3G8TA

Crystal structure of the g33a mutant bacillus anthracis glms ribozyme bound to glcn6p
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
90
structure length
90
Chain Sequence
RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U1 small nuclear ribonucleoprotein A
publication title Structural and chemical basis for glucosamine 6-phosphate binding and activation of the glmS ribozyme
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 21
structure length 90
sequence length 90
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3g8tA00
1KQSR 2FC9A 2MQQA 2MKKA 2KRBA 5GMKa 5LJ5Y 1U1RA 2HGNA 2N3LA 2HZCA 3CULA 4Z2XA 1VQOS 1VQLS 2NZ4A 1FO1A 1WTBA 3EGZA 4QU6A 1OO0B 3NNAA 2MKHA 2MSSA 1WF2A 2MZRA 1YI2S 3TYTA 2DNRA 1YIJS 2E44A 2KFYA 2DB1A 2MZ1A 4WF9Q 2KM8B 2D3OR 1U1KA 2L41A 2HGLA 2ZJRQ 3VAKA 1YJNS 2J8AA 3MD3A 4IOAQ 2KU7A 2N7CA 2CQ3A 1N88A 3BO3A 3NNCA 3NS5A 2DHXA 1Q82T 2DK2A 4LJMA 5ITHA 1JJ4A 2PE8A 5D77A 1VQ8S 2M70A 3CD6S 1DRZA 2FPHX 3TO8A 2BZ2A 2DNMA 3PIPQ 4F02A 4IO9Q 3CXCR 3DLLQ 2MKCA 2N82B 1A7GE 1JJHA 1SJ3P 3H2VE 3P3DA 5JVHQ 2DHGA 1SJ4P 3UWTA 3OW2R 1VBYA 5LJ3Y 5LSOA 3S01A 2CQIA 2MGZA 1ZZFA 1F9FA 2OSRA 1PO6A 3MURP 3S6EA 1HD0A 2MKJA 3MI7X 2MZQA 4IUFA 2DGWA 3NS6A 4YOEA 3UCGA 1YWXA 5IQQA 1BY9A 2JVOA 2DNPA 2OTJS 1IQTA 1WWHA 2PEHA 4IOCQ 1WG4A 5GAGU 2DNNA 1KC8T 2CPIA 3VAMA 3VAIA 1X5SA 2KHCA 3CCSS 3ZZYA 2FY1A 2MZTA 1FHTA 1WF0A 1X4CA 2M88A 1OPIA 2CPEA 2QFJA 1QM9A 1VQKS 2VOOA 5GAHU 3Q2TC 2OJ3A 4ZKAA 1FJ7A 2CQHA 2YH0A 2AYBA 3UD3P 3LQVA 1X4GA 2CPJA 5DETA 2ADCA 3VAJA 2DNHA 2CJKA 2J0QD 1HA1A 5FJ4A 1M5KC 2MY7A 3G4SS 2MSTA 1FJEB 4CQ1A 1NJIT 1RK8A 2DGOA 2DISA 2VONA 1QVGR 5HL7Q 1S72S 3P49B 2CQ1A 4ED5A 2XS5A 1Q86T 1XN9A 2DH9A 2MGZB 2M8DB 3IRWP 4CH1A 4U67Q 2MY8A 1VQ7S 2KT5A 3P5TL 2DNQA 1K9MT 4C7QA 2LECA 2KXHA 1M5PC 2LXUA 1U1QA 2O3DA 1N54B 3VAGA 2CQBA 1NU4A 2DGXA 3ULHA 1URNA 2M8HA 2RT3A 1K8AT 2N3OA 3VAHA 2LXIA 2XNRA 2Q79A 2YTCA 1M5VC 4UY8T 3G6ES 3MD1A 3G96A 3S7RA 1ZZNA 5EN1A 3V4MA 4Y00A 2LA6A 4PRFA 1R8HA 1M1KT 2DHAA 1NO8A 1WEXA 2GHPA 2RQ4A 4Y0FA 3U1LA 4F26A 2LA4A 2M2BA 1W2BR 1YJ9S 2J0SD 2ERRA 4WKRA 1X0FA 5GADU 4BS2A 1WHWA 3TP2A 3CPWR 3CCES 2DIVA 3HI9A 3MUVP 1X4DA 2FC8A 2SXLA 2G0CA 1VQPS 2D9OA 2X1AA 2CPYA 2LYVA 2MMYA 1UW4A 2JVRA 2MHNA 3EGNA 3Q2SC 4PKDB 4M5DB 2MYFA 3BO2A 1WHVA 2JRSA 2AYEA 2LEBA 3B4MA 1WHYA 2DH7A 4C0OC 4ERDA 2CQDA 2JWNA 2I38A 5MLCV 1VQ9S 2M52A 2RVJA 4QQBA 2KH9A 3FEXB 3UD4P 5DDQC 5GVQA 4WCEQ 2V94A 2DHSA 1WELA 5LXRA 1HD1A 2DNKA 2RNEA 1RKJA 2AYGA 3CCRS 2XS2A 2CQ0A 3CCMS 1H6KX 1VQ6S 2OTLS 2KXNB 3CTRA 3PIOQ 1H2TZ 1KOHA 3MOJB 5DM7Q 2E5IA 2A3JA 2M7SA 3U1MA 3K0JA 2L08A 2KVIA 2OSQA 3ZZZA 2EK1A 4CIOA 3MUMP 2VODA 2B0GA 2CQ2A 2X1BA 3THTA 1YHQS 1SJQA 2DITA 1M90T 1CVJA 3UCUP 2CPDA 3UE2A 5LSLA 2DNOA 4QU7A 1Q7YT 3VAFA 2DNZA 4EGLA 1SJFA 1JJ2R 2BOPA 2DH8A 1DBDA 4J5OA 2MXYA 2YKAA 4WIIA 4V19X 3CCUS 1WG1A 2M4MA 2MZJA 4A8XA 2HGMA 3CCJS 1WEZA 2MQOA 4W92B 2K3KA 2CQ4A 2YWKA 2AD9A 1KD1T 2MKIA 3BS9A 5H1SV 2RQCA 2HYIB 5IM0A 1G2EA 1H2VZ 3R1LA 3B4DA 2E5GA 5DDOC 2LQ5A 1VC5A 2L9WA 4CH0S 1P27B 2XNQA 1DZ5A 2M9KA 4QPTA 2VOPA 2LEAA 1U6BA 2LKZA 4W90B 1X4AA 1X4BA 5IFMA 2RUGA 2X1GA 2OIHA 3CMAS 2KG1A 2M0GB 2U1AA 1VC6A 1VQ4S 4WFBQ 2E5JA 1Q81T 2DNGA 4TU7A 3J7ZT 1UFWA 3VF0B 1L3KA 3THPA 4TU9A 2LMIA 2D9PA 3R1HA 4YUDA 2KXFA 4FXWA 3US5A 1VC0A 4OZ0A 5CA5A 2NLWA 1U1PA 4YB1P 3CC7S 2EVZA 3G8TA 1WG5A 4WFAQ 2KYXA 2EK6A 2G1DA 5CYJA 2DO4A 3SDEA 2MJUA 2F3JA 2MQMA 2RS8A 3P6YC 4LMZA 2DO0A 1D8ZA 1VQ5S 2FHOB 2X1FA 2DGSA 3EX7B 5HO4A 3CCLS 2DNYA 3SXLA 2WBRA 3VALA 1M5OC 1QVFR 1DHMA 5DDPC 1YTYA 2KM8C 2RS2A 2MQLA 2MQPA 1N52B 3L3CA 3G8SA 1FT8A 2KG0A 1YJWS 2ZJPQ 1SXLA 1N8RT 3IWNC 1WEYA 2MJNA 3DXBA 3HHNB 4TU8A 2UP1A 1K73T 3I56S 2XB2D 1X5TA 1FNXH 5IM0B 3CC2S 4WFNQ 1S79A 2U2FA 5D78A 2MKSA 3N9UC 2GO9A 3CUNA 3UCZP 2QEXS 4P6QA 1B7FA 2CPZA 2DNLA 4C4WA 1VQNS 2CQCA 5GAEU 2E5HA 2DGQA 1A9NB 1WI6A 2KN4A 4LIRA 4PR6A 1JMTA 4TLQA 1WHXA 3RW7A 3I55S 3S8SA 2KI2A 3MUTP 1WI8A 2LCWA 5LXYA 5CXTA 2G4BA 4OZ1A 3G71S 2XS7A 2CQGA 3NMRA 3R27A 2KRRA 1D9AA 2ADBA 1U6FA 2F9JA 1H2UX 3J7YU 5JVGQ 3FEYB 2RRBA 3CC4S 1R8PA 1U1LA 2RRAA 1U2FA 5BJRA 2J76E 2JX2A 1FJCA 2I2YA 1U1MA 3SDEB 2CQPA 2DIUA 3G9CA 1AUDA 1U1OA 4FXVA 1VBZA 2HVZA 2ZJQQ 1VQMS 2XSFA 1SJRA 1P1TA 1ZH5A 2MZSA 3MXHP 3JB9k 1VBXA 3MDFA 4RU2A 5DM6Q 2AYMA 3NNHA 2QA4S 2MB0B 3CCVS 3BO4A 4F25A 1FXLA 1OWXA 1KOOA 2K8GA 4UQTA 2CPXA 2CPHA 1X5OA 2DGVA 3BEGB 1PGZA 3SMZA 1O0PA 2F9DA 1UP1A 3CCQS 2YH1A 3LPYA 1X4EA 1OIAA 1UAWA 2MQNA 2RU3A 2CPFA 2MPUA 3D2WA 3RW6A 1U1NA 1WF1A 2DGUA 3H2UB 2DGTA 1X4FA 1HL6A 1X4HA 1X5PA 5DDRC 1YITS 3CF5Q 3CMES
chains in the Genus database with same CATH superfamily
