OENG 2NT4A 3CKMA 2HSGA 3EODA 4RK7A 4KFCA 4RU1A 2A9QA 4QYMA 3H5TA 1DJMA 3D02A 5KC9A 4LE1A 1EWKA 1Z18A 4DN6A 4YLEA 1VRVA 1BVHA 1P8AA 4HYEA 2ID7A 4P98A 4PZ0A 3K4HA 2FEPA 3LFTA 5IEJA 2VK2A 2QW1A 1FQWA 1Z2EA 3FDFA 4L85A 4MS1B 1DBQA 3HEBA 1FSPA 3IP9A 3MMNA 5BQ3A 4H3KB 4B09A 4MRMA 1SXGA 3QLVC 4KV7A 5GQSA 1JX6A 3GV0A 3KTOA 2JRLA 4Z4GA 4G0OA 2R48A 5C5EA 5CNMA 3MIZA 3Q15C 4ZYLA 2Q5CA 5TQ2B 3HDGA 5TQ0A 5T7BA 3I09A 3F73A 4KREA 4W5OA 2WRZA 1USGA 1QKKA 1ZDMA 1ZESA 4OBBA 5JNSA 4QYWA 3T38A 4KRFA 2MYUA 2IPAB 5CNIA 4L4UA 4W5TA 2PUEA 2QR3A 2FW0A 4MLDA 2R47A 3LUKA 5TE9A 1EHCA 1DG9A 3CG4A 4YS6A 2JVJA 2PLNA 4MGEA 2GKGA 2J48A 3RVKA 1EFAA 3HJFA 1DCKA 4WT7A 3H6GA 5EWMA 3RVOA 3FFXA 5JS2A 2FQXA 2FLWA 3BBLA 3GYBA 5I4CA 3HUTA 3TX6A 3CNBA 3M9XA 4PYRA 3O1IC 2PUCA 1JBEA 1DBPA 3TO5A 1RZRA 2IOYA 5HM6A 3IDOA 1YS6A 2F8TA 4KZKA 4MR9A 3QX9A 5FBHA 2PE5A 4NCBA 2MYNA 1ZVVA 2YHAA 1DBWA 1MIHA 3CZ5A 4MS1A 2IPMA 4Z4IA 1WETA 3T6KA 4MRMB 1Z15A 3JS5A 3C6QA 1JL3A 1E6MA 4ETNA 4IMIB 2MSKA 5B3JC 4MQEB 1P6UA 3L6UA 3MF4A 3IP7A 4YRZA 2QVCA 5JNTA 4PE5B 1QQAA 1VKRA 5TQ2A 5KQMA 1Z12A 4YGXB 3SG0A 2IPLA 4ETMA 1ZH4A 3QLUA 4CBVA 1JYEA 3OQNA 3IPCA 1DC7A 2L2QA 3DGFC 3EGCA 4G0QA 4TLLB 4N41A 1KRWA 1FFWA 2BGGA 3JPWA 3GA5A 3HCWA 3G85A 1ISSA 5TQJA 2IDMA 2E4VA 4N03A 5KQGA 5TPZD 2LP4Y 2WB4A 1DRKA 3LKBA 4TN5A 2L19A 3SNKA 1APBA 5EWMB 3QEKA 4LDZA 3L49A 3IP6A 3QELA 1M2EA 2JVKA 3H5VA 1YMVA 4KVFA 5JNWA 2L17A 2IKSA 4OATA 5F64A 3T8YA 1CEYA 3HK2A 3KG2A 4WZZA 1XWWA 3A3KA 3M9WA 1F51E 5IUJC 2L18A 1NATA 4RV5A 4UHKA 2FEWB 2FSPA 4G0YA 4MS3A 1K68A 4EYGA 3CRNA 3E61A 4MPTA 3SQNA 5C5CA 2PUGA 5ED4A 5D2CA 3LKVA 4YCSA 2XDYA 5CNJA 4MQEA 3HXMA 2PUFA 4IGAA 1JDNA 4QICA 2E4WA 1JHZA 1LJUA 3NHMA 1U04A 1Z26A 3HS3A 4RK1A 5EWLA 2AYXA 4OLBA 5JNUA 3O1JC 4MR8B 1JYFA 1NXSA 1QO0D 1U0SY 2P9HA 3HSYA 4S05A 3LOPA 3SM9A 3QK7A 1P2FA 1QP7A 3LUGA 3I42A 1SXHA 2FXIA 3KYIB 3MQ4A 1KRXA 3VNAA 1L5YA 4RWEA 1JH9A 3Q7RA 2A9PA 3LMKA 4KK4A 4MS4A 2RDMA 2FMIA 3JY6A 4DQDA 5JS1A 4NV3A 2A9OA 1USIA 1D1PA 1TMYA 1XHEA 2FMFA 4IF4A 4F8JA 4ZMRA 3A0RB 4MR9B 3FMVA 3EQZA 4JP1A 5DLEA 1DRJA 2WMYA 1A2OA 2R4QA 1EWVA 1GCGA 3H5WA 3HDVA 2RGYA 4HNQA 4LRQA 4Z9BA 1ZH2A 4KQ9A 3K9CA 1JF8A 1NXXA 3N0RA 4Q6BA 8ABPA 2FLKA 1AB6A 5TPWA 4MS3B 3C3KA 2FKAA 1JDPA 4JAVC 4OLAA 3H75A 3E3MA 1B00A 1DCFA 1NY5A 2QU7A 1MAVA 1VLZA 3O2SB 1OXKB 2NZUG 4FE7A 4WXMA 4Z4HA 5IC5A 3N0XA 3LTEA 4Z9AA 3HO1A 5KI6A 1D1QA 5EWLB 5PNTA 1ABEA 2W42A 1YK1A 4MR8A 3CFYA 4PICA 3RVMA 4HNRA 1D5WA 2H0AA 5JNVA 4LX8A 1MVOA 4YO7A 3HV2A 3S99A 5KQPA 3GWGA 4EUKA 2HQBA 2MSWA 2FEKA 3IP5A 2LIVA 4EVSA 3QELB 4GPAA 3EDCA 3P9YA 5ABPA 3LUJA 4RKRA 4N0QA 3C3WA 3MA0A 2RJOA 1DCMA 1Z25A 1MB0A 4RS3A 3F7NA 3F6PA 2JCGA 4G0MA 4M88A 2CD7A 4RXTA 4XLTA 1YK0A 4IMJB 4YR7A 4S04A 4YP9A 1QPZA 3DBIA 1NXVA 1XHFA 2HPHA 2VUHB 1RNLA 1BA2A 3HM9A 4FB4A 2KYRA 4XXHA 5TPWB 2QXYA 3H1EA 5HKOA 5BRAA 2GI4A 3HUUA 1DP4A 4JOQA 5CNKA 2F8SA 3HVRA 1QNLA 2NZVG 4JB2A 4D6XA 4LE2A 1GCAA 1C4WA 1RXEA 1QP4A 4LE0A 3O2QB 3CTPA 3OLXA 3OM1A 1PHRA 4RZSA 4Z4EA 1L5ZA 1TVMA 3D8UA 2B1JA 2RJNA 4EGSA 3FFWA 3NNNA 1ZAYA 2FMHA 1F4VA 2ZAYA 1EAYA 1M5TA 2IPNA 2R25B 3CU5A 3RH0A 2E4ZA 3KKEA 1M2FA 5KC8A 2JVIA 3KYJB 4RSMA 4F3TA 2QZJA 3QX8A 4Q7EA 1FFSA 1Z17A 3LUFA 3TMYA 4MS4B 4EYOA 3FGZA 4RKQA 9ABPA 1QP0A 3QLUC 1ZY2A 4Y9TA 4RK4A 5IULC 3KCNA 4EYKA 5FBKA 3JPYA 2PUAA 2FVYA 1NXTA 3GRCA 2O20A 1OXBB 1Z2DA 2YHBA 2HQOA 2QSJA 3ILYA 2JB9A 2HJ9A 4ETIA 1BDHA 1YVUA 2OQRA 3LUCA 3QLVA 3JVIA 3M6MD 1TM2A 4Z4FA 4XASA 4E7PA 3I45A 1UDRA 2WWVD 1J56A 1A04A 3JVDA 4W5QA 3I5AA 3QEMA 3EULA 4F11A 1VPWA 1S8NA 5B3JA 4MQFA 2V0NA 2E4YA 2FMKA 3KLNA 2FN8A 3H1GA 4RK5A 4LZLA 5DCLA 5FWXB 2CWDA 2TMYA 3KSMA 2FQWA 2NT3A 4TMYA 3N6VA 3DLBA 3T95A 1KMIY 2GX6A 4HNSA 1Z13A 3F6CA 2NUBA 3CLKA 5DKFA 2ID9A 4RY8A 3EQ2A 1CYEA 4QPJC 2PMCA 1RZRD 1D4ZA 2B4AA 4D74A 1JLKA 1ZN2A 4MAAA 3LUDA 4WXEA 3SY8A 3DZDA 5IEBA 4RY0A 4RK6A 1JFVA 1ZGGA 2A9RA 4F06A 3NHZA 3OO0A 3RVPA 4NCAA 3N75A 4P1ZA 3NNSA 4JB0A 3GL9A 5EWJB 3ROTA 1C0EA 3ILHA 3GT7A 2QV0A 3G1WA 5CHYA 3DGEC 2N9UA 4MR7B 3BILA 4PEVA 1ZITA 4NQRA 3EAFA 1KGSA 3QEMB 4OTZA 1PNRA 2P4UA 4MQFB 4Q6WA 4D6YA 1URPA 5IX8A 3CHYA 1E2BA 3OLVA 4Z4CA 1JFTA 1M5UA 5FWXA 3OO1A 3H6HA 1TLFA 1GUDA 1NTRA 4OG2A 4IILA 3URMA 7ABPA 2CHFA 3OMXA 3IPAA 3O75A 4EVRA 4H60A 5JNRA 2WJWA 3A0UA 5DGCA 4JA2A 1YTUA 1FFGA 3H5IA 2E4UA 1RXIA 2QVGA 1E6KA 4KK3A 4ZJPA 2JK1A 3O1HB 3O21A 4H3HB 4N0PA 1PEAA 2CHEA 3SAJA 5E3JA 3UK0A 3OMWA 5KQLA 3Q41A 4W5NA 2PJUA 5TPZA 4DADA 4UHJA 3VNBA 3Q7SA 5T3YA 3OQMA 4N76A 1BAPA 3H5LA 3RVRA 3OQOA 4G0ZA 3DLHA 4KPYA 3LUAA 4O1HA 3BRSA 2MSLA 3BREA 2PUDA 1JWLA 4Z99A 1E6LA 5IUKC 3KLOA 1QQBA 3UKJA 1ZHHA 1IIBA 1CHNA 1R8JA 5FWYB 4ZPJA 4N47A 4EY3A 5BRJA 2LBPA 3CS3A 3OLZA 4YWHA 1ZGZA 4IRXA 4O5AA 2FN9A 2FQYA 3EJWA 1SXIA 3OLWA 3N8IA 1BDIA 2MYPA 4EVQA 4ML3A 5GOTA 1U8TA 4W5RA 4KMRA 1USKA 3TB6A 3W9SA 6CHYA 1JFSA 1D2AA 1LBIA 1BDJA 4GNRA 3FFTA 4JASB 2MYTA 3RVSA 3N0WA 2M1ZA 2WY2D 2HQRA 3A10A 1I3CA 4LDAA 1QO0A 1LJLA 1LK0A 1H9CA 5IUNC 1GLGA 1DC8A 3CG0A 3CZCA 3H1FA 4RDCA 4G86A 1NXWA 5HQJA 1Z16A 1YIOA 2IYNA 2LUOA 5EWJA 3OLYA 4KQCA 1HEYA 3N53A 3GBVA 4MR7A 5DTEA 4YV7A 1EWTA 4RXUA 4EYQA 2M98A 2WJAA 2PKXA 1QMPA 2AYZA 5IBQA 4XARA 3NBMA 3MYYA 2JBAA 4RXMA 4KNYA 3Q9SA 2LPMA 2H3HA 3H5OA 3KS9A 3RVNA 2PAFA 1SD5A 1GUBA 3ROFA 3RVLA 3B2NA 3Q7TA 3UUGA 4E7OA 4G0XA 5HSGA 4NICA 4FE4A 3R0JA 6ABPA 1PNTA 1PUXA 2I6FA 3O2JA 1SRRA 3HZHA 4RK0A 1RPJA 3GBPA 1K66A 3OM0A 1T34A 2PL1A 1YS7A
