3G8YA

Crystal structure of a putative hydrolase (bvu_4111) from bacteroides vulgatus atcc 8482 at 1.90 a resolution
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
391
structure length
391
Chain Sequence
GYQPEKHAVVKSDRGDGRLLSTYAIVHEMLKDTHPQYAYRSGMSAQEFTQWQDGVRAAMVEIMKFPEIKRQPSPVCVKTEKKEGYILEKWEFYPFPKSVSTFLVLKPEHLKGAVPGVLCIPGSGRTKEGLVGEPGICDKLTEDYNNPKVSMALNMVKEGYVAVAVDNAAAGEASDLECYDKGWNYDYDVVSRFLLELGWSWLGYTSYLDMQVLNWMKAQSYIRKDRIVISGFSLGTEPMMVLGVLDKDIYAFVYNDFLCQTQERAVVMTKPDKENRRPFPNSIRHLIPGYWRYFNFPDVVASLAPRPIIFTEGGLDRDFRLVQSAYAASGKPENAEFHHYPKFADKAVRKDVEHLDEGLDSKTYFEAVNVDPPSHYFKNELVIPWLRKVLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of SusD/RagB-associated esterase-like protein (YP_001301335.1) from Bacteroides vulgatus ATCC 8482 at 1.90 A resolution
rcsb
source organism Bacteroides vulgatus atcc 8482
molecule tags Hydrolase
molecule keywords SusD/RagB-associated esterase-like protein
total genus 124
structure length 391
sequence length 391
ec nomenclature
pdb deposition date 2009-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12715 Abhydrolase_7 Abhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3g8yA00
2VT7A 4UHCA 5EHNA 1XRQA 4AO8A 1YS1X 1FJ2A 3G8YA 5JZSA 4QDTA 1VOTA 1FFAA 2PL5A 1IZ8A 1ZOIA 4OU4A 4G1FA 5FPQA 4ZGBA 3AIKA 2WILA 5SYNA 4NS4A 2RONA 5A71A 2OPHA 1U65A 1R50A 4CI9A 1XZMA 3H2KA 2C0PA 3C5WP 2VQ6A 4U2GA 1AKNA 3AZOA 4Q1VA 3A6ZA 4E11A 4OB8A 1RYYA 4G4GA 1GKKA 2I03A 4Y2PA 1QZ3A 4JYPA 3UUFA 1GXSA 4LXGA 3F98A 3G9ZA 3O9VA 3G7NA 4WY5A 1TRHA 1WB6A 4ZWNA 1MJ5A 2WSLA 2XI4A 5KREA 4L72A 2CJPA 4ZV9A 4B81A 4BC1A 4KE6A 4AX4A 4C87A 4MQMA 4FLFA 3B12A 1JJIA 2VJBA 5DYWA 1DT5A 1O6FA 3HI4A 4UPDA 2K2QB 5E4JA 4M0MA 1QIFA 2WIDA 1QIKA 1CUHA 2E3JA 5CT8A 3WL7A 5JALA 4QLAA 3IA2A 2GBCA 3M83A 1AUOA 1E3QA 1GZ7A 1W6RA 3C45A 1HPLA 1XQXA 1WOMA 3FWHA 3VJLA 3BL8A 3W04A 2C5GA 1DQYA 3DKKA 4Q3KA 1CFJA 2WIFA 1K6EA 1BS9A 2W22A 3IB3A 3F96A 3LS2A 5JAUA 2XLBA 1SCIA 5HK9A 5I8PA 3AIOA 3PUHA 2H1IA 1TKRA 2PSEA 1CLEA 4DGQA 3STVA 4YX9A 3WKAA 2ROQA 2HRQA 4N5IX 1LPPA 1SCQA 3D2AA 5IVDA 5K3EA 5ALKA 3G0GA 2VSQA 4BE9A 1H2WA 3NUZA 3ED1A 4KE8A 5DLPA 1LGYA 1W4LA 4B80A 1WB4A 2EDAA 3H1BA 3V9AA 4WFIA 1ZJ5A 1BEEA 4CCYA 3FOBA 2YYSA 1AMNA 3HJUA 4HXFB 3WKCA 3TRDA 1Q83A 1L7RA 3FLAA 5A62A 5FP0A 1AGYA 3ZV7A 4UBJA 2XUFA 3W2TA 3JW8A 