1L3TA 4ZLNA 2MQQA 3VVUA 2EFNA 1TKXB 1WTBA 1FK9A 3H5XA 1V3ZA 1WF2A 1YI2S 4U7UK 3IBWA 2R7UA 4E98A 2KDOA 4WF9Q 1YJNS 3RRHA 5CH7B 1UJ6A 2E1AA 3NS5A 2JLFA 2DK2A 3ZTSA 1A0OB 1U0HB 2W8LA 2KTQA 1VQ8S 3TO8A 1OSCA 2HIQA 1TP7A 3ZO7A 1LWEB 4X66F 1CJKB 4OX6A 4DN9A 3SZ2A 3UVJB 3MURP 4PQUA 1RAAB 4OV1A 4ZP7A 4Q2MA 1L3UA 1RHUB 1FESA 3KKFA 4IDKB 5DLFA 1LKZA 1WC5A 2V50A 4OQJA 4EBCA 3QLHA 1RSCA 2FY1A 1FDAA 1HBNA 1OJ4A 2JSXA 1X4CA 4DV5F 3M8QA 4ED6A 1R89A 3MCNA 1D1UA 2AEMA 2DRAA 2QRRA 2IA6A 1RT5A 3GYGA 3E2EA 1RU2A 2BM1A 1BC6A 4B3RF 2W25A 2F8MA 1PCAA 1XR5A 5E41A 2DISA 1OQ3A 2OFHX 4RW6A 5F0WA 5K14B 2PDAA 1F6TA 4ED5A 1DQ9A 5KG3A 1Q5VA 2DH9A 1YVFA 5D4OA 1Y5IB 3KJNB 2KT5A 4ZHRB 2LXUA 1U1QA 2HMIA 3TEGA 3EGWB 3CDEA 1ZOTA 4H4MA 4LVNP 2LXIA 2XNRA 4UW2A 3ZTRA 1T3OA 2HFOA 4YB6A 4EMDA 1ZM2A 2LA6A 1R8HA 2GHPA 3SI8A 1V9OA 3HD1A 1NAQA 4F67A 2B5JA 2EXUA 2CPYA 2LYVA 5KFBA 3MAAB 3NLCA 4M5GA 3OL7A 4CO4A 1ZS6A 4OYZA 3LTOA 2KH9A 3AHPA 3MMBA 1WC1A 3CJRA 1S12A 1RKJA 1IBLF 2BE2A 3K58A 2KXNB 4DR1J 4KE5A 3F0NA 2YQ1A 1NB7A 5B0BA 1S0VA 3K0JA 2L08A 2B0GA 4LF8J 4X62F 4JOUA 3VAFA 2HNZB 3JSYA 1C1BB 3I32A 2VG7A 2K7KA 2C1EB 2C3YA 3HP6A 4X84A 2O1PA 2HGMA 4LBHA 1TAQA 1GH8A 4EFAC 1C0TA 1KVKA 1RHRB 3A8IA 4YEAA 1OYEA 1YBTA 1PG5B 1IJFB 1IQZA 1BUXA 2E1PA 2AX1A 2BDPA 5ETNA 2XSJB 4DZDA 4TU9A 5EWGA 1VQYA 1SL0A 4WK3A 3LP0B 5G4DA 1WG5A 2QJ3A 5BXIA 2YNFA 1UEUA 4LMZA 3M8WA 3VR1A 3OUYB 4RO0A 5HO4A 3SXLA 4BCAA 3TI0A 2RD5C 1DLOA 4LSLA 3PW5A 5J2NB 1Q0NA 1S79A 2IYIA 3BM7A 2HNDB 2QL7B 2WCXA 1TK0A 3PX6A 4YY3J 3JSMA 3GB0A 4NXMJ 4P52A 2B6AA 3MUTP 2J0WA 3BPDA 4F0HA 3T1YF 4OZ1A 3MM5B 5L1IA 4PABA 2ADBA 1X9WA 1S97A 4HT7A 4ZVFA 3E01A 5K8NA 4NCGB 4P10A 2JX2A 3SDEB 2BW2A 1CULB 1YJ7A 1M5HA 2UVVA 2NSCA 5EX3A 4ITSA 3L09A 4OJHA 2ILYA 3MDFA 3I5AA 5C2CA 4M8LA 4JYAJ 2EPIA 2RRNA 1HQEB 3IWLA 4Y2CA 1WC0A 4WXWA 3EXYA 1ZA1B 1A6LA 4I67A 1UAWA 1K1SA 2EFOA 2MPUA 1NZAA 3GYNA 1B64A 2YPZA 3A3PB 4JI6J 1EKRA 3BREA 2K1RB 1C1CB 5C5JA 4ZVRB 2WSCC 2WHOA 1OO0B 5HQLA 4ZPCA 3JTNA 2OPRA 2P8IA 2DJWA 1T7PA 2DB1A 2MZ1A 3OVSA 1ZM4A 2L41A 5DG9A 4WKYA 2JJ4D 2QX0A 4I2PA 4DL0C 3GIRA 4KPCA 3CXCR 2NSBA 2R7TA 3LF0A 4X4RA 2BRLA 3I87A 1RT7B 2MTLA 2BABA 5DG7A 4LFAJ 1C0UB 2HG4A 2RKIA 3M6UA 5GAGU 2V2QA 3CCSS 3EDRB 3Q89A 1FHTA 3DKDA 3TJAA 4NCBA 1V5IB 4UF4A 3LGHA 5LMNF 1QM9A 2LLZA 2Y1RI 3UD3P 2AWZA 4Z7CA 2CJKA 1NK6A 5J1PA 3MCMA 4B9TA 1RT3B 3FC9A 2CA9A 4FYVB 1FJEB 4NLYA 3DLHA 5E2QA 3UDLA 5CABA 1FX2A 1AUSL 4UOFA 2GC8A 2VA2A 4PQAA 3Q8UA 5IWAJ 2V8GA 2ZHAA 5KG7A 3EYZA 3RAQA 4U67Q 2VQEF 1T95A 3L7PA 4Y28C 3BQ1A 4JI4F 1TU0B 2EFGA 5A8WB 4DV4J 2JLGA 1SIWB 2RT3A 3VAHA 2GVZA 3HHLB 3KK1B 4WIQA 3WQPA 5F8JA 2UUWA 5F9NA 1UPMB 3PFEA 2ROPA 4P2MA 4LUBA 1WEXA 1G4CA 1TQLA 1UFLA 3CCES 3I5BA 2W2MP 3RJMB 3FCVA 4GMKA 1RKIA 2ASLA 4RBTA 5AJ3F 4J9OA 4QYRA 4YR3A 4J9NA 2XWXA 3HSJA 3M32B 1QJHA 1RT6A 3AA8A 5B0FA 2I38A 1KS2A 2M52A 6FDRA 5DDQC 5GVQA 1F1BB 3I0RA 1E6YA 1NXIA 1CJVA 2AYGA 5KFTA 2ZH9A 1H6KX 1DTTB 1EAYC 3HT3A 3PIOQ 2KJWA 4QIFA 5DM7Q 2OHDA 3JYTA 4DHVA 3AJDA 4QZVB 2CQ2A 3AODA 3H4DA 5D0GA 3SQGB 4PWDA 5H9FJ 2DNZA 4JB8B 4PXEA 5B0EA 1JJ2R 2POKA 4MJKA 3T5JA 2VUGA 3R97A 3HFKA 4A8XA 4C98A 1XMQF 4FF3A 2R2SA 2G2YA 2EFVA 1Q16B 1Y5LB 1BQMA 5DDOC 2FHKA 3HPOA 3T9ZA 1SI9A 3NS7B 1LWFA 1FKOA 1BWVA 1TVRB 4UOGA 3KLVA 2C2ZB 5H9EJ 4OI0A 1DTQA 4HH1A 3VF0B 4OZ0A 3O1LA 2YQ0A 4DV1J 2G0JA 3G8TA 4DBQA 4EZ9A 3D6TB 3AB4B 1N34J 3LP2B 2MJUA 3DRSB 1PBUA 5KFOA 2EG2A 3AT1B 3R6GB 4C9DA 4OYWA 1YX2A 4PZVA 3OR2B 3IWNC 3I31A 2ZOFA 5KFUA 1X5TA 2F4VJ 4A8KA 4CLTA 1G1XA 4DR3F 2DNLA 3WZ0A 2W4CA 3AJ2A 2GCFA 4CDIA 4J9KA 1JMTA 5CYQA 3BGFA 1JLBB 1D8YA 5KT6A 3GPAA 4WTOB 1R0CB 2ZH6A 3T1HF 3V81B 3T41A 3IP0A 5KFGA 4Q8EA 2E5LF 1RTIA 4PYDA 4AUKA 1U1LA 2PA3A 4JV1A 4USHA 4B3OA 4CO2A 2KJVA 1UFKA 4O0NA 5ETVA 1HW8A 2GVDB 2LU2A 4CH7A 3EVOA 1P1TA 1MU2B 5F8IA 2H5EA 4RU2A 4U96A 1LK7A 2OELA 3G6VA 3ZFVA 4UZBA 3MMCA 1FE4A 1OPZA 2ZBCA 4F4YA 1C4CA 2QA1A 4OI3A 5L8RC 2ALZA 1LV5A 1SVDA 2YKOA 3RW6A 2FZGB 2HHPA 3HDSA 1PILA 5ETPA 1X5PA 5DDRC 1PC4A 4NL5A 2FC9A 2CDQA 1LWCA 2XO6A 3D67A 1FWPA 4M63A 3AH6A 4IOBA 2L48A 1JNZB 2MSSA 4LFBF 1HPZB 4LRBA 3MMAB 4FZVA 1RT4B 1CEZA 3H7HB 4CM2A 2FJBB 4HDHA 3T3FA 3F44A 2YWWA 1RA6A 2M3DA 4PWWA 1SJ4P 4OI2A 4HI2A 5LSOA 1S9EB 2MKJA 1S99A 2HAIA 4IUFA 3PACA 2R8HA 4I2QB 3HZGA 5KG1A 3D4JA 4KGZB 4HYKA 4KKOA 4J9SA 5JUMA 1S1UA 1D09B 3T19A 4IFYA 2XTJP 1L3SA 2YKQA 3W60A 3VGSA 3A13A 2J6UA 1H73A 1RTHA 1UWBB 1XBWA 1SKWA 3PJXA 5HVFA 2PI5A 2NCKL 3PFOA 4AL7A 4NA1A 2MSTA 4ED2A 3I9V9 4CQ1A 1NJIT 5G0RB 3D0GE 2DGOA 3GILA 5T41A 3FSXA 3MPUB 4DJBA 5A2QU 1WOOA 2NR0A 4CH1A 4DR2J 3D0HE 1NZ8A 3W64A 2GO8A 4C7QA 1FKPA 3W66A 1S9GB 5DO2A 1B0VA 4DV7F 1FE0A 3QRPA 4UY8T 5GMEA 1JXVA 2XZDB 5LT5A 3MD1A 2XMVA 3SIPB 3W61A 2W2OP 2DHAA 2CADA 4LR9A 3V5RA 1YJ9S 1FXRA 4CNYA 3CPWR 2CUYA 1X4DA 4OFZA 2ZVIA 2G0IA 5AXKA 4N7TA 3OJUA 1N5SA 3B54A 1LWXA 5M2RA 2PMWA 2RDJA 2H4WB 3E3XA 3U1NA 1PC5A 4OZNA 3CTRA 1H7WA 2A3JA 4ECTA 3DGVA 1SJQA 3G82B 4QU7A 3QWUA 1X31C 2IAJA 1FJGF 1TELA 1IXKA 1RWMB 2RJZA 2HWIA 4V19X 3SFUA 4HVZA 4ZMMA 2P9GA 4NA3A 2CJQA 2MQOA 1JLCA 3VTIA 2YWKA 3FBFA 2ZDOA 3FFIA 2BKPA 4P71A 4X4TA 3UPFA 1G2EA 4JI7F 2BM0A 2V68A 3NMAA 4PXBA 2R8KA 1T9TA 4PQUB 3CE8A 3U7JA 2RUGA 1GNKA 2OIHA 4CCHA 3CMAS 5DZ6A 3TRGA 2NPIA 3DI6A 2EG1A 4O3SA 4MT1A 3VCDA 4KC5A 1HBNB 3A12A 1R8CA 5JJBA 3M8QB 1HNWF 1D3WA 2B4OA 4M94A 5CAAA 2XYGB 3P6YC 4U7UD 4OX7A 1QTMA 4A8YA 3C2PA 3J7Z5 3CCLS 4OYPA 1RT5B 1JKHA 4ZP6A 5I42A 1I94F 2BR0A 4NXNJ 1KNZA 1S1WA 1T9YA 1R0AA 3R5GA 4C97A 4LRAA 1RLCL 2GIFA 2ZH7A 1NHUA 1SXLA 1N8RT 