chains in the Genus database with same CATH superfamily
1X9GA 4RPLA 1S2MA 1Z2CA 1K4YA 2M1XA 4QL3A 3TZHA 1S2IA 1O5TA 4B2LA 3TR6A 2ZYRA 1W9HA 3IUJA 2C96A 1I6LA 4XIYA 3S8YA 3T4PA 4I9GA 4TZKA 3UMMA 3P97A 4YRJA 4IXMA 5K3AA 3ZX4A 4UZSA 4DCOA 4K6HA 3TD9A 3A05A 1NU6A 1ZM2A 1B43A 4Q7LA 1U5BB 5JBIA 1E98A 1KL7A 1GGFA 1IHYA 1PG2A 3HCOA 3KDSE 5JZOA 1ULZA 1ZMRA 3FPAA 2II6A 4FEEA 4YPFA 4RY9A 2BV3A 2JFBA 2R4UA 3AESB 1DS6A 4F2WA 2DF8A 3DW3X 4LRTB 4G0PA 2VATA 2COEA 1W25A 2EW1A 3QVGB 2VT6A 5I8PA 2N75A 4M1ZA 4KX3A 1BX0A 2VWQA 4HF7A 4D0GA 1Q3KA 2E4XA 2HMYB 1OI4A 4G5HA 5HE8A 1C7ZA 3L2OB 1KDZA 1DJMA 2JLXA 4X62B 4C21A 3VZQA 1T0JB 1AUVA 4G4GA 1YBVA 4KE9A 4KRXA 4DDTA 4EATA 1LNQA 3K4HA 4J9UE 1MFZA 1N9GB 1FBTA 1FQWA 3OCVA 3IUQA 3KIPA 5D7NA 2C61A 2JEYA 2XVYA 1U2SA 3ZHTA 4KSYA 1OUMA 5AI9A 1V47A 5KQRA 2DQYA 4LC9A 1AGXA 4JBYA 3EQ8A 3O4VA 4P22A 2ZDQA 3L40A 1FXWA 2ZKIA 4DV7B 1NN1A 2R48A 1SULA 3DTVA 3GZTB 4BE7B 4G0WA 1W5SA 3PD0A 1DBSA 2ECOA 2DPYA 3BGOS 4ER7A 3D59A 1YCHA 2GT1A 3WTBA 2IS6A 3E53A 1UBFA 3CN9A 2BPOA 1R27A 4QPNA 4OQQA 3GEBA 3BS4A 4CL3A 1LZLA 3D4NA 3GMTA 5I4BA 4HXGA 1Z4OA 2JGIA 4BFLA 5ECWA 1EFRA 1Y8RA 5KB3A 1OWNA 2B4QA 3E8MA 1M54A 3I12A 5IP5A 3BSFA 3FUTA 5LU9A 2C78A 2IXAA 1O54A 4WT7A 1KFKB 2OGZA 1YZVA 3Q7PA 3KUKA 1H69A 2P9TA 2FQXA 3WL4A 3JD4A 4JT9A 1GYQA 1C8VB 1TO6A 3DP9A 1XTUA 4PW0A 3CR3C 5BYBA 4LJ6A 4HLDA 2ZKLA 4M8NE 3SEAA 1BMFA 1SIBE 4IS3A 1R10A 4MJ7A 4NZ9A 1B76A 4U7WA 4Q9AA 1ZG3A 4KRGA 4RVOA 5ICSA 4HRAA 1N6HA 3L8FA 3PI6A 1Z28A 1U0RA 3ETGA 3L4BA 5U4QA 1GTL1 1U8ZA 5IMBA 9ATCA 1RBMA 2P0EA 4ZT6A 1KS9A 3BMNB 3C3CA 5D3MB 4QBIA 1JFFA 2VVTA 2C8VA 4MRMB 1KKLA 4ZRMA 1ZZGA 3ITDA 4K26A 3WNBA 1XA3A 1JE1A 2QZPA 1U2GA 3CW2A 1VGVA 3ZC3A 4J4TA 3AFMA 2QJRA 4MNTA 5B3JC 4OA5A 5I47A 2ZSKA 3AV3A 2YVKA 2WYHA 4YRZA 1QQAA 2QSZA 4AO6A 1DTWA 1DMSA 3I9LA 2J8ZA 3ORYA 3H8WA 2ZUWA 1Z12A 3PDCA 4YGXB 2C7QA 2W6CX 1QRDA 3A14A 4LCJA 1JYEA 1MC5A 2H54A 3ZY4A 4UAJA 4HAIA 2RAVA 5AK4A 3PGLA 2AYYA 2G4CA 2FF7A 1EDBA 4IH9A 4UHHA 3UNXA 4DLKA 4N03A 2I1QA 1HNNA 7ADHA 3SMVA 2ZJBA 1WU7A 2NAPA 4DG9A 5CB0A 3RC2A 2BC9A 4M9UA 4EF5A 4B2PA 1N9KA 3GA7A 3H0KA 2EZUA 4PHFA 1IL0A 1HL3A 1Y8CA 2DR3A 1C1YA 3NWBA 5DRTA 3SU8A 2G40A 1NLUA 1ZW6A 1ZM7A 3JQDA 4DRXA 3MBKA 4KUHA 3DOOA 2CXRA 1FP4B 3OE5A 1B0UA 3DHEA 4HJXA 2GZDA 5F9HA 3E3NA 4PCVA 1IWPB 3Q3CA 3L0BA 4R0MA 1VG9B 3M9WA 2ECQA 3K0CC 3NIWA 3FYUA 1D09A 2FK8A 1NATA 2HRCA 2YIJA 4OY3A 4B8ZA 1NG9A 2CVPA 1J8FA 1KJWA 4BQIA 3KSAC 3TQCA 1PG0A 1EWQA 4WXYB 5A62A 4PSVA 2AL7A 4BCDA 4YRTA 4F21A 3FTPA 2Q6KA 2CUNA 2WNIA 4XJVA 1NVVQ 3F47A 2C83A 3KWFA 2IOFK 1WULS 1XLUA 1QCYA 3GRPA 5CW2A 3A3NA 1XTIA 1EINA 1L0BA 3NBAA 4CYMA 2RK3A 1Y7TA 4XCQA 2ZWAA 3CWCA 2Z2JA 5IM4A 4HLCA 3A36A 2G28A 2XQKA 5REQB 3NTQA 3ANXA 1QP7A 4E51A 1L1RA 5J2UB 3MTBA 3MWEA 2HT6A 4LEIA 3KYIB 1CJMA 5JH7F 5FUBA 2HRQA 2AN9A 1GTVA 1L5YA 2B2NA 2GJSA 2FQQA 5FQOA 4C4YA 4DQDA 3CNLA 3VVMA 5JIBA 1JQAA 3GCDA 4IJWA 4MHOA 3L4JA 4MXDA 4ZMRA 1H93A 3PGKA 3WX0A 4MR9B 4EL0A 4HDSB 3F67A 4MYCA 4Z51A 5BWBA 4TTAA 3QPCA 4LYYA 1FP2A 3M7IA 3UGTA 4D96A 1G8JA 2FPRA 1RQ2A 4Q6BA 4Z53A 2GA8A 1KQNA 3ZTYA 4CMAA 4Q7KA 5TGDA 1EVLA 4L4YA 3R7WA 4EHHA 3NPAA 1KBOA 3ABQB 2A5FA 3DS8A 1SC6A 1FFEA 1GLVA 2NSDA 3K7EA 1WB4A 2F17A 1MAVA 2AOTA 2YMLA 5EKTA 2NZUG 3CRQA 3DP7A 1P4RA 3FUXA 3IUSA 4C0BA 2EHDA 1VYTA 4WLUA 4LSZA 1BJKA 4IZHA 3LTEA 4Q5IA 5CA0B 1O7JA 5L7TA 1ZK2A 4HEA1 4DC9A 5FOQA 2AFHE 3ZZ0A 4PG6A 1KYXA 4L57A 2Z1DA 1WU8A 2ZJ7A 5TMBA 4U1RA 5FTMA 2P1RA 1XJWA 1DARA 3ZV5A 1SCUB 4E5DA 4FWTA 1OI7A 1ZGAA 2TS1A 4GU5A 3G5LA 3EG5A 4EUKA 1P1HA 3OTOB 5KYWA 1MPXA 4RLFA 4KQHA 3SE0A 4XWTA 3TZEA 3GD7A 1UDCA 1FDOA 2HV9A 3EDCA 1TC2A 3IRUA 3M89A 2P6OA 2VNSA 4MZDA 3UUFA 4E15A 4I9UA 2PWAA 1ANKA 2MMCA 4UC0A 1HLFA 3KYDB 4HFRA 4B81A 5TMDA 3HWX1 2X0DA 2NIPA 3V4LA 1OMOA 3O3CA 1MHTA 1LY1A 2QY6A 1RQLA 5IXYA 3MSXA 2X8BA 2FUKA 4FDTA 1E32A 1GA6A 4BO9A 1J25A 1J8QA 4CV0A 3NBUA 3EG9A 3I9V1 2V1XA 2IZ1A 5C53B 1E8MA 3TG8A 1HDRA 2GYYA 2DT8A 1IEVA 3LTNC 3W77A 1C4WA 3IR7A 1AKNA 4BKUA 3OQIA 1E9SA 1KI7A 3EXHA 3FWPA 4RLQA 2JIBA 1GFSA 2CDNA 4RZSA 2Z4SA 4ACBA 4OFXA 3FCSB 1QF7A 1CIVA 2CUZA 2ONZA 1AS3A 5BWNA 4KI0A 4CM5A 1IHOA 5FOUA 4E1AA 3OQVA 5H8WA 1W48A 1RRKA 3CU5A 4HSGA 1CD5A 2W22A 2VTBB 5B1HA 2FZLA 5JD5A 1BVRA 3WISA 4HSEA 3RTCA 4EJFA 3ZW8A 4TKZA 2ZIUB 5K0CA 4YALA 1OAKA 2BDTA 2JI9A 3LUFA 4ZTBA 3DBLB 3AETA 3GVHA 3MTAA 2NUAB 4JSTA 1SU8A 1T1EA 3I2KA 4RIHA 2BTOA 3O83A 2A35A 4YLGA 1JHRA 1GDDA 1TPYA 5EHIA 4IIFA 5J63A 1YCGA 4Y9SA 5F35A 3S29A 4CQJA 1U94A 4DIUA 4XYBA 5F78A 