3G8SA

Crystal structure of the pre-cleaved bacillus anthracis glms ribozyme
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
90
structure length
90
Chain Sequence
RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and chemical basis for glucosamine 6-phosphate binding and activation of the glmS ribozyme
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
molecule keywords U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
total genus 22
structure length 90
sequence length 90
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3g8sA00
2AYMA 3P6YC 1HA1A 2DNQA 4W92B 5GADU 1ZH5A 1SJ3P 1WHWA 1VBXA 1D9AA 2MZQA 3ULHA 1DHMA 3SDEA 4IOAQ 2CQIA 3CCSS 2KXFA 1KC8T 2WBRA 1O0PA 2AD9A 2N82B 3H2VE 3NNCA 2JWNA 3NS6A 2MKIA 1OO0B 1X5SA 3LQVA 3MD1A 2CQHA 3PIPQ 1K9MT 1N8RT 2V94A 1M5OC 2CQ4A 2DHSA 4FXWA 2FPHX 1WHVA 3CCLS 1X4FA 3G96A 3CUNA 5LSLA 3IRWP 1WTBA 2FC9A 4M5DB 3VAKA 1VBYA 2DNNA 1WI6A 1NJIT 2DGQA 1H2TZ 3CC7S 3UWTA 4PR6A 3J7ZT 1X4GA 4CH0S 2QA4S 2F9JA 2XS2A 4J5OA 3UCUP 1ZZNA 2JX2A 1AUDA 2MY8A 2J76E 2YH0A 2MQOA 1DZ5A 2MY7A 1FHTA 2YTCA 3R1HA 2DB1A 2AYGA 2CPZA 2FHOB 3I55S 2RT3A 1WEXA 1WWHA 3BS9A 4WCEQ 1X5TA 2UP1A 2HYIB 2M4MA 5JVGQ 1WG5A 2MKJA 4TLQA 2K3KA 3VAFA 2KG1A 4UY8T 4C0OC 3EGZA 4OZ1A 2MKCA 3D2WA 5LSOA 2HGNA 2CPHA 2RS8A 3S01A 3MXHP 5HO4A 2LA6A 4TU9A 2DGWA 3LPYA 1VQLS 1M5PC 1XN9A 1X5OA 2YWKA 4RU2A 3THTA 3P3DA 1VQMS 2BOPA 2DGUA 3MUMP 1KOHA 2MQPA 2I2YA 1FO1A 1X4EA 2KN4A 3G9CA 2XSFA 1VQ5S 2DNKA 2DHAA 2DNRA 2DNZA 2J0SD 4F02A 2CQCA 2JVRA 1U1NA 3UCZP 2PE8A 1F9FA 2KI2A 2M8HA 3FEXB 5BJRA 1WF0A 1X4AA 2X1BA 1YITS 2KHCA 1URNA 4YOEA 4PKDB 5DDRC 3MD3A 2L41A 1WG1A 3CXCR 2CQ1A 2J8AA 2LMIA 4Z2XA 1K8AT 2FY1A 1BY9A 2KU7A 3DXBA 2ZJRQ 5CXTA 2LEAA 2DITA 2DNMA 2NZ4A 1M1KT 2DK2A 1ZZFA 2RNEA 5LXRA 2MQNA 2XS7A 2LKZA 2CPEA 2F3JA 2ZJPQ 4ERDA 4ZKAA 1WEYA 1FJCA 2K8GA 2HVZA 4PRFA 3Q2TC 3IWNC 5D77A 2G1DA 1YJNS 1U1RA 2RRAA 1U1PA 2M52A 2I38A 1X4BA 2CQDA 4A8XA 1OPIA 5JVHQ 4YUDA 3RW6A 3B4MA 2OSQA 2KFYA 1G2EA 2ZJQQ 3R1LA 3NS5A 1M90T 4ED5A 2OTJS 2X1FA 1WI8A 1U1QA 1YIJS 2MKKA 3U1MA 3G8SA 3VALA 2B0GA 3SMZA 1U1KA 3CCJS 2A3JA 2E5GA 1Q86T 5FJ4A 1U1OA 1H2UX 2YH1A 2HZCA 2JVOA 4WF9Q 4CIOA 1HL6A 3DLLQ 2G4BA 2BZ2A 2EK1A 1VC6A 2CQ0A 2XNQA 3CCMS 1JJ2R 1U2FA 2LXUA 1WEZA 1YWXA 1YHQS 2DO0A 2CQGA 3MUTP 2M7SA 2OJ3A 1N88A 2CPIA 4OZ0A 5CYJA 2DISA 2YKAA 2DGTA 3I56S 4LIRA 1VQ4S 2VOOA 1FNXH 2XS5A 4QU6A 4C4WA 1HD0A 1D8ZA 2M2BA 4IUFA 3U1LA 1U6BA 2VOPA 2KT5A 1SJFA 2MKSA 2MJNA 3CTRA 4FXVA 2L08A 3US5A 2MGZB 2SXLA 2M88A 5LJ5Y 4EGLA 2QEXS 2DGXA 1WG4A 2KVIA 3K0JA 1HD1A 1VC5A 2LCWA 1DBDA 2CQPA 2DIVA 2MQQA 2Q79A 1U6FA 5GVQA 2KRRA 3EGNA 5GAHU 2RS2A 1SJ4P 3S8SA 3N9UC 2RQ4A 2ADBA 4CQ1A 4TU7A 2DGOA 2MQLA 3J7YU 5GAEU 3VAJA 1YI2S 1RKJA 3NMRA 1WF2A 1S79A 3CC4S 2PEHA 1KD1T 2MPUA 3SDEB 3R27A 4WFNQ 3MOJB 5HL7Q 4WKRA 1QVGR 1X4HA 3THPA 5DDQC 1VQOS 3G6ES 2VONA 2J0QD 3G8TA 1PO6A 5DDOC 2DNLA 1M5KC 2RRBA 2ADCA 4TU8A 4QU7A 2MKHA 5D78A 2E5IA 5IM0B 3CPWR 1Q7YT 3ZZYA 1DRZA 2MYFA 2GHPA 3CCES 2CJKA 2FC8A 5IQQA 1P27B 2X1AA 1X0FA 3JB9k 2CQBA 1VQNS 3VAMA 1R8PA 1QM9A 3MUVP 1S72S 2M70A 2U1AA 3MDFA 5DETA 2AYBA 2DH9A 1FJEB 2MZSA 3CMAS 5DM7Q 3UD3P 1NO8A 3P49B 3OW2R 2CQ2A 1RK8A 1VC0A 1VQKS 3VAGA 3P5TL 4IO9Q 3NNAA 4BS2A 1KOOA 3HHNB 3S6EA 2RQCA 4UQTA 2OIHA 2CPYA 1YJWS 3BO3A 1QVFR 1N54B 2DIUA 5LJ3Y 1M5VC 2CQ3A 2DNGA 1YTYA 2VODA 3G71S 1A7GE 3RW7A 1FXLA 2CPDA 5DM6Q 2MJUA 2M0GB 3VAHA 2MQMA 3B4DA 2DH8A 2DO4A 1FJ7A 1VQ7S 3TYTA 2DNPA 2LQ5A 4CH1A 4IOCQ 2RVJA 2RUGA 2MXYA 1PGZA 3TO8A 3CD6S 4P6QA 3UCGA 2KM8C 3CMES 2MHNA 2MMYA 2DHXA 4WFAQ 1R8HA 2CPXA 3H2UB 3FEYB 2HGLA 2AYEA 2D9PA 1Q82T 2CPJA 1X5PA 5GAGU 1VBZA 1UP1A 2X1GA 2L9WA 2D9OA 3NNHA 3CCVS 2LEBA 3CC2S 2MB0B 2E5JA 4LJMA 5H1SV 1OWXA 3BO2A 1WELA 2KXNB 1VQ8S 3MI7X 3TP2A 1SXLA 1U1LA 2QFJA 2N7CA 2MZ1A 5LXYA 2KYXA 4LMZA 3VF0B 1UFWA 2KH9A 4F26A 3UE2A 2MZRA 2KXHA 3L3CA 1X4CA 2KM8B 2U2FA 3CF5Q 3SXLA 3Q2SC 1K73T 3CCQS 2E44A 1P1TA 2ERRA 4U67Q 5MLCV 3EX7B 2EK6A 2DHGA 1YJ9S 2F9DA 1VQPS 1VQ9S 4V19X 1U1MA 1X4DA 5ITHA 2OTLS 2HGMA 2LECA 2KG0A 2DGVA 1W2BR 1VQ6S 2EVZA 1UAWA 4C7QA 4Y00A 1SJQA 4Y0FA 3ZZZA 1FT8A 1H6KX 2GO9A 5DDPC 3HI9A 2E5HA 1UW4A 2DNYA 2MSSA 3CCRS 5IFMA 1KQSR 1SJRA 2LYVA 2DNHA 2RU3A 4WIIA 4QPTA 1CVJA 1WHYA 5IM0A 2G0CA 1IQTA 1WF1A 1A9NB 4QQBA 1Q81T 3BEGB 2MZTA 2LXIA 1OIAA 2NLWA 2DH7A 1JJHA 3VAIA 3V4MA 2D3OR 3PIOQ 3CCUS 3UD4P 1H2VZ 2OSRA 2M8DB 2KRBA 3MURP 2M9KA 3CULA 1NU4A 2MSTA 2XB2D 2N3LA 2JRSA 4W90B 1B7FA 1WHXA 2O3DA 1JMTA 5GMKa 2LA4A 2MGZA 1N52B 3BO4A 2N3OA 5CA5A 2XNRA 3G4SS 2CPFA 2MZJA 4YB1P 1L3KA 1JJ4A 2DNOA 5EN1A 2DGSA 4F25A 4WFBQ 3S7RA
chains in the Genus database with same CATH superfamily