1IWAA 1RAHB 1NDLA 2GW8A 2Y1JA 1N33J 4RW6B 2ASYA 1K0TA 4WFNQ 2U2FA 5D78A 1QUPA 5I4MA 2IDLA 1B7FA 1RYRA 1VS3A 3UDCA 1QLNA 2RSQA 2HMIB 2DR5A 4H4MB 4CZCA 2KI2A 2BMBA 2VB6A 4H4OA 5F3TA 1JLAA 4B9NA 1H2UX 4LRCA 3J7YU 2I2YA 3CVKA 3GSDA 3IS9A 3AOAA 2ZH1A 2BJDA 4I64A 5FLXY 3F41A 2B5JB 4ZLPA 1MROA 3ZC4A 2VICA 2QA4S 1JIHA 4F25A 3PZPA 4FP9A 1KTQA 5KFMA 3MMBB 4USKA 4DX7A 2QL5B 4Y65A 3CD0A 1S9FA 1IBKF 4I68A 2V4RA 3LH2S 2BE2B 2B4VA 1GMWA 3HZEA 1NMEB 4DX6A 2C3OA 2EI5A 1VK3A 2MKKA 2XGPA 4EBDA 4NLGA 3OTOF 1S6QA 3BQ2A 1TV6B 1FDBA 4Y2MA 4QU6A 1OSDA 5JMNA 2VV5A 2VG7B 1Y5NB 3V6JA 4MIAA 1HHQA 4RUAA 2E44A 2ATLA 1RGVA 3TA0A 3GJTB 1BQXA 3J80U 2ZJRQ 1PJ5A 3PNIA 1C0TB 1N88A 4E8UA 3CGIA 3D6MB 2LFVA 1IBMF 4F4XA 1T3NA 5D0HA 2WBMA 4DUZF 1SCJB 2JLEA 4ICLA 5LJ3Y 4PCQA 5ETKA 1ZZFA 5E0OA 2VQFF 2AQ4A 5FDLA 1V3RA 1CC8A 4DDFA 2IYGA 2BACA 2OTJS 1VR6A 4L74A 1UKUA 3OVBA 1XNQJ 2YNFB 2RH3A 3OBIA 2R2TA 1WF0A 2Z0GA 2DHHA 1WUUA 1WTFA 2QT7A 4M5MA 3ILIA 1UVNA 2VBYA 5HROA 2IJRA 4NYOA 1RWXB 1DLOB 3N5BA 4LSLB 5DETA 2DNHA 5B0GA 2A10A 4OJ1A 4EO8A 1NPRA 4Q0BA 3JSMB 1S6PA 2F63A 4C0HA 3QBCA 4RNOA 3B82A 2MY8A 2HRTA 4CO1A 4ENOA 4RW9B 1ZTWA 5C7PA 3E01B 2CJBA 3BGLA 2FJDB 3BN4A 2DY1A 3PW0A 2W9CA 5D3GA 2HHHJ 3BKTA 1XK8A 1S0OA 3FK4A 1FEEA 1XEZA 4IRDA 4FS1A 2DXDA 3GONA 4X4OA 4Y0FA 4F26A 2BANB 1WHWA 1SC1B 4DUYF 3CJ8A 5BYRA 2YWFA 1N5YA 1ZYQA 4GKJJ 1LFPA 5KFXA 5DQHA 3RBXA 3OSPA 1WHYA 2DH7A 2WOMA 4ERDA 2JWNA 2VKZG 5EWFA 3IRXA 3BGUA 3DRYA 3GFZA 1RCOB 3OLBA 1H2TZ 1TUGB 4CLFA 2Z2LA 3U1MA 2OPRB 3GYXB 4NLDA 2OKQA 3ISZA 3MECB 1VLOA 1YBAA 3O8WA 1KLMB 2CYYA 4NX9A 2YKAA 2XMAA 3UFCX 3CJTA 4I2PB 4JV5F 1ICEB 3EVMA 3KNGA 2C2RA 5ETSA 3QRRA 4ZLJA 2L9NA 1XNRJ 1KD1T 3LWLA 1HBUB 3BR9A 3KDNA 2HBZB 4B02A 5EDWA 4F0KA 2N7YA 4ZVHA 2M9KA 1B70B 1J5OA 3DMJB 4X4VA 3A8EA 1MSWD 2LMIA 3N6LA 4F3QA 2LDYA 4RWXA 4YB1P 5DG8A 1U25A 3VWSA 1GTHA 1SJ1A 1V5VA 3R5JB 4DPUA 3TX8A 4DXLA 5IT4A 3PEHA 2OEJA 3X1LB 1CQNA 5KFAA 4DSIA 3BF4A 1FVQA 2ZEJA 3O6QA 5EUHA 4LFCF 1NDKA 1JLGA 5EGYA 5K8OA 4UUXA 4PR6A 8AT1B 3ELHA 1T9XA 1H74A 4LR8A 4BWJA 1SC6A 2B8QA 3QPIA 1HNVA 2GVZB 4DR4J 3H5UA 2IJFA 2MLXA 1B99A 4V1Ak 1MN9A 5HQMA 3DXSX 3M7VA 4PWUA 4KQZA 1YZ6A 5BYQA 1KVJA 1HWJA 2DIUA 3IR7B 1S0NA 4LF6J 2CNOB 3I9ZA 4FXVA 1Y00A 2ZJQQ 1SJRA 1DY3A 4MKYA 2VHGA 3BGOP 3KHGA 1RT6B 2MQ8A 1Y11A 2CPHA 5U47A 2NZCA 3I0RB 4OYMA 3AQOA 1HMVB 5C24A 1CJVB 3VV2B 2BKNA 3QQCD 2A18A 3P4UB 1HL6A 5KFCA 3JYTB 4RW8A 3DU5A 4HR2A 3H20A 1U1RA 3ZTOA 1S4FA 3M8PA 4TVAB 1RWNB 1IN0A 3UNGC 3MD3A 4C8LA 4NLRA 4YDDB 2DY9A 4C8ZA 1D0EA 1BQMB 4L3KA 4A8MP 4FF1A 2Y1LB 2UUAF 4B3MF 4X66J 1LWFB 1FKOB 2BQ3A 1VHFA 1DTQB 2FIUA 5F0UA 3SCIE 2DCUB 2YKPA 1Q79A 1YKWA 4KR0B 3NGDA 3CWJA 3MHYA 1KHVA 4WFXA 1DFDA 3HMJG 4DV5J 2WW4A 2OP5A 1WKJA 1U8WA 5HN0A 1VK8A 4ZPWR 4KO0A 4ILMA 2H5JB 3ETMA 4B3RJ 3D66A 5LM7E 4F8RA 3LQVA 1IWGA 2B9XA 4F2SA 1RA7A 1HA1A 2MY7A 2VC1A 3KK3A 4KSEB 2F65A 4CRJA 1TKZA 5HL7Q 2CQ1A 4DR6F 3H4BA 2A0FB 3FCWA 3KMSA 3LAKA 4MKVA 4OYAA 1RTIB 3M1VA 3W9HA 1K8AT 4L73A 2YTCA 2ZUAA 4E2FB 3DYAA 4I1TA 4B3OB 3OTCA 2HQIA 2XY7A 2OEMA 4Y00A 2A2DA 1VLYA 2IA0A 1SH0A 2YKNB 2V2ZA 4BS2A 1FCAA 3QGIA 4O23A 4CO3A 3PRVA 1RWPB 1VHIA 4J91A 3FDSA 4C8KA 1WD6A 1YRTA 2D9OA 3VZHA 3KHLA 1JWWA 1UW4A 1KSPA 2JC1A 2CXEA 3NOCA 5KT4A 3OQ2A 2QL9B 5DS7A 1XR6A 1Z4UA 2RVJA 1IBLJ 4QOTA 4C6AA 1S1XA 4HLBA 4LF2A 2RMLA 3GCWP 2FHJA 5K8PA 4FXDA 1ZA2B 3LGNA 4X62J 4CLYA 1QY7A 5BR8F 1XMBA 1YJRA 2M7SA 1EETB 3EDQB 2YNGB 3EVWA 3ZZ0A 4K4TA 1CVJA 3R7SB 1Q7YT 2H65B 2BX6A 2H9ZA 1HI0P 1HKAA 3MR5A 2QLJB 5KG4A 2IVYA 4WIIA 4O3PA 5HAOA 3PRBA 2PGCA 1WOSA 1RHMB 1UPPA 1X0PA 2IHR1 3C66A 3L7UA 1N0VC 2RE1A 2AD9A 3PY8A 3MEGB 3MM6A 1P8GA 2R7XA 2NXJA 3DLEA 1CPZA 2YVSA 2XNQA 2DD8S 1TFWA 1WACA 4RNFA 1U6BA 4MK7A 2CVIA 3LA0A 4U95A 2M0GB 1WDDA 2QZ8A 2KB2A 3R1HA 4KKOB 3TJ9A 1R7IA 4C8MA 1S1UB 1YJTA 4IR1A 2MDAA 3NL0A 4IFYB 4ETZA 4KH1B 4WFAQ 2UU9J 2YBVA 2WBRA 3K57A 1DHMA 5DDPC 2VPXB 1RTHB 2KKHA 3MEDB 1FFGB 1RZMA 3TUJC 1LQ9A 2R42A 1FNXH 3CC2S 2BJ3A 4WWSA 4ECYA 3NBPA 2KT3A 1VQNS 1MWQA 3T1YJ 1FKPB 1WI6A 2ZBPA 1UVIA 3MM9A 2C28A 2G9OA 3NAIA 3QT8A 4LF9F 5HATA 4B9MA 3HX9A 4DS4A 3CNQP 2QLWA 3CC4S 4PEOA 1U1MA 2EC0A 4C3KA 2ZHBA 4ZA1A 3OFGA 1VBZA 3RAMA 2LP4A 3E8OA 2HW3A 4N77A 3W2WA 3M05A 3FBCA 1G6BA 3BO4A 1YG0A 1YJUA 4G1PA 3SMZA 4XTTA 3LPYA 1RI7A 3JTOA 2AZ3A 2RU3A 3PEJA 3QSIA 2AJQA 1AYEA 5DQGA 1X4HA 1U09A 4DSFA 2KRBA 3GJRB 3I0SA 5LJ5Y 3BB5A 2XI3A 3DRRA 2ZH4A 7FD1A 2BKOA 3K5PA 5J2PA 3N01A 1R0BG 1NKCA 2JZ5A 5I3UA 2FLOA 5DGBA 1U1KA 4IOAQ 1JLCB 2CQ3A 4OV6A 2NS1B 2OPPA 1JJ4A 4XPCA 2PE8A 2BZ2A 2DNMA 1QAIA 1YBUA 4ZPDA 1N0UA 1EX8A 1Y4ZB 1F0XA 4K4YA 3DI6B 1UVLA 1PO6A 4DL6A 5IC4B 2ZC4A 3CEDA 2MEWA 3GJSB 3N5FA 4DU8A 5B7WA 1RTZA 1FD2A 5LMNJ 3ILOA 1FI4A 2I5JA 4FKXA 4DQPA 3FZ2A 1JKHB 2ZNZA 1S1WB 3OHBA 3I82A 2FLLA 4Q45A 1VQKS 3KLIA 5J1EA 2ZZNA 1FRKA 1S4EA 5HP1A 2CPJA 3PRDA 4WE1A 4Q44A 2NXEA 1WORA 2EFPA 1VRTA 4NEZA 1URRA 1RK8A 2VQEJ 2GMJA 3J7A1 4X4QA 4LBPA 1S59A 4H4OB 4ZVTB 4ZVQB 3JSRA 4BHQA 2KXHA 2HK2A 3ENWA 1KDNA 3M6XA 4DPOA 4F4KA 3GV7B 4K0KF 3R5AA 1K0VA 4S0MA 3O2IA 3IS9B 5ETRA 4F36A 2QTWA 3R7NB 1EQMA 4O0IA 5GADI 