5L51A 1YZHA 4PO9A 3SVZA 1V7CA 4UM8B 3DL0A 1B2RA 1NXTA 4G65A 5IC6A 2CZCA 3ZHOA 4Q4CA 2ICAA 4BB9A 1DO8A 3DTTA 3F97A 3TGPA 3FNEA 1SHLA 4U2CA 1W85B 1QV9A 4LBZA 2HQOA 5HF5A 4Y98A 2I7TA 1JLLB 4CIYA 3GR6A 1N4DA 2V4MA 1E2EA 1U63A 1AQUA 1P1KA 4E5UA 4CU2A 1NDUA 3AY0A 2RCYA 4YAJA 3ONWA 4L3WA 2ASVA 1IN4A 3ZE0B 4E7PA 5ARBA 2ZS8A 4Y0AA 3C5EA 5AI4A 3SR3A 1J56A 1JEOA 1N1EA 3R74A 3Q0TA 3R5FA 5EMMA 3UFBA 2RKBA 4WA7A 1KO5A 4MA5A 1U0LA 2X1MA 3B51X 5F73A 5C80A 1E2PA 3H1GA 3OHMA 4RK5A 4CNQA 5CGQB 1GAWA 2Y1DA 3LP6A 2VA8A 1E3EA 1ZI6A 2ZETA 4TV8A 1WKVA 5CITA 4ZV7A 4TMYA 1MOQA 2G8LA 2ZJOA 3JR7A 1WM1A 3ND7A 4PCUA 3T95A 5BN4A 3COJA 1Z0KA 5EI5A 3UICA 3ML1A 3IO3A 1ONOA 2CXOA 2Z58A 3E27A 3GRUA 4TTVA 1U7OA 3QVKA 4QFMA 4ARIA 1P7CA 1W88B 3CKLA 1G41A 2VDKB 4PZEA 5EMNA 1OVGA 5HF6A 4AY3A 1GRNA 3WBJA 3PPYA 1P0IA 3Q10A 5J4KA 8MHTA 1DC5A 1YJCA 4ZCPA 1Z6PA 4ROTA 3VYTB 1CG6A 2EFHB 4LOAA 1O0CA 3PDUA 2ADMA 1YV9A 4Q9IA 2EAUA 4Z9YA 2GCNA 2OXRA 2Q45A 4YREA 3WRYA 4BYGA 1UEJA 2JLWA 2PZGA 3C70A 2Z3WA 3EZYA 3N75A 3OAAA 4PYQA 4R68A 4YBZA 3KVNA 3TNFA 1G21E 5CM8B 5CLIA 1AUOA 5AKHA 3UXMA 5ADUS 5IFLA 3G1WA 5TNXA 3RJZA 4AJOA 4GOXA 4XSVA 3BILA 3MGBA 4G5XA 3KLMX 3I9JA 1XZIA 1QBKC 4OSEA 4Q18A 1L7XA 4BIIA 4XUEA 4P80A 5JXJA 4LVOA 4BO6A 3T9BA 1DAKA 3DEAA 5JHGB 3IE1A 4E5KA 4WK4B 1P3JA 4UEWA 4GPEA 4P3KA 3ONEA 2HHHB 1RAIA 2IUYA 5EY5B 2FFHA 3GXOA 3VISA 4GXNA 1K3FA 1PHPA 1Z7WA 2RBGA 3RAEC 3NUGA 2ZYAA 1FLNA 4M0FA 2WM3A 3USCS 2CB0A 1YNSA 4AF8A 1VIAA 4PC6A 2SHKA 3HKCB 2JPDA 1G8HA 4C4RA 4F2PA 3K1JA 2WFMA 3L7JA 3TJMA 1P1IA 2IYTA 1R0WA 4IQGA 1LSOA 2GJAA 4MAFA 2CL7X 2CUTA 1EX1A 2E49A 1Y5RA 2JK1A 4LPSA 4OQDA 4YROA 5CRIA 5IAOA 1ECBA 4MW5A 2O59A 3JRNA 1RWQA 5E3JA 8AT1A 5L6LB 5KYXA 4ER3A 2KI5A 3LYAA 2ZYIA 3H04A 1LQUA 4FUTA 1ML3A 1XX6A 1D7OA 3DLHA 1UBSB 3CW9A 5A1JA 1X2BA 2BRUC 2Q4BA 4N5NA 4YJHA 2HU5A 2PKRA 2VPWA 1ESCA 1C3LA 6AT1A 1D2RA 1G6OA 1DJQA 2YRWA 2CSUA 1M1YB 3P9KA 1X8KA 3U3RA 3ZW9A 3EDYA 3OLZA 2ZQYA 2HBQA 4DLSA 4BLWA 4N7MA 4MHSA 4QXAA 1ECJA 1JJVA 1WNTA 4EW2A 1BS1A 3GVCA 2WDPA 2G8NA 4R05A 4I9FA 4CIVA 5GOTA 3J7AC 1OTXA 4AP6A 5C8XA 1JR4A 3IEPA 5ESXA 2C88A 3VDMA 5FBLB 4UBNA 5JY1A 2EG9A 2ZTHA 2RGCA 1KY3A 1FW6A 1CVLA 1F2TA 1I1NA 2EW2A 2B4KA 1BXZA 3B89A 1M6VA 5B37A 1V8FA 1NJ6A 4MKZA 4Q9JA 4BP9A 2PRSA 3A10A 3IMCA 2A5YB 1A97A 2G9NA 4EB0A 4EMBA 3T1YB 4W6QA 2A1UB 3OIFA 3DVSX 2OFFA 3EUFA 3CG0A 5JCZA 5B55A 3GJZA 4GEKA 1ZAKA 3SBDA 2WWIA 4E14A 3MMXA 1TK9A 2IYNA 1PQUA 4ZDKA 2AN3A 1OCEA 5FUYA 1DGQA 3NV9A 1XK7A 3LBHA 5I6DA 1WY5A 3I2HA 1HEYA 4O02B 1QHFA 3EOAI 1ZJYA 3DUFA 3TCNA 1O95D 4H2DA 1NVFA 2HNAA 4CU5A 2K87A 2VF4X 1M7HA 1TU4A 1TF2A 3CT4A 3D4BA 1D0IA 3JARB 1Y6QA 5EUBA 4GC9A 4WL0A 5TJHA 3VU0A 1EI9A 4G37A 4DR7B 1O03A 1QONA 2FR8A 1HDCA 3ZUGA 1KAGA 2LWIA 4F6LA 2J3MA 5TXGA 5T41A 4OJMX 2W00A 3THWB 2E5WA 2YINC 4L50A 3ESRA 4HS4A 1RYEA 2ACEA 4BO2A 1JE0A 3GPIA 1KQOA 4XUCA 3ZDRA 5HQ3A 3BDIA 3VR6D 2QLTA 1DAPA 4YRBA 1T1GA 3SF8B 1I32A 3A04A 5K2MA 3RSGA 2QGZA 4DDMA 2AT1A 1YFKA 4RZ3A 1GADO 2NPOA 5HX7A 1E5VA 3M6FA 1PO7A 1SXJD 5JCOA 1NQWA 2OVFA 4RD0A 3P26A 2XXBA 3C97A 4PNZA 1QGUA 1A0OA 1PAUA 1NVGA 1BVYF 1RCUA 1BROA 1CUWA 2H3EA 1XAHA 3CGGA 3KJXA 1JR3D 3R4VA 5GJWC 2R11A 2FTKE 4ALJA 2ZDGA 4D8UA 3IL2A 1A9RA 5BN5B 5CTAA 1T9AA 2AK2A 1WUHS 13PKA 3KTFA 1E63A 4DILA 1HYBA 2H1VA 2H9YA 1GO2A 3WYNA 1U7DA 3OWHA 1JFLA 1IY8A 1CZNA 4X7RA 4WLVA 4D0SA 3DBRA 4M9XA 3TDKA 3CSUA 1TM3E 1KJIA 2JCXA 4ES6A 3PPVA 3UV6A 3C41J 2QTZA 4HQ0A 3GO4A 3EODA 3QA3E 4K9MA 3H5TA 3KU1A 1CY0A 5ITWA 2OAQ1 2RHRA 2GN8A 2Y66A 1JVNA 1N2ZA 2A92A 2RJ3A 2VXBA 3MCVA 3OHPA 3EF0A 4Q7JB 5CX1A 1XR3A 2IYFA 3B9PA 4URWR 1CUDA 1OGJA 2VA9A 3LDFA 2YJGA 2FEPA 4JC5A 4HS9A 2OQIA 3S3TA 1Z2EA 3IBGA 1E2NA 5JH7A 2BKXA 4EITA 2VO1A 3P2YA 3IH5A 5EC8A 4GWLA 1H2FA 1UJ5A 1VYHA 5TX7A 3SPXA 3SOPA 3N76A 5GM2A 3GEHA 1GQOA 3G6WA 2BHRA 3QLJA 5BV0A 2JG3A 3W4KA 1G6KA 2EZ4A 3K72B 1DIGA 3QEJA 1YI8A 3UANA 2O0LA 3ZR4B 3WL6A 4ALMA 2X4LA 4CKBA 1XPRA 3CUWA 3AVXA 3L79A 4R9NA 2WILA 2FQ1A 1NDHA 1NLYA 1QKKA 1TCVA 4H7DA 5BWLA 3N07A 3SVLA 1LU9A 1H9AA 1ZYUA 3CWZA 5FPQA 1TJ3A 1W36D 2X8WA 5BUQA 4WJZA 5CNIA 1Q0TA 1NMXA 2XCSB 2I2DA 2QN2A 4G3XA 5DO9A 2I5PO 3QVXA 5GVRA 3O2NA 1IBMB 2JLBA 1HA3A 2GKGA 2ZRIA 1HNWB 3KYCB 4Z0PA 3EPRA 4RTQA 1VLVA 1LDMA 2OFPA 1ZXXA 4KSCA 1MG5A 2HSEA 4LJ7A 4MWOA 4B83A 5EXSA 4YMVA 2EDCA 4PQFA 4Q9NA 4X1YB 3L7BA 1QU2A 2CLSA 3I62A 1N7GA 1H85A 1RVV1 4P0TA 5EQFA 2ATVA 2OK7A 2ZSAA 4XW2A 2H07A 4A2CA 1C7JA 4CWAA 4DA7A 3VOBA 5DZSA 1K7XB 4JC0A 5BSRA 1T0HB 1Z3CA 1I36A 2VPZA 1JHDA 2UXCB 3O4JA 4KMMA 2YHAA 5JRZA 4J75A 3TCKA 3LJKA 4Q66C 2XXAA 5KAPA 3OE7A 5HGJA 5IT9A 1Z15A 2ZXUA 4Y30A 4AY4A 2CNOA 4RKWA 1TM4E 3W9UA 4I4TA 4WLOA 4AUEA 2MSKA 2HD4A 2ORWA 1G0OA 3PTZA 3ZW7A 3MJDA 1OQAA 4L6IA 4IJUA 2BHSA 1XTBA 4V3BA 4B6PA 2H4JA 1F8UA 1UPUA 2JBWA 5A4AA 2Z4TA 2AMLA 4OHWA 4L74A 5KQMA 4PLGA 2IPLA 4WVFA 5L4LA 1LWNA 1K8YB 1OLOA 2GFHA 2FPSA 4U7PB 4WNIA 3A1UA 4G24A 1C30A 2DWQA 2LVBA 2ZCUA 1FZQA 4FXOA 4DJFC 1P6XA 3GEGA 8ATCA 1K3TA 