3C8HA 3SC2A 3WZLA 1DINA 4MYDA 5E2IA 3PFCA 3K9BA 4PO3X 1EVEA 3DEAA 3YASA 4BZZA 5HF8A 1IZ7A 3H2IA 5A7FA 3VXKA 1P0MA 2QXTA 1IVYA 3WYDA 1DWOA 1LZKA 1JMKC 4HXEB 4AN0A 5IKXA 1FSSA 1BE0A 3WQHA 3LP5A 3I6YA 4PSUA 4YPVA 1VE6A 5LZ8A 3MUOA 3L1JA 3EQ8A 4U2BA 3STXA 3PF9A 5JANA 1EX9A 1ZI6A 1O6GA 2BUAA 2DQYA 3LCRA 3RLIA 2WG1A 2O7VA 3C43A 4WY8A 4X6UA 4QDOA 4TVKA 3ZI7A 3FSGA 4EUSA 3E4DA 4EY7A 2HDWA 2HIHA 5HQ3A 3H2GA 1X70A 2ZJ7A 3I2IA 3O95A 2JIDA 1GPLA 3FYUA 5FKJA 4B84A 4CG2A 3TGLA 2W6CX 4WCVA 3QMMA 4M0FA 4DMCA 4JUIA 1XZFA 3ILSA 3I28A 3VVLA 4EY6A 4J0IA 2WJ4A 5A2GA 3TJMA 3CXUA 1FFDA 3FBWA 2WFZA 3HABA 3QMVA 3WL6A 2XUKA 4UHDA 2AJCA 2DHCA 2OCLA 1L7QA 1YA4A 3KSRA 2HRRA 5AOCA 3AFIA 4J03A 2PSDA 1XKLA 4FTWA 1LPSA 2XLCA 1ZD3A 5AKGA 4BAGA 3U0VA 3V1NA 2BGNA 1CEXA 3WL8A 4FKBA 4AO7A 1VXRA 1THTA 3DS8A 3R41A 1GPKA 4LXIA 1XZGA 4RE5A 4X6YA 5AK6A 5ALVA 1USWA 2GBIA 3QPAA 3O9MA 5DTJA 3F67A 5ALFA 4JNCA 1IMJA 2ZJFA 3NOXA 4C4XA 4ZREA 3WLAA 2CKMA 2LIPA 1MO2A 1JJBA 4G5XA 5AO9A 4H7FA 3HSSA 5LZ4A 3HEAA 3O4IA 4KACA 5CMLA 5AK5A 2YXPX 4B6GA 4J0GA 5LZ7A 1K5PA 5EIEA 2Y2UA 3WWCA 3WA6A 4AMYA 4XVCA 2IIVA 3G0BA 5AIAA 1CQZA 1ZGCA 3AZPA 4BVLA 3DOHA 4ZRDA 4KYVA 5AJHA 5AM3A 1CUBA 3GA7A 5LZ5A 5CURA 2J3QA 5FOQA 2ONCA 4JYMA 1NX9A 4WDQA 2JBWA 4UBIA 1LZLA 1P0PA 1WPXA 1X2BA 4BCDA 2QR5A 4EHBA 5EIHA 4N8SA 3CN9A 2XMGA 3IUQA 4BATA 4Y2TA 2OQIA 4UFOA 3BIWA 2DFPA 1BU8A 4FFVA 2XQKA 3Q0TA 4U2CA 2DHEA 1F6WA 1MAAA 3G9TA 4A23A 3HZOA 2BAGA 4PV7A 5JZ9A 2B61A 4UBOA 3MUNA 1Q84A 1R3DA 5AI4A 1CUIA 3I1YA 5AKIA 4QWWA 3FCXA 1BCSA 2ZSHA 5CH3A 4PF1A 1E66A 2WUEA 5JD5A 5AM1A 3PF8A 4RPCA 5T4BA 3IIIA 1R9NA 4MJ3A 2WHPA 3P2MA 5DNVA 3WK7A 5EGNA 2J4FA 4ETWA 3PFBA 5T4HA 4B9AA 4FBLA 3O4GA 5FDFA 1EB9A 4V2IA 1KU6A 1JU3A 3A70A 4HS9A 1AQLA 2DQZA 5ALYA 5AI5A 4W63A 2XUIA 2WUFA 5AKKA 1TK3A 4G4JA 2GYVA 4PNZA 1IUNA 2XMSA 2VTVA 5LZ9A 3VDXA 1ODSA 3A2LA 1AURA 5EHZA 3M81A 1HL7A 1N8SA 1UOOA 2RIPA 5K3AA 1EH5A 5FLKA 2XMZA 3N2ZB 1UKCA 4HVTA 4MEAA 2PU7A 3BJMA 4U2FA 1W1IA 5AI9A 2X8BA 4IH9A 3QZUA 2PU5A 1QIMA 2AJ8A 5AM4A 4B83A 2Z3ZA 3G0IA 4B85A 4BVJA 2VJAA 3UUEA 5AKZA 2HA6A 1R4ZA 4CCWA 3V48A 4DMKA 2C4HA 2XQGA 2JGJA 1EVQA 5AKYA 4DM7A 3HC7A 3PDCA 4KE9A 4L0CA 4GEGA 2H7YA 4FWBA 4GECA 4B0OA 3K6KA 3BDVA 4F0JA 3VVMA 4IH4A 3AIMA 1SC9A 1H2ZA 5KWIA 2PSJA 1GT6A 4K5QA 3KOOA 2ZJ6A 1DQZA 3H2JA 2XE4A 4PSDA 3QPCA 3ZLUA 3LIPA 2QRUA 