1I51B 2AYMA 1HBUB 1CC7A 3D0HE 5D4PA 1JNZB 2HMIA 2WAQD 1ZH5A 1KFSA 3CIMA 3TJ8A 3AD7C 2VH7A 1GXLA 3WZ0A 3HHLA 3SSQA 1D9AA 3I0SA 1W2IA 4ZS6A 1Q78A 3KLIB 4MK8A 5KFNA 5B0GA 4FPRA 1IKYB 3RG6A 2CQIA 2AHOB 1VBKA 2CWKA 2YNHB 3MEGA 3QNWB 3RZAA 1XC9A 3IAS9 4OX9F 1KC8T 1BWEA 1BLUA 1FWLA 2IHR1 4LT6A 3AQPA 1J5EF 2AD9A 2V9WA 2XBPA 2N82B 4LSZB 4RJVA 4LF6J 3AFGA 1NPPA 3RAXA 1OO0B 3MD1A 5HBMB 2ZNYA 3L7PA 4DPUA 3RBDA 2AX0A 2YWHA 2V94A 3DRSB 2J0XA 3T6BA 4NZ0A 2YPZA 4O3RA 2CVEA 2CNNB 2AWZA 1CBKA 1NPRA 1CS4B 5KFYA 3OJSA 3CJTA 1FRHA 2JEIA 4N8NA 2DCLA 2CG8A 4M5MA 4R5PB 3VAKA 3SEOA 3EICA 3HHKA 5ETVA 2ZH7A 4B9MA 3DMJB 1NJIT 1D8YA 4DV2F 2Y1LB 5EX3A 4OI1A 3UWTA 2FVRA 4DQIA 4KGVB 2Z58B 5KT6A 4ILMA 1X4GA 3KLFB 4ZP6A 4CH0S 4YB5A 2XS2A 4J5OA 1VFJA 4DU7A 2HFZA 4CYUA 4B9NA 3NEKA 1GMWD 3OTBA 4F0MA 4NMLA 1ZTWA 2YH0A 2ZFHA 2MQOA 3EVOA 4NASA 5T14A 4DSEA 1XMQF 3M8SA 4Q7AA 5BYRA 3FFIB 2V4QA 3GIMA 1S1WB 3S1TA 4OYXA 3HM9A 3RB0A 1XWLA 3HHLB 1OSDA 3I55S 4M5NA 5DGBA 3FCVA 3EZUA 2ZC3A 3DLBA 1WSVA 2C2DA 4CLYA 4OJ1A 4DX6A 3A3OB 1C0TB 2B6AB 2IBOA 3MAQA 1I6JA 2CJYB 5IC4B 1BWVA 4CT9A 1JLCA 2MHEA 2M4MA 1YKWA 2HQIA 1RU1A 2GVZB 2ZUAA 4CTAA 5F8LA 2DKOB 4B9SA 4ZCMA 3O3LA 5KFZA 2E1AA 4HH1A 1H7XA 5FDLA 4CO3A 1HBNA 2FQQB 1SQFA 1WACA 3HHEA 1RAHB 2MKCA 3GTYX 4IH7A 3PW0A 1NH7A 4X4QA 3I5AA 4I69A 4RW7B 2RS8A 3S01A 2VZ9A 1T0TV 3QYYA 5HO4A 2VG5B 3THVA 4JI6F 1KFDA 2DGWA 3LPYA 4X4SA 2GVZA 3KK2A 2OO4A 3JQKA 5JXSA 3DLHA 2OMLA 4UOCA 1D3WA 3BH7B 2DT9A 2XMVA 2R8IA 1CEZA 1FRJA 4WJBA 1SIWB 3C6UB 4B9UA 4ER8A 3MR2A 4HT5A 3P4UB 1QLNA 3C15A 3UNYA 3VVTA 3G2XA 2HHSA 1DJ0A 2DD8S 2DPJA 1KOHA 1WKKA 1MN9A 3I6PA 3JSRA 4TXSA 3AOBA 2VG7B 1P8GA 1K47A 3A4TA 3EUNA 7AT1B 1RT6B 2OH2A 1X4EA 4CM2A 2EWHA 2IYIA 2KN4A 2YX4A 4IQXA 4JI4J 3VGTA 3G9CA 3TRGA 4LF5J 2DHAA 4NLRA 4J9OA 3SV3A 4FXDA 2J0SD 3KDNA 1AZSB 1U02A 3A8IA 3RRKA 1N4LA 3DHXA 1NMEB 3QMQA 4P2SA 1HQEA 1KWMA 5L9NA 2UXDJ 3N6MA 1U1NA 3PCOB 2C1EB 1S9FA 1TAUA 1MSWD 1WC4A 3KLGB 4J9QA 5G4DA 4U7UD 2KZZA 4MIAA 1EP4B 2FUG9 5K8NA 1HWKA 2YKMB 3T5LA 3FBBA 1XR7A 2UUCF 2GAHC 2HZVA 4X66F 5BJRA 1U49A 1X4AA 4FVMA 2X1BA 5BR8J 1RP5A 4ZITA 2YNGA 4MMOA 3DOLA 3MGJA 3W9JA 3OTEA 3CXCR 2W9BA 2OPQA 5ETLA 4CLTA 2XZWA 2HHXA 4NXNJ 2IJFA 1NB7A 2VG5A 1IBLF 5DGAA 1M1KT 3D6FB 3RB3A 2DK2A 4LF9J 3LOUA 2D3UA 4M5JA 3OXFA 4ZVSB 3EXCX 1ZAXA 4ETXA 2Y8YA 3QJLA 3PJXA 4C8LA 5D6GA 4USVA 1RSCA 3RRHA 5DQHA 1UCNA 3CDWA 3KDOA 1VMBA 2HVDA 3GU0A 2AP6A 1KQKA 4DL0C 5L8RC 4NZ7A 1MG7A 3JSBA 3ZZUA 2ZC4A 1QUVA 4NLUA 3TR5A 1Q1KA 1S7IA 2OEKA 1RYRA 5D77A 3IGNA 1VCTA 1CJTB 2RKIB 4RNFA 1P6TA 3UPFA 3K58A 1UVLA 1U1RA 2CZVC 2IC3B 3LGNA 3RJMB 3C46A 5KG1A 3U02A 2B9EA 3V81B 4JI1J 4HKQA 1GK8A 2CQDA 4KFBB 1JLQA 3ZTSA 1NSPA 2X51A 5A0YB 5JJBA 3KMSA 5JVHQ 2YKNA 4DU8A 2W01A 2IDEA 1EKSA 2CADA 3BF4A 4ZCKA 3M2UA 3FSYA 5GMDA 4CLLA 4DPOA 4DUYF 2EI5A 4M5LA 4UTGA 4YY3J 2CFXA 2JEGA 4H4OA 4MYUA 4KV8B 5GAHI 4MAKA 3A8EA 2FJAB 5DO2A 4LF1A 4ECRA 1M90T 4ED5A 2QLJB 1RACB 3GFXA 3HKZD 1NAQA 2X1FA 4WIQA 2HWTA 4WPAA 3K7RA 3PRBA 1F0XA 4ES2A 3SMZA 3G8SA 3CCJS 3FRYA 2NUUG 2OPQB 5JMNA 1J2VA 1KONA 1REVA 4HTJA 4ECYA 1T05A 1H2UX 2RQKA 4KV8A 3SCLE 3U27A 3QT6A 1U09A 3GG0A 2JVOA 4LRDA 5LMUJ 4KO0B 2B8QA 3MTJA 1NEEA 4NEZA 1HL6A 3W2WB 2VFTA 1VHFA 2BJ7A 2EK1A 2XZTB 4IR9A 2XI3A 2PDAA 3NAHA 1PYTA 1S4FA 3I32A 2HQCA 4IG3A 1ROFA 2QGFB 4W4MA 4ZPBA 1ICEB 2PA3A 4DEZA 2LXUA 1WEZA 2AGQA 2XMMA 4X4TA 1JXEA 4X2BA 2DO0A 3OFEA 2H5IB 3J81Y 1RCXB 2O67A 1JLAB 3FCWA 4WE1B 4XDDA 1N88A 3MUTP 2OJ3A 2CPIA 2HNZB 2ILZA 1Y3KA 3DYAB 5CYJA 1MU2B 2BXJA 2KDOA 2XY5A 1CJVA 2NZCA 1V3ZA 4LIRA 4Z7YA 2IBKA 2R7VA 1FNXH 2XS5A 1BD6A 3KTQA 3RTVA 4O4GA 3GCXP 1NKEA 2O1PA 2LQJA 1SL0A 4IUFA 4JI0F 4DR2J 1SJFA 4M5IA 3CTRA 1Q8KA 2XQCA 4FXVA 1Y11A 4CLWA 1FWPA 4YDDB 1PC5A 3MEDB 5EDWA 3TAPA 4BWMA 3N0VA 2DGXA 2VF3A 4IFVB 1N5TA 4DL4A 3K0JA 3UI3A 1HD1A 2QSFA 1VRTB 4F3QA 4B9VA 4A8SA 2ZH1A 4I56A 4CO2A 1WKJA 2MQQA 2VPWB 4DPTA 4Y2CA 2V8GA 3KYLA 1IKWB 1REVB 2RAQA 2JFDA 3P8BB 4WBFA 1N48A 2DR9A 2E7VA 5GVQA 1B0TA 4IFYB 4ENOA 2V2VA 2VBZA 3NY0A 2XO7A 2RS2A 3TVKA 1CQMA 1TAQA 3S8SA 1VIOA 3OL7A 2RQ4A 2BM1A 2UZAA 2ACYA 1T94A 2YWEA 1Y5LB 1W25A 5I3UB 5GAEU 3FGVA 5C24A 1S79A 1GTHA 5D0RA 4ECTA 1SV5A 1UWAA 3HLUA 3LP1A 3ZC4A 4P2MA 1IXKA 1QVGR 5BYSA 4KRWA 3JAMY 3I0SB 3WDOA 1XNRJ 3DXSX 3JTOA 3ADAC 1NZAA 2HQ3A 3DHWC 5DDQC 2JHEA 5KFAA 2EKNA 1V6HA 1S6PB 2FIUA 6FDRA 4DG1B 2COLA 2FHJA 3MM7B 5DDOC 3PRDA 1EQ0A 3V5RA 3W5XA 3PHTA 5KG4A 4WZMA 1QTMA 5CCMA 1VR6A 1N33F 5HBMA 3G6YA 1CULB 1VI7A 5IM0B 1IWGA 4MIBA 3ZZYA 3GV7B 1XMQJ 2MYFA 3EVMA 1KLMB 3U7JA 3KK1A 1HNIA 3LF0A 4N77A 3KHHA 5L1LA 4EZ6A 5G0RB 3N5FA 4HTIA 4PYDA 2YWFA 9RUBA 1X0FA 2E5LJ 4DSLA 1RT7B 2B5JA 1T8EA 2CQBA 1VQNS 1H98A 2CG4A 2WB4A 1QY7A 1R8PA 3MZIA 1FJGJ 3RYLA 1S72S 3AB4B 4DR1J 1XNQJ 1HBOA 3K57A 1V3SA 4H54A 4HT7A 1XMBA 2G0IA 4JI7J 2QN6B 4F04B 4NYOA 3H25A 4EEYA 1N5YB 1RKIA 3Q8VA 4E0DA 3OW2R 1MWZA 2Y3YA 2F5GA 3DNCA 2FHJD 3SSRA 2QL5B 3T41A 5H9FJ 1UZHA 4IO9Q 3ILIA 4I68A 3HXMA 3N5BA 4TN2A 3BQ0A 3BN7A 4UQTA 4I7FB 3ZTRA 3IBCB 4UW2A 4ED7A 1FNOA 1PJ6A 2FGOA 4KH1B 4OX8A 2UUBJ 1NDKA 3AA9A 3QGPA 4N41A 3P5BP 4NLXA 4OZLA 1DURA 1O51A 2CA9A 4CWBA 1S10A 2YNIB 3POTA 1R0BG 2C2MB 3D6HB 2E7WA 3MAAB 1VK3A 1L3UA 2JFKA 3VAHA 3KOAA 4DX7A 4GMKA 3MM8A 4ZPTR 2DH8A 1KQFB 4WTYA 5IT4A 1HBNB 5J2MA 2VA3A 1ZPVA 1CG2A 3PHEA 1PO6A 4OQJA 4F4ZA 5KFSA 4HHUA 2NCKL 2CXEA 1EETB 3KWMA 1R0AB 1PJ7A 3PTWA 4QBUA 1RT3B 1LWEA 4IOCQ 2RVJA 3D3BJ 3CO0P 3MAAA 3O5TB 2MXYA 4P6QA 3DOMA 1PGZA 2RF2B 4ZVEA 2KM8C 1RTHB 5IS2A 1IBMJ 3PX0A 2ZM6F 1LFPA 2MMYA 3Q24A 4DV3F 