4EPVA 2JD2A 4FGUA 1FNNA 1XQ6A 4MMZB 4L0MA 4OFZA 2VQ6A 3K1AA 3IJ5A 2WB4A 5K6AC 4X24A 5LZ4A 4M0CA 2N47A 2H2DA 4QPPA 4Q9KA 2LKDA 3DL7A 1JEQA 2YXBA 4RVGA 4EHJA 2XMCA 1U8FO 3C5VA 1M2EA 4NZZA 4LCBA 2HW8A 1R74A 5DX0A 4XH9B 1UH5A 3LBNA 2YICA 2B7LA 1MG0A 1ZD9A 5F21A 2W7TA 6ADHA 3KR9A 5IUJC 1WPRA 3KPVA 4DNQA 1OZ0A 2VH5R 2FEWB 1P73A 4O4IA 5CCBA 5JRJA 3TOSA 3NIDB 2DH5A 4KR9A 3KSBC 2M6SA 2OORA 3CUEF 2VYFA 4I1SA 4DFDA 1H2HA 1SBQA 4D79A 3I9MA 4EQ6A 4WBXC 1F7VA 1K2WA 4AZVA 1NC3A 1XMPA 1XL1A 1QM5A 2X2OA 1C9JA 1M66A 3MCTA 3N70A 2PUJA 3QFSA 3R3UA 4FKZA 4HY3A 4CV3A 5HUJA 1JHZA 1UC8A 2J08A 3L7NA 1KFJB 4I99A 1WXWA 2AYXA 5EP4A 3RUFA 4FDVA 3FUWA 2BHTA 3CO0S 5JDIA 4R3NA 3S7ZA 5JY6A 3VDRA 1DT5A 3DOIA 3VZPA 1DWOA 2H5JA 2G1PA 2HRZA 2JA2A 3V2IA 1SVSA 1NJFA 2IDJA 4P4GA 1FS5A 2P4HX 2FXIA 5CR9A 3MQ4A 2AUMA 1KYVA 1PJBA 5HGXA 1Q77A 3IE2A 2P1DA 4E13A 4R6WA 3WDMA 3W5AA 4JBGA 3LMKA 3DKRA 2WQ7A 4B85A 2GUWA 5EIOA 3K32A 4QM6A 3RK0A 2RHHA 3WIBA 2Q1UA 3DOEA 4NV3A 3FF4A 1YL5A 4NFLA 1JKJA 4OQPA 2BGRA 4BJ1A 1JZTA 1ILWA 3KPYA 3VHLB 3A0RB 1UFVA 3TLBA 4NYMR 3I0ZA 5DLEA 1TZBA 4I1RA 3BHMA 1GCGA 2YXNA 3TPCA 2BR4A 1NBMA 4B3XA 4OP2A 5AW2A 1PJ8A 4O2BB 2OR3A 1QLJA 3K9CA 2A8YA 4NABA 5F77A 2E37A 1IUNA 5FA5A 4EL5A 1ISPA 4XM0A 3K53A 2ZTMA 1I6WA 1FIUA 1OJLA 2GYUA 4ZOBA 5CAEB 2YXEA 1AHIA 1DCFA 2VAPA 2JC3A 3SEFA 2ZIWB 4D46A 1OXKB 4FE7A 2OGTA 2C4VA 2YQ4A 1Y4AE 2QTVA 4Z4HA 5JD6A 1I2BA 4MGZR 4W5WA 2FFRA 1QQ6A 4Z1MA 5EWLB 5AW4A 5PNTA 3VC1A 1QG6A 4LYFA 2YUTA 4J76A 4RVDA 4WESA 2W42A 5ULLA 1UJ4A 1PJRA 4JP5A 3OZDA 2D1SA 4Q1DA 4ZVQA 4ESVA 5E7IA 4B87A 1SVUA 3CO5A 1BRTA 4HNRA 4Q4JA 4DE5A 1MVOA 2FR1A 1JQKA 3QFFA 3TUZC 4RCZA 3W8DA 5A4DA 4EGQA 2GNPA 2QENA 3OIWA 4MIOA 1ZOIA 3MINB 3H1BA 4JLDA 3ICCA 2ZIEA 4CEIB 4IQ8A 3STWA 3QVJA 4PR3A 1TQ2A 5B6PA 2IDZA 3HWWA 1U0JA 2B69A 1V5EA 3RSCA 1GGNA 3ZU2A 3W6ZA 4D0NA 3TE7A 3EGEA 1W47A 4KR0A 3VJKA 1AN0A 1XDZA 3ND8A 2O8DB 3WWCA 2ZJ6A 4KMSA 1O0SA 3KXPA 1IPEA 3QNMA 4IY1A 4GF5A 4B44A 1K08A 4D4IA 4C3ZA 4QC2A 1NJ8A 2WAYA 3EXIB 2J3IA 5TR9A 3RYHA 3U40A 1F0PA 4LF8B 4CUJA 3L07A 1TQDA 1XRLA 2F8SA 1C29B 2ZRCA 2OKGA 4WGFA 5CAEA 1NUQA 3QG5A 4FJ2A 1NVTA 2BM0A 3OM9A 4QUEA 4H31A 5FL3A 5M29A 4RTNA 2DHEA 4FILA 1QPGA 2O8FA 4JUDX 4Z4EA 2WPNA 1CY7A 1H22A 5EINA 3IP3A 2RJNA 4FQ8A 3UJAA 3W2IA 4BLTA 2DY0A 2NXJA 1WOMA 2X3FA 1QIJA 1UXJA 1YBAA 2XVZA 1M5TA 1NT4A 3PFIA 1NLMA 3TTWA 1XEFA 2QUJA 3MJTA 3QU2A 2X4GA 4GQIA 1K5PA 2XMBA 3U6KA 2C2OA 1SA0B 4KE7A 4M0PA 4KWIA 4EH1A 2RH8A 3F5QA 2EQ5A 1E3WB 2GEVA 5IT4A 4P84A 3AERA 4TKUB 3L6RA 3IA7A 1O6BA 3CSDA 5CJPA 5FOXA 4C3VA 1P44A 4JB3A 4JT8A 4M4SA 5MN6A 5NULA 2L42A 3GLIA 5FXMA 1V3QE 1ISHA 2Q6IA 4JBIA 1DXOA 3S68A 2EFGA 2HIAA 2R2AA 3AHJA 3BFXA 3HFSA 3HXTA 1DEHA 1SCBA 4QBHA 4Y2VA 1Q74A 2C2GA 4IWYA 4LWQA 1ZSYA 3TH5A 1QGDA 5TDHA 3WR5A 4E2ZA 1CSEE 4PC1A 5DGIA 1YZTA 4A15A 3SQWA 5JZMA 1FUKA 3GMDA 3LUCA 4QLAA 3T4UA 2PBZA 3FDFA 1L4EA 1SKBA 2XNJA 4LXYA 2XVAA 2QU8A 1E60A 2ZYVX 5BR4A 1DFHA 1VA5A 1CB0A 4PNPA 1FFBA 1WCXA 3DD1A 1UDRA 2GZMA 3EXFA 3INRA 5LYJA 1SG0A 1SKYB 2QRLA 1R0YA 3SJUA 2J3JA 3WGOA 3ZY2A 1NNEA 2RHDA 3NXSA 1YB7A 2R8XA 4QHTA 5AUNB 5HIMA 3L9WA 3GRAA 5KYKA 1CY4A 1K06A 4TKLA 4ECAA 4ENPA 1Q0UA 3MHTA 5H1YA 3TIFA 3HFRA 5EAIA 4B4KA 3A6PC 1YF3A 3SN6A 2DWUA 2B98A 3E0XA 4YCLA 3QPVA 4A6PA 1W2HA 3AL3A 2V9CA 4AIIA 3V1NA 3I1FA 4DQ0A 3K8YA 3KKQA 3NCHA 4NU0A 5DI3B 2HXYA 4RF2A 2QL5A 1PZGA 1AUPA 2EFDB 3M8KA 4KXNA 2VSFA 3PDWA 1GTMA 3ZQUA 4QUJA 5A2GA 5ERYA 4WFIA 4RZXA 2GEFA 2JHGA 3W6PA 5K8VA 1RXCA 3ZDQA 3PQ7A 1V1JA 3EJ6A 2ZSEA 2V3WA 1WUKS 2XNDD 3LQ2A 4REQB 4ITRC 2IV2X 2ZLBA 1QTRA 1P1RA 3RABA 4YJ3A 1W8IA 2I66A 2DGDA 3TNJA 4E2FA 2A9RA 4TVSA 1ZNYA 1UKYA 1KHHA 3MWLA 5ESDA 4YY3B 1A5SB 5CBPB 4L6AA 1TJNA 4QT4A 1PW7A 1GG2A 3NNSA 4JGIA 3V1UA 3AUJB 3L93A 3I83A 4J3JA 3M1LA 2R5FA 3AHHA 3C4JA 3UOWA 5B53A 4PS1A 4FFRA 3QNWA 4LQ4A 2OQ2A 2QN1A 1ZITA 5SYNA 4CTJA 1Z8HA 3LXRA 5J4VA 2JFWA 3I28A 4O0LA 3WB0A 2HF7A 2VHVA 621PA 1Q15A 3L0PA 1PWXA 2BBTA 2O52A 4I3GA 3A31A 2QMOA 3SS7X 4FC7A 4R1OA 4W5HA 1BRMA 2W37A 3DL4A 3FOWA 4GS5A 4KFUA 1Q7BA 2PH1A 2HLDA 3ESQA 3D3EA 1OW3B 3LQKA 3OEED 5DHSA 7ABPA 4TWRA 3AF2A 3HQ4O 3IT0A 4BDSA 1SB9A 1XXLA 3UCXA 2NOAA 3HV0A 2XTJA 4O4JB 3G3EA 3ZCTA 3AM1A 3HMKA 3A0UA 3C7TA 4EBBA 4K3UA 1CFZA 3E22B 3DO8A 5HF8A 3UPUA 2DBQA 4QWMA 3NX4A 1Y5LA 3JQ7B 5L3VA 4RVCA 4GECA 2DEUA 2O0MA 2ZRJA 1UK7A 4PLFA 3VO2A 3BX1A 3LY5A 4BEWA 1H0KA 3GDFA 1WDLA 1I7DA 1C3VA 3VNBA 3WBBA 1GAXA 4WERA 4DIFA 4JU9A 3EY4A 3FOAA 1XA0A 1PQPA 2O1SA 3KC2A 1RWNA 3KWLA 4IDCA 4MVYA 1NVBA 1LC0A 1G6Q1 4N65A 4TV8F 4CF3A 1XWIA 3O47A 2JDID 3PXAA 1MX5A 1ZHHA 1IIBA 4FGKA 1CHNA 3QE2A 4JR2A 4LRXA 3RBAA 5DNCA 2C7PA 5LP6F 3DDCA 3FKJA 2H57A 5JPIA 3KVRA 1XD2B 1Z4JA 4EPWA 3NW9A 1Z73A 3OCZA 3N8IA 4A16A 5A7HA 3KHKA 5K3EA 1S01A 4NK5A 3VOSA 1F8XA 1U8TA 1YU9A 2DKOA 3C7CB 1BCSA 1Q21A 2HIGA 2ZI3A 3D4IA 3UMCA 3BMCA 2VJMA 3WQBA 3P2KA 3BQMB 4CL2A 1V37A 5CT9A 1BCRA 1NN3A 1RYBA 1JKXA 3FFBA 3LZDA 3ONDA 5BVHA 4GX2A 1GAQA 2Q8PA 3AY6A 4LRUA 