1DX4A 1LBTA 3VJMA 5JZBA 1XZDA 4UHEA 4HXGA 2WG2A 4JH0A 5AK4A 2G5TA 5HFAA 5A7GA 3IVMA 5JATA 1QO9A 5ALUA 2XUDA 2GYWA 2WLSA 2P8SA 1XLUA 3TEJA 2CUTA 4TPKA 4B82A 4KRXA 3C70A 5AKLA 4Y2VA 4GBGA 4GWLA 1F0PA 4I19A 3FCYA 4BAUA 2HL6A 4XJVA 4KAAA 2V97A 5ESRA 5LKRA 1XRPA 2FUKA 3I6ZA 3PI6A 3K2IA 5CT4A 5D3ZA 4WJLA 3S2ZA 5JAPA 5A7HA 2Q0XA 5LKAA 2QJRA 1XZLA 3VKFA 3ZLVA 5LZ2A 2HFJA 1VA5A 5FRDA 1J06A 2VT6A 4QZVA 4ITVA 1XRLA 5K3FA 4AZ3A 3BXPA 1XLWA 4XIIA 2HHAA 2WHQA 5SYMA 6YASA 1B41A 3WIBA 1TAHA 4XX1A 1RP1A 4PW0A 4RGYA 2B9VA 2WU3A 1WB5A 3STTA 3ZPXA 4ZV7A 3PUIA 2D0DA 3EBLA 2WQZA 1NU8A 2PUJA 5HF5A 3GBSA 3DKRA 3SK0A 1ZIXA 3H18A 3WJ2A 2QOEA 2GZSA 3FLBA 4RE6A 4AZ0A 4G8DA 5EHQA 1G42A 3C6XA 4BP9A 1TIBA 3N0TA 5ISMA 4H7JA 3R3VA 4CG1A 2WFLB 4LXHA 4DNFA 2QVBA 3ESBA 4BYMA 2CMFA 3G02A 3FVTA 4W1SA 4LHEA 4X95A 1XZKA 2H9YA 3C5VA 1JFRA 5JIBA 1JU4A 3M3DA 1VXOA 4FOLA 5K3FB 4MEBA 1CUCA 3D59A 4H7EA 4NZZA 5LLSA 2B20A 3STWA 4DSZA 2R11A 5CT5A 2G5PA 5ALIA 3AILA 1EINA 5ALXA 5C8VA 1XZEA 2OCIA 3NWOA 1UK7A 2ZVDA 1KU0A 3IBTA 1EHYA 5C8XA 2D5LA 3ICWA 2HA5A 1Y37A 3U1TA 1A7UA 2VEOA 4FFWA 4DNPA 4QNNA 5ALRA 2PKYX 4HRXA 1UZAA 3DLTA 3O4JA 4Y2JA 4DYHA 4UBLA 4C4ZA 4EBBA 1WCYA 4OU5A 1XZAA 1EDBA 4OCZA 1TCCA 3C6BA 1JI3A 3QBJA 1EA5A 2VF2A 3D4LA 5ALPA 5JAOA 2R8BA 2XDWA 1HBJA 5E4YA 1FFEA 4OSEA 4BVKA 1XLVA 2WFMA 1TCBA 2ZSIA 1CUWA 4FMPA 4QLOA 3OOSA 4QEKA 4DTCA 5K3CA 4F21A 4O08A 2QTBA 2V96A 1BRTA 3BIXA 4L3WA 3EF3A 5IVKA 2PVSA 5ALJA 1QE3A 3HLKA 2PSFA 1Y7IA 2XUPA 4BB0A 2HFKA 5IVHA 3C8DA 3IUJA 1UOQA 3UMJA 3R3XA 3STUA 2VA9A 2XT0A 1JMYA 1YA8A 1FFCA 1QIDA 5JADA 4Q34A 3C6YA 3HYSA 5CTAA 5CXXA 5LP1A 2XMBA 4MWSA 4KAFA 4X3CA 2X76A 1K8QA 4MQLA 5D6OA 2WUGA 1BN6A 2Z3WA 2Z8ZA 2JGFA 2Z8XA 1R88A 4RNCA 1RWQA 2X5XA 3ANTA 1XKTA 1C4XA 4BDTA 3DOIA 4EY4A 1U8EA 4UFNA 3D3NA 4N5HX 2OG1A 1VA4A 1EB8A 5ALDA 3WK5A 4W1RA 3B3QA 2DR0A 4FNGA 5ALSA 3M82A 2Y1KA 4AN1A 1XRNA 2Y6VA 5CT6A 1M33A 4A5SA 3Q8WA 4Q05A 3FSGD 2WIJA 4IHAA 4Y2SA 1MX1A 3QVMA 4C4YA 2B4KA 1YS2X 3RKSA 1J07A 2WTMA 2QUBA 1XROA 4ZXFA 3WMRA 3V1KA 1U2EA 1H23A 4W1PA 3WWEA 3DJYA 1A8SA 5A6VA 4BCCA 1W76A 5YASA 3WKEA 1ZGBA 3RARA 1MU0A 1E8MA 1GQSA 4D9JA 1S8OA 2QZPA 1LBSA 3D0KA 1HQDA 1OXMA 5JYCA 3DYVA 1QFMA 4OYYA 3KWFA 4ARBA 5LYYA 4GI1A 4AO6A 4H77A 2XQJA 4M0EA 4OD0A 4YK7A 3DD5A 3GELA 1QIIA 3EQ9A 4E14A 4UHBA 2JGIA 1JT2A 4GHWA 1QLWA 1AC5A 5DJ5A 