2ASLA 2CKWA 1R8HA 1NDCA 3PW7A 1N5VA 2RMLA 2VFVA 3GQCA 1XMOF 4YDXA 3GFYA 3M30A 1YBUA 2YKPA 2D9PA 3GLJA 3IN5A 5GAGU 1I1GA 1J5EJ 1UP1A 2OHDA 1K1SA 2VG7A 4C11B 5KFHA 1R3NA 3K89A 4LF4J 1ZAVA 2M5YA 2OPRA 3VQTA 2XC9A 3FNNA 2WK4A 3DN9A 1NK4A 1OWXA 1TL1B 2D69A 3DCAA 4QYZK 5C7PA 2OP5A 2KXNB 1BC6A 4USKA 5DJBA 4MYTA 3C16B 2WB1D 5L38A 3EPGA 4X65J 2XTJP 2F65A 2BACA 2XYPB 5KFEA 4RW4B 2QFJA 1U1LA 4KJIA 1IR1A 1Y10A 4ED4A 2N7CA 4PQUB 5K14A 2BRLA 3T6JA 1ZA2B 3IWXA 3MMJA 4J9SA 4IOBA 3SV4A 1SH0A 2KH9A 4OZ2A 2P5VA 1VGYA 2Z30B 4RX6A 1FFGB 4CDIA 2PMZD 3K5MA 1F5AA 2P9EA 1Q8IA 3GIIA 1R0AA 4OHVA 2EBEA 4NA2A 2VICA 2RIJA 3QLHA 3OR2B 3GONA 4LR9A 2A1BA 3TEGA 4DCJB 5IWAJ 3BBBA 4RUCA 1IR2A 2G1HA 4Y2AA 2W7PA 5J2PA 2HBQB 3BDPA 3ENQA 5AJ3J 3ITHB 2E44A 2HQFA 1P1TA 4ZDNA 1NDLA 5T41A 5BR8F 5MLCV 3N6LA 4M5KA 2XMJA 4DN9A 1GMUA 1TR0A 2FJBB 3EX7B 4DL2A 2DHGA 3LWMA 4XTTA 1SL1A 5ETMA 4L72B 3ZNUA 4DSFA 3QIPB 3PX4A 2F9DA 3H8YA 4LR7A 2CJQA 1NKCA 1JLEA 3I0RA 1O5JA 5KT5A 4NOHA 5LMUF 1X4DA 1HI8A 4WP8A 2ALZA 2GJ2A 1UVNA 3M32B 3B6BA 5HQLA 5ADZA 4P2FA 1EHWA 1N36F 2XZDB 4K0KF 2OAUA 4NLGA 1SL2A 3ISNC 2KKHA 2L48A 4DR7J 2GO9A 5DDPC 3HI9A 4AL6A 4B3TF 3QRQA 1YG0A 4CLSA 1A0OB 4LFBF 3ISZA 3BQ2A 2V2QA 2E5HA 3CJKA 2DPIA 1UW4A 3AD8C 2MSSA 2W2MP 4LREA 2ZITA 4ZPDA 3NOGA 1LWCB 3EMTA 4P9SA 5AXMA 5HMXA 2PIIA 4J9MA 1KQSR 2FLPA 1SJRA 2ZKUA 1BQMB 2DNHA 2ZDOA 3ZZRA 2HIQA 3M6UA 2FJEB 2HS0A 3H5YA 2AF6A 4OIXA 4F4KA 1NJZA 2W7OA 2JEFA 4K50A 1X0PA 4ECXA 1RXOB 3TA1A 1IQTA 3MFIA 2XO6A 4ZJLA 2J5AA 2PA8D 3D6TB 4DFMA 5KFGA 2H54B 1RWMB 2AJ2A 2CNKB 4RW6A 3FMWA 2K06A 2CNOB 2E7XA 1NK0A 1LW2A 4UOFA 5E5NA 2B9XA 3VAIA 1UFLA 4TKTA 4PUOB 3UD4P 3DLKA 1ZM2A 5KFCA 1H2VZ 2OSRA 2V34A 4YMEA 3GV8B 2AEJA 2OEMA 3KUHA 3QWPA 3ZXWA 2M8DB 3FQLA 4J90A 2HNZA 1JKHA 2YQ0A 2YWWA 3FZBA 4KPCA 4LBPA 3TZWA 3V6KA 1LXNA 3QIDA 4ZA1A 2C3UA 4MKVA 3P45B 4K2JA 4QWEA 4IG0A 3BKFA 3ELHA 1E6VA 4UZBA 4ZP7A 1C1CA 3X1LB 1B7FA 3CD0A 5E41A 3G6VA 1S9EA 4K8RA 1HBMA 4QZVB 2DRDA 3HVWA 3DRYA 4G6VB 1OJ4A 3MEDA 3HP6A 1RGVA 1N52B 4C98A 4ED1A 3TANA 1YSJA 4F8RA 4DR6F 2R7SA 4NXMJ 4KR0B 1GX5A 3GMGA 1V9OA 3IFEA 2HFSA 4CH7A 1EAYC 1MW7A 3G4SS 3H4DA 1NBEB 3T1YF 3N01A 2J7KA 3MMBB 4GKKJ 2BKPA 1JJ4A 2MLYA 2DNOA 2OLWA 2F8EX 1SC3B 3M8ZA 3CJ4A 1LWFB 1OS5A 4IQMA 3K8VA 3U1NA 3OTOJ 2I1RA 3R5DA 4KHMA 4B3SJ 4H4KA 4EO6A 3P6YC 3O1LA 2DNQA 4L3NA 3Q22A 4RW6B 4Y3CA 1WHWA 3OXLA 3F56A 1NM2A 2LU1A 3W66A 4C48A 1VBXA 3ULHA 4YY3F 1S1WA 1ZBTA 4DN0A 2CDRB 1DHMA 1RZMA 4NYZA 3J7Z5 5E3QA 4B08A 1NRKA 1LK7A 3CCSS 5M2PA 3R97A 3HHDA 2DR7A 4FP9A 2WBRA 1O0PA 2GJFA 2V4JB 4KGKA 4X4NA 1HYSA 2J7WA 2EFGA 3OFGA 1YQHA 1BMQB 1SKSA 2PD1A 2B7CB 1WTFA 2UV8G 4K4TA 3MR3A 1ELOA 3SQGA 2HBZB 4DPWA 1Q4RA 3SCIE 5HSPA 1UVKA 2C2NA 3EGVA 1N8RT 1N34J 1K0VA 4K4XA 1HHSA 3UVJB 2RQMA 4ZVGA 2DHSA 1F1BB 2V9KA 3HVTB 4DOZA 3PACA 1H73A 3G96A 3CUNA 1WTBA 2J9DA 3M4XA 1FRLA 2HAFA 1GAOA 4XK8C 5ETOA 2R2TA 2ZKTA 1VBYA 1YGYA 4Y34A 2KZMA 2XY6A 2PFFB 2DNNA 1WI6A 3A13A 1HMVB 2IPOB 3CC7S 3IG1A 4QYRA 2D1CA 4H4KC 4RUBA 4DFJA 5HLFA 1OY8A 4MJKA 3J7ZT 1SKWA 3NS7B 3E51A 2C42A 2F9JA 2BKNA 3PNIA 1NJYA 4K5RA 1HLWA 3UCUP 2KO1A 4A47A 1ZZNA 2J76E 4ZK7M 2IVMA 1CLFA 4EBDA 2DR5A 2YKOA 3OD2A 1RT6A 1BQNA 1PBUA 1S9GA 4CLFA 3BSOA 2EKYA 2BANA 1FKPB 1DQ8A 1SQEA 1KTVA 2B9YA 2FHOB 2R7WA 2LFVA 1B3TA 3TZXA 1RTIB 4WCEQ 2ZVIA 1C1BA 1HBUA 2ALYB 2G2YA 4NYPA 1Z2LA 2VBXA 2PEBA 4I7FA 4MT1A 3H40A 1KRPA 1OMSA 2HYIB 5AXKA 1RAOA 2ZVSA 2QRRA 2KL8A 1NSQA 4JV1A 3H20A 3C14B 3ZTPA 5JVGQ 2XY7A 3TQ1A 2Y1IA 2K2PA 2K3KA 1TL5A 3CDAA 5IQ6A 4UY8T 4C0OC 5G0RA 4A4JA 3SZ2A 4DS5A 8ATCB 4NMXA 2GNKA 3BR9A 5SZTA 4JV5J 4XIUA 2RH3A 4LQ3A 2PC6A 1TMJA 2FHMA 2I9SA 3K5NA 5E2QA 2R2UA 1FE0A 1LKZA 3AODA 2C2RA 2ZH3A 2ZZMA 2VBYA 4KHRA 4TU9A 4Q5VA 2PMHA 4DUTA 1XN9A 2UXCF 2QMUB 1P1LA 1X5OA 4ZPWR 9ATCB 3IR7B 4ECUA 2BR0A 4UUWA 1BE4A 5LOQA 2ZH5A 4RWXA 1IM6A 5HVFA 3THTA 2W8LA 2CJAA 1ZPWX 2R42A 2VG6A 3P3DA 4A8QA 1N0VC 2IY5B 3MM6B 2XMAA 4TQRA 2AJ1A 4ANEA 4RO0A 2E1CA 1U2CA 1TVRB 1RADB 3HVRA 4DV4J 1KN6A 2WVFA 2VPZB 4NLSA 1MMNA 5KFIA 2DNKA 2DNRA 2DNZA 3PYDA 3RB6A 1VQ5S 2V8PA 3NMAA 1Y7PA 4X64F 2XMTA 1ZAWA 2D41A 1G3OA 1FEHA 3G86A 2OPRB 4O23A 2JVRA 5IT0A 2R8KA 1VLYA 2C2ZB 1KHWA 2HWIA 4ZHRB 2L3MA 1HBOB 5IWAF 3PKMA 5MAOA 2LQ9A 3GWCA 3UCZP 1S1XA 1UW9A 4I6WA 3D1HA 5D0EA 3GV5B 4LF8F 2KI2A 2F63A 2C2OB 3G6XA 2FVCA 1N5YA 3FEXB 3T19A 2KHCA 2UXBF 3J7AN 2E1RA 3ZO7A 3JQJA 3P96A 5DDRC 1IUJA 3UW1A 2FJVA 2RF2A 2RD5C 4K4WA 4DFKA 1BY9A 1SBRA 3LP0A 1K8AT 2FY1A 4WYLA 1MLAA 3MEKA 3W5YA 2DNMA 1S5ZA 1T3NA 3TW0A 1ZZFA 2RNEA 1RYSA 3W3SA 2V6AA 5LXRA 1LW0A 4B9TA 2MQNA 3SYZA 1N56A 3E2EA 2VUGA 2LKZA 3E3XA 4CM0A 5IXUA 4X64J 2IYGA 2BA9A 4ZKAA 2W24A 4LVNP 4C11A 2QA2A 4USTA 1HQ2A 4Q45A 4DFPA 3HF5A 5CHCB 5SUHA 1REGX 2GQCA 3KNAA 4GKJJ 4LRAA 3UDEA 3CEDA 1FRMA 1FJCA 2N4CA 3BKUA 5HK4A 4ECWA 4EO8A 4JI4F 4X4VA 1U26A 4QR0A 1ZM9A 2RRAA 2GMLA 3TEHB 4V19J 4QPXA 3TJ9A 1S12A 2I38A 1HQUA 1F9HA 3FDSA 1FFWB 1Z4UA 4A8XA 3M2RB 4Q8EA 3Q8UA 1TK5A 1MWYA 4OX9J 3B78A 1B0VA 1UMJA 2Q43A 3RW6A 1RAAB 3B4MA 2MLXA 3D4JA 4KGMA 4TY8B 4KPYA 2HMIB 4W98A 4L73A 4IDKA 2DCUB 2XI2A 2HNDB 1HNVA 5DG9A 