2GHVC 5AJ3J 2RQ4A 4C8NA 2HNYA 4ZP8A 4ECUA 4DS5A 4OLOA 2CDRB 1S57A 2Z56B 4IH6A 3FRZA 1RTDA 3X3UA 3UD5A 2JRSA 1RLDA 3FBEA 4C0OC 3PW7A 3ZZPA 5AE3A 4CWBA 2R8JA 3A4TA 1T05A 3UN3A 3UD4P 3NXZA 3JXOA 4WCEQ 3W3SA 4L72B 4ZPBA 4CO0A 3RAXA 2X51A 3CCRS 1CG2A 4J9UE 1S6QB 5KT3A 4O4RA 2E5IA 4FYYB 2VD3A 1NH7A 2EK1A 3QGPA 3MZIA 4F3OA 4CO5A 4G1QA 3Q23A 1NRKA 5M2PA 2RIJA 3GJQB 2DT9A 1SJFA 1Z2ZA 1XMQJ 4N41A 4CYUB 1F2HA 4ES2A 4ZK7M 9ATCB 1NUEA 3B78A 3PCOB 3CCJS 1H7XA 2V67A 2HHWA 1UA1A 1NSPA 3OT9A 2Q43A 4WJBA 4ILLA 1B0TA 2FB0A 3NOGA 4PAAA 4ALZA 4ICLB 4A8OA 3R1LA 1O8BA 3Q83A 5FDLB 4DR7F 1X4BA 3TEHB 3KLHB 1KQKA 3MR2A 5C42A 4RKUC 3JSBA 1R8AA 4NMXA 3THPA 2KXFA 4FXWA 1BWEA 2VG6A 1N36F 1N6QB 4CM0A 4QW8A 3EUNA 4TNOA 2D74B 3K5LA 5CYJA 4GO5X 1PJ7A 1VQ5S 2FHOB 2RQMA 5HROB 2ZE2A 1H72C 1JQGA 2FDNA 1XMOJ 5K5MA 3NG8A 3VGTA 5KFVA 4K50A 2BW7A 3L3CA 2KG0A 2EW9A 1QSYA 2JNJA 2V8VA 4DSJA 4Q0BB 3CSKA 3FRYA 4F04B 2I1RA 1S6PB 5IM0B 1FA0A 2B9EA 4UZCA 2MKSA 3BBCA 2QEXS 4IQXA 4JP8A 3LWMA 4ZPAA 3HVRA 1HBOA 3UDVA 1NLKL 4NZ0A 5GAEU 2E5HA 5HK4A 3T1HJ 1Q78A 1Q8IA 1SKUB 3I55S 2E5LJ 4MK9A 4NYPA 5K8MA 4ZCKA 2W9CB 5D3GB 3NMRA 4CLUA 2IJNA 2F9JA 3FEYB 4QIWD 1U2FA 5BJRA 2V2VA 8ATCB 3VQTA 3TX0A 1MWZA 1VGYA 2IRXA 1N5YB 2E66A 5E7OB 4DPWA 1WJ9A 3JB9k 3DRXA 1Y3JA 3PJ9A 2ZC3A 5F8NA 5SZTA 3CCVS 5KTQA 2WOMB 5HVGA 2K8GA 2RF2B 2J6SA 4QYZK 1FX4A 1CBKA 4NMLA 1PGZA 1UP1A 4ELVA 1CS4A 1F2GA 4QWEA 3MCSA 3HKZD 3CD5A 4TY9A 2XLJA 2N3LA 1JNRB 2NZ4A 4OZLA 3TA2A 3R2DJ 1NM2A 4FNHA 2KFYA 1PYOB 1VISA 2A2CA 2X3GA 1KFSA 1FTCA 3T5KA 4F3MA 2CIMA 3JQJA 2UUBF 4I6WA 5CHCB 1HARA 1RQ0A 3G2XA 3DLLQ 2R7VA 2N82B 2PO4A 3T9NA 5IV4A 5KAKA 1HNXF 3OW2R 4USMA 2B8PA 4RUBA 2EEYA 2IFXA 3BBFA 4NXMF 4ZIWA 2UUTA 4CT8A 4K4SA 2WB1D 4ZVGA 2AJ0A 1BY9A 1S7HA 1WWHA 2PEHA 2CPIA 5AXMA 2IRUA 1Q95G 3Q8SB 3FCHA 2XG8A 3ITHA 3Q8RB 1GX6A 4ZP9A 5D4PA 1IUJA 2OD6A 1X9MA 4GVLA 4LF1A 3Q2TC 2OJ3A 3ET6A 3N6NA 4C11A 2YH0A 1UJ5A 1TL1A 3OL6A 3DM2A 2V2KA 3G4SS 2ZHOA 4B17A 1JLGB 4WXOA 1TK8A 2LQJA 1KWMA 2CAJA 3P49B 4EO6A 1HNVB 4DV7J 1R43A 4NLQA 2FD2A 3EICA 4B9UA 3ZNJ1 3LO3A 1GFWB 3IAM9 3RR8A 2M8HA 1PAUB 3OTDA 3DDIA 1TL5A 3KTQA 1EP4A 4M5LA 1WOPA 3SSRA 5F41A 3O44A 2DBBA 1C4AA 3WC2A 3QAEA 2VFVA 5KT7A 3QZ8A 1DURA 1EARA 4GVBA 3IG1A 4BDPA 4B3TF 5HBMA 2GGPA 1KR4A 3K5OA 4RW8B 3C19A 4HL9A 3RBEA 2VC0A 2N4DA 2ZOGA 4HACA 1Q4RA 3M8PB 7FDRA 2YKMA 1IM4A 1HHTP 4R25A 3ILLA 1FJGJ 2HLUA 2RU9A 3UE2A 3SEOA 4OI4A 2DNOA 2XYHB 2H51B 1PAEX 4YP3A 1TL3A 5KFRA 3B6BA 2VG5A 2J9DA 1JLEB 1WEZA 4JI7J 2CQ4A 2BJ1A 5L46A 2YNHB 3NAHA 5CCLA 2FVQA 1F60B 3NWGA 2IDEA 2X7IA 1DZ5A 3KXDA 3D1QA 4IFVB 1X4AA 3DU6A 4NZ6A 1FF2A 4DV2F 2U1AA 1VQ4S 5KFKA 3DCAA 4EZ6A 1AB8A 4IKAA 2V4JA 2V9KA 2XO7A 3BYRA 4DV4F 1VC0A 4KO0B 4R0EA 1EQ0A 1EHWA 2ASJA 1I94J 3GFYA 2R3VA 3HVTA 4GKKF 3EGVA 1VRUA 4G6VB 4ANEA 4UUWA 2JFKA 2QMWA 1SC3B 1HR0F 4LT6A 3DXBA 4LRFA 3W9IA 1LW0B 3CCTA 1T11A 1HQUA 4X65F 1TKZB 8RUCA 2CNNB 4DUTA 1UEKA 3R6LB 4U8YA 2HPUA 3GV5B 2QE5A 3DOKA 3QFWA 2C42A 3QIPA 3PKYA 1TKXA 1R8PA 2HWTA 1TZ0A 4E0DA 1O5JA 4CLKA 4NI2A 1K47A 3R9LA 5E3RA 1VDHA 2MB0B 1IBKJ 2DGVA 2KO1A 4ED4A 4OHVA 1S1XB 1JJCB 4M5DA 2HK3A 4P73A 2R7QA 1W26A 5J2QA 2DGUA 3CJKA 3OTOJ 3AJ1A 1KQSR 4IDKA 1UETA 4DPXA 1LXJA 2KFNA 3KOAA 3MR7A 3DGPA 1FO1A 5I3PA 1SL2A 4DV1F 2KFZA 3GSIA 4ZPVR 3TYTA 3G6XA 1U02A 5A8KB 2QA4G 5EX0A 5L1JA 2N7CA 2K2PA 4NLVA 3BO3A 1WC6A 1X9SA 2XEXA 1IR1A 2RUSA 4DUZJ 2KZZA 4K59A 5D77A 4F02A 5GAEI 3Q22A 2W2PP 2VQFJ 3K8WA 3NWRA 3QMQA 2R7RA 5K14A 2AJ4A 2EFQA 4ZVSB 4W4MA 4DG1A 2FVCA 4ZHRA 2HVDA 5L9XA 3UCGA 1QAYA 3TZZA 1IQTA 2DR6A 1NEEA 4ANDA 2FTRA 1OQ6A 2VPWB 3KLGA 2BV3A 4ECQA 5GAHI 3TA1A 1NJXA 1QUVA 2VDIA 3VGVA 1HNIA 4X4UA 3MMJA 2AYBA 3VQSA 5HMWA 4QR2A 2D7SA 3QWPA 1TAUA 5A8RA 5FJ4A 1XTZA 3QJPA 2YQ3A 4A46A 4CLPA 2YY3A 1U45A 3NBPB 4H4KA 1HFEL 4IH7A 4PG7A 3MM9B 2M8DB 3QATA 1M5PC 4DFPA 4RW4A 1URNA 1U24A 2PD1A 3MPVA 3FKBA 2PFFB 4GC6A 5KFLA 1NK0A 1M5VC 3ADAC 2QIFA 2D3ZA 3BQ0A 3W62A 3G96A 4NLPA 5EN1A 3FQKA 4KFBA 1YRUA 2GIRA 2D3UA 3QJLA 5KFPA 3BN7A 4I0WA 4AYBD 3MUVP 3C15A 5KG0A 4B9LA 4UOHA 2X1AA 4YB5A 5RUBA 3W2VA 2QV6A 2NYIA 1U7LA 2CQDA 3IN5A 2IBKA 4DV0F 5MLCV 3BJYA 4LQ3A 2WVCA 1KHWA 2DNKA 4C2MA 2BQUA 3UN5A 3DRRB 1Y10A 4ELTA 1MWYA 1CJTB 4AT1B 2ZH8A 2KVIA 3J80Y 2V34A 3SSSA 2UV8G 3THTA 5I3UB 3QJJA 4JV5J 1GT8A 4J9PA 4DQSA 4DL4A 2ZM6F 2B4PA 4EU0A 1VJQA 1RWKB 3Q24A 1WKKA 5ETMA 5EHHA 2HYIB 3I4HX 4NA2A 1J5EF 2IMOA 2LQ5A 3D1OA 1FNOA 5DRKA 1ITPA 3A8JA 4OI1A 1JLFA 4I6AA 3KLEA 4DR2F 4FS2A 4TU7A 2KZMA 4B3SF 4F7VA 2FVSA 3OL9A 2I5JB 2Z2ZA 3SCLE 3US5A 1NDCA 1QSLA 4ID8A 4ES3A 1KKHA 2Q6CA 4J9VA 3WX4A 2CWKA 2EK6A 3SDEA 3KLIB 5J1EB 1LXNA 2DO0A 3TZYA 2MLZA 2QG9B 1CULA 3ZZRA 3QSYB 2HFZA 4WE1B 1FKAF 2MQPA 1LK5A 2PT0A 2V8DA 1VRTB 4LFCJ 1K73T 3M8SA 2EBEA 3AD7C 3BDPA 2XYPB 2HS0A 5KG2A 2CPZA 2W24A 4C4WA 1ZAXA 2IM2A 1WKLA 3HULA 3MPWA 4R0JA 2HHTA 4ZITA 2Z2MA 1Y7PA 4URSA 2G4BA 2FHMA 1QE1A 2NXCA 3UR0A 3TAQA 1HQ2A 5HANA 2HVZA 1D9DA 1GXUA 3J81U 1F9EB 1RTDB 2OH2A 1T03A 3QT6A 2B4UA 1Y0HA 2NQPA 5HQ8A 2IC3B 1OWXA 3DLBA 3W5XA 2XHWA 2JEFA 3R5CA 1WC4A 3GIIA 2HWHA 2UXCF 2AGPA 4FNIA 4ZPTR 2CPFA 3QGHA 