4HDQB 1EWYA 5HCIA 1CR6A 3TVYA 2P3SA 4MJ3A 2Z8YM 3H3JA 1M2VA 3QV2A 4J07A 1M1UA 1WW2A 4WLFA 3W04A 1C4XA 4X64B 4OAOA 4LDAA 4DAOA 1BKYA 3D54D 2P6UA 5A5GA 2XYVA 1JSLA 2YVQA 3QU4A 3COPA 2YMPA 1S3SA 5G4KA 3OOYA 4KXFB 3L8GA 2Q2NA 2X0JA 1C5KA 3GFSA 4XJSA 2O2CA 2V45A 2X9GA 2GLTA 2OV2A 3GRKA 1E7RA 2YV5A 2J5RA 3K5PA 4FMCB 4JP8A 3ZU5A 4B3TB 5I7UA 2DAPA 1GVHA 1IY2A 1HOTA 2ADOA 2QTFA 1N0UA 1RQPA 1XDDA 2WJAA 3HJTA 4IDGA 4X8LA 4E2YA 2IXGA 2NSYA 4KWTA 4LJLA 3M3DA 3U4DA 3ZBQA 3N8KA 3SX0A 1UAYA 5JQWA 4IJQA 1I33A 5KSWB 4B8YA 2FN3A 4DJJA 4ERNA 2I65A 3B12A 5COBA 2PAFA 1AMUA 1AUQA 4E7OA 2XNHA 2BOVA 2WWFA 2H2HA 3BQ9A 3C6ZA 4FFNA 2PLFA 2FGKA 3CEAA 2PWBA 4W9NC 1BHO1 4NICA 3TAUA 4D9JA 2GJKA 4HNGA 1I5RA 4QGSA 1SOUA 5H7XA 3BE6A 2X0FA 2DM6A 2ZB2A 4V1CI 1W5TA 3OPYB 4HAVA 3WAKA 5ESWA 1T34A 3IQGX 4AC9A 4MJLA 2GF0A 1TT5A 2VBCA 4BQEA 3S2IA 2P9EA 2GLUA 1TJYA 3GJ3A 3ABSB 3KOZA 2VCEA 2WF6A 1U0GA 3SP1A 5CVCA 5KVCA 1E8DA 2AMVA 4UVDA 2JIMA 4G5YA 1KP2A 4UVGA 1EP9A 5FLKA 5LP1A 3A6JA 1UXOA 2I7VA 3MUEA 3D1VA 1PQ4A 3F9RA 4P4TA 4Y2QA 3UFXB 3SD7A 1YNOA 1U28C 1ZIOA 4RJTA 3PVSA 1DMRA 5CFLA 3DB1A 1GZUA 1OHHA 3WL3A 1XI2A 2EKDA 1I7SB 2GPBA 2VUIB 5C8YF 3A6HA 2IX3A 2NO0A 3N0TA 3GAAA 3I1YA 4QOSA 5C37A 2ORIA 4LV8B 3IB6A 3TOZA 4C22A 4Y1GA 4OK6A 4FFSA 3GJ5A 5CMLA 3INTA 2PL3A 5LC1A 3BRQA 3NHRA 1E79D 3A9CA 4LWZA 4RK7A 4EG6A 2SECE 4RU1A 1D2CA 1LVHA 2ATEA 3LX8A 1J5PA 4LUCA 4OSOA 5CVUA 5IJ0A 5HVNA 5LMZA 3R7NA 4MRNA 1XJQA 4PBRA 1ZQ1A 1UBEA 2J85A 3HCPA 2P1ZA 3LPLA 4ZXPA 3V8RA 5CIYA 2VDQB 2PCLA 4MW9A 3WGYA 1U9ZA 2YVLA 5E7MA 3F98A 5I7VA 4OUDB 2JJMA 3RARA 2OO7A 4KV7A 4QATA 7GPBA 1ZMBA 1CEQA 1QDUA 2JRLA 3BMOB 2P6MA 2EWMA 1XZPA 3F8SA 2DLDA 5CLGA 2PH5A 1TYZA 4NG5A 5C5EA 3ERCA 3L6CA 4CF4A 1ZUHA 2HBYA 2XKJE 1NTOA 3EXAA 5HKKA 1XDUA 1ZJJA 4HQKA 1V7QA 4YACA 4YMUA 2UUCB 1MGOA 1QAMA 3UW3A 1GNPA 2PKEA 3BAFA 2VL7A 3NYIA 4RABA 4AN4A 4W5OA 3KQLA 2EXXA 1JEDA 1TUGA 2Q5EA 2BIFA 2OZKA 1OTHA 3R40A 1VLMA 4KBGA 3ABZA 4ZOCA 4NH4A 2P40A 1M2KA 1Y1SA 3UV7A 1WEKA 1UQRA 3VNQA 2P9ZA 1EFAA 5AVYA 4H1WA 2GK6A 4RHTA 4FCVA 2PRIA 1NC1A 1X42A 1BXRA 2WDZA 3BAZA 3QJYA 1BIFA 4RD4A 1N0VC 1EFRD 4BGEA 4C6RA 1VOTA 3GH3A 3VC3A 5EZQA 4C0XA 3ESDA 1D9ZA 1EG7A 4IOJA 1OX4A 4RV9A 4IP0A 2BKLA 1MLDA 2OCGA 3FYUC 4LW8A 1Z2NX 1A95A 1T6NA 3BDVA 4P7GA 3NGMA 4A4DA 4CKEB 3W3ZB 4DQXA 5JCOC 3NDPA 3N8NA 2EWVA 4B45A 3WDLA 2H4FA 1SXJE 1XEWX 4IDFA 1ORTA 4EW3A 3PFHA 2C94A 2JJ2D 4UMFA 3FMOB 4KGDA 2NV0A 4UAVA 3W2EA 1QIEA 1DSSG 4PM4A 3W5JA 2BKUA 4DXDA 3S2EA 3CNQS 3NOVA 3OOSA 4YUAA 1M2NA 1DADA 2NZ8A 2YUIA 3I2IA 1S4MA 5KYTA 2CCGA 2E48A 2QBYA 2C9OA 3AM5A 4XSHA 3V7YA 4MUIA 1Q95A 2VPIA 4CHTA 1NVXQ 2IIQA 4BKQA 5JPDA 3OJCA 5LMUB 1T0UA 2BW0A 3GIWA 3CA8A 3QU9A 2DCUA 1SCIA 5CYOA 4MYSA 2WHPA 2WUGA 4MUFA 5C5IA 2PGIA 4K9LA 3ZWOA 3OZCA 3SNKA 1U5CA 1Q2XA 2L19A 5CW1A 1C41A 1SGWA 3ZVKA 1GL6A 2XHEA 5KSZA 2MSEB 2AF4C 1RHJA 1YMVA 3BL8A 4RJKA 1QYDA 2GM9A 4WQMA 3WSWA 2FPMA 1QKJA 2Q0HA 1C1XB 3MTQA 1G7SA 1VSVA 4C0QC 4J0KA 3UJ3X 1T9HA 4IG4A 5LU8A 4ECEA 1WV1A 2P5UA 2ZP1A 3HA3A 3ROKA 4DKJA 4GKBA 4ND3A 3L4SO 5JSUA 1GAEO 2YC2C 3HYRA 1H5UA 1W36C 1W76A 4TTQA 3CM0A 3E4DA 2V9PA 1I3OA 5AJWA 1KNQA 2CMGA 1U3FA 2C4NA 5HOEA 1QYXA 3MW8A 4RGVA 3LKVA 3T1NA 1RQNA 3EZ6A 5FUVA 3WOVA 2PDAA 1U7XA 4J03A 3GLFE 2V58A 1BE8A 2GSWA 2X6QA 1QG0A 3ED1A 3LCJA 3TDNA 2FDXA 1CS0B 1UM9A 3TRDA 2P2CA 1EDOA 1U7TA 1NSTA 3U7JA 3BBPA 1FXSA 1EVJA 1W5EA 1AXEA 2ZYSA 4MGIR 3I9KA 4FS3A 5JADA 5TVKA 1OLXB 3UKDA 4K9RA 2OYSA 3VR3D 2QTBA 2F9MA 2QYSA 4UNIA 4BLOA 1K2VN 3WDKA 4O6VA 1R4MA 2O8NA 2AJ8A 1A82A 2SBTA 3GLHE 1PFQA 2OAEA 2YJZA 3MN1A 2QRVA 3NONA 5H16A 4MUMA 1GSAA 5CDYA 3OIVA 3GZ4A 5EP3A 1F5SA 1RI1A 4V0MA 3WMGA 4Q7QA 3MXTA 1VJCA 1UK8A 4PSDA 1L6RA 2GCOB 1P5ZB 1XHEA 2OWEA 3L0YA 5CX4A 5LBTA 3UHJA 5M2QA 4GLLA 3W8EA 5LXTA 1VLQA 2PK3A 2PT9A 1DKMA 1H1TA 1IULA 2R4QA 3FDIA 3I9FA 3MG9A 3P9SA 4HAUA 4MV6A 4Z9BA 5JCJA 3BMNA 4HXFB 1ZH2A 4JR1A 2HN9A 1RHKA 1RMTA 4KQ9A 2INGX 4KV9A 5D3MA 1O9GA 2HYDA 4ZD6A 2FLKA 3X2SA 4HWPA 1OIXA 2IHKA 4M2LA 1H5QA 4MVJP 2W6ID 4ZVMA 2Y05A 5TJ9A 2PMEA 3TMKA 5AOCA 3MB8A 3RROA 3JAKA 4TQAA 4NCJA 5KSYA 2ONYA 3P2MA 1XCLA 1KVUA 4LDRA 4M46A 3DL2A 5K20A 1HL7A 1L4MA 4N5LA 1ACJA 3EXHC 1E99A 1OGYA 5AHRA 1MZVA 4O4IF 3VDXA 3VSCA 2GJ9A 1P31A 2R7MA 3TQHA 1E96A 1QVZA 2ZI5A 3EXEB 4UHCA 5L3ZA 3ZWQA 4E0BA 4ZYVA 2GEKA 2RGDA 3RK4A 3ZWCA 3E7PA 1R9NA 1LB1B 3KQUA 2OE2A 1ODKA 3I5MA 1R8QA 2J46A 3VYWA 1JILA 1W1WA 2G25A 4GKAA 4MRVA 1E2MA 3SBOA 3AINA 4YI3A 3AP1A 2CLMB 3UMYA 3QVWA 1YTLA 3HEMA 4IW3B 3D6HA 3NM5A 4GP9A 4LECA 1A27A 4DVGA 1FU4A 2JIZA 3CCFA 4FNAA 2P3QA 2QRVB 4Q21A 4RVFA 3ND6A 4GPAA 4ZANA 4GX0A 4O2RA 5B58T 1GD1O 2RGWA 3O94A 4MP3A 1DCMA 5F3WB 3IVAA 3GROA 4MKHA 4FLEA 2CD7A 3FYUB 1U1FA 2ZT7A 3F5MA 4IXNA 4NCKA 4E70A 1ZN8A 5LL6P 3D4LA 2FMTA 2MHCA 5BMVA 1YONA 5BSHA 3GC6A 1O96B 1HYEA 4AKGA 4EA8A 4QDOA 4LOKA 2JIZD 4ZARA 1NNSA 3H1PA 2VYNA 3DMDA 4L4ZA 4BBJA 3HB5X 1Z0AA 3DXXA 3RF6A 2NZVG 3VOTA 2WFZA 1OU0A 3B8EA 3IBYA 1ECGA 2R1VA 3LK6A 3F9CA 