3DI6B 3QT5A 4JP8A 1NZ8A 3BYRA 3NS5A 4U8VA 2R4FA 5A8RA 1TUGB 1WI8A 4ECSA 1VS3A 1U1QA 2YKMA 1QAJA 4LSNA 1FESA 1GX6A 3G87A 2ZOFA 3R5AA 4ZVRB 2B0GA 2XSJB 4JUZA 6AT1B 3VALA 2BE2B 4JI2J 5BXIA 1Q86T 5KG3A 4F4XA 4LF9F 4QWBA 1RE1B 2HNDA 3ILLA 3OL9A 3QJPA 1PG5B 2HZCA 5J2MB 1SH2A 3CSKA 5KG7A 4CIOA 4DR5J 4AQYJ 2VL1A 2E1PA 3OR1B 1B64A 3DRSA 3OVSA 1VC6A 4FF3A 1H72C 4RW9B 4RZRA 3HX9A 4ZVHA 5KTQA 5GADI 1JLBA 3Q8SB 1JLCB 3E01A 4A8MP 3GIRA 1QE1A 2GGPA 3V6DB 1AB8A 4OJ3A 2RU9A 3CD5A 3UQSA 4ZVFA 1YWXA 5HANA 2H5EA 2A2DA 2CQGA 1VQYA 1XIQA 1NPKA 4ANDA 5EX0A 4OZ0A 4C0HA 2YKAA 2DGTA 2H5JB 3CJRA 3NGTA 4FNHA 4RW9A 3I56S 2J6TA 1TTHB 2AT1B 3TAMB 3PDNA 4MTPA 3OL6A 4K7QA 1TL4A 2VPXB 3AOCA 3D6MB 5C2GA 1N5SA 4MK9A 2HSEB 2KT5A 2VOPA 4WK1A 2MKSA 1NH8A 2WRMA 3PO4A 4TVAB 5THWA 1Y4ZB 2QEXS 4WF9Q 4O3OA 2KVIA 3BYPA 2Z0GA 2FLOA 3KFWX 5B09A 3PW4A 1IJEB 3LP2B 2OGUA 5EUHA 3NL0A 2DIVA 1HNIB 5B0DA 1MN7A 1UJ6A 2CJ9A 2Y0BB 1Z1ZA 4QWDA 2E66A 4NEYA 5K14B 2H4WB 4YP3A 1NJXA 1HPZB 3LUYA 3UN5A 3RBZA 1U6FA 4P7VA 3EGNA 3HKWA 5J1EB 4O0IA 3QPIA 1T03B 4Q0BB 1CQNA 2YX1A 3CIZA 4DUZJ 2WVDA 4OYOA 1WOSA 3E8OA 1N6QB 3L9ZA 4CQ1A 2MQLA 4LRBA 3C8YA 3J7YU 2DYAA 5CYMA 5K20B 3VAJA 4PUOA 2A0FB 1BHNA 2V2KA 1Z2ZA 1H7WA 1L3VA 4NLDA 3T1HF 1NSKL 1SC6A 2CUYA 4C8MA 2B9WA 1CJTA 2AW0A 2WTFA 1UKUA 3SDEB 4EK2A 3QWUA 3R27A 3PW5A 1EX8A 5HL7Q 1N36J 4NCBA 4K0KJ 4NLOA 1X4HA 5B0EA 5D3GB 2G13A 4I0WA 2RDIA 4UQGA 2HFVA 3BBFA 3MTKA 4KH0B 2CJBA 2N7YA 3ENVA 5FD1A 3G6ES 4QIGA 2J0QD 1H74A 2QMWA 4FS2A 3OSPA 4PG5A 4N8OA 4TU8A 2MKHA 4WFYA 2EBGA 3PYGA 3C3LA 4NLQA 2GCFA 2BQRA 1Q7YT 1JXVA 3GCWP 3I82A 4P2XA 1GQEA 2W7AA 3EE3A 4B3MJ 2GHPA 1FVQA 2EG2A 2HZAA 2AEMA 4YHHF 5IQQA 2GX8A 4PG6A 3QRPA 4LF7J 2Z2MA 2BKOA 3KLEB 1QM9A 1TELA 2M70A 4KKOB 2AYBA 3QT8A 4CI0B 4TLRA 1AW0A 4FYWB 4ZMMA 4I2QA 4ED8A 3CMAS 2XHWA 1HARA 2F1FA 2MDAA 1JB0C 5L39A 3KK3A 2NSCA 3UD3P 3GYXB 3QO9B 3MMCA 3M8RA 3PX6A 2DRAA 4DI6A 5J2QA 3DOKB 2H4YB 3FC9A 1RK8A 4EYIB 3NKYA 4OYZA 3GR0A 5KFWA 1RWOB 3DYAA 3NNAA 2R3VA 1TZ0A 1KVIA 3I4PA 1ZOTA 3S6EA 2RQCA 2R2SA 2CPYA 4ZJQA 4AL7A 3BO3A 3I9V9 2Z8QA 4I2QB 1YBAA 4DWIA 2DNGA 1S4EA 2X3GA 3D7SB 1SB6A 4KTQA 3AY0A 2VODA 1WC6A 2QLFB 4ZP9A 5EWFA 2W9AA 3M8YA 4U7UK 1FXRA 2V8DA 4ED0A 1NK5A 1FXLA 3VV2B 2CJXB 5DM6Q 4GO5X 4HLBA 1WC3A 4ITSA 1OYEA 1PYSB 3HT3A 2PSZA 2V63A 3A8KA 4JBCA 3AHPA 4YN3B 4PQUA 4QW9A 4PQAA 2O66A 1RHQB 1UVIA 4JYAJ 3HZEA 2C22A 3GYNA 3R5BA 5F0WA 3TYTA 4LFAF 1ZS6A 2DNPA 1Q5YA 2LQ5A 2FLNA 2HRTA 2RUGA 3X3UA 4BDPA 3CD6S 1FHTA 4U8YA 3UN2A 1Q53A 4F0HA 4M95A 1FJGF 4OZJA 3PZPA 2R7QA 3CMES 1RHKB 3DGPA 4CLKA 2WSCC 4USUA 4GVBA 3KK1B 1GTEA 1S77D 5KFDA 4ATNA 3O8WA 3BN4A 3FEYB 2HGLA 2WSEC 3KJNB 2BANB 3PM9A 3IRXA 2AYEA 3R5GA 4OV1A 1IBKJ 3FSXA 4ZCLA 1Q82T 4QR1A 2NR0A 2CPJA 3QBCA 5DZ6A 1OY9A 2A2CA 1G6BA 4OI6A 3BDEA 3NNHA 4F2SA 3K59A 5D8HB 3CCVS 1V3RA 3NP5A 2PT0A 4DLGA 3T5JA 2NREA 3OTCA 2MB0B 2E5JA 1NHUA 1QUPA 2K7JA 5A6PA 5F3ZA 5H1SV 3CDEA 2FJXA 1GXUA 3BO2A 1SVDA 4P75A 5DS7A 1RBOB 1WELA 3IG1B 4G1IA 5HLFB 3DMJA 3M6XA 1Q16B 3MI7X 4ZP8A 5KFLA 4DS4A 4JYAF 3TP2A 1KP6A 1SXLA 3KJVB 1H38A 3DU5A 2Q6BA 1TU0B 4DXLA 5KT3A 4X62F 3PR4A 1BQXA 2GV1A 4OX6A 1VQ6S 1JQGA 4OZ5A 2OPSB 1KLMA 3DLEB 5CYQA 4A8OA 2R7TA 5H9FK 1DLOA 4RNNA 4RNHA 1WJ9A 3VF0B 2CWXA 3BSCA 4HHHA 3CJKB 2XGQA 2V4RA 1B70B 1TK0A 1G1XA 2HHUA 3J80U 2HG4A 4KBIA 1APSA 2RUSA 3KHGA 2HFNA 2CDQA 2AU0A 2KXHA 2W9BB 4M5GA 3L3CA 4O3QA 2KM8B 1C0TA 2B6AA 1HIYA 2OPPB 2U2FA 3LH2S 2DXEA 3NAIA 4N47A 1RT2B 1RT1A 3ILJA 4UOGA 4NI2B 3CCQS 2FGCA 4FBUA 1F6TA 1FKOA 2WZ1A 2QA4G 3KJFB 4U67Q 1B0PA 4HI2A 2IMWP 2BX6A 3M8PB 4DUYJ 3CJ5A 2MKYA 3LO3A 2OFHX 2QFIA 1LW2B 5A8WA 1YJ9S 4X4PA 2ABYA 2BV3A 3R7SB 1FK9A 1SPBP 4ECVA 2NPFA 4NPOA 4DV5F 3DRRB 3ZZ0A 1GEHA 3RR7A 4DV7J 4ED6A 4X4OA 1BQNB 4ZCIA 5F8JA 5KG5A 1FKOB 1FTRA 2OTLS 4JV5F 2H3EB 5HROA 1HNZF 2DGVA 4C0BA 5KFFA 2QYCA 1W2BR 2EVZA 3H5UA 4LRFA 5KFVA 4DMZA 3TUIC 1TKXA 4HACB 2D7SA 4C7QA 1PCAA 1SJQA 4Y0FA 1FDAA 1KS2A 1PBAA 3OUYB 3MF5A 3PYFA 2HEKA 2V0NA 2DR8A 4DV2J 2RDDA 1DLOB 2IM0A 4ZVPB 2JLGA 2GC8A 4DG1A 5IFMA 3Q0AA 2ZHOA 4HL9A 2LYVA 2B4PA 1UA1A 2RU3A 4R8UB 2VQEF 4QPTA 2OKQA 1CVJA 3CW2C 3UDCA 1S0MA 5IM0A 1EP4A 2G0CA 3KLIA 5KFBA 1RWUA 1WF1A 2JJ4D 1A9NB 2JSXA 1GFWB 1RB0A 1SUQB 1PSDA 3IGVA 4OHYA 2VFUA 2HHVA 1VRUB 1HQUB 2LDYA 2LXIA 4C3KA 1FRXA 3TVZA 1RAGB 1RWWB 1IKXB 1PKUA 3BSNA 1JJHA 4K59A 3M8PA 3PV8A 4X4UA 1TK8A 4LVOP 2DR6A 5HJYA 2ZOGA 3QAEA 2EXUA 5JUMA 1Q7LB 1TVRA 3CULA 4P71A 2M9KA 2NXEA 1UVJA 2MSTA 4FYXB 2XB2D 3DRRA 1L3TA 3VTIA 2QLXA 3OQ2A 4RNOA 2GIRA 2KFZA 4RW8B 1CS4A 1JLFB 2O3DA 1RCOB 3D1QA 4PWDB 1JMTA 3W2VB 2BJ1A 4B17A 2XSJA 2B56A 3HHLD 1TUVA 4UUXA 4XDCA 3PO5A 2DEIA 3SQGB 1RLCL 3H59A 2BW7A 1NHVA 3IA0A 4L74A 1LOUA 1SCJB 2A18A 3NRBA 4AUKA 5DQIA 5CA5A 1WKLA 2AZ1A 3PW2A 2Q6CA 2NXUA 3WQPA 4ELVA 3LP0B 2DHHA 3QGHA 2LQ8A 1L3KA 1S1TA 1TL1A 2QYGA 4NCGB 4QWAA 5EN1A 4CO4A 2WW4A 4MIWA 2OEJA 2DGSA 4O0NA 4PXEA 1HR0F 4H4MA 2XHCA 4WFBQ 2WOMA 4R0EA 4B3OB 1C4AA 3D0GE 3BGRB 2AZ3A 2AEFA 3H90A 2BYCA 4PXCA 2ZE2B 1YJUA 2MZQA 5KFUA 2BDPA 5L1IA 1S59A 3ZNJ1 2IM1A 3SDEA 3MFHA 2R7RA 1RWVB 4R25A 2HQDA 2KXFA 2B4UA 3DLGA 