5C2GA 4OHXA 2FJWA 2E7VA 1F5BA 4DQRA 4J9RA 5D4LA 4DLEA 1SQEA 3CJ3A 4OX9F 5IXUA 1VQLS 5CZVA 3MM8B 3O5TB 2QN6B 2FQQB 2COLA 3HXMA 2DNRA 2VDHA 2D3OR 3TVZA 3OSNA 4QPXA 4LF5J 4XDCA 2UUAJ 3D68A 4B3MJ 1Q82T 2HBRB 2VFTA 3OVAA 3H42A 1Z1ZA 2DXEA 1W25A 2WB4A 1N33F 5AE1A 2RHQB 3HD2A 5JVHQ 2DKOB 4KGXB 3UWTA 2EBGA 3HHDA 1NK5A 5C42B 4M5KA 4OIXA 5ETQA 3HLUA 2CJYB 2VG6B 3L9ZA 5MAOA 4DL3A 2DVIA 4PXCA 2DNNA 3HHLA 4GC7A 3VAIA 3TAMB 5IT9U 4TYBA 2MZTA 2FVRA 3WBZA 5D0EA 2ZE2B 2V9WA 1PSDA 2Y0BB 4PYAA 1T9VA 2AP6A 4ZCIA 3VAJA 4QIGA 2Z4PA 2GQ2A 2PC6A 2VBXA 1NK9A 4DR6J 3IO1A 1Q53A 1NB2A 3FMBA 1NCLA 1FVSA 3I5CA 4ER8A 1XN9A 2MGZB 1L5UA 4J9MA 4OZJA 2LXFA 2AJ1A 3KG4A 2W7AA 2QFIA 4DSLA 1H38A 4A4JA 3Q86A 2J6TA 4ZJLA 2ZOMA 2HHXA 3BDEA 3S7RA 1MMNA 1GEHA 5A0YA 5IV3A 4YR2A 2N4CA 3ENQA 3N28A 3U1LA 3GP9A 3ZNUA 1W2BR 3D28A 1IBCB 3DLGA 2C2OB 4DFJA 1VCTA 5HVHA 1E6VB 3TQ1A 2CZ9A 3CJ5A 2ZFHA 1LEOA 2IM0A 2LEBA 4DQQA 4JI3F 3NRBA 1CS4B 4DV6F 3CDUA 2IM1A 2YWGA 3CJ0A 1ULRA 2XZWA 4C48A 5BR8J 5T7LA 3CCMS 1KLNA 3UW1A 4ECXA 4YR0A 3MUMP 4TN2A 1UWAA 3IFEA 4NEYA 4ILRA 3KFWX 3W5ZA 5IC6B 3D5MA 4B08A 3MR6A 2VKRA 1VC5A 4WFYA 2A1BA 1HBMB 4NLWA 2LEAA 2LKZA 2VBWA 3W8PA 4W90B 5IFMA 3BV8A 1T02A 4HEA9 2XM3A 3ZZOA 2YX1A 3RTVA 4C8OA 3TANA 3FZBA 3RRKA 1FDNA 4KTQA 2MQMA 3ZZTA 2XBPA 1RXOB 3ET6B 4EUVA 4C11B 2ROGA 3QIDA 1M5OC 1YTYA 3HF5A 1TL1B 4CI0B 3QT5A 3DM2B 1N52B 1FT8A 1RU1A 3PG9A 4O3RA 1ELOA 4Y3CA 3I56S 2XB2D 2BRKA 3K7RA 3BGRB 3RRGA 7AT1B 4MIWA 4K4UA 2BXJA 1T9UA 2BBEA 4M1KA 2BJEA 2HVIA 4ED7A 3MTJA 3T6BA 3PR5B 2DPJA 1T94A 4JV0A 2VPZB 1U1OA 4UOCA 3C6TB 2YWHA 4IRCA 3IM9A 5KFDA 2WW8A 2XSFA 1WSRA 3UR3C 1PBAA 2KHDA 1ZH5A 3MXHP 4GVBB 2J5AA 5CYMA 4EYHB 3IG1B 3MPDA 2AU0A 2Z2YB 4UQTA 1XNRF 2V8PA 2FY8A 5HBMB 2GGPB 2GQCA 3KG1A 4RZRA 4DEZA 4FBUA 1TKDA 2FZCB 1PKUA 4ECWA 1U1NA 4DFMA 1WF1A 1HWKA 2OGUA 4J9LA 3M2RB 1LFWA 2YKMB 4K4WA 3SYZA 4N76A 3FNNA 2HGNA 5JXSA 5GMDA 3EGZA 2VA3A 2CG8A 1RAJA 2E9RX 2UVWA 2HIYA 4NE9C 2KU7A 1AROP 5KT2A 3WHIA 3PIPQ 1N4LA 4IO9Q 3IBCB 1KN6A 5C25A 4O44A 2RB7A 4BWMA 5IS2A 2GJFA 2HFSA 3N4WA 2V4JB 4DR5F 4JI1F 4YMEA 5GAGI 1N5TA 1CJUA 1SKSA 2DNPA 3ZTPA 1L3VA 3VAMA 4PG5A 4N8OA 3TW0A 1IKWA 2KHCA 1FK9B 4OHWA 3MR3A 2HQGA 2VFUA 2LU1A 1VRUB 4O4GA 3BSAA 3OTBA 2EC2A 5KFWA 2B51A 3OTEA 2J8SA 4I6YA 4AFFA 1X4GA 5DLGA 2PI4A 1HQUB 3OR1A 1TUWA 2J0QD 5HI7A 2QMUB 4KAIA 2NYHA 4OHYA 4ZN3A 2ROEA 3R7BB 4X64J 2IVMA 3EZ5A 2XI2A 2UUCF 1FD8A 4K0KJ 2AGOA 2Y0SD 3JQKA 3DOKB 1OMSA 2LECA 1GMWD 3QIPB 2ZH5A 3AD8C 4L75A 5F9LA 2N3OA 2JEIA 3QLHB 4Y2AA 1VOMA 3AFGA 2XY5A 2W01A 3G82A 4IRKA 4NI2B 2C2EA 2M2BA 4J90A 4WKRA 4WP3A 4C3LA 1RTJA 3TP2A 3IMQJ 4L76A 5CD4A 4QJVA 2HHVA 4QWCA 4YQWA 4NPOA 4YS2A 5DQIA 4M5DB 4C8YA 5KFYA 2ZNYA 5J2QB 3PR4A 2XLIA 1RE1B 3CJKB 2C2NA 5LL6d 2DHSA 1HD1A 2ZITA 2O66A 3M8YA 3V4IA 3GTYX 1HNZF 3QZ7A 3SQOP 2XS2A 3R8YA 1X7VA 3DGPB 3DRPA 4YFUA 2UXBJ 3TAPA 1F9HA 4FN5A 4Z37A 2VODA 1YHQS 3LGMA 2F7VA 1AA1B 3KJFB 4RUHA 1DBDA 4J7CA 2MXYA 1UEVA 3NGTA 3NKYA 3OHAA 4AQYF 3H0PA 2K3KA 3NY0A 4KV8A 1NNDA 4DR7J 1H2VZ 4F4WA 4ELUA 3PO4A 1AXQA 2XMKA 2J9CA 4DG1B 1RT2A 2AEJA 3IC1A 1ZBTA 1N36J 2ZZTA 4USIA 4I56A 5KFFA 5CA5A 3KLGB 1GMVA 4LBIA 1Q8LA 2G13A 2F3JA 2JC0A 4LSZB 4QCLA 3KJVA 1HNIB 2IIHA 2UXDF 3FMWA 3PW4A 4MAKA 2RS2A 5A8RB 3HJFA 2VU5A 1RBAA 5L1KA 2OPQA 1WSVA 2B56A 2GO9A 3SFGA 4PUOA 3DHXA 3KG0A 2WVBA 3C16A 4RW4B 2LQ8A 4KHPF 5LXYA 1S10A 5EWEA 1EJ7L 4I7FA 2EKYA 1U6FA 4KFBB 2HRUA 4KYZA 3NGSA 1TV6A 1UCNA 1W7WA 4URQU 2J76E 2W4PA 3CDWA 3H8YA 4DV3F 2C3UA 4DFKA 4LF7F 1CLFA 3C15B 2G2ZA 4PG4A 2AIRB 4YDXA 3W2VB 1R6YA 4LRDA 1RAOA 4RJVA 1FXLA 5E3QA 3PW2A 1X5OA 5T14A 5KOWA 2OMOA 3OV7A 3CCQS 3M9OB 1EZZB 4ECRA 3MPYA 4PG8A 2APOA 2V63A 1NK4A 4TYAA 3Q8VA 3UQSA 2B6AB 4RWWA 1YITS 4DN0A 1MMDA 4RPFA 2C2DA 1SL1A 4WP8A 3SV4A 3CULA 1VQOS 4ANCA 3FQLA 1LOUA 2R4FA 2MZRA 4URGA 1YIJS 3OFEA 3H90A 2HZAA 3S1TA 3MAHA 2HGLA 3VAKA 2UUBJ 3TZWA 3SCJE 2UU9F 2P9EA 1RAEB 3SV3A 1FRIA 3PJWA 3CD6S 1HNXJ 1BD6A 3I96A 2MKCA 1R3NA 3CCZA 4FPIA 5K9FA 1JLFB 3RB6A 4JI8F 3KLEB 3H40A 3S01A 2CQIA 2W4DA 1IKXA 1F9FA 2ZBIA 5D8HB 4OLPA 3RU0A 2DGWA 4RW9A 2YWEA 2RDDA 1ACMB 4YOEA 1YWXA 4ED3A 3KDOA 2JVOA 2ATCB 1KC8T 3GQCA 4DLGA 3RZAA 3D1HA 4PPDA 2ZWPA 4F50A 3BSCA 2CPEA 2WZ1A 3SSQA 2BANA 1SUQA 4X4PA 1FJ7A 4M5IA 5HJYA 2ADCA 4BC7A 4TY8A 2VONA 1UW9A 1QVGR 2OPSA 1S72S 2JOQA 2V0NA 2FZKB 2B9YA 5IOLA 3IRWP 1ZETA 2AEFA 2K06A 4LSNA 2DNQA 2ZVSA 2DRBA 2W9BA 3RBZA 1QE1B 3BPSP 2QSWA 2OD4A 4IYQA 2W1BA 4ED1A 2RKIB 3FSIA 2WONA 3MECA 2QLBB 3AXKA 4X4NA 4JI2F 1KLMA 3PX4A 3V2UC 2LA4A 2P6TA 1T03B 3R5DA 3DFEA 2MLYA 3W5YA 2HRYA 3HI9A 1RWWB 3T5HA 1M1HA 2AGQA 5J1NA 4B3TJ 4PKDB 3LUYA 1HBUA 1FNMA 2VJUA 3MM7A 1RACB 3C14A 1FWLA 4IH5A 4ZCMA 3RR7A 1RB0A 5KFQA 3LP1A 3DMJA 3CT9A 4P9SA 2AV5A 4R8UA 2E7WA 2OTLS 1FERA 1RT1A 4FF4A 3MOJB 2HFVA 4DPTA 3BKUA 1G3OA 4JI5F 3UCUP 2CPDA 4Q43A 2IPOB 4FPRA 3JAMU 4C3MA 4IG0A 3CCUS 2M4MA 2J9EA 2DEJA 2HQCA 4N5SA 1NSKL 2MKIA 5H1SV 1PYSB 2VFRA 1RAGB 2HVEA 4CH0S 1P27B 4DV2J 1YLXA 1E6YB 2HBQB 4HTJA 1REVA 2QLXA 4Q2LA 2BJ8A 2XHCA 3CO9A 4FVCA 2QMXA 3HHEA 2CZVC 1U1PA 4Y2KA 4GKKJ 2EVZA 1UJ4A 2F8HA 4PWDB 1SC4B 