4IVPA 3V00A 5C81A 3PWKA 3JAMA 2NQTA 3AR5A 1TZCA 2R79A 3K09A 1F5NA 3MCWA 5CJ2A 3DO6A 3R75A 1ZGCA 3ZCVA 3IKVA 3P0EA 1GZSA 4B6RA 3AIMA 4J3NA 3DQQA 1R4AA 3F3SA 4F4DA 2PCJA 4B35A 4GL2A 2VHQA 2BFWA 1FVFA 4DC1A 2O1XA 4HDMA 3QTLA 3N58A 4KNVA 1DWQA 1X1BA 3QX8A 4E1BA 2AC4A 5ALEA 1XF9A 2W6IA 3OJEA 4EKEA 3FHLA 4KKXB 2NU6A 3BJZA 1QP0A 1LEHA 2HWUA 4DKXA 4KPFC 4QREA 4WBNF 3DNPA 3LS2A 4IQ4A 4OJNA 3WK8A 4CHGA 1NMEA 5HIKA 1WJGA 3A6KA 3PWZA 1EXDA 1YZUA 3EEFA 1LLCA 4AG5A 2RB5A 3EEYA 3Q3JB 2YV4A 1X0XA 1EM8B 3LGXA 4AKEA 3QLVA 4YUYA 3I01A 4QARA 1FNCA 2AOTB 1T9BA 4O4LF 2LGJA 5KNCH 2BM9A 4HCJA 4Q1AA 4B4OA 1Y9DA 1R0LA 1BOOA 1E79A 3GD5A 3IX7A 4OXNA 3O95A 5DK4A 4FLMA 5E9QA 3VR3A 2QI9C 4OREX 3E5RA 5B3JA 1ZM3A 4WEQA 1SBTA 1RPNA 4JODA 2CLIB 1M6HA 3C3BA 3PI7A 1SBYA 3REOA 2EGHA 5A5DA 4C7MA 5LQCA 1VPTA 3JQBC 1V1MB 4GIBA 1XPJA 4BFXA 5K3OA 1G98A 5KBYA 1GPH1 4IIJF 4BMVA 3WWYA 4URZR 2HCRA 3ANTA 4IFBA 4BJ5A 3VVLA 1AO0A 2WKQA 5HS6A 4IRUB 5AVXA 4DR5B 3TTUA 1VHDA 2NU6B 5A0FA 4YV1A 1I3KA 1AQYA 1W4BA 4BJHB 5KDOA 4HUJA 3G2PA 4MAAA 1GT91 4PLYA 1IMJA 4J29A 2IHUA 3DZDA 3WGMA 4AIRA 1VL0A 4RHYA 1Q0PA 4ON9A 2YN2A 2ZBEA 2DH6A 3AX6A 5LQUA 2QXTA 4HMOA 1PK7A 5BW4A 3AUKA 1OV4A 5JR3A 3KYBA 4LGVA 2V03A 3LFUA 2BRUA 1C0EA 2WHQA 3R0VA 4L02A 2H08A 3KQMA 4LJYA 4BTVA 1LI5A 2CFSA 3GGJA 4GRDA 4O2AA 3TG2A 2WB2A 1SM4A 3IR6A 3KP1A 4QHSA 1MJGM 3TECE 4PY2A 5B3LA 2W6QA 1E8NA 3COZA 2HAEA 2O50A 3DAOA 5KU7A 4PZUA 3R76A 3DMGA 2BL4A 1B4DA 2WVAA 3WK7A 1QH9A 4AULA 1CC1S 4V38A 5K9ZA 1LW6E 2IBSA 5FD8A 3G8AA 3PC6A 3G1UA 3T3PB 2VTBA 4YT4A 1GDHA 1M5UA 2AWOA 4E33A 3ESBA 3IMKA 4OM7A 2O54A 2WF8A 3BIOA 3S40A 1VYUA 1V1MA 5HIJA 3ZH2A 3UEOA 3DMNA 3JATA 3PDIB 4C14A 2JGDB 3G02A 5YASA 4BTEA 1Y1KE 4BO1A 4ZZ1A 2C1ZA 1T4CB 1IHPA 5DGCA 2DPHA 3HR8A 1PKXA 3PTLA 2PRKA 5IHXA 4O63O 3SHFA 2XWSA 1GA4A 3PRKE 5IJ9A 1LZKA 3SAJA 5AVQA 1XNQB 3ANSA 1PTKA 2DFNA 2P3LA 2F00A 3U3JA 2XGJA 1E2KA 4JJ6A 4QGBA 1N5OX 1QVVA 3VHXA 2ID4A 2HA4A 5IBCA 2F7SA 1JLLA 2NNLD 3IT2A 4Q05A 1L8QA 3FNRA 4G0ZA 4TM7A 4Y2PA 3NUQA 3OESA 4DNXA 4DLLA 2ZIAA 3F4LA 4O1HA 3RJ5A 4JLJA 3NHFA 2F1HA 3BG5A 4DL9A 2ZBPA 3VSBA 1JZSA 1RQ7A 1JDJA 4O3MA 1ZR2A 4UBIA 2QW8A 4RJLA 1A7UA 1XF1A 4ZPJA 3Q0EA 4AU1A 3G2NA 3V4SA 2ET6A 3GDHA 3NYQA 2HF8A 3QQPA 3WS7A 3OM8A 3VH4A 1CCWA 2JZCA 1Z07A 1F3OA 2Y77A 3C87A 3VI3B 2FWRA 3DMTA 3IELA 1JIIA 4MW1A 1E3TA 2NYRA 3B6JA 3VKHA 1FVOA 3CLRD 1KZ9A 3GQBB 1PZXA 3WQSB 2ZR8A 2DFKB 4R71A 3CN7A 4A73A 4IOLA 2YDYA 1KVSA 2YY6A 1GV1A 1GUZA 3E03A 1QO9A 3A9TA 2D00A 3SC6A 1G66A 1K9VF 4ENSA 2JGRA 1N2CA 2UV8A 1RI3A 4ESOA 3D7SA 3TTYA 2C54A 3ZVRA 1E2HA 3AK4A 5KTNA 2QMYA 3PC3A 4L72A 4PGAA 3WGKA 4MQBA 1GZ7A 2LCIA 3KT8A 2X14A 2JI4A 1OFUA 2ZYWX 2OHJA 3HU3A 3HU1A 3QXJA 4U3JA 2BP7B 3SC3A 1ZGBA 1KERA 4DXHA 3KALA 3IFSA 3ZD9A 1MIOA 2WAMA 4MUBA 1J90A 4EJMA 4YAWA 5E6RB 2GLXA 4AZ0B 1SFRA 3NWEA 1CUAA 4X1IA 3N6XA 4UOZA 3B38A 2BBWA 3QKIA 5JYDA 1YHZA 3GPDG 1GCOA 3RC8A 1HEIA 2CXHA 2Y1GA 5FIUA 1NE2A 3ELWA 3FAZA 3IAM6 4GDFA 2W4IA 1ONBA 5AMXA 1EG2A 5IYZB 2QSUA 3QW2A 2QUBA 4HDOB 5IXJA 1EBBA 1HFWA 1C1DB 3RSZA 4B82A 3CZMA 3KDPA 2BJVA 2FPLA 2WJVA 4EDHA 2RHOA 4MW0A 3ZE8A 4ZVOA 1VSBA 1A2BA 1UBOS 4HLNA 1SRRA 4INAA 4LG1A 4QGFA 4TGLA 3I73A 5IVPA 2DBVO 1K66A 1SQGA 3MAGA 3PIIA 3QHQA 5EEGA 1RBQA 1DAFA 2DHRA 2YY5A 4YLEA 1PWYE 1N2CB 2HB6A 2WSSA 2YWXA 2YXPX 2ZT6A 3CONA 3QLTA 4D4JA 1KU0A 2WWRA 2G17A 1PSZA 2CGEA 3EPJA 4R8KA 2QTGA 2W90A 3FB4A 2VP4A 4KO1S 4XDZA 5B7NA 1MB3A 2V7TA 2BP7A 3I6IA 5HEKA 3RVJA 1T1JA 1X1DA 3HEAA 3LX4A 1BVUA 4FP9A 5BW6B 3RM3A 3KL2A 3ZN2A 1FC0A 3HE3A 3GXBA 4QUDA 4LOJA 2JAXA 1QX4A 3P4YA 4NENA 1I2DA 3ROPA 1KPGA 4FBLA 3SS9X 5FNZA 2OXCA 2B5VA 1H8HA 4JUBA 4J9VA 1W5AA 4L7QA 1ID8A 2GZRA 4YMGA 1NA5A 3NOXA 4OO3A 4MUEA 3PT5A 4Q4AB 1NXOA 4FZ3A 1S2OA 4I3FA 3PYMA 4EG1A 1BWPA 3UYLA 4TQ9A 5AHWA 2OENG 3KZXA 5A6VA 4JBNA 4AZWA 2HLNA 2BEUB 4OGWA 1ND6A 3HRKA 4X00A 3WHPA 1NW7A 2X0IA 3DMPA 3MBIA 3OUTA 5TF0A 1P4AA 4K9PA 4TROA 2NUPA 2IITA 3BT7A 5HOQA 1OREA 2C2KA 4HYEA 5C31A 1NFFA 5CVDA 5I7FA 2CLFB 2VK2A 2ZANA 1EXVA 3H3FA 3VR5A 1WZNA 2AEMA 3MNFA 4C5BA 1ST3A 5BMVF 3ZJUA 2G63A 3K6SA 4H9GA 1V96A 1XMQB 1UIRA 4ZHQB 1Y4UA 1KIFA 2A5GA 3NEYA 2GN9A 1HDXA 3QMPA 2APJA 4JJKA 5CEJA 3G79A 1TJPB 1MAAA 5F9FA 2PSHA 4KH1A 4D0RA 1LRLA 3B2QA 5ECDA 1KJZA 4FKMA 1M0TA 2JEZA 3HDGA 4MV8A 5TQ0A 4ENQA 2W2VA 1SKAA 4QU8A 4IEFB 2X2EA 3ZGOA 1JPUA 2R1ZA 2NSHA 3CTMA 4C0WA 4QYWA 3RC1A 3T38A 4KGVA 2IP2A 4YCCA 1JYSA 3DEHA 4MUJA 1C7EA 4ER6A 4OBXA 1MT3A 1D3AA 4I4LA 4WJLA 3VUEA 1WMBA 2MSNA 1N92A 4TWIA 2Y2UA 3NS7A 4R3WA 1Y6FA 3AEZA 2WJZB 6YASA 2Q0XA 1SNYA 1PT5A 3FFXA 3U7QB 3CISA 3C3DA 3FNBA 4JOSA 1ZCAA 4K9KA 1J39A 3OCWA 1VL2A 3THWA 1KOFA 4OJTA 4DRXB 1SU6A 3CV3A 2IYVA 3O8QB 3RSOA 3L18A 4RHUA 5G40A 1UZNA 4AYWA 1S2GA 5TV2A 2R7KA 4C5AA 2DX7A 2JASA 3C6KA 3H0CA 2FZGA 2E4AA 1ORRA 3LT5A 3W8FA 2B5OA 3JQAB 3DKIA 3K15A 1HQYE 2VQFB 3K6SB 3T5CA 1MV5A 2EJWA 2NNWB 1RE1A 4AZ3B 3LUPA 3A1NA 1OJ7A 1PL6A 4PC7A 2GAFA 2IW1A 5B1DA 1FMCA 3EIQA 1G8SA 3KV3O 4WA8A 3THXB 1YJBA 4PGFA 1ODCA 3VR6H 4MAMA 3RIYA 4ZTUB 1LV8A 5CLQA 1EHIA 1M1YE 1QF6A 2D54A 4KPUB 1AZWA 2EZTA 2REXB 3D0RA 4FOPA 2L2QA 2WVGA 2K6GA 2Z8YA 3K6RA 3OQNA 3T1QA 2OOKA 1KXJA 1PL0A 2FRVA 1JJFA 3OY7A 4CW7A 3V8NA 1VSQA 1FJHA 9MHTA 3DFIA 4EFLA 3MTDA 4ZVLA 2ZBDA 5IPFA 2G72A 4NCXA 3CLSD 1Z7GA 5B7QA 2C03A 5I9SA 3L8CA 1FUEA 4BVFA 1U3DA 5EWMB 3KVOA 3UMGA 5CGZA 4BBPA 1N8TA 4LDZA 5LQRA 4ZFNA 4URVR 2BGJA 3RPEA 2BFEB 3AW8A 2AFHB 1UBRS 1KZ1A 1ID1A 4Q37A 1D8TA 3N3BC 3T4EA 3P7MA 2FUCA 1NUAA 4QLOA 2HDNB 1F51E 2I4MA 3DONA 3RS7A 1N3BA 5LZ2A 1QDLB 4CG1A 2Z6AA 2GA9A 1C4OA 1DE0A 1E3DA 1YZFA 2WD7B 2GCPA 3R2JA 5HRAA 1G2PA 5JFGA 1ODLA 3GUZA 1SEVA 4GLJA 5KOHB 4DHWA 4PHTA 3BA1A 4V02A 3CLRC 3THXA 4X61A 4WY8A 1NF9A 5A7FA 1FNSA 3B8HA 3CEJA 1L7RA 1KOGA 4II2A 2HXGA 1X13A 3D6NB 3FSJX 3HY3A 3JWEA 4G89A 4M0KA 5FWDA 3O1JC 4GMGA 5IKPA 5JUWA 5LNK1 2P9HA 1Q0SA 3S81A 4R01A 1L1FA 2GMWA 2PQ2A 4EA7A 121PA 4PLWA 2G5TA 1SXHA 2I03A 1GNRA 2P90A 4MULA 4QOHA 1N2OA 3H2GA 3ZVNA 1RD4A 1W1UA 5CYPA 3OZUA 2B0CA 2GR9A 3I5UA 3B1JA 1CLEA 4RGBA 2YTZA 2AN5A 4X1YA 5HMLA 1ATZA 4AMZA 4UOEA 1DRUA 4LXTA 1LUAA 4NHOA 3IMEA 4K81B 1OR8A 1W19A 3BMQB 3F3MA 1TMYA 2CXNA 4ZO7A 3P4XA 3LGAA 3RRJA 1TI7A 2YNMA 3FMVA 4I50F 4C76A 3NBQA 4QPCA 3I30X 5CA1B 4HNQA 3ETEA 1A8SA 1QYWA 2H8GA 2YWJA 3OFND 1XYVA 4LVCA 1OH7A 4KUGA 4YRPA 4D41A 1LTHR 5ANRB 1ADFA 4C05A 1JAZA 4QOEA 5ELMA 4MRSA 2OZVA 5FPSA 3QX3A 2FKAA 3BTOA 4C43A 5AKYA 3ZK9A 1Q0RA 2P4SA 2PU7A 4Q3OA 1RQRA 2WYVA 3K31A 4WXMA 4NEGA 1XQWA 1CKEA 2IGBA 4J1NA 4EDFA 3FZQA 2IC5A 3T9AA 4JBLA 1FXUA 4FR5A 4EB3A 4KXYA 2VF8A 1LBQA 3D6TB 3OI7A 3QFRA 4HDNA 4Y2TA 3RTAA 2HX1A 1XYYA 5F2OA 4FN5A 1U11A 4QYTA 4KTTE 1W36B 4UZEA 1RWPA 2VBGA 4AT1A 1XBTA 1OWPA 2VRBA 1DQNA 3EGIA 3QVMA 4JUCA 2H06A 2P2LA 4I5FA 1JSCA 2JARA 1GTSA 1EIZA 3T3DA 2I76A 3PXXA 3B7WA 5G1NA 3FOFC 2KBFA 3BGWA 1A69A 3CJQA 3P2EA 4QVIA 1PEDA 2VPQA 3MT0A 1ZRMA 2RBEA 4NF2A 1JG3A 3RI3A 4UDYX 5ABPA 5B30A 1D4FA 4EB6A 2FNAA 1H9BA 3BHIA 3B9RA 3FHOA 4NOKA 5AJYA 3RSLA 2Q8QA 4YAEA 2CHQA 4R1MA 2WG1A 3DPSA 3CF4G 1EWRA 5SICE 2WKWA 1ZK1A 2H5IA 2HPHA 5DW3A 1RLIA 2RKOA 5HPYB 5ICCA 4B7CA 1TRHA 2QXYA 1C0PA 4RS4A 2NXCA 2ZXEA 5ALHA 2JGJA 4IIEA 5FAKA 2BFNA 2VZEA 5KHLB 1R66A 3ORSA 3N86A 3NAGA 4JQCA 3FETA 1YACA 3JQ9C 5BT9A 1QP4A 3O2QB 3W8RA 1ODJA 2ZBVA 5AVKA 3BXPA 3JQGB 5BOVA 2AKEA 1UOOA 5ALNA 3IA2A 2IYQA 3EEBA 2YMQA 4MICA 3CPSA 1EVZA 2OCAA 4BAZA 2JW5A 1OI2A 3O91A 4C3UA 2IUFA 1NF2A 1EE1A 1GKIA 2VSXA 3QOXA 1D0VA 2I6TA 4AQ7A 1FFSA 3H6KA 1PGJA 3AU8A 3LO8A 3BOSA 3P0RA 2XITA 4KIJA 2D3WA 4OIFA 2B0JA 2NN3C 3EEIA 4HDKB 4U9IS 4UXHA 2R6R1 1G1AA 2QRKA 1IIRA 5BNIA 3V32A 1LH0A 1H2RS 1Y9JA 3L7DA 2CFOA 3QLUC 1XTRA 4Y9TA 1L5NA 1ORIA 3E5HA 3KCNA 3UV3A 1RRCA 4EYKA 1KMNA 1V16A 3HUEA 1G5IA 3PJFA 3UJ9A 3GRCA 3HWSA 1MU0A 4L9RA 4V0NA 4UOQA 1UC5B 5LIPA 4DEYA 2EBUA 2XVXA 4QOJA 1YD7A 2DQ4A 1N9ZA 2ZRFA 2VTDA 3NBFA 3ZJYA 1X15A 2H0RA 2HA5A 3LL4A 4YUWA 3D3JA 3IB3A 4FBGA 2ZYGA 3OKCA 3DXFA 1OWMA 3U49A 3RIGA 2R62A 3CF6R 1Z3IX 4L4XA 2LDBA 4EI2A 3QEMA 3QHPA 1AD2A 4X45A 3QV1A 1V5FA 2EFEB 1KO8A 3AQIA 2XEDA 4XFDA 2FN8A 4LMPA 5GV7A 1WG8A 2XIJA 5DCLA 3LCVB 3MMPA 1T36B 4CGZA 4D6PA 1FSGA 3U4QA 4EPTA 4JWKA 4POAA 3VZBA 3S8EA 4HNSA 1YUNA 4MKFA 1GRVA 5LSAA 2IUTA 4JY7A 1UZLA 1JR3A 4DMCA 4R40A 5CCDA 1VE6A 3BGIA 2NMVA 2XV1A 2FWBA 1PYOA 2H1CA 3BFKA 3OCYA 2YCLA 4PSAA 5CA0A 3RREA 4D74A 4DMLA 4CN9A 1AMNA 3P27A 2OG2A 4OSPA 3O8NA 5ICEA 1MMFB 5KTRA 1FTGA 4BS9A 2JAPA 1JKFA 4WXPA 4UEKA 5D7BA 3U4HA 4EZIA 3W1VA 3WG9A 2K2WA 2I1WA 3NASA 3VV3A 3ZD7A 3HGQA 3EPPA 4ZAZA 4RTSA 2O8BA 3GT7A 2RGUA 3X3HA 4LKRA 4AW9A 3HBFA 2OBXA 1FB5A 3V6MA 4FWBA 3ZZMA 3PVCA 4M1TA 2OORC 4MSUA 3WJ2A 2GAIA 4B9AA 5HE9A 5K6AA 3QEMB 1PNRA 1N78A 4URYR 4V0ME 4LXGA 5KZMB 1CRZA 1E20A 4D6YA 3FKSD 1Q0HA 3VR4A 3TQSA 1Q50A 2NU9A 1CUSA 2QJTA 1KDVA 1JFTA 4WBNA 1TMGE 4D57A 4DBVO 1R00A 4UNQA 1LI4A 3U4QB 1FTNA 4P0QB 3OT4A 1TM5E 1C8BA 2JIPA 4RV4A 4N5DA 3NVKI 3E1SA 2Z56A 3I4FA 3X0DA 1KO4A 5DYNA 1NNUA 4G1EB 2G77B 3M6UA 2XOEA 3LUBA 1H0RA 2Z0MA 2CFCA 1HE4A 3DNFA 2OCLA 2BD0A 3SYRA 1FFGA 1JNXX 3QUTA 4KK3A 4W7HA 5FOSA 4MB0A 5D00A 3SIRA 4BO5A 3RKRA 2Z9DA 4D9KA 1PEAA 1VL1A 2CHEA 3G2JA 1FOEB 2O5CA 5AHOA 3S8MA 3RT7A 4FNOA 1FUYB 3VPGA 5TPZA 2BY4A 5CUQA 1BE6A 1CNMA 3GA0A 2AMFA 3HBLA 1LSSA 4QJIA 4ALNA 1XKQA 1T3SA 1NIPA 3KXDA 1UZAA 4RDIA 2FZ4A 3L5KA 2OO5A 4GYYA 1NKTA 1QMGA 3OWXA 1B2LA 1VE5A 1XQ9A 1QAQA 3ND9A 2P65A 2QD1A 5CDTA 4J6FA 4MDEA 4L22A 1OHHD 3KQWA 5IUKC 3MOSA 3DYIA 4NMHA 2XCOA 4EKYA 5FWYB 2R96A 4JL5A 4BWFB 2FCRA 2GH1A 2A4MA 3ANLA 2GD6A 4M8IA 3QF7A 4O33A 4ND5A 4Q3AA 5TB5A 4BMDA 5KJFA 3VNUA 5A4MS 1ODIA 1FNMA 1GYPA 2GZ2A 2YV1A 4KVAA 4XD2A 5FO0A 5JATA 4KLZA 1JIJA 2QBYB 1FUIA 2QD3A 2AIRA 3HH8A 3KEMA 1ZZEA 4LA4A 1OT3A 3MS7A 1EFTA 3RD5A 5GY7A 3V97A 4CT0A 5B4VA 5I7OA 4OKSA 4X84A 3E9EA 5SZIA 5BWMA 3LP5A 3ZDEA 4KDCA 3T61A 3U3KA 5DISB 4BLVA 5J3JA 1EX6A 4HDRB 1P2BA 1BH6A 1Z47A 3H17A 4RZIA 2HQRA 1L7MA 1OBHA 4JBWA 5EGSA 4ZIRA 1C9NA 4REQA 4L75A 5HUQA 2IHJA 