1R8CA 3OR1A 4KIAA 1RT5A 1WORA 4S0MA 4Y65A 4KO0A 4E2FB 2K1RA 1Q5VA 3MM5B 3V6HA 3KLFA 3M6WA 3Q89A 3FK4A 3H2VE 4HDHA 3NS6A 4KSEB 4QIWD 1J27A 2D3O1 3F44A 3LQVA 1X5SA 4F4WA 4EBEA 5T7LA 1U7LA 1VOMA 2CQHA 3UD5A 1T9WA 3Q8PB 1LQ9A 3MM9A 3OHAA 2W9CB 1M5OC 2I5JA 2BABA 2W1BA 2GAGC 4DL7A 1U8WA 1FRKA 1HNVB 1VK8A 2YNFB 1HWIA 2K1RB 3DI6A 1WHVA 3V4IB 1KVJA 1CULA 4WK3A 5LSLA 4N76A 2FC9A 1RTDA 3RB4A 1ZTTA 1IM4A 4ZLLA 3QZ8A 1G7CB 4F4YA 3I0RB 4TQSA 2E9ZA 2DGQA 3VQSA 1NJWA 2P6SA 3DRPB 4Y2IA 1X9MA 5L9XA 1S49A 3D1OA 3HMJG 2IJNA 1L3SA 3W9IA 4M94A 1U24A 5L46A 3L7UA 4MKAA 2JX2A 1AUDA 3KLVA 3BGFA 4NA3A 5D3GA 3BR8A 4OYWA 4DPXA 3DM2A 3M7VA 4FDFA 4PG8A 1JLBB 5IT9Y 2F4VF 2YTCA 4NZ6A 1HNXJ 1C0UA 1S99A 2DB1A 1I5OB 1MMDA 1G4CA 2EPIA 2CPZA 2RSQA 1WWHA 2RT3A 2ZDPA 3BS9A 5HI7A 1PYOB 2R7XA 2V69A 1RT4A 2UV8A 1IKWA 1X5TA 2UP1A 4E8UA 4LF7F 1R89A 5HQ8A 4DV4F 3BB5A 5HMZA 2HVEA 2ZH8A 1YZ7A 4IG3B 4OHWA 4DV6F 1N6QA 3FKBA 2XLKA 2FJDB 3PR5B 4K4ZA 1WG5A 3JS9A 1S48A 5EWGA 2MEWA 4JI2F 3CCTA 2WONA 3OSNA 1EJ7L 3OTOF 2KVQE 3OV7A 3EGZA 3R2CJ 1PILA 1YRUA 2ZH9A 3D2WA 1CC8A 8RUCA 5LSOA 2HGNA 3PXGa 3WIVA 3RR8A 3N28A 2ZBRA 4DUZF 3A3NB 4LF8J 3MXHP 2MQ8A 4KKOA 3H98A 4AT1B 1M5HA 2LA6A 1XMOJ 4JI1F 2C2EA 2B4OA 1TV6B 2V5HG 3BBCA 2B51A 3CJQA 2JZ5A 2A6MA 2GFFA 2ROEA 4OZ3A 3BPSP 3PFEA 1Q0NA 2J9CA 5F9LA 4A8KA 2IRYA 1HNXF 1TFWA 1VQMS 2NQPA 2BOPA 3MMAB 3IS9A 4ZIWA 3HFKA 4NLVA 2Z2YB 5K8OA 4JI3F 3HFZB 3V6JA 2I2YA 1IKVA 2W4CA 3MR5A 1VHIA 1E6YB 4NLYA 4RUAA 3NLCA 2XSFA 2C2KB 2JNJA 2PFDA 2QLBB 3LPEA 4UY85 4J37A 3R5CA 2KJVA 3G8QA 4F2RA 1Y5NB 3N6NA 1ACMB 1R7IA 4IRKA 1KQGB 2ZEJA 4GKJF 5I4MA 2XMUA 1R27B 4PABA 5J1PA 3EGWB 1IKVB 3A8JA 4KE5A 5A6WA 1F9FA 3D3CJ 2BJDA 3HULA 4DF8A 1S1UA 2E9RX 2M8HA 4ICLA 1WF0A 1X60A 4ALZA 5DG8A 1YITS 4DQPA 1URNA 4QYZJ 4PKDB 2APOA 3G82A 4RBTA 3UVJA 3MD3A 4PG7A 2BJ3A 4HH0A 1D09B 2JL9A 4OI4A 1EKRA 2LMIA 4Z2XA 4LSNB 1FCAA 4ZVOB 2KU7A 3HFVA 3PFOA 5GAEI 4YEAA 3LALA 3RAMA 2LEAA 3PKYA 4EZ9A 2DITA 3SIPB 1S6PA 4LRCA 3M2VA 1JXLA 2XULA 3W7BA 3VZHA 3EZ5A 4YFUA 2HK2A 1P9YA 2HPUA 2ZD1B 1HQEB 3NGRA 4HDGA 3WHIA 1RABB 1NK6A 3CT9A 3R5JB 1RWPB 2RRNA 2XS7A 3EM1A 3ZZTA 2CPEA 1HKAA 1UPPA 4F0KA 4ERDA 1NKBA 2FZCB 2QG9B 4ZVTB 4F3OA 5FLXU 2O5DA 2HHHF 2K8GA 1FA0A 3TI0A 2B8PA 4PRFA 2VD3A 1FF2A 7FD1A 3JSYA 4EMDA 3Q2TC 2AQ4A 4NLWA 3FVYA 4PZVA 2G1DA 4YQWA 1YJNS 3KK3B 1UETA 5A8WB 4DJBA 2JDJA 5F41A 2M52A 4NLPA 4JI6J 4F36A 2YXLA 4J9KA 2BM0A 4Q2MA 2BQ3A 1FNMA 3VVUA 3DOMB 4ECQA 1WC1A 4YUDA 5F8NA 1BGXT 2KFYA 2CRLA 1UA0A 5C25A 1PIEA 2RHQB 4ZPCA 3J80Y 2QV6A 3LGHA 1N0UA 1RDRA 2FB0A 5IC6B 4EU0A 4J9NA 2J0WA 2AIRB 2XCPA 2G0JA 1RTJA 2JLEA 4GVLA 1L5UA 1RWNB 1XTZA 4WWSA 3W2VA 1YIJS 2G2ZA 1YJTA 2MKKA 4IR1A 3MWBA 2IAJB 1UFKA 2GO8A 3NGKA 4ZLJA 4WYWA 4ZLNA 2E5GA 3NXZA 4BHQA 4P73A 1Q8LA 2R7OA 3C19A 5HVGA 4O4GB 2R9LA 2YNGB 2FVSA 3JYTA 2UXDF 2Y9HA 1RTIA 2VDIA 5KFMA 3DLLQ 2YKQA 1VLOA 2ZH6A 2G4BA 2Y8WA 4PEOA 3VWSA 3J7A1 2CQ0A 5GMEA 4C9DA 2BOAA 1IJFB 3AJDA 1WC0A 3C14A 1M5SA 3IR5B 1JJ2R 4WZQA 1U2FA 4ID5B 2UUBF 1U0HA 5A8KB 1S1VA 1RJJA 1R31A 3IBWA 3QJJA 3ZFVA 2W4PA 1RAFB 2HLTA 4PAAA 3M05A 5HROB 3T5HA 1CJKB 3WX8A 2BUNA 4BCAA 3A12A 2DISA 2VQFF 4K4SA 2VJUA 2VKRA 4NL5A 3I4HX 2QL9B 4M5DA 1JLGA 3VGUA 4ES3A 3HPOA 1HD0A 5IOLA 5LT5A 2HVHA 3W5ZA 2M2BA 3F0NA 3HJVA 4PG4A 5DZ7A 1U6BA 3HD2A 3EWGA 2QO3A 1TKTB 5J2NB 5C24B 1YX2A 4GRSA 2VA2A 1GXTA 1HR0J 2E1MC 2SXLA 5LJ5Y 4EGLA 2PGCA 5KG0A 1WG4A 1QSSA 2BW2A 3B82A 1Q95G 2BBEA 5HATA 3GILA 4R8UA 2ZM6J 4DV3J 1XR6A 3GG1A 2IVFB 1OQ6A 3QGIA 4FBTA 5F8GA 2Y0SD 2JOQA 2FZKB 1J5OA 1HHTP 1QSYA 2WCXA 2CVIA 4TYBA 2QLWA 1CJUA 1RAIB 2Q79A 4JI5F 5A2QY 3DGVA 4EWTA 1SJ4P 4BBYA 4FKXA 4LIWA 3M32A 3QATA 5E3CA 2EW9A 4KHPJ 4CTAB 4NLTA 4WXOA 4DR6J 4TU7A 3NMRA 1YI2S 2OMOA 1RKJA 2HHPA 3ETMA 1WF2A 4C2MA 1AROP 1RI7A 4I4BA 4OX7A 1T9YA 1YBTA 3Q86A 2KFNA 2G2OA 2PEHA 1T9XA 1KD1T 4Q0BA 1U0HB 2B3TB 4QOTA 3SFGA 4OFZA 3HSJA 3DRXA 4LF6F 3FZ2A 4CNYA 3OBIA 4NI2A 2FLLA 3E01B 4WFNQ 1Y5IB 1SH3A 3D28A 5KFJA 1OQ3A 2AJFE 2RE1A 5CCLA 3AB2B 2ZE2A 3MEEA 2X3DA 3THPA 3KHRA 4B3SF 1HNWJ 1BQMA 5DLFA 5FIIA 2DEJA 3KG1A 5IV3A 4C97A 2UVRA 2VONA 3H4BA 2HK3A 2XEXA 4RU9A 3G8TA 4N5SA 1FDDA 2FVQA 1FERA 2DNLA 3NWRA 4P72A 1SUQA 2XLJA 4USJC 2ADCA 2BRKA 3MCNA 2EEYA 3AXKA 1KVKA 3QSYB 2E5IA 4ZPVR 3CPWR 2I8EA 3PJWA 2ZWOA 1DRZA 1JNRB 1PAEX 4KT0C 4NWBA 2IM2A 3WC0A 3MPWA 1HWJA 2FC8A 2CJKA 1GH8A 3N79A 4NX9A 3JB9k 1AXQA 4J9LA 3VAMA 1T05B 1DQAA 3QAUA 5KFRA 5LMNF 3HO1A 4QJVA 3NWGA 4IFVA 4DX8H 3MUVP 1U47A 3HDSA 4QWCA 1F2GA 4MKYA 2XMKA 1JLQB 2ZHAA 1FJEB 3H5XA 1E6VB 2JLFA 4NXNF 3R6GB 1RAJA 4G1QB 4LFAJ 4CO1A 4RUHA 4DSKA 3JSMA 4AYBD 4IDKB 1FDBA 1U45A 2CQ2A 2HHTA 4PYAA 3IBFB 5CH7B 2VFRA 1NDPA 2BE7D 3AJ2A 3P5TL 4OI0A 4U95A 1QAXA 3HSDA 3W1YC 3HHNB 4LF4F 2HAIA 3O2IA 1QVFR 1M5VC 2C3PA 3HD1A 1IKXA 4I64A 2CQ3A 3TUJC 3K5PA 4RPFA 3G71S 1A7GE 4F67A 3MR6A 2UU9J 4NCGA 4HEA9 3LAKA 3NGDA 3HK2A 2CPDA 3M30B 3WBZA 4JI3J 5KFXA 2M0GB 2MQMA 3QQCD 2DJWA 4JB8B 1SKUB 2H1YA 1AUSL 3OR2A 4ECZA 2ATLA 3B4DA 2HKEA 3NBPB 3F73A 2DO4A 2C3MA 1UZDA 3GR1A 4TY9A 1VQ7S 4JI8J 4GKKF 1FJ7A 4DLEA 2W25A 2HFOA 2XCAA 1FX4A 3KKFA 1DTTA 4CH1A 2GQ2A 