4DF8A 2DGSA 4CLWA 1HR0J 2MHEA 2RHSB 3Q8PB 3CJ2A 3FEZA 4JV2A 3N79A 4X65J 3C6UA 3NCRA 2R8GA 3PV8A 4P2SA 1MG7A 5L39A 1BGXT 4NASA 4JUZA 3N9UC 3CUNA 3L7OA 3BBBA 1B0PA 3EWGA 3HVWA 1HMVA 3LAMA 1GAOA 2KN4A 1WHXA 3RW7A 3Q0AA 4MK8A 2GJIA 2FHJD 2HQFA 3G71S 2XS7A 1NJWA 3J7YI 2KRRA 1UA0A 4LREA 1IR0A 4KGVB 1QDUB 4TLRA 5A0YB 3HJVA 1TK5A 4RX6A 4USUA 1AT1B 3FUYA 3HSZA 3GG1A 1S1TA 3DLGB 4B9VA 1IM6A 1HLWA 4DX8H 1VQMS 1NPPA 2CFXA 4QYZJ 1VBXA 4G65A 2AX0A 4Y34A 4YHHF 1AFIA 4FYDA 1UTAA 1T9WA 3RBDA 5IZHA 4USJC 3CIZA 1K44A 3G8QA 5LMUF 2GMHA 4CLLA 3PTWA 4LR7A 4ZCLA 1VRQC 1BE4A 2E1RA 3F56A 5T7LB 2C22A 1ZAVA 5CYQB 2PMHA 1S1VA 4OI6A 2WVFA 4UT4A 1TL7A 4KH0B 1YGYA 4NWBA 3CJ4A 4UTGA 2Z8QA 3JS9A 1T8EA 2KM8B 3TOQA 3H25A 4JI0F 2JH3A 2DCLA 3CJSA 5LSRA 3O3LA 1XMOF 4MFBA 2H54B 1VIXA 3MF5A 2DHXA 4EBEA 3TZXA 2RILA 2A6MA 5M2UA 4L6V3 2FPHX 3MMCB 1RP5A 3RB4A 1H3DA 4NLUA 5L1LA 1MNEA 2P6SA 2CWXA 1RJJA 4ZN1A 1S6OA 3M2UA 2WTFA 4HTIA 3S6EA 3ZXWA 2ZBQA 3PVXA 3A3OB 2D1CA 1LWCB 4A47A 1RHQB 4P7VA 4G3IA 3V6DA 2XC9A 3OJSA 3K2YA 3M30A 2QFJA 5D6GA 2YKNA 1RWVB 3IR5B 4HT5A 3LW5C 5E3CA 3QAUA 3GIKA 2GNKA 3MGJA 1R27B 4FYXB 2PEBA 2GIQA 4WZQA 3RUBL 1U4BA 2C2MB 4MMOA 4WZMA 4DL5A 2W8KA 3P45B 1SB6A 1RBLA 6AT1B 3EM1A 5BYSA 1NK7A 2YX7A 3KYLA 1VIOA 2NREA 3JTPA 3DLKA 3TVYA 4RNNA 1H0HB 1N54B 3VAGA 1NU4A 1RAFB 3ZTQA 3IGVA 1TMJA 1SH2A 3OD2A 1EETA 2P2CB 2YNGA 4ZJQA 3TARA 4KIAA 5A6PA 1BXNA 1HW9A 4WBFA 2OAUA 1DARA 3RB0A 3D0IE 2P9CA 1NO8A 5CYMB 4P2XA 4O3OA 2ERRA 3DNCA 2FLNA 4OZ2A 3TWZA 2FC8A 2AF6A 3OXGA 1IVZA 4HI1A 4DV0J 2JVRA 4OYXA 3LALA 3MEGA 3HSGA 2G2OA 2AYEA 4M5NA 3EMTA 4H4KC 3UI3A 1GQEA 4RNHA 4FKYA 3FEXB 1NSQA 2RNEA 1U48A 4N56A 2CQ0A 3AY0A 1N32F 1I3OB 5L38A 4CIOA 4Y2IA 2DITA 2ZM6J 3D3BJ 5HLFA 3T6JA 3B8HA 4A8QA 4LF4F 4J5OA 4A8SA 1BLUA 3AOBA 4L3NA 2LEPA 1WG1A 1HI1A 2V4QA 2MZJA 2GMLA 3MEDA 4CTAA 3Q8QB 1J5EJ 4W92B 2CJXB 2E9TA 5C25B 3QO9A 5KG6A 4O44B 2E5GA 2VIHA 3DOLA 1M1GA 4ZJOA 3RGIA 4QPTA 4B3SJ 1TKTA 1CJUB 2V5HG 4AE5A 2HS3A 3IR6B 3VZIA 2R2UA 1IJEB 3QRQA 3CW2C 4K5RA 1IKWB 2GS8A 1FRHA 1H98A 2UV8A 2NLWA 1CSJA 2J0XA 5SUHA 3CC7S 1GTEA 4O4GB 1U49A 3CCWA 1OY6A 2IAJB 3H59A 3VALA 3DLJA 3GFHA 1XJWB 3J7AN 1X8DA 3OR1B 4NLXA 2FGOA 2AW0A 2QGFB 4K2JA 1YJWS 3QYYA 3MEEA 2B9WA 3HHNB 3FFIB 4HHHA 2GA7A 3K59A 1SV5A 2J9DE 1HYSA 3EXCX 1FRJA 4AXJA 2HURA 1I51B 5CD4H 1FDDA 1A9NB 1XC9A 2J7WA 2OLWA 4HKQA 2XMUA 3CD7A 3NCQA 5CXTA 1ZM3A 3MFIA 4HH0A 2FJVA 3WX8A 4ED8A 3KUHA 3D54A 1C2PA 4ID5A 1BQNA 1RTJB 2CNLB 3OL8A 1N56A 5I42B 1UL3A 1R0AB 2MZSA 2E1CA 4DI6A 5B0CA 2VJVA 1KONA 3SBMA 1NKEA 2UXCJ 1XERA 3K17A 3NGKA 2CPXA 1RHKB 4NLTA 4RBUA 4CP5A 4U6PA 2VH7A 1N5VA 2CKWA 2QA2A 3AXMA 2BJ7A 4ZVEA 3U02A 1FRMA 2ALYB 5F8MA 2UVUA 3V4IB 3TVKA 3NGRA 3CDAA 4JI4J 4OJGA 1RISA 3M2VA 3H2UB 3DRPB 1RWUA 3V6HA 1U26A 4OX9J 4RW7A 1JLAB 5GMKa 2VASA 5AXNA 4EI2A 1HIYA 4OL8A 2NPFA 1QTNB 2YNIA 3RB3A 4KRWA 4KJIA 4ECZA 1FRLA 3AB2B 4M5JA 2B7CB 1JXLA 2D3O1 1RABB 5THWA 2AMCB 1MROB 3DC2A 2FJEB 3NNCA 4KV8B 1T0TV 4LJMA 2XMMA 4UY85 2WVEA 2M70A 1DRZA 4AL5A 2B7BB 1A7GE 1SJ3P 4TQRA 1CQMA 1RT2B 4NRTA 1IKYA 1VQSA 1S49A 5L9NA 2OSRA 1U6ZA 2I8EA 3OFFA 3MI7X 5B0AA 3A1YG 3ENVA 1R8BA 5E3PA 4TXSA 1WNEA 4PPZA 4EK2A 2R7OA 2QYCA 3OXLA 3QGGA 3CDBA 3KJVB 3GMGA 4EEYA 2VZ9A 2OMLA 4FF2A 1KBRA 4NRUA 4DPYA 3KNAA 4W98A 4MH8A 2OPQB 4QW9A 4PUOB 2PMZD 3POTA 1YDLA 3C16B 5IQ6A 3T5LA 4WP9A 2ZZMA 3W7BA 3PM9A 2HFUA 1IR2A 3QFHA 3BYPA 3DHWC 4USVA 5K20B 4I7FB 2PIIA 1P6TA 1NDPA 2BYCA 4R5PA 1G7CB 1MW7A 2WVDA 3HHLC 1B4SA 1APSA 1JLQA 3G86A 3J81Y 3J81j 1XR7A 4F4ZA 1VYAA 4PRFA 1N48A 1M1KT 2W7PA 4CYUA 2J0SD 2XMTA 2Y1IA 1X0FA 1F5AA 1QAJA 1VQPS 2VF3A 4JI3J 2GHWA 2MHNA 4RUCA 1YJVA 2Q3PA 1BMQB 2OI2A 3HM9A 4DV6J 1JXEA 2FUG9 3D6HB 2Y3YA 4DR3J 2HHUA 3B4MA 1EIYB 1VQ9S 2H48B 1S7IA 3GR0A 5A76A 3GE9A 3ILJA 1SQFA 3KLHA 2Z57B 3THVA 4IG3A 3EE3A 4WTYA 1KOHA 4Q5VA 1N6QA 2BQRA 4U9RA 4DR1F 1M90T 1ZTTA 1MMLA 4I69A 2GAGC 2UVRA 3H5SA 1Y9OA 4LF8F 2BOPA 3I4PA 4EWTA 5H9FK 3UN2A 2I6WA 2H4YB 1U47A 4CT9A 2DEIA 2RQCA 3HFZB 3OLAA 2LVWA 2IMWP 1FXDA 5IM0A 1N5QA 3HK2A 2F40A 1IKXB 5KFZA 2Q6BA 4USTA 2W7OA 5F8HA 3IRXB 4KT0C 2CNKB 3LPEA 5IT9Y 1NBEB 2Y9HA 1NHVA 4NLOA 1DQAA 2A6OA 2WSEC 1OY9A 5H9EK 2NUHA 2V8HA 2KYXA 4LFBJ 2G1DA 3UDEA 1WDTA 2RS8A 1SUQB 5ADZA 2QLFB 3IBFB 1RAIB 5KFEA 2KM8C 4D3GA 2DPIA 3OFHA 3G8SA 1M5SA 2AKWB 4TY8B 2MJNA 1B7YB 1KFDA 3H5YA 3TQEA 2UP1A 2RF2A 1SQGA 2OPSB 1JB0C 1AZSA 4LIWA 3KLFA 2OUGA 5KOXA 4LSNB 2W9BB 2OFGX 5CCMA 1J5OB 2PA8D 1RBOB 2XCPA 1ZAWA 4YY3F 3AD9C 4KHRA 2WONB 4PXDA 2GX8A 1QD1A 1FJCA 1TUVA 3FBBA 4DX5A 3G9CA 4DCOB 2JL9A 3K89A 4WPAA 1R6VA 1KP6A 4P72A 2V6AA 5DM6Q 2KT2A 3MM7B 4RU9A 2QSFA 3C14B 2VFSA 1KOOA 4MIBA 1PJ6A 4DWIA 1O0PA 4JYAF 3LP1B 2EWHA 4Q7AA 2WK4A 2MQNA 4R8UB 4O3NA 5KT5A 2Z58B 4F4AA 1RT1B 3CF5Q 3VGUA 3CMES 2EKNA 4XIUA 2HZCA 4HHJA 4AXIA 4DQIA 4JI6F 3VHQA 2MKHA 4IG0B 4WFZA 1W2IA 4M95A 3W1YC 2HEKA 3LANA 1SIZA 1RYSA 2IY5B 3OXFA 2J8AA 1YZ7A 2ZKTA 3BSNA 5J2MA 2ZD1A 3EPIA 4KBIA 4GRSA 3M9NB 3D9BA 4MKBA 2VPYB 1NHKL 3HCXA 3MOZA 5E5NA 1REVB 4DR5J 5C24B 4JI1J 2HHQA 3C8YA 1VMBA 1HD0A 4P7TA 1DJ0A 2RAQA 3KHRA 1YSJA 4IOCQ 1WG4A 3PYGA 