5EI5A 4HAIA 2BFNA 5AH0A 4BBZA 5I9IA 3ANSA 4CIBA 2JF0A 3WL5A 5T4FA 1GKLA 3QITA 4B0PA 4QDZA 4J7AA 4BC0A 2C7BA 4QA9A 3G0CA 1CR6A 2PM8A 4Y2UA 4EB0A 1JJFA 3I2JA 3EIOA 1EK1A 3WKDA 1MTZA 1T2NA 4PSCA 5ALGA 3E3AA 2G4LA 4ARAA 5JD4A 4BTLA 1B6GA 2PPLA 2XUAA 3W06A 3AINA 1CUSA 4BZWA 1QONA 2JEZA 4GLBA 5FUMA 5HKBA 1CUAA 5K3BA 1QGED 2CBGA 4GW3A 4EZIA 5AM5A 2OCKA 2VJCA 3DL7A 1BN7A 4GXNA 5BOVA 2O7RA 4IH1A 3I6MA 7YASA 5EIAA 2AJLI 2XMRA 3C6ZA 5CBKA 1G5FA 4OB7A 4B7ZA 5ALLA 2AXEA 5C7YA 1Z68A 2OXEA 2WJ6A 4KRYA 4AXBA 1XZJA 4G9GA 5LIPA 4UBNA 4X00A 4INZA 1N5RA 4Y9SA 1ZI8A 4HRYA 1QIEA 2PX6A 5C8ZA 4C01A 4X6XA 5AK3A 2OCGA 1XQWA 4UBMA 3VISA 1C7IA 1MN6A 4DMFA 4J0KA 1BEZA 5CH8A 3CCBA 4X85A 1F0NA 3PICA 4OYLA 3LIIA 3AJAA 2UZ0A 5AM0A 4X97A 4QDUA 4TGLA 1UKBA 2GYUA 4S0XA 5EFZA 2C5FA 4H7KA 2QJWA 3WIOA 3WWDA 3ESCA 4FBMA 2WFLA 1HLGA 2J4CA 3FYTA 2WU4A 3H0CA 1ZJ4A 2QS9A 4EY5A 3GZJA 1H22A 1AX9A 3T4UA 1WHTA 1SFRA 1MX9A 4X94A 3RM3A 2YH2A 1A8UA 4W1QA 2VAXA 3G0DA 3RK4A 1E5TA 2JGLA 3I2GA 5AKXA 3QM1A 3WK9A 4K2AA 5AI8A 1XZHA 4KEAA 2WHRA 1CUZA 1K63A 5HQ3B 4DLNA 5D3KA 4G9EA 4J3JA 3BE8A 2G63A 4G8BA 1QTRA 1EK2A 4X91A 1N1MA 5JARA 4I4CA 1ZD2P 3WZMA 2HADA 2WIKA 2J3DA 3HXKA 1U4NA 5HZGA 5DTIA 4LIPD 1OILA 3B5EA 1OCEA 2VAVA 5HK8A 2JGEA 1J2EA 2Z5GA 1Q0ZA 1UXOA 4OB6A 1FFBA 3GROA 1WHSA 3E1GA 1Y7HA 4F5ZA 1VE7A 2C58A 4P92A 2ZYHA 1P0QA 5AIBA 5EHXA 2WTNA 1IUPA 4Y2XA 2OGZA 2JEYA 4X90A 2WKWA 4F60A 2V98A 2PSHA 4J0JA 2DHDA 1ZD4A 4LKOA 1UT6A 2XQIA 4H7DA 5ALMA 3T52A 2I3ZA 1K4YA 2AJBA 3A2NA 5F4ZA 1CUDA 1YASA 5AOBA 2CEKA 3F8SA 2PUHA 2XMCA 4K6KA 1CVLA 2O2HA 1UWCA 1AZWA 4Q3OA 5BWBA 1ZD5A 4MYSA 5H3HA 1UK8A 4KR0A 3AZQA 3H17A 5DWDA 4IQ4A 3WA7A 1ZIYA 4QE3A 3BDIA 2EDCA 1CUXA 5CT9A 2I78A 3SX4A 3GUUA 3V1MA 1MAHA 1CPYA 4EA6A 1KEZA 1GPNA 1ACLA 5JD6A 4P93A 1IUOA 3IURA 3C87A 4K6HA 4X71A 4WFKA 3V1LA 5DYTA 3QYJA 2CB9A 2CZQA 2BUCA 1BROA 4I3FA 1CUYA 1C7JA 3WK4A 4CIAA 5D7BA 4EY8A 2H7CA 4FHZA 1CRLA 1L7AA 2HA3A 1A8QA 3IULA 4B9EA 5ALZA 4FLMA 1R1DA 3WYNA 1CUUA 3KD2A 3DL4A 3DQZA 4Y2YA 2QM0A 1QO7A 1LPOA 1H2YA 3IUMA 3O4HA 4C89A 1XZBA 4BRZA 1PJAA 1YSCA 2VATA 5HFNA 3ICVA 1YAHA 5DYYA 2WHPB 5BWCA 1BCRA 2FJ0A 5AKHA 5ALHA 1QTIA 1DTEA 3OPMA 2GBFA 2WIGA 4Y2QA 2OGSA 4DNQA 4AMZA 3R3YA 4FDMA 5HCUA 3HRHA 4QWMA 3NGMA 5CRIA 3F9CA 4H7IA 1E8NA 3R3WA 3BF7A 1LPNA 3CCCA 5IH7A 4P9NA 2BCEA 1MNAA 1F8UA 3KWJA 3H19A 