4OHXA 1F3VA 3HSZA 5EHHA 3TO8A 4DL6A 2C28A 2YKNB 3KG0A 3ONQA 3K5OA 1ZYQA 1OSCA 1S9EB 2EC2A 4XPEA 1TFYA 3DDKA 2HBRB 2MHNA 3BGOP 3C2PA 2DHXA 3QIPA 4UF4A 4AFFA 1RHJB 2IRUA 2XYGB 4RW4A 4ZVUB 3CB4A 1C0UB 4N56A 5I3PA 4WKYA 1I94F 3BM7A 5IV4A 2VBWA 3GPAA 5CD4A 4O3NA 5KOWA 1JIHA 3BGLA 3V2UC 3Q8RB 3GJSB 2UU9F 3GFHA 4Z37A 3LTOA 2KTQA 2L9WA 2NXJA 2X7IA 2D9OA 2B43A 1AYEA 3PRVA 4FKYA 5LL6d 3SCKE 1HFEL 3UDVA 3UFCX 3BGUA 3CC2S 1OYDA 3MCOA 1CSJA 2E5LF 3IXQA 4DV1J 2YX7A 1R0CB 1NK7A 1NK9A 1QSLA 3FBEA 1P9QC 3V6DA 3AH6A 3TQEA 5M2RA 2DRBA 2HHWA 1YDLA 2GIFA 4USIA 1S57A 4JI8F 5C5JA 1T03A 4R0JA 1AT1B 1MMLA 4G3IA 2Q1LA 4NXMF 2OUGA 2F7VA 2ATCB 1FVSA 2LU2A 4IFYA 4JI7F 3OFHA 3DLJA 5K8MA 3MR7A 3C6TB 4KGXB 1FWKA 3M6VA 3QSIA 5D4NA 5LXYA 2KYXA 4E98A 5I3UA 4LMZA 2L9DA 2W2OP 2V8VA 1ZETA 4I2PB 1M1HA 2BJ9A 4PWUA 4F26A 3UE2A 1B4SA 1SKRA 3R3TA 2MZRA 1H3DA 1SC4B 1UL3A 3OT9A 1T7PA 4Q8FA 1TKZB 3MM8B 1WC5A 2CZ4A 4MH8A 3SXLA 2XLIA 4FYDA 1FE4A 1HHQA 4XAKA 3C16A 3Q2SC 2F40A 3CVKA 4DHVA 2GHWA 4I67A 2AJ4A 1JKHB 2ERRA 4QIVA 1RA7A 3DOKA 1QJHA 1F60B 1YJ7A 2WSFC 4WFZA 3VGVA 1NB2A 1XNQF 1JWWA 4UT4A 3MECA 2ZZNA 1TKZA 5KAKA 3D67A 3NG8A 2VASA 5DLGA 3CJ3A 5IT9U 4V19X 1UVMA 1WD6A 1O8BA 5C2CA 4A8WA 2Z57B 2AGPA 5ITHA 1NCLA 1RAEB 3M8WA 1IBMF 3QT7A 1CPZA 2HGMA 5HAOA 3M9NB 2KG0A 3EXYA 1RT7A 2B5JB 3IS9B 2HRUA 3EJMA 1UAWA 1YVFA 4LUBA 4MKBA 1F2HA 4LQ9A 1IQZA 1GMVA 4MFBB 4IH5A 4LSLA 4Y00A 4HYKA 3ZZZA 4A8YA 1IBKF 2P6TA 4GC6A 8AT1B 2IVYA 5ETRA 4K4VA 2PMWA 3M2VB 5KFQA 3CJ8A 3QGGA 4KGZB 5ETPA 5K8PA 1S0VA 2QA1A 4RKUC 2DNYA 3L95X 3IO1A 1T3OA 1WDDA 1C4CA 1TUWA 2QSWA 2P9CA 3FBCA 5E3AA 3HHLC 5A8RB 3CCRS 1YLXA 2B7BB 2NXCA 5K9FA 2UVVA 4CZCA 3QFHA 5KG6A 4LFCJ 1NHKL 4QIFA 1LEOA 3AOAA 2BE2A 4J7CA 2GMHA 1WHYA 1W7WA 4ZIVA 3TWZA 1S1UB 4N7TA 5HQMA 2ROPA 4Y28C 4CO0A 2F8MA 4HHJA 4DZ6A 1ULRA 4QQBA 1JLAA 1F9EB 3GJTB 3BH6B 3ETOA 1Q81T 3BEGB 3MOZA 2MZTA 3M1VA 5HJXA 1HYSB 1YJVA 1NSAA 4PPDA 4CYUB 4K5SA 3AJ1A 4B3OA 1LFWA 4WU3A 4DDFA 4ID5A 1WOOA 3KNGA 2XGPA 1JJCB 1QE1B 2GGPB 3K8WA 5A8KA 2QIFA 3CCUS 2D3OR 4URSA 3FFIA 4D3HA 2Y1JA 1S0NA 3W63A 5E0OA 3MURP 3PJ9A 1UEKA 1CJKA 3KUGA 2QJ3A 3NOCA 2E29A 4V1Ak 2NYIA 3OXGA 5BYQA 3UDLA 5AE1A 1R8AA 3MM6A 5H9EK 5GAGI 2JRSA 4DQSA 1KTQA 1TP7A 1WHXA 3OTDA 4QW8A 4DCPB 2PO4A 1LWFA 1EQMA 1D9DA 1RTHA 1YRXA 2BJ8A 3OJUA 2HVIA 1XR5A 3FUYA 5GMKa 2W9CA 3BSAA 1N34F 3VHQA 3H7HB 3H0PA 1FRIA 3LW5C 1JK9B 3TJAA 4RW7A 2N3OA 5CZVA 2YNFA 1TKXB 3I9ZA 4HACA 3V4IA 3G82B 4DV5J 2J8SA 2V4JA 1B7YB 2CPFA 4GC7A 1Q8BA 2NXNA 2V8HA 1WSRA 1Y3JA 4YR2A 2LEPA 4KFBA 5A0YA 5C42B 2GQQA 2ZWPA 3TUPA 2IMOA 3QFWA 1C1CB 2VDHA 3FSIA 3RBXA 4ILLA 3S7RA 4OLPA 1HA1A 3GFZA 4W92B 5GADU 3M1VB 2HLUA 2L9NA 3DU6A 2W4DA 5CYMB 3IAM9 5J1NA 1JLGB 4ILRA 1B99A 1SJ3P 2KB2A 3L09A 4LBIA 2LP4A 4WU2A 1Q79A 4ZN3A 3I31A 3O6QA 4IOAQ 1X8DA 3JYTB 4G1PA 5DG7A 4C8YA 1SIZA 3MCSA 3MCMA 3GB0A 4M1KA 5B08A 3BV8A 2VQEJ 4OL8A 1U2RA 3NNCA 2JWNA 4KHPF 2MKIA 4RL1A 1S97A 3RGIA 2DVIA 3PIPQ 1DTQB 4OYMA 1K9MT 1FD2A 1RT1B 1RT2A 3W2WA 4ZPAA 3L4BC 2CQ4A 3BPDA 3DOLB 1HW9A 2F4FA 2DY1A 3C15B 4FXWA 1AFIA 2HQGA 2FPHX 3CCLS 1X4FA 1SC1B 2JH3A 3IRWP 3I96A 2FJWA 1T9UA 4CLUA 3KHLA 4M5DB 2AX1A 3M2UB 1SQGA 5E33A 4DL5A 2ZHBA 1DTQA 2LVWA 2V2ZA 1UWBB 1T9TA 1NXIA 1H2TZ 4AE5A 5B0BA 2OPSA 3DLEA 1JLEB 5CYQB 3W64A 4PR6A 2P9GA 5CABA 1YRTA 4X66J 5J2NA 1M0SA 3MPYA 4CP5A 1AZSA 3K17A 2QA4S 4K4YA 3WX4A 4OYBA 2MY8A 2DBBA 3FMBA 3ZTQA 4BWJA 4KY3A 3MEEB 4WP3A 4Q43A 1DZ5A 2CIMA 1PAUB 1S1TB 3C66A 2MY7A 5KOXA 3KLGA 4WFXA 2NS1B 3MMBA 3OL8A 1S6QA 1C2PA 3R1HA 2K7KA 3MMCB 2AYGA 2GA7A 2UUAF 5J2QB 1WEXA 3M9MB 1RHRB 1CJUB 1IBLJ 4H4MB 4DR3J 4TYAA 1HPZA 2WOMB 1T11A 4OJHA 2CYYA 3CO9A 3JXOA 5ETNA 4PCQA 3PY8A 2FZGB 4Z7CA 2MKJA 4TLQA 3R9LA 5HMYA 2V50A 3ITHA 1O6XA 2KG1A 3VAFA 2HHQA 3GIJA 3KLHA 3VZIA 2VJVA 2WVEA 3M8QA 2Q3PA 2VKZG 1OPZA 4OZ1A 1YZ6A 4U9RA 5LM7E 1N32J 2CPHA 2PI5A 3LWLA 1URRA 4KAIA 1X7VA 1S7HA 1TL3A 4C3MA 3HSGA 2E9TA 1VQLS 5E7OB 3CGIA 1M5PC 3MM9B 5F3TA 2C3YA 1F5BA 2YWKA 4RU2A 3T1HJ 1KSPA 3GSIA 2YWGA 2POKA 3IM8A 4UZCA 3SCJE 4X4RA 3Q8YA 4YB7A 4DR4F 4A48A 2IM3A 4OI3A 2DGUA 2I0XA 3OLBA 3DC2A 3MUMP 4C8NA 3RAQA 1VDHA 1UPMB 3ENAA 4DR3F 4OYAA 1U4BA 2PI4A 4FF4A 2MQPA 2CNLB 2J9DE 3IC1A 1FO1A 4ID8A 3NGSA 2ACMA 4PXDA 5CQGA 7FDRA 3MM7A 2ILYA 4HVZA 4F50A 4RBUA 1DAXA 1FDNA 4AXIA 3I5BA 4KB7A 4YB6A 2XG8A 1AFJA 1LK5A 2CQCA 3ZTOA 4F02A 3TAQA 4HR2A 3JTPA 3OVBA 2HHHJ 1EZZB 3Q83A 3TUZC 3TZYA 2EFVA 2PE8A 2HNYB 4QR2A 4WTOB 4B3MF 1SI9A 5KT2A 1IN0A 1EB0A 2DTJA 1PJ5A 1SV5B 4J9VA 5EGYA 3R2DJ 4YOEA 4A46A 2XMWA 3O44A 2DY9A 4WXWA 2L41A 3KLHB 5LMNJ 1WG1A 3M8QB 2CQ1A 3WIUA 2J8AA 2GJIA 2LQBA 4DR4J 3J7YI 2VV5A 2ZJRQ 3DXBA 2IAJA 4X84A 3AXMA 4X65F 4J9PA 2HNYA 5HP1A 5CXTA 3KK2B 1TL3B 3KUEA 2NZ4A 3ZZPA 1RA6A 2W8KA 3D54A 4Q2LA 3LGMA 4DV6J 4C6AA 2XYHB 4OYIA 3DLGB 2N4DA 2OD6A 1GMWA 4IG0B 4PXBA 1RT5B 4QIEA 3SQOP 4MK7A 2F3JA 3IMQJ 4I6AA 3CWJA 5EWEA 4XPCA 2ZJPQ 1X31C 2BE9B 1WEYA 1TMMA 2LDIA 3LAMA 4FNIA 4JV0A 3HJFA 1MU2A 1HBMB 5KT4A 4XO0A 1CJVB 4P52A 4AD6A 4ANCA 2HVZA 3DM2B 5DRKA 2YNIA 3POTB 2M3DA 3DDIA 3D66A 3IWNC 1S6UA 2F8HA 4KC5A 2IIHA 4G1QA 4DX5A 2MLZA 2EFQA 