2ZSFA 1I13A 1E1LA 2GEUA 3HDHA 5K3BA 5JARA 1QIIA 1RRMA 3FMIA 1DB3A 2NYUA 3VSAA 1KMCA 4EJSC 3H1AA 4QRDA 2PD4A 1ZRHA 2C3YA 4KQCA 2I3DA 3FCOA 4P92A 4EMSA 1PFVA 2QN9A 3OZTA 3AFIA 3MJSA 2VQ3A 2G76A 2Z4RA 2ZE5A 1V95A 2VHXA 4GQBA 3A11A 3IIJA 3R0IA 3NAMA 4G8CA 5K3FA 1MQAA 1VXRA 3MCZA 3OT1A 2D5CA 1NP6A 2JGEA 2ZWIA 2JBAA 3LCMA 3LLVA 3PX2A 4G09A 4MCAA 4BMSA 4NRDA 2YQ5A 4ZAYA 3UMBA 3N2KA 4IOKA 3Q12A 2XD4A 5K8TA 3Q7TA 4TT3A 1QYCA 1XG5A 3JQQA 1HT2E 4CLRA 2PYZA 5I9TA 1M34E 3PFNA 4EY6A 1C9KA 2EFCB 3UT5A 3DEFA 5FBQB 5H4GA 3NBKA 4ARBA 4IO0A 4OGLA 2VRCD 4WNCA 2IYZA 2EYUA 3GBPA 3AKZA 3IC5A 1O94C 1RYHA 2FK7A 1KDOA 5TQVA 3RG2A 1GGEA 2QN7A 2WLSA 4WECA 3TE6A 1Y48E 4WKGA 2PGOA 3GOHA 1GGVA 1I2ZA 1P6QA 1RQXA 1D6JA 2MWMA 2BMAA 1FW8A 3DM5A 3LT0A 3B52X 3JTEA 4DSAA 2O05A 2P2DA 2R8RA 1F6DA 3WLKX 5JSKA 3C3MA 2PPLA 4E31A 2F9LA 2IHVA 5DM1A 4Q3KA 1VPDA 1SIOA 4ZT4A 1J1UA 4XX0B 1QVWA 2GQ0A 2QE7D 2UZAA 3DO5A 5C1BA 3E7FA 2X1VA 1T43A 2Q1WA 3GUCA 4J2HA 1O95A 4R51A 3CYFA 1WCWA 1GZ6A 4XD7A 5AR1A 1EK1A 3ENKA 1AKMA 3F74A 1F17A 2HSGA 3NHLA 4IIBA 1WW3A 3SDSA 3WK6A 3L4EA 5B1YA 3WI7A 1ZIYA 3D02A 3ASVA 4LE1A 5A3QA 3ZDYB 3PEFA 2XDWA 1UQUA 1ZMTA 4F4IA 1GFIA 1CY6A 1SBZA 1I30A 4UTOA 3W9YA 4KR6A 3B85A 3GGSA 4KQMA 2ID7A 4P98A 1M8KA 1THMA 3I05A 2WTMA 3LC1O 3M81A 1U3WA 3PNSA 1IE3A 3PE6A 3CINA 1CQZA 1TAHA 5A4JA 2VK4A 1KI4A 2CC2A 1CJTC 2GD2A 2ZB7A 3BF8A 1N25A 2O5RA 2O9JA 4PQRA 5EMJA 4B09A 3DMFA 4U7FA 3U3MA 3U4AA 1QKIA 4YQEA 3W1WA 4UULA 1B14A 1ORDA 1SBCA 4IYRA 1LVGA 1XFDA 3KTOA 5F4BA 5CFNA 3TZBA 1ZICA 1EP2B 3IDQA 3HACA 4BQPA 3ORFA 5EESA 3MIZA 5K2OA 4I8IA 3KSRA 1XCOA 2OCPA 4EENA 1G8AA 1X38A 3E82A 4XVCA 3E70C 4ME6A 5BXYA 3NVMB 3TL6A 1AF4A 4DYHA 2GXAA 4EEXA 3KRTA 1C30B 2AJDA 1Y9EA 1OXVA 5BQ3A 2MYUA 3G9TA 1Z34A 4HADA 6REQB 3O93A 2R8ZA 2A9JA 3HJUA 2UAGA 3UC9A 3LQ4A 3EEOA 3B1ZA 3VX4A 1GA1A 2PGNA 3RVKA 4QRHA 1IQRA 2PA0A 1H3NA 5CU7A 4DLPA 4NAUA 2PUTA 5LVAA 4YAIA 3FSGD 3GFFA 2IHNA 3O8OB 4TL6A 2OBYA 4N6OA 5JS2A 3EVBA 1CU1A 4RBNA 3VTAA 3FUCA 2X41A 5EJFA 2A57A 4G1UC 1YIAA 1WABA 3CVWA 4KHZA 3NR2A 3HO6A 1F38A 2YJNA 1KFBB 4TLDA 5K0TA 2YASA 3TBFA 1RIFA 2QTRA 5KHAA 3DZ8A 4PG4A 5LBIA 4BO4A 4U7JA 5GTDA 3T1HB 5WRFA 5K3SA 4DSUA 1W35A 2ZTSA 2Q5JA 5JJKA 1MIHA 3D43A 4UE6A 4V0QA 2BE7A 3LF2A 4R7ZA 1GQFA 4C07A 1UJCA 3C6QA 1TDJA 3L0OA 3WKEA 4FYPA 4NULA 3H2ZA 5KNDD 4C4SA 2I34A 2SNIE 1Q19A 1TAQA 4YJFA 4JI3B 4XTCS 3YASA 5AI0A 5LCXA 4A8JA 4NBNA 4AWBA 3M1AA 4CBVA 5GP1A 1WHSA 1E58A 1ZL2A 1HT1E 2BJHA 3OSUA 4HQ6A 2WTEA 3K16A 3HKBA 5JC8A 5AVWA 1JH8A 1H65A 1OY1A 4XLZA 5BXQC 1WSAA 1U5AA 4E22A 3QJGA 4PYOA 2IDMA 2ODBA 3N2ZB 1H4QA 1PE0A 1Q1QA 2F8LA 4YRIA 4QD3A 4NECA 2ADFA 2YS6A 3ZBTA 5AJTA 5M34A 3T9EA 2XJ4A 1RXUA 1WO8A 2ZJ3A 3DF9A 4LF7B 4MW7A 1XN1A 3VMFA 1A8QA 2OG1A 1ISMA 1E1YA 1SH7A 1LVUA 2JVKA 1T5SA 4I1VA 1IVYA 4LMRA 3EDOA 3HBJA 4JJAA 3WFIA 3K8OE 3DXYA 4OATA 1JQJC 2ZU0C 1TQ8A 2ODQA 3J80A 1K1EA 4RA6B 4NCHA 2XMDA 4OUDA 2IEYA 1G38A 4NYMQ 4JQZA 2A84A 2VRNA 3PNOA 1W93A 3TSWA 3FVRA 5CLFA 1XNGA 3RYCB 2XQJA 2RSLA 3UJNA 2DOKA 1RJDA 1WL8A 2H1FA 2PVCA 4LK2A 4NZNA 3RV3A 4ZV4A 5KTSA 1C7QA 4CLOA 1XAJA 2J0UA 1OKKD 4LCEA 3O26A 5IK2A 1RWKA 4JI0B 3FDXA 3H3XA 4AUKA 3AUFA 5FF9A 4CG0A 4LKOA 1Z26A 2OCKA 2CY0A 4JELA 4WZAA 4DNFA 3C1AA 3AUUA 4KH0A 3O4FA 3VH3A 4WASA 2A0XA 4CIXA 3LOPA 4G6ZA 3LDAA 3VR5D 2REQB 2IF2A 1FCJA 2I7XA 1FSZA 1KRXA 1S9DA 4LDJA 4UAUA 5FPHA 1UPFA 5AJHA 1Z8DA 2PM8A 1SEPA 1R2QA 3VNAA 3W34A 1MV8A 3E4CA 2FUG6 1T9CA 3TXXA 2GXSA 1ZQ9A 3IEUA 4LHXA 1TCCA 3DZFA 1DAHA 3EVGA 2Q49A 5AKIA 3SR4A 1SQFA 1QQ7A 5KQSA 2XAUA 2XCLA 4P58A 4B3CA 3Q6NA 5LPNA 3ADBA 1DTSA 1SBNE 3I9V6 3OX2A 4KXXA 1KSGA 3UT6A 4O08A 1I2AA 1GXSA 1W46A 3O92A 3OQJA 4QUAA 1U8AA 4S0ZA 2VI5A 4Z0HO 4B4WA 4KHPB 2WF7A 1LSJA 1H8HD 3HVIA 2WJHA 4R2WA 2QA5A 1UMBA 3WB9A 5ILGA 3ICEA 2C58A 4CFSA 4YQYA 1NWCA 5IDXA 3Q0IA 1V6SA 2I9KA 1R9MA 2WIFA 4CMGA 5IJZA 2KHZA 4FFOA 2LR0A 4TYWA 1WMEA 5AUQA 2HU7A 3CPJB 2JAOA 5LQSA 4U00A 2EKQA 5I7RA 3Q98A 2J41A 3TOCA 5JXHA 1WTAA 2CB9A 1S0UA 2HXSA 4FD3A 1NLFA 2F8MA 4G5QA 1KY2A 1N5RA 3HPRA 1T1SA 4XI9A 4E5VA 1NOKA 2KB0A 1LWOA 4MQUA 1JBQA 1WAMA 5DBHX 2VP3A 1VJ5A 1ZD8A 3V80A 4C0SA 4I1OA 5ICGA 2AG5A 4RMNA 3TW6A 2BEVA 3B1FA 1ZH0A 2C4TA 2VHUA 4XCXA 1X86B 2ZQ5A 1PI3A 2DUUA 3AERB 2FV8A 2OCIA 1JNYA 3N8DA 1WMFA 4NH0A 3ZQJA 2H2FA 2H4XA 2PWZA 3LAWA 2PZ8A 4NNPA 4ZV9A 5KEIA 1PGPA 1Q1GA 2V59A 4BBZA 3Q8WA 2QDXA 4EHNA 1ZLXA 3JYPA 1T2FA 2G08A 2JCGA 3BA6A 1QXSA 5LKRA 4J1TA 4NOMA 2D74A 4PG5A 1X7DA 2HREA 3QF4A 4F85A 2QNBA 1M6WA 2B7BA 3T35A 1BMFD 1GGHA 1UMBB 4P9NA 4L16A 4YIHA 1GTG1 1T3TA 2YOFA 4XQCA 3SK0A 2A1TR 5JI3E 3HVRA 4JB2A 1H8ED 1R18A 2BCJQ 3HG7A 1DAMA 1QYRA 3ETNA 2A9FA 1RXEA 4IDEA 2R6HA 3TI9A 3VJLA 3BD7A 5AUOB 2Z95A 2R751 2B1JA 1LI7A 3HHPA 4EGSA 2Q9UA 2Y0CA 3A28A 3NNNA 3R1IA 4JX8A 3HO8A 2CK3A 1OYOA 1ZWLA 3CX3A 2R1TA 2X86A 2VJYA 1DV2A 1BNCA 1JDBC 1A88A 1X1EA 2DWCA 2JVIA 2P9YA 3JQEA 2YYSA 3TEFA 4KXWA 4BMOB 2ZU6A 4H6WA 4Q7EA 1Y1TA 2JFGA 2BELA 3EFOB 3TW8B 3OZFA 3WC4A 1DG1G