1J1IA 3DCNA 4H35A 3HACA 2IX9A 5CXUA 5JASA 5KBYA 1XZIA 1ISPA 4HTAA 4YASA 4BDSA 3FNBA 3I2HA 5ALQA 5DNUA 1MPXA 5IVIA 4UFPA 5ALTA 3ZLTA 1QIJA 1LNSA 3WWPA 5HKAA 4H18A 1QOZA 4KE7A 1QIGA 3D2BA 1CQWA 2JGKA 4G8CA 3JWEA 4Y2RA 4BAZA 3WK8A 2WM2A 3FVRA 3O0DA 3G9XA 4E15A 1DX6A 2XMQA 1UK6A 1Q0RA 3W05A 5AOAA 3IDAA 5ALNA 4AB1A 1UKAA 5I7UA 2HA4A 3I1IA 3ZWQA 1MX5A 3EQ7A 5CH5A 3VJKA 1SOMA 4K6GA 1XQVA 1HDEA 1XZCA 2QUAA 4U2DA 3STYA 4DNOA 2XMDA 2OQVA 3KXPA 1UOPA 3X3HA 4QDXA 1DWQA 1ODCA 4IO0A 3E0XA 2AJDA 2WUDA 1CUEA 1WM1A 1GGVA 5J3JA 4H7HA 5AP9A 3BJRA 4WFJA 1N5MA 3H2HA 2O2GA 5AKJA 1I6WA 3FYUB 3WKBA 4NVRA 1EDDA 1XRRA 4A16A 2RHTA 1ORVA 4UHHA 3OG9A 5K3DA 4KJXA 2XUOA 2WG0A 1DU4A 1YB7A 2YASA 1R9MA 4BE4A 3CN7A 2XUJA 1EXWA 1ACJA 2HU7A 3JYHA 1QIHA 5C81A 1ZICA 2RHWA 1ZI9A 2HA2A 3OTQA 3MVEA 5AKEA 1QJ4A 3AUKA 3MGAA 4UBKA 3OM8A 2BJHA 2ORYA 4BTVA 3LLCA 1YCDA 2RI6A 1SCKA 3R40A 2HA0A 1EI9A 4BRSA 2OAEA 1GQRA 4Q82A 3L1IA 1MT3A 1CUGA 2ECFA 2Y6UA 2RAUA 5HF6A 4PQEA 4X7BA 2XUQA 5T4EA 3SWWA 3OURA 1LLFA 5E4TA 4AQDA 1E89A 1T4MA 4Q3LA 2HU8A 5AI0A 5BV7A 3ESAA 3QPDA 4FNMA 4J0CA 2HA7A 2H7XA 4GDMA 1DWPA 1THGA 5ALEA 1MNQA 1PFQA 4JEIA 2ACEA 4CG3A 3FYUC 3OC0A 1W75A 4L9AA 4C6HA 2QMQA 4ZI5A 4G4IA 4BCBA 4HZGA 2BKLA 1A88A 3WJ1A 2EEPA 5K5EA 2ES4A 1G66A 2O2IA 5HF9A 1VJ5A 1VLQA 1TCAA 2HM7A 5JAHA 3W9UA 4CCYB 3KDAA 4FLEA 4C88A 4OUKX 1JKMA 2XUGA 4BP8A 1VZ2A 3D2CA 1CIJA 3R3ZA 2ACKA 2GBGA 4ROTA 3FAKA 4LYDA 1CUFA 2QXUA 4DMHA 4Y7DA 2ZYIA 3G9UA 2I3DA 1EDEA 4CFSA 1QFSA 3D5EA 2NW6A 4X92A 3DYIA 2OLEA 2BGRA 4UHFA 3S8YA 4J0DA 4UUQA 2JGMA 1XQYA 3I2KA 3D7RA 1WPRA 4W9RA 1CUVA 3WWOA 5AI6A 4H0CA 5AM2A 4NMWA 5CW2A 2QKYA 2OAGA 4WDRA 1TQHA 4DIUA 2RGUA 4N8DA 2GZRA 1HKHA 1YB6A 2ZYSA 3ESDA 5AICA 4X93A 4LYEA 1PV1A 4XWGA 4KAJA 1LPBB 2FX5A 2IITA 2FJPA 3DNMA 1ETHA 1ODTC 3L1HA 3QH4A 4OPMA 1UFOA 1YR2A 2V9ZA 3R3UA 3BF8A 1LPAB 5DNWA 4MXDA 2Y2VA 4J0HA 1LPMA 1D07A 2XB6A 1W52X 4MWTA 2QT9A 5ALOA 1DT3A 1ORWA 1X2EA 1UK9A 3A2MA 1H2XA 2PBLA 1E8DA 3WK6A 3BWXA 3W9BA 3FLEA 1CV2A 2DSNA 4N8EA 2HU5A 5FXMA 3F97A 4E46A 1NU6A 3WI7A 3IUNA 5AHXA 5FPPA 4Z49A 2OGTA 5KWJA 2ZYRA 2XUHA 3QMWA 1XFDA 3H04A 3R0VA 3DDUA 3PE6A 1VKHA 4DSAA 3I2FA 2WJ3A 2VJDA 1VZ3A 2DCMA 1P0IA 1YAJA 4U2EA 4P08A 1CUJA 5ALWA 1XRMA 2XQFA 2C0QA 1G4HA 3GFFA 2BUBA 5FV4A 3H1AA
chains in the Genus database with same CATH superfamily