3JSMB 1Y0HA 2VG6B 1U1PA 1RT4B 2XM3A 3PG9A 4DF4A 1X4BA 1HNWF 1QAIA 1LXJA 3BKTA 4B3TJ 1OPIA 2IFXA 1E6YA 4IO1A 2HURA 2RHSB 2VFSA 1RTDB 2UVUA 5I3QA 4FVCA 2OSQA 3QO9A 4Y2KA 1EETA 4CT8A 5L1KA 3WC2A 2A10A 2EFOA 3LANA 2VIHA 4I1TA 2DXDA 3AD9C 4DR1F 4YHHJ 2GVDB 2K3IA 2FYXA 1G2EA 5U47A 4FYVB 1U6ZA 3CDUA 2QZ8A 4U7CA 4TNOA 1AA1B 2ZJQQ 3R1LA 1U0SA 2HRYA 5IZHA 2OTJS 4JOUA 3RUBL 1VIXA 4U96A 3CE8A 5CZXA 2ZUGA 1FKAF 4DSJA 3U1MA 4O4RA 1S1XB 1TQLA 1MWQA 1NLKL 1TV6A 3ILOA 2A3JA 4U6PA 2W2NP 3K2YA 1U1KA 5FJ4A 3A3PB 4RLEA 2FY8A 1U1OA 3CJSA 1J5OB 4ELUA 2XWYA 2QMXA 2YH1A 2ROGA 2GVDA 3EPIA 1WOPA 2AKWB 3TOQA 3TX0A 1U8SA 4OMFG 4EI2A 3TARA 1RUSA 3R6LB 2I5JB 2BZ2A 4LFBJ 3VR1A 4TY8A 3MPDA 1ITPA 2JC0A 2XNQA 3CDBA 3BJYA 5AE3A 2FD2A 3DDNA 1YK9A 1GNKA 2GS8A 3CCMS 2W2PP 3DLKB 1K1QA 5L1JA 4DV0J 1N33J 4GO7X 1TL7A 1VRQC 1YHQS 4WP9A 2HW3A 2Z2ZA 2ZNZA 2IA6A 2FHKA 2M7SA 2WVCA 3UNGC 4IH6A 1UEVA 3Q8QB 2R8HA 1FD8A 3T1AA 4O3SA 1VQ4S 1XNRF 1MNEA 3R8YA 2VOOA 4QU6A 3VCDA 4J9RA 3CMQA 4R5PA 3HCXA 3PVXA 4C4WA 3IRXB 4I6YA 1D8ZA 1KEKA 5H9EJ 4LF5F 1WNEA 5D15A 3KMQA 3U1LA 1TL7B 3KG4A 4RR5A 2Q66A 4DL3A 2MJNA 2KT3A 2L08A 3US5A 2MGZB 1HI0P 3T3FA 2M88A 2LLZA 4AXJA 4CRJA 3TX8A 1VC5A 5J2PB 2OFGX 3W9HA 2LCWA 2UUCJ 2RB7A 3Q23A 1DBDA 2CQPA 4L3KA 4KYZA 4BC7A 3C6TA 1RISA 4URGA 1D9FA 1V5IB 1C1BB 1OY6A 2J9EA 3GJRB 1ZM3A 2HS4A 3FQKA 2WONB 2KRRA 4HI1A 4J9UE 5GAHU 2QX0A 2J6SA 2UVWA 1VISA 2R7UA 5AXLA 3M9OB 3N9UC 1KKHA 2Z56B 3UN3A 3T5KA 2ADBA 1T02A 4M63A 3RBEA 2DGOA 3IR6B 2RJZA 4C8OA 4ZOSA 5K5MA 4FF1A 4OV6A 3AAWB 1UJ4A 2CAJA 4DCOB 2O01C 3CC4S 3NCPA 3OHBA 6FD1A 5ETTA 2AV5A 2MPUA 2YQ3A 4C3LA 5CAAA 2EC0A 4A8FA 2V68A 2YNHA 3A1YG 5AXNA 4JI0J 3MOJB 1IR0A 4WKRA 3LA0A 1R8BA 3JAMU 2Z2LA 3OVAA 5D4LA 4KQZA 1HWUA 2NUHA 3BGRA 4LBHA 1YJRA 3OLAA 4DBQA 1VQOS 4L6V3 1QDUB 3D0IE 2V67A 3FCHA 3FRZA 2I6WA 3C6UA 1LWCA 2P2CB 2QT7A 2ZD1A 3NCRA 3HVAA 3EDRB 2D3ZA 3ENWA 3HZGA 2RRBA 4Y2MA 2A6OA 1M5KC 1RBAA 2G9OA 4FZVA 1R6VA 1RHMB 3H5SA 4QU7A 1DY3A 4PPZA 4URQU 5D78A 4USMA 4ED3A 3KJQB 2F4VJ 1NNDA 4AL5A 1LV5A 3PEJA 2VU5A 4YR3A 3FJ2A 1TKDA 2NYHA 3IWLA 1F3FA 3SBMA 4MFBA 3CJ2A 3CCES 2ASDA 2VB6A 5FDLB 1P27B 2X1AA 4OI2A 2VQFJ 4F7VA 2HS3A 4JI5J 1FEEA 1KNZA 1FX2A 1XERA 2KHDA 2U1AA 3DFEA 3ISND 3MDFA 5DETA 2DH9A 5A76A 3OUYA 5B7WA 3R7NB 2MZSA 3D68A 3TNVA 2RKIA 5DM7Q 5C25B 1NO8A 3P49B 1S1VB 2ASJA 4C8KA 3I5CA 2YY3A 4NE9C 4AQYF 1VC0A 1XBWA 1VQKS 3UO0A 1MROB 3VAGA 2WBMA 3LP1B 1ZA1B 1U48A 4BS2A 1EARA 1XJWB 1KOOA 1K44A 5B0FA 3T9NA 4BLGA 2GZOA 2OIHA 1YJWS 3W60A 3AT1B 1XQIA 4PWWA 1N54B 2DIUA 5LJ3Y 5FLXY 3DGPB 1YTYA 1LW0B 2BJEA 4GVBB 4FS1A 2B4VA 5C42A 3KLEA 3RW7A 5F9NA 4M5HA 1MROA 3SSSA 1F5CA 4O44A 1Y00A 2R8JA 3PEHA 2KYZA 2Y1RI 3K5LA 4EBCA 4IRCA 2MJUA 2AMCB 2ASYA 1NUEA 2AJ0A 3CJ0A 2OPPA 3QRRA 3H2LA 2AJQA 1XEZA 4B3RF 3QLHB 3CCWA 2RDJA 1RLDA 5AT1B 5E3RA 3EVWA 1UWBA 3MAHA 5RUBA 2OI2A 3JQMA 2BMBA 2H48B 4O44B 3UCGA 3BREA 4NRUA 3F41A 1RTJB 1SJ1A 3W61A 5F8MA 1X9WA 3GIKA 3CCZA 1FK9B 3D9BA 3OPKA 2IJRA 4WFAQ 2GIQA 4DQQA 1ZM4A 4OHZA 2CPXA 3H2UB 5D0GA 3TAMA 3B8HA 4H4OB 1S6QB 3SFUA 5F8IA 5AJ3F 4DR7F 3W8PA 1BUXA 4USWA 4DV0F 2GMJA 3J81U 2EG1A 4P10A 4FYYB 1X5PA 4DR5F 4IYQA 1VBZA 2HWHA 4NA1A 4RWWA 2LXFA 2X1GA 4NCAA 4USHA 2ZOMA 3MECB 3L7OA 5HN0A 2LEBA 4IRDA 4LJMA 4YS2A 1R6YA 2XWXA 3GSDA 1N5QA 5F0UA 2HBYB 5LSRA 1VQSA 4EUVA 2P8IA 2QL7B 3CNQP 5E3PA 4BC9A 1VQ8S 3UR3C 1T95A 1JX4A 3RRGA 4B3RJ 3VGSA 2W2QP 1X9SA 3DKDA 4NRTA 2H65B 2KT2A 5J1EA 4OLOA 5KT7A 3W8GA 2OD4A 1RHUB 4IKAA 2MZ1A 4Y6IA 2IDLA 3EYZA 4K4UA 3IM9A 4RBVA 3TVYA 4ICLB 3MHYA 1BXNA 1QD1A 1W26A 1PC4A 1UFWA 5I42B 3SI8A 1VJQA 2PN6A 3AQOA 4JV2A 2J7UA 1LWEB 1DQ9A 2NSBA 4L75A 1RU2A 1QTNB 2IRXA 1TKTA 1WDTA 2BVZA 2VC0A 1X4CA 2YPYA 3TA2A 1T9VA 3NBPA 3BZQA 3GZ7A 5AE2A 2UXBJ 2FDNA 4CO5A 3CF5Q 2IA0A 2R2RA 1RBLA 2EFPA 1V5VA 3EDQB 2MTLA 2JEJA 2UUAJ 1K73T 3KJVA 1HI1A 1I94J 4CCHA 3FEZA 1GT8A 2ZBCA 5ETQA 5A2QU 1H0HB 5B0CA 4LFCF 2ZZTA 1RWXB 3D5MA 2EK6A 2HIYA 2IC3A 3N4WA 4QCLA 1JLFA 3V81A 1NK8A 4PWDA 1KDNA 1U25A 4ED2A 2UUTA 3QZ7A 1VQPS 3GJQB 3OFFA 1VQ9S 1S6OA 3UR0A 3DRPA 4DV1F 3T1YJ 1FFSB 2GW8A 4EFAC 1U1MA 1HMVA 4ELTA 2VC1A 2RILA 1FI4A 4F3MA 4C8ZA 2R8GA 2LECA 3TA0A 4FF2A 1HWLA 4OYPA 3ET6A 5HMWA 3MMAA 2WVBA 4LF2A 2Z4PA 1FTCA 3HT0A 1VRUA 1LWXA 5CD4H 1FT8A 1H6KX 2UUWA 5ETSA 5KFTA 4CNZA 2GHVC 5HVHA 3IP0A 1S0OA 4DZDA 4ZVQB 3CD7A 4CLZA 5DQGA 1IBCB 1RWKB 1FXDA 2VPYB 5I42A 4P7TA 1DTTB 2WHOA 3PYEA 1KLNA 1QAYA 3GYGA 3HVTA 4Q44A 2FTRA 1WUUA 4ZN1A 2UXCJ 3ET6B 1HW8A 2J6UA 5KG2A 3MPVA 4WIIA 4M8LA 4RW8A 5B0AA 4J91A 4CLPA 1UTAA 3AA8A 5D4OA 1Y9OA 3RU0A 3NGUA 1RTZA 1VJWA 5KFKA 4ZHRA 2C3OA 2HFUA 4X62J 5KFPA 3NCQA 3ZZOA 4WE1A 1OIAA 2DH7A 2NLWA 3MM5A 4ETZA 4YR0A 1VYAA 5D0HA 2FVPA 5KFOA 5M2UA 5ETKA 3V4MA 2KJWA 1RQ0A 3PIOQ 2YVSA 1I3OB 2ZH2A 1IKYA 4RNMA 2H9ZA 3MEGB 3B54A 4B9LA 1FKPA 2ZBPA 4OJGA 2KRBA 3W62A 2BEFA 3KXDA 4UOHA 1NU4A 1KR4A 4DV7F 1EIYB 2N3LA 4ZLPA 4FN5A 1N32F 1UJ5A 3BQ1A 3EZOA 1KHVA 3GE9A 4K2XA 4L76A 4LR8A 5F8HA 2BQUA 2H51B 4W90B 1IVZA 1K0TA 4D3GA 2QC3A 3FBFA 3R7BB 1D0EA 1A6LA 2D74B 2CZ9A 3LP2A 3MPUB 4G65A 3TZZA 1VRTA 4EYHB 1RT3A 2YBVA 2NPIA 3T9ZA 4I2PA 2LA4A 4B02A 2MGZA 2QE5A 3W65A 2ZBQA 4FPIA 4F4AA 3BO4A 1D1UA 1M1GA 1DFDA 1IWAA 2EFNA 3GP9A 4ES1A 2ZH4A 4LSLB 3J81j 2XNRA 3H42A 1XK8A 1UEUA 2WW8A 1DARA 2MZJA 4YB1P 2VHGA 5HP1B 4OZNA 3JTNA 4O3PA 1HNZJ 4DSIA 1S9GB 2QTWA 4ZJOA 5T7LB 2ZBIA 1KBRA 2OELA 3ICLA 3M2RA 4DR2F 1R43A 3I87A 4DPYA 4DQRA 4F25A 2YQ1A 4P74A 2DXFA 2AGOA 2JC1A 1S76D 1LNQA
chains in the Genus database with same CATH topology
2AYMA 5D4PA 1HBUB 1CC7A 3D0HE 2HMIA 1JNZB 2WAQD 1ZH5A 1KFSA 3CIMA 2VH7A 1GXLA 3WZ0A 3HHLA 3SSQA 1D9AA 3I0SA 1W2IA 4ZS6A 1Q78A 3KLIB 4MK8A 5KFNA 5B0GA 4FPRA 1IKYB 2CQIA 2YNHB 4Q0BB 3MEGA 3RZAA 1XC9A 1BWEA 3IAS9 4OX9F 1KC8T 1BLUA 2IHR1 4LT6A 3AQPA 1J5EF 2AD9A 2V9WA 2XBPA 2N82B 3RAXA 1OO0B 3MD1A 5HBMB 2ZNYA 3L7PA 3RBDA 2AX0A 2YWHA 2V94A 3DRSB 2J0XA 3T6BA 4NZ0A 4O3RA 2CVEA 2AWZA 5KFYA 3OJSA 1FRHA 4N8NA 2DCLA 4R5PB 3VAKA 3SEOA 3HHKA 2ZH7A 4B9MA 3DMJB 1NJIT 1D8YA 4DV2F 5EX3A 2FVRA 4OI1A 3UWTA 4DQIA 4ILMA 5KT6A 1X4GA 3KLFB 4ZP6A 4CH0S 4YB5A 2XS2A 4J5OA 1VFJA 2HFZA 4B9NA 3OTBA 4NMLA 1ZTWA 2YH0A 2ZFHA 2MQOA 5T14A 4DSEA 1XMQF 3HJFA 3M8SA 4Q7AA 5BYRA 3FFIB 2V4QA 3GIMA 1S1WB 3S1TA 3HM9A 3RB0A 1FHTA 1XWLA 3HHLB 1OSDA 3I55S 5DGBA 3EZUA 2ZC3A 3DLBA 2C2DA 4OJ1A 1C0TB 2B6AB 2IBOA 3MAQA 1I6JA 4CT9A 1JLCA 2MHEA 2M4MA 2HQIA 4B9SA 5F8LA 4CTAA 4ZCMA 3O3LA 5KFZA 2E1AA 4HH1A 1H7XA 5FDLA 4CO3A 1HBNA 3HHEA 1WACA 4IH7A 2MKCA 3PW0A 1NH7A 4X4QA 3I5AA 4I69A 4RW7B 2RS8A 3S01A 2VZ9A 3QYYA 5HO4A 2VG5B 3THVA 4JI6F 1KFDA 2DGWA 3LPYA 4X4SA 3KK2A 2OO4A 5JXSA 3DLHA 2OMLA 4UOCA 1D3WA 1CEZA 2DT9A 2XMVA 2R8IA 1FRJA 4WJBA 1SIWB 3C6UB 4B9UA 3MR2A 4HT5A 1QLNA 1DJ0A 2DD8S 2DPJA 1KOHA 3I6PA 3JSRA 4TXSA 2VG7B 1P8GA 3EUNA 2OH2A 1RT6B 1X4EA 2EWHA 2IYIA 2KN4A 2YX4A 4IQXA 3G9CA 3TRGA 2DHAA 4NLRA 4J9OA 3SV3A 4FXDA 2J0SD 3RRKA 1N4LA 3DHXA 3QMQA 4P2SA 1HQEA 5L9NA 3N6MA 1U1NA 1S9FA 1TAUA 1MSWD 3KLGB 2KZZA 4J9QA 5G4DA 4MIAA 1EP4B 2FUG9 5K8NA 1HWKA 2YKMB 3T5LA 2UUCF 1XR7A 4X66F 5BJRA 1U49A 1X4AA 4FVMA 2X1BA 1RP5A 2YNGA 4MMOA 3DOLA 3MGJA 3OTEA 3CXCR 2W9BA 2OPQA 2XZWA 2HHXA 2IJFA 1NB7A 2VG5A 1IBLF 5DGAA 1M1KT 3RB3A 2DK2A 3LOUA 2D3UA 4ETXA 3OXFA 3EXCX 1ZAXA 3QJLA 3PJXA 4C8LA 5D6GA 3RRHA 5DQHA 3CDWA 1VMBA 2AP6A 1KQKA 4DL0C 5L8RC 4NZ7A 3JSBA 3ZZUA 2ZC4A 1QUVA 4NLUA 3TR5A 1Q1KA 1RYRA 5D77A 3IGNA 1UVLA 4RNFA 2RKIB 3UPFA 1P6TA 3K58A 1U1RA 2CZVC 2IC3B 3LGNA 5KG1A 3U02A 3V81B 4HKQA 2CQDA 4KFBB 5A0YB 1JLQA 5JJBA 2X51A 3KMSA 5JVHQ 2YKNA 3BF4A 4DPOA 4ZCKA 3M2UA 3FSYA 4DUYF 2EI5A 2JEGA 2CFXA 4H4OA 4MYUA 4KV8B 5GAHI 4MAKA 3A8EA 2FJAB 5DO2A 4ECRA 1M90T 4ED5A 3HKZD 2X1FA 3GFXA 1NAQA 2HWTA 3K7RA 3PRBA 1F0XA 4ES2A 3SMZA 3G8SA 3CCJS 3FRYA 2NUUG 2OPQB 1J2VA 1KONA 1REVA 4HTJA 4ECYA 1H2UX 2RQKA 4KV8A 3SCLE 3U27A 1U09A 3GG0A 2JVOA 4KO0B 3MTJA 1NEEA 1HL6A 3W2WB 2VFTA 1VHFA 2EK1A 4IR9A 2XI3A 2PDAA 3NAHA 1S4FA 3I32A 4IG3A 4ZPBA 1ROFA 4DEZA 2PA3A 2LXUA 1WEZA 2AGQA 2XMMA 4X4TA 1JXEA 4X2BA 2DO0A 3OFEA 3J81Y 2O67A 4WE1B 1JLAB 3MUTP 4XDDA 2OJ3A 1N88A 3C46A 1JWWA 2CPIA 2HNZB 2ILZA 1Y3KA 3DYAB 5CYJA 1MU2B 2BXJA 2KDOA 2XY5A 4LIRA 1V3ZA 2IBKA 2R7VA 1FNXH 2XS5A 1BD6A 3KTQA 3RTVA 4O4GA 1NKEA 2O1PA 2LQJA 1SL0A 4IUFA 4JI0F 1SJFA 3CTRA 1NK4A 4FXVA 5EDWA 4YDDB 3TAPA 1PC5A 3MEDB 4BWMA 3N0VA 2DGXA 4IFVB 1N5TA 4DL4A 3K0JA 3UI3A 1HD1A 2QSFA 1VRTB 4F3QA 4B9VA 4A8SA 2ZH1A 4I56A 4CO2A 2MQQA 2VPWB 4Y2CA 2V8GA 3KYLA 1IKWB 1REVB 1N48A 2JFDA 2DR9A 5GVQA 1B0TA 4IFYB 2RS2A 2VBZA 2XO7A 3TVKA 1CQMA 1TAQA 3S8SA 1VIOA 3OL7A 2RQ4A 2BM1A 2UZAA 2ACYA 1T94A 2YWEA 1Y5LB 1W25A 5I3UB 5GAEU 3FGVA 5C24A 1S79A 1GTHA 4ECTA 1SV5A 3HLUA 3LP1A 3ZC4A 1IXKA 1QVGR 5BYSA 4KRWA 3JAMY 3I0SB 3WDOA 3DXSX 3JTOA 1NZAA 2HQ3A 3DHWC 5DDQC 2JHEA 5KFAA 1V6HA 1S6PB 2FIUA 6FDRA 4DG1B 2COLA 2FHJA 3MM7B 5DDOC 3PRDA 3V5RA 5KG4A 4WZMA 1QTMA 5CCMA 1N33F 5HBMA 3G6YA 1VI7A 5IM0B 4MIBA 3ZZYA 3GV7B 2MYFA 1KLMB 3U7JA 3KK1A 1HNIA 3LF0A 4N77A 3KHHA 5L1LA 4EZ6A 5G0RB 3N5FA 4HTIA 2YWFA 1X0FA 4DSLA 1RT7B 2B5JA 1T8EA 2CQBA 1VQNS 1H98A 2CG4A 2WB4A 1QY7A 1R8PA 3MZIA 3RYLA 1S72S 3AB4B 1HBOA 3K57A 1V3SA 4H54A 4HT7A 1XMBA 3H25A 4NYOA 4EEYA 1N5YB 1RKIA 4E0DA 3OW2R 1MWZA 3DNCA 2FHJD 3SSRA 5H9FJ 4IO9Q 4I68A 3HXMA 3N5BA 4TN2A 3BQ0A 3BN7A 4UQTA 4I7FB 4UW2A 4ED7A 1FNOA 2FGOA 4OX8A 4N41A 3AA9A 3QGPA 4NLXA 4OZLA 1DURA 1O51A 1S10A 2YNIB 3POTA 2E7WA 1VK3A 1L3UA 2JFKA 3VAHA 3KOAA 4GMKA 3MM8A 4ZPTR 2DH8A 1KQFB 4WTYA 5IT4A 1HBNB 5J2MA 2VA3A 1ZPVA 1CG2A 3PHEA 4OQJA 4F4ZA 5KFSA 1EETB 3KWMA 1R0AB 4QBUA 1RT3B 1LWEA 4IOCQ 2RVJA 3O5TB 2MXYA 1PGZA 4P6QA 3DOMA 2RF2B 4ZVEA 2KM8C 1RTHB 5IS2A 3PX0A 2ZM6F 1LFPA 2MMYA 3Q24A 4DV3F 2ASLA 2CKWA 1R8HA 3PW7A 1N5VA 2RMLA 2VFVA 3GQCA 1XMOF 4YDXA 3GFYA 3M30A 2YKPA 2D9PA 3IN5A 5GAGU 1I1GA 1UP1A 2VG7A 1K1SA 4C11B 5KFHA 1R3NA 1ZAVA 2M5YA 2OPRA 3VQTA 2XC9A 3FNNA 2WK4A 3DN9A 1OWXA 1TL1B 3DCAA 2KXNB 2OP5A 1BC6A 5DJBA 4MYTA 5L38A 2WB1D 3EPGA 1U1LA 2BACA 5KFEA 4KJIA 4RW4B 2QFJA 2N7CA 4PQUB 5K14A 2BRLA 3T6JA 4J9SA 3IWXA 3MMJA 4IOBA 3SV4A 1SH0A 2KH9A 2P5VA 1VGYA 4RX6A 3K5MA 2PMZD 1F5AA 2P9EA 1Q8IA 3GIIA 1R0AA 4OHVA 2EBEA 4NA2A 2RIJA 3QLHA 3OR2B 2A1BA 4RUCA 4Y2AA 2W7PA 5J2PA 3BDPA 3ENQA 3ITHB 2E44A 1P1TA 4ZDNA 5T41A</