3D3CJ 3N0VA 4LFAF 3BKFA 1U2CA 2O67A 4DCPB 4ED0A 3FGVA 4Y6IA 1IKVA 3C6UB 4F0MA 2CQHA 2CVEA 5CZXA 3TR5A 2GQQA 2VL1A 2NXNA 2UUCJ 1OS5A 4KHMA 2CJ9A 2QO3A 1J27A 4K4VA 3AA9A 2WAQD 5B09A 2XS5A 1Q86T 3ICLA 3P96A 3TJ8A 1K9MT 5IWAF 2K7JA 3KK2A 1F3FA 3PDNA 4DOZA 2Q79A 2E1MC 4ZIVA 3R5BA 1HNWJ 2HBYB 1DAXA 1S1TB 4QWAA 3GWCA 2FYXA 4MYTA 3KHHA 3V4MA 2K3IA 1MN7A 3MAQA 3PO5A 4V19J 1Q8KA 5GADU 5B0DA 3M6WA 1XIQA 2SXLA 4KB7A 4DCJB 1XQIA 2G0CA 2AJ2A 1O51A 4LF5F 1JLEA 1KQGB 3K5MA 3Q2SC 1LW2A 3BO2A 2YNHA 3KK3B 1WHVA 3GZ7A 4CLZA 5A2QY 2DRDA 4I4BA 4N8NA 3MWBA 1HNZJ 3DOMA 4HHUA 1S1VB 4IFVA 2V94A 3R3TA 4AD6A 1S6UA 1TL7B 1HWIA 2OEKA 3F73A 2DR9A 4ES1A 3M1VB 4QR1A 5ETLA 2R9LA 1LNQA 3PYEA 3DYAB 2OSQA 3IGNA 1HWUA 3KJQB 5LSLA 4J37A 2XY6A 4MFBB 4AQYJ 2QC3A 3TNVA 2B3TB 3IAS9 4NLSA 3C46A 3ISNC 3BS9A 1LW0A 1U0HA 3JQMA 4MKAA 3B4DA 4K4ZA 3M2UB 2F1FA 3C3LA 5FIIA 4U7CA 3U27A 3W8GA 1LWEA 1CJKA 2E7XA 2DNGA 4BBYA 3UVJA 5D4NA 2O01C 1L3KA 4DSKA 2D9PA 4OMFG 5FD1A 3V6DB 3RG6A 3BZQA 3M30B 4P2FA 4ZOSA 1S5ZA 2B43A 2UXDJ 5I3QA 1RADB 4OYOA 2X1FA 3EJMA 3HT0A 1N34F 3HHKA 4JBCA 4QWDA 1NK8A 1V3SA 1IBMJ 1KRPA 4WYLA 1GK8A 3MM6B 3PKMA 3DLEB 3PHEA 3W9JA 4KHPJ 4RL1A 1SPBP 2H1YA 2F4VF 3DLKB 3GU0A 2NXUA 4LIRA 1Z2LA 3Q8YA 1VI7A 5E33A 4RNMA 2LCWA 4D3HA 4FBTA 2YPYA 1CC7A 2CQGA 4ZVUB 2LDIA 4DV3J 3AOCA 4FYWB 4XK8C 4LF7J 5KFIA 1U2RA 5CQGA 2RRAA 3WC0A 4KY3A 4QIVA 2CQPA 4ECVA 1AUDA 5A8KA 4OX8A 4M5HA 3VVTA 2ZBRA 3KMQA 2W2QP 4Z7YA 4KGKA 1P1LA 3GV8B 3GFXA 1P9YA 3BEGB 3MAAA 4TQSA 1X4EA 3CB4A 2CJAA 1YQHA 1S48A 4LQ9A 2AJFE 1SH3A 2FLPA 3M4XA 1Q5YA 2J7KA 3GCXP 4Z2XA 1QSSA 5HLFB 1UZHA 4K2XA 2HFNA 3V6KA 3NNAA 1TL4A 4MTPA 1UZDA 2JHEA 1HI8A 4CTAB 4DUYJ 3MFHA 4DU7A 2HNZA 3H98A 1C1BA 1KEKA 3W2WB 1S76D 4RR5A 3T1AA 2Y8YA 3QO9B 2MKYA 2FJXA 2XCAA 1SKRA 5DGAA 5D0RA 2XZTB 4JI8J 3DOLB 1JJHA 2R8IA 3H2VE 3P3DA 2DHGA 3PHTA 2FJAB 1TKTB 2KYZA 3EZUA 4NZ7A 1JX4A 4A8FA 3NS6A 2IBOA 5IQQA 3I0SB 2HZVA 1KVIA 2XSJA 1GXTA 3PXGa 1X5SA 5B08A 5J2PB 2JEGA 4KPYA 3LP0A 4DSEA 3GIJA 2ABYA 1I5OB 2VOOA 3OPKA 2ILZA 4DL7A 3OUYA 3MEEB 1KQFB 3CJQA 2I0XA 2OPPB 4ATNA 3M8ZA 3WDOA 3A3NB 1Q7LB 4OZ3A 5F8LA 1TR0A 4XAKA 1SV5B 1PIEA 1HYSB 2GJ2A 4NOHA 5J2NA 3R2CJ 4B9SA 4WU3A 4USWA 2HNDA 4ZLLA 4P75A 3RYLA 5AE2A 2LQBA 5ETTA 2CZ4A 2W9AA 1VQ7S 4QWBA 2UZAA 3P5TL 3LOUA 2KVQE 4IQMA 2DR8A 1ZPWX 3GIMA 2CQBA 3ULHA 2XULA 2PFDA 1ROFA 2ZUGA 1CJTA 4DF4A 3DN9A 4JI2J 4ID5B 5HMZA 1BQNB 3IA0A 3MM5A 2JFDA 3BH6B 1FRXA 4NCGA 2QYGA 1P9QC 3K5NA 4P74A 2DIVA 5HP1B 2BOAA 2L3MA 2Y8WA 3EGNA 5FLXU 1XWLA 3AQPA 1HQEA 1D9FA 3CO0P 3ETOA 4QQBA 3M2VB 3TUPA 2GV1A 2VBZA 4TKTA 1EB0A 5DZ7A 2ZH3A 4RW7B 4Q8FA 4U8VA 4JI5J 4MYUA 2V69A 2M5YA 2DR7A 2I9SA 1Y3KA 1DQ8A 2YNIB 3WIVA 3ZZZA 2K1RA 2DTJA 1C1CA 1NJYA 2PSZA 3HHLD 2YXLA 3L95X 2DH8A 4WYWA 2HNYB 1NJZA 1EKSA 5HMXA 4RLEA 3PYFA 4A8WA 1HWLA 5KFHA 1S0MA 1IKYB 1NSAA 5HJXA 3UNYA 3WIUA 1T05B 3PX0A 4X64F 2XGQA 1RUSA 2X1GA 2HVHA 3BSOA 1RT7A 3NP5A 1AW0A 3CIMA 2DYAA 4WFBQ 2C2KB 1Q81T 3AAWB 1UFWA 2BA9A 4YUDA 1C0UA 4CLSA 1RCXB 4G1QB 1AFJA 1UVJA 1D8ZA 3QNWB 4QBUA 4ZDNA 3EX7B 4ZVPB 2DNYA 1QVFR 4NCAA 4PG6A 2MQLA 2ZKUA 2ZJPQ 3POTB 4NXNF 2ZH2A 3P8BB 4TU8A 2IC3A 4IR9A 4X4SA 1RT3A 4P6QA 2Z30B 2BEFA 4TLQA 4R5PB 3E51A 4ECSA 1WI8A 9RUBA 1JLQB 5A8WA 2UXBF 4H54A 3EPGA 5JVGQ 3MM8A 2E29A 3IXQA 3KK1A 4UQGA 3SCKE 2BJ9A 4YHHJ 2O5DA 1VJWA 4C0BA 5KG5A 1F3VA 2C3MA 1V6HA 2AYMA 3NNHA 5LMUJ 3ONQA 4HDGA 3L4BC 2XMWA 2BUNA 4XO0A 2F9DA 1M0SA 3M32A 1HBOB 3IWXA 2GAHC 1OIAA 2H5IB 3BH7B 4OJ3A 3D2WA 2IVFB 4IG3B 2DGTA 1U0SA 1TFYA 1DTTA 3NGUA 3JAMY 1FTRA 3TAMA 2FGCA 2FVPA 5A6WA 3UO0A 4JI0J 3KWMA 3M8RA 3SQGA 4LVOP 2GFFA 1Q8BA 3NCPA 3I6PA 3QT7A 5ITHA 5F3ZA 3MCOA 1NH8A 2WRMA 3DDNA 5KFNA 1I1GA 2WSFC 1O6XA 1VBYA 1HHSA 3IM8A 2MGZA 1TTHB 2HAFA 1FFSB 2MZQA 3HFVA 2BE9B 5IT0A 1TVRA 2HSEB 2ASDA 3H2LA 2HS4A 3FJ2A 2F5GA 3ZZYA 1RHJB 5F8GA 2M88A 1OPIA 2XQCA 1XNQF 3N6MA 4BC9A 3TUZC 3LP2A 3DRSA 5GAHU 4ZKAA 1K1QA 4EYIB 3D6FB 1E6VA 1REGX 4OYIA 5HSPA 1M5KC 3OR2A 1AZSB 2G1HA 3GR1A 1YK9A 3KLFB 1FFWB 3CMQA 4XDDA 1SBRA 2HHSA 1WC3A 4QIEA 4ZS6A 3NEKA 1I6JA 4X2BA 2R7SA 3ENAA 4ETXA 2O3DA 2DGXA 1JLBA 4F2RA 2W2NP 2NUUG 1S77D 3V81A 3G6ES 3KUEA 3ITHB 1ZZNA 2JEJA 2IM3A 2E9ZA 5ETOA 2HHHF 2RQKA 2RDIA 4NYZA 3D7SB 1NPKA 2GVDA 4OYBA 4KGMA 4K5SA 2F4FA 2MMYA 1MU2A 1PYTA 3M9MB 3HVAA 2MYFA 3PYDA 1FWKA 4GKJF 3GLJA 5HMYA 5KFJA 2PN6A 2OO4A 1MLAA 2YX4A 3GG0A 4IO1A 2CRLA 1JK9B 3A8KA 1HBMA 1VFJA 2AHOB 1RWOB 1B3TA 2IRYA 1WELA 5LXRA 1N32J 4CNZA 4LF9J 1VQ6S 3ZZUA 4O3QA 3FSYA 5AT1B 3HO1A 1OYDA 4K7QA 4LF4J 2X1BA 3DDKA 2KL8A 1EP4B 2ZDPA 1GXLA 2HLTA 3FVYA 4EGLA 1RDRA 3KUGA 5J2MB 2ZD1B 1HPZA 2GZOA 2L9DA 2R7WA 4QR0A 4ZVOB 3MMAA 1RT4A 4DMZA 1GMUA 2DXFA 3M6VA 2L9WA 3BGRA 2D41A 1NKBA 1UVKA 4DL2A 2VOPA 5AXLA 2JDJA 4K4XA 4AL6A 2ACYA 4DZ6A 3W65A 2HQ3A 2KG1A 1VC6A 2E5JA 4HACB 3J7ZT 4J9QA 1S9EA 4N47A 3EZOA 4I2QA 1UVMA 1Q1KA 1F5CA 4YN3B 3W63A 2D69A 1FEHA 2DO4A 2BVZA 1IKVB 1KTVA 1ZM9A 3MTKA 3C6TA 2J7UA 1TL3B 1UMJA 2H3EB 4BLGA 2ZWOA 2HQDA 5D15A 1ZPVA 2VG5B 3HKWA 4FVMA 2R2RA 4WK1A 1QAXA 1WEYA 4G1IA 1UWBA 4XPEA 3MEKA 2CG4A 3ISND 3UCZP 1U8SA 3P5BP 1VBKA 5G0RA 2CQCA 1OY8A 2DGQA 1YRXA 3KK2B 2ACMA 3S8SA 3HSDA 3M2RA 4GO7X 1J2VA 2HKEA 2X3DA 2XMJA 4WU2A 4A48A 3R27A 4RBVA 1S9GA 6FD1A 3K8VA 1D9AA 4DR4F 2RRBA 2Q66A 3HVTB 2AZ1A 2Q1LA 2XLKA 4OZ5A 4OHZA 4YB7A 2AT1B 3BR8A 1BHNA 4LF6F 2F8EX 1LW2B 2XWYA 2LQ9A 5LOQA 3TUIC 3G87A 1R31A 2BE7D 5KFSA 3G6YA 3DOMB 2YH1A 1X60A 1GX5A 2P5VA 4FDFA 1X4FA 5DJBA 1TMMA 4K8RA 5E3AA 2C3PA
chains in the Genus database with same CATH topology
1L3TA 5D4LA 2MQQA 4RW7A 1JLAB 5GMKa 2VASA 3DU5A 4DLEA 5AXNA 3H20A 1U1RA 1SQEA 3CJ3A 1S4FA 4OX9F 2EFNA 5IXUA 1VQLS 4OL8A 1TKXB 3M8PA 1WTBA 5CZVA 2NPFA 3MM8B 2YNIA 3RB3A 3O5TB 4KRWA 1FK9A 3H5XA 4KJIA 1V3ZA 4ECZA 1FRLA 1WF2A 3AB2B 1YI2S 2B7CB 2COLA 3IBWA 4U7UK 3HXMA 2R7UA 2DNRA 4E98A 1JXLA 2KDOA 4WF9Q 2D3OR 3TVZA 5THWA 1IN0A 3OSNA 1YJNS 4QPXA 1MROB 3UNGC 3MD3A 3RRHA 4NLRA 3DC2A 2FJEB 4YDDB 4C8LA 4XDCA 5CH7B 1UJ6A 3NNCA 2E1AA 4KV8B 3NS5A 4C8ZA 1Q82T 2JLFA 2DK2A 4LJMA 1D0EA 2XMMA 2VFTA 3OVAA 2W8LA 2KTQA 1BQMB 4A8MP 1Z1ZA 4UY85 1VQ8S 2M70A 1DRZA 4AL5A 3TO8A 2B7BB 4FF1A 2UUAF 1OSCA 4B3MF 1W25A 2WB4A 1N33F 2HIQA 1A7GE 5AE1A 1SJ3P 4TQRA 1LWFB 1FKOB 1TP7A 2BQ3A 1CQMA 5JVHQ 1RT2B 4NRTA 3UWTA 1IKYA 2EBGA 1VQSA 1VHFA 1S49A 3HHDA 1DTQB 1LWEB 4X66F 2FIUA 5F0UA 1NK5A 4OX6A 5C42B 5L9NA 3SCIE 4OIXA 2OSRA 4DN9A 2DCUB 3SZ2A 2YKPA 1U6ZA 1Q79A 2I8EA 3OFFA 4KR0B 3MURP 3MI7X 3NGDA 4PQUA 3CWJA 3HLUA 5B0AA 3MHYA 4OV1A 1KHVA 4WFXA 4ZP7A 3A1YG 3ENVA 2VG6B 1DFDA 5MAOA 4Q2MA 1L3UA 1R8BA 5E3PA 4TXSA 1FESA 4DL3A 3KKFA 4IDKB 5DLFA 2DVIA 1LKZA 1WNEA 3HMJG 4PPZA 4PXCA 2R7OA 4OQJA 2DNNA 4EBCA 3HHLA 4GC7A 3QLHA 3VAIA 2OP5A 2QYCA 3TAMB 3OXLA 3QGGA 4TYBA 2FY1A 1FDAA 1HBNA 2MZTA 3CDBA 2FVRA 3KJVB 3GMGA 3WBZA 5HN0A 1VK8A 2JSXA 4ZPWR 2ZE2B 4EEYA 1X4CA 1PSDA 4DV5F 2V9WA 2VZ9A 3M8QA 4KO0A 2OMLA 4FF2A 4ILMA 4ED6A 1R89A 4NRUA 3KNAA 1D1UA 2AP6A 2DRAA 2QRRA 4F8RA 2IA6A 1RT5A 3LQVA 4MH8A 3E2EA 2B9XA 4ZCIA 4F2SA 3VAJA 2OPQB 4QIGA 2BM1A 1RA7A 2Z4PA 1BC6A 2GQ2A 1HA1A 4B3RF 2MY7A 2VC1A 4QW9A 3KK3A 2W25A 4PUOB 4KSEB 2PC6A 2PMZD 2F8MA 3POTA 2VBXA 1NK9A 1XR5A 5IQ6A 3IO1A 3T5LA 5E41A 1Q53A 2DISA 2ZZMA 1OQ3A 2OFHX 3FMBA 4RW6A 5F0WA 5K14B 2PDAA 3W7BA 1FVSA 3I5CA 1TKZA 5HL7Q 4ED5A 1DQ9A 2CQ1A 3PM9A 5KG3A 1XN9A 2DH9A 2MGZB 1YVFA 1L5UA 4J9MA 4DR6F 3H4BA 3DHWC 5D4OA 4OZJA 1Y5IB 2LXFA 2KT5A 4I7FB 2PIIA 4ZHRB 3KMSA 3LAKA 1P6TA 2AJ1A 2LXUA 2BYCA 1U1QA 3KG4A 2W7AA 2HMIA 1RTIB 3EGWB 3CDEA 4R5PA 1G7CB 1ZOTA 1H38A 4DSLA 1MW7A 3M1VA 4H4MA 4LVNP 4A4JA 1K8AT 3HHLC 2LXIA 2XNRA 2YTCA 2J6TA 3DYAA 4UW2A 2ZOMA 1APSA 4I1TA 1JLQA 4B3OB 2HHXA 1T3OA 2HFOA 3BDEA 3G86A 3J81Y 3OTCA 2HQIA 3S7RA 1MMNA 2XY7A 4YB6A 1XR7A 4Y00A 2A2DA 1VLYA 5A0YA 1ZM2A 2LA6A 4F4ZA 4PRFA 2IA0A 4YR2A 1N48A 1R8HA 1M1KT 2GHPA 2N4CA 3ENQA 2W7PA 3N28A 1SH0A 3U1LA 2YKNB 3SI8A 1W2BR 2J0SD 2XMTA 2Y1IA 1X0FA 4BS2A 1FCAA 1V9OA 3QGIA 4O23A 3D28A 4CO3A 1NAQA 1F5AA 4F67A 3DLGA 2B5JA 4DFJA 3FDSA 4C8KA 1QAJA 1VQPS 1E6VB 1WD6A 1YRTA 2D9OA 3VZHA 2CPYA 2GHWA 2LYVA 3KHLA 1UW4A 1JWWA 3TQ1A 1KSPA 2JC1A 5KFBA 2MHNA 4RUCA 1YJVA 5KT4A 2Q3PA 3CJ5A 3NLCA 3HM9A 3OQ2A 1JXEA 2FUG9 2ZFHA 5DS7A 3OL7A 4CO4A 2IM0A 2LEBA 4DQQA 2HHUA 4JI3F 3B4MA 1XR6A 1Z4UA 1VQ9S 2RVJA 4QOTA 2KH9A 3AHPA 3NRBA 4DV6F 3MMBA 3GR0A 1S1XA 3CDUA 4HLBA 2IM1A 2YWGA 3CJ0A 3GE9A 2RMLA 1ULRA 3KLHA 1RKJA 2XZWA 1IBLF 2FHJA 5K8PA 4FXDA 5T7LA 2BE2A 3CCMS 3LGNA 3THVA 1KLNA 3UW1A 3K58A 2KXNB 4IG3A 4ECXA 4KE5A 4WTYA 4YR0A 1KOHA 4Q5VA 1QY7A 5BR8F 1XMBA 1YJRA 2M7SA 1NB7A 1EETB 1N6QA 2YNGB 5B0BA 1S0VA 3K0JA 2L08A 2BQRA 3MUMP 4TN2A 2B0GA 4U9RA 3ZZ0A 4X62F 4K4TA 4DR1F 1CVJA 1M90T 1ZTTA 3IFEA 1MMLA 4I69A 4JOUA 1Q7YT 3VAFA 2HNZB 2UVRA 3JSYA 1C1BB 3H5SA 1Y9OA 2VG7A 3I32A 2K7KA 4ILRA 2BOPA 2H9ZA 4LF8F 1HI0P 3MR5A 3I4PA 5KG4A 4EWTA 2IVYA 4WIIA 4O3PA 2C3YA 3PRBA 3HP6A 2PGCA 4X84A 2O1PA 2HGMA 1TAQA 3KFWX 1GH8A 3D5MA 1U47A 4EFAC 1X0PA 2IHR1 3C66A 4B08A 1C0TA 4CT9A 1N0VC 2RE1A 2AD9A 3PY8A 3MEGB 2RQCA 3OLAA 2LVWA 3MM6A 2IMWP 1FXDA 2VKRA 5IM0A 3MR6A 1N5QA 1P8GA 4YEAA 2R7XA 3DLEA 3HK2A 2F40A 1CPZA 1VC5A 4WFYA 1IKXB 1IJFB 1IQZA 2YVSA 5KFZA 2XNQA 2DD8S 1TFWA 1WACA 2Q6BA 2A1BA 4RNFA 1HBMB 4NLWA 2W7OA 2LEAA 1U6BA 2LKZA 4MK7A 2VBWA 5F8HA 3IRXB 4W90B 2CVIA 5IFMA 2AX1A 4KT0C 1T02A 5IT9Y 2BDPA 4HEA9 2M0GB 1NHVA 4NLOA 2QZ8A 1DQAA 2XSJB 2WSEC 3ZZOA 2KB2A 2YX1A 4TU9A 5EWGA 4KKOB 3R1HA 1R7IA 1VQYA 3RTVA 1SL0A 2NUHA 4WK3A 4C8MA 4C8OA 3LP0B 1S1UB 5G4DA 1YJTA 3TANA 4IR1A 2MDAA 3NL0A 3FZBA 4IFYB 1WG5A 1FDNA 2V8HA 3RRKA 2KYXA 4ETZA 4WFAQ 2G1DA 4KTQA 2YNFA 2MQMA 1UEUA 2RS8A 4LMZA 3ZZTA 1SUQB 2XBPA 5ADZA 3OUYB 3VR1A 4EUVA 4C11B 2ROGA 5HO4A 3QIDA 3SXLA 4BCAA 2WBRA 5KFEA 3K57A 1M5OC 1DHMA 5DDPC 2VPXB 1YTYA 2KM8C 3HF5A 1TL1B 1RTHB 4D3GA 3TI0A 4CI0B 2KKHA 3MEDB 3DM2B 2DPIA 1N52B 3OFHA 1FT8A 3G8SA 1M5SA 4O3RA 1ELOA 4TY8B 2MJNA 4Y3CA 2RD5C 3TUJC 1KFDA 1LQ9A 1DLOA 4LSLA 3H5YA 2UP1A 3PW5A 2RF2A 5J2NB 3I56S 2XB2D 1FNXH 3CC2S 2OPSB 1S79A 2BRKA 1JB0C 2IYIA 3BM7A 2HNDB 2WCXA 1TK0A 3K7RA 3BGRB 3RRGA 4ECYA 4LIWA 4MIWA 3KLFA 3PX6A 5KOXA 3NBPA 4K4UA 4LSNB 2BXJA 2KT3A 1VQNS 2W9BB 2OFGX 5CCMA 1FKPB 2BBEA 3GB0A 3JSMA 1J5OB 2PA8D 1WI6A 4M1KA 2BJEA 1UVIA 2B6AA 3MM9A 2XCPA 2C28A 3MUTP