3OQHA 1POWA 2VT7A 3QLVA 1G20A 1TYAE 3A6GA 1Y5MA 2B82A 5EHNA 2ZRMA 2ZI7A 4QXMA 2H2GA 4U6QA 2XR1A 4PLPA 4UEJA 1Z4PX 1S8FA 3OF3A 5IUKC 4MUMA 1E1CA 4OMFG 3T0IA 5C1DA 1R0XA 3HN6A 4QDTA 4R2MA 4FCWA 5D86A 4EHKA 1SB8A 4UDXX 4JLAA 1XYGA 2BI8A 5CM9C 1VDMA 2OTCA 4OU4A 1EX6A 2R97A 1X1EA 2NV0A 2BHRA 3EYAA 3H4IA 2VAPA 2UVPB 5I7EA 5FPQA 5DNCA 3BGOS 2CBXA 2D2XA 5HJ7A 3TW8B 5REQB 1P1RA 4FOOA 3DAOA 3IIKA 1DC6A 2J4DA 1VG8A 2JAWA 2H5EA 2JNWA 2PS1A 3NFRA 3QU4A 4GI5A 4GPTA 4NF2A 4NS4A 5SYNA 1G41A 2ZATA 1M0WA 4EVRA 1BGXT 1KOJA 5KOHA 5EZ6B 3VHXB 2VQEB 4HB2A 1U65A 4OQ4A 4QJ5A 4X1IB 5EE0A 3T3GA 2CXUA 3D3KA 4WFQA 4IDCA 3GT4A 2WUWE 1HZJA 1E2QA 3HSKA 3KR0A 4LVUA 4C4OA 1NYRA 4BZQA 1ZN2A 2AC4A 4JBLA 3F5QA 1GQOA 3LXMA 1D5CA 4LXUA 1AKNA 4B2IA 5KTNA 4YHBA 3DVRX 3NXSA 1HK7A 1P73A 3F49S 5D3QA 4OHOA 3UOAB 4G4GA 3CRZA 4I6JA 3FI9A 2YOGA 3NVAA 3BYZA 4M1QA 5H4GA 3NGLA 4PZZA 2HJSA 2I1WA 2NYVA 2VK8A 2P0EA 2ADOA 1FBTA 1QG2A 2ON6A 4X8LA 1YULA 1W5AA 1ZXLA 3Q10A 4QELA 2I03A 4L8LA 1WDLA 4Y2PA 1NRXA 2R96A 2PNJA 4C5CA 1PEKE 4EKEA 4MKHA 1QZ3A 1JG4A 2B9EA 1WNFA 4ZAFA 3E82A 5FR2A 1ODLA 3ZCSA 3DVQX 3ZGZA 3UUFA 2XADA 1JLSA 3GUHA 3BMQB 2VNIA 4MR7A 1TD1A 3CFYA 4LWPA 3WNQA 2YXBA 3EG9A 3E22B 1KY5A 3EMDA 3SR0A 3ZOZA 1XRJA 5TEVA 3ZDXB 4D9GA 5KREA 3OI7A 1YZUA 3OTHA 3GEHA 1AM4D 3OETA 4I5DA 1HDRA 2CJPA 2Q1WA 4IVPA 3MB5A 4OJTA 2PZKA 5DH9A 5TPZA 5KCZA 3VO9A 4PWZA 2UYCA 2A5JA 5BSEA 5CLFA 4NG4A 3RASA 2YYAA 4M21A 3FNIA 4M89A 4AX4A 1RTKA 1WUHS 4TMZA 1PQYA 1Z75A 2COEA 2XDQA 4D0LB 2PWAA 3B12A 3A4IA 2VJBA 2VDLB 3UTDA 3CB4A 2IYNA 1DKLA 2P4SA 3B8HA 3DV2A 4IY1A 1T5OA 2FVXA 4R1UA 2AL7A 5DSXA 1IMOA 5F73A 3ZE8A 4WY2A 1Y1QA 2ZTLA 1M10A 4X8MA 4QNMA 1NW9B 1YC5A 3BE6A 1RLMA 3NLLA 4E6PA 1KEEA 1W36D 5B2EA 3ZWPA 1W88A 3GJYA 1VKRA 3MILA 4DJTA 2WNIA 4X84A 3WQQA 4Z6KA 2I66A 2DOKA 1W9HA 4REOA 2GLXA 3D7LA 5CDTA 3G5MA 4Q1BA 5D7NA 1RI5A 5TX7A 2GCOB 4QLAA 3IA2A 1E9SA 3TS1A 2OKCA 3AR9A 1ZOLA 4TWBA 3RNLA 1TUGA 5FBQB 3W2HA 4Q3DA 5EKSA 2H1RA 3KPYA 3OH8A 1T4DA 1CQIB 2I99A 2AYYA 3NHLA 4GOOD 4L75A 5AW5A 4H27A 1GZ7A 2UV8A 3EZLA 3N59A 1KY3A 3GLSA 5JMWA 1JFFB 2ZB8A 4KO3S 4RIGA 1E18A 1G38A 3R5XA 2MU1A 3M1IA 4HNTA 1WOMA 3QYFA 1CY6A 3HJRA 3FWHA 4HYQA 4QQ8A 4DBVO 3PUYA 2OHFA 4ESHA 3AEYA 2R5WA 3G68A 1H2EA 2EFJA 3BL8A 2ZS7A 1KKUA 2OHGA 1L2TA 1PL6A 1Z06A 3AM4A 3OZRA 2B7LA 4KXNA 1BE6A 3HPRA 1SD2A 4A7PA 1YXMA 2JIRA 4MQ5A 4M8NE 1MDBA 1W5TA 4Q19A 4LK2A 2VLIA 5EPEA 1VCMA 2X0FA 5MGNA 4DJAA 4PBTA 3HQ4O 1D1TA 1F17A 1SXJB 3BBPA 4G1CA 3UV3A 2CXNA 1IAVA 1PN3A 2D0PB 3LS2A 4B3TB 1FMJA 1JI0A 5ED0A 2COUA 4GBMA 3GLGA 2G0NA 2I3AA 4RENA 4B73A 5ICSA 5BSRA 2J5QA 1UDWA 3AIOA 2R47A 3VKHA 3RHZA 3WLQA 5LSAA 2P69A 3QVOA 2H1IA 2GPTA 4XD7A 3UJ7A 1TKRA 2J0VA 3A9UA 2Z9DA 4L5AA 4KQ9A 3CVWA 4CMEC 3HVIA 4PYKA 4ER0A 1WXWA 4A6PA 1FTYA 1N0IA 2E55A 2CV2A 2AVNA 1T5HX 2D2VA 1YZYA 5BUQA 2P6MA 4M88A 4UU8A 5A5GA 2HRQA 4WESB 1IOWA 2ZJ3A 4ECAA 3UM9A 3ZY4A 3UGKA 4B3JA 1HNWB 1N4DA 2C9BA 5DV9A 4ZC1A 3VRHA 3TG2A 4LF5B 4PO8A 1U5AA 4X20A 1R6XA 2V7TA 4YP1A 4LYAA 4FM9A 3JPYA 4DPMA 4TZ0A 5IVDA 1OX4B 3MCTA 4JR0A 2PT7A 5IBRA 4JYAB 2PAAA 1G2QA 5FWXB 2QM3A 2WVAA 3AM3A 3NHFA 3P5BA 3ZNPA 4B8ZA 4E03A 3GDHA 3KQTA 4RTSA 3AV0B 3P9XA 4JWKA 3SDSA 5B3AA 3MF4A 4RH0A 1T6ZA 5JH7F 4N0DA 5DLPA 3JALB 2AHRA 3BORA 3T0FA 3O21A 1YQTA 4D9BA 1FDUA 4B80A 4GOKA 2GN1A 5HHTA 4OA5A 2DBQA 2IGTA 4YJ3F 1CJCA 5A0FA 4P7KA 3WSVA 2VJNA 4ZYYA 1WBJB 1G1AA 2JAOA 3SHQA 3KLBA 4TKZA 1LS6A 5BN5B 3PDWA 2YV5A 1G21E 3EUAA 4IIHA 3THYA 2JZOA 3RC7A 4PPGA 2FR8C 2B94A 4PFQA 1GADO 1L4UA 1AMNA 3PUKA 3AF1A 4HXFB 1R5NA 4OMDA 3PB3A 2QY9A 2BRUA 1ZQ9A 3EY4A 1ZMBA 5HMLA 3HMQA 2ZYDA 10MHA 4DV0B 2VHQA 2GBLC 4P82A 2A9JA 4QXQA 2NZUG 1XTQA 1KPIA 2ORED 3CRQA 4A9AA 4E88A 2F8SA 4YV1A 1NUSA 2EF1A 4Y1EA 1ISIA 3ETDA 3JW8A 4PIVA 3SC2A 4JI0B 4OG2A 4WLUA 2BRUC 4IQFA 4P3YA 3VR6A 1U4OA 1RHQA 3PR1A 1UXHA 3RV3A 2VJOA 1TQ4A 3C3PA 3U5TA 1DINA 4MYDA 4TV9B 2IYPA 4QVKA 1QFZA 4LC0A 3AHFA 3FNGA 1NVVQ 4QTZA 1I8TA 3BWCA 5IJ0A 1XCBA 2VTBB 4GZ5A 2BMWA 3T7RA 2YY5A 1LZKA 3LY9A 3LE8A 2OHHA 1C9NA 1YZLA 4ARVA 1C30B 1R0RE 1P9OA 2H4YA 3MWKA 1S3SA 4AN0A 4FNAA 4KFTA 1FSSA 1KIFA 5DPMA 3UKDA 1JZTA 3TM5A 1DO2A 4EX7A 1AS0A 3EZNA 4HLUC 5AVJA 1GG2A 4OQEA 3VR6H 3VHQA 4DUGD 4P4LA 5LZ8A 2G88A 1FX0A 5HA5A 3L0CA 2VP6A 3GZNA 3MUOA 4HAWA 2H00A 3NOOA 1B15A 2QDXA 3AESB 3PF9A 3P4UA 2I80A 4LOJA 1W73A 3L18A 3G6WA 3LUPA 4KP7A 1CEEA 4LCEA 2H8GA 3JVEA 1VHWA 2YRWA 1O6GA 2H2DA 4XX0A 1R74A 5IDVA 1P4SA 2GAIA 4EL0A 2XEDA 2BISA 4A0HA 2D0IA 2MSCB 2PZBA 3L92A 5KCMA 4KTTE 3QV1A 5BN5A 2PJUA 2ATVA 2NNLD 4JROA 3GIDA 4WY8A 4X6UA 3WNCA 2QRPA 1U4SA 5DI9A 3OIUA 2H2AA 1UWVA 3U4QB 1R0KA 1TQDA 1Y8RB 2J3LA 3ZCVA 4EDFA 4WBSA 3BMXA 1YZTA 4MP6A 4DLLA 3KQNA 3E4DA 1G8GA 4EY7A 4LRQA 4IF6A 4Q37A 4UCXA 2IYAA 2HIHA 2BEVA 4FXPA 2X9QA 2XDYA 5KHAA 3C6MA 3H2GA 1T9ZA 3K16A 3FY4A 1WVGA 3MK31 4R2IA 3TR0A 3U13A 3W3AA 5LQAA 1E7MA 4Y0NA 3VH4A 1YS9A 3N87A 3ODGA 5ER6A 1GIAA 4YUYA 4XQCA 1CQPA 2VJLA 2AH5A 2JD2A 2XH8A 3G3EA 3I2IA 4ZQGA 2R60A 4P0TA 1TI7A 5HJ2A 3PFNA 4EJSB 1YHYA 3QLUA 1TJNA 2Q8QA 1GPLA 4Y6OA 1NFFA 3FYUA 3D7MA 4YROA 3IQIX 2NV2B 3KV1A 3BTSA 1A96A 1X94A 3UHFA 4UMEA 3TIGA 5IJ0B 4ZQBA 2DYKA 4JASB 4V38A 1MENA 1R4NA 2W6CX 1SHLA 5K20A 4U6SA 2M32A 2VYVD 3QMMA 2WAYA 8MHTA 5FL7D 3TVTA 3UWDA 1HY3A 1D6NA 1NP6A 1XMQB 1NY5A 2ODPA 1LWNA 3C8ZA 1M2VA 1XZFA 3OFND 4NBRA 4TKVB 5JZVA 2WZBA 5IXSA 1XDWA 3S1AB 3VSBA 1YDFA 4R8LA 1IHDA 2VUHB 2JIOA 1ZRSA 5CVEA 1GU1A 4HF7A 3UW3A 4EVSA 3VQTA 4MVYA 1HDZA 4PYIA 4EYKA 4L50A 1IWPB 1N33B 2IDMA 1PJCA 3LUFA 3UO8B 2SCUB 1XTUA 3OBIA 4V24A 4ARCA 2WYUA 2ODNA 2ZLBA 1KEKA 3FCSB 3KC2A 5GONF 3CXUA 2VJMA 4G97A 5K45A 3CUSA 1EX1A 1CVIA 4ZZ3A 1Z7WA 2FDRA 3WGKA 5C5CA 1PBNA 3HABA 3QMVA 3O2SB 5EZSA 2AXNA 4MVWA 4OH7A 2AJCA 3I83A 2ETVA 4GGPA 3ZV3A 3TI7A 5J5VA 1NFQA 1B8VA 4EUFA 5AOCA 4BNGA 5CVTA 2I6FA 1YZ3A 4WLFA 3MWYW 1K75A 1GQ2A 3ZUPA 4WJKB 1RXWA 3QHPA 4Y6LA 2XCLA 3JQAD 1ZD3A 1NPTO 4EYGA 4MA0A 5BNIA 3I01M 3MLEA 2LNDA 4WT7A 2B7CA 1NR7A 2V6IA 2F00A 4N5LA 2GKSA 4U02A 1PJTA 5AHWA 3IQDB 3X1JA 5L3QA 1S4QA 1G3IA 1PJQA 3RSGA 4PTZA 1HOXA 4M0DA 1FP6A 1KSFX 3B78A 3WL8A 4ZD6A 1TVMA 5IWCA 1F6DA 4XSHA 4UOZA 4G0VA 1MC8A 2IODA 3GPLA 3DPUA 3M2PA 2X8JB 1KO1A 4LHWA 4CTJA 4ENTA 5HPYB 1AHHA 3F2VA 3MFYA 3S2SA 5KWSA 1WRBA 2HW8A 2JHGA 1U7ZA 4FONA 2O0HA 3FJOA 1RKXA 1ZVJA 3MTEA 4PU0A 1DV2A 1USWA 5B53A 3TBFA 1JMVA 2OO7A 3T12A 2JEOA 2XBUA 3QPAA 1LDNA 1PYOA 2JA1A 4MRNA 3VZCA 4JU9A 3FFBA 1R4NB 2PA3A 3O4VA 5C1BA 5HS4A 2NIPA 3R6WA 3ITKA 2NG1A 3PKZA 2ZWAA 2VBIA 2P35A 1L5YA 3BICA 3W9SA 3WRXC 4WW0A 1H4QA 4CEJA 1SKYE 1G5QA 3TW8A 3BH7A 3WLAA 2JFFA 3LA8A 4FE3A 4ZOAA 4P81A 4D9IA 5JTTA 2D2IA 1W8DA 1X3SA 1BX0A 1JJBA 1YI0A 5J40A 1U3UA 3GVHA 4NQRA 5EQTA 1VKOA 4LI0A 1Q22A 5JJIA 1XOIA 3BTUA 2IH4A 1OUMA 3KZKA 1T5DX 2OHVA 3VC7A 3NXKA 4Q7LA 4QICA 1H3EA 2DBZA 3NV7A 1DL5A 2HRCA 2OZLA 5F3RA 3SKVA 4B6GA 5IFLA 2WT9A 1IULA 2PUDA 2Q9BA 3KO8A 3DZ8A 3WWCA 4LDZA 1V3QE 3WA6A 1J8MF 4MJXA 3AR2A 4XQGA 3UXEA 1W5BA 4JDUA 1PT9A 3M6WA 4RIIA 2C4VA 2OMEA 1EQ2A 1UMBB 1UZUA 2PYDA 1IY0A 3DLCA 2ZULA 5DBOA 5TB5A 1LU9A 1ZGCA 4MGYR 3MOIA 3IKJA 4TZKA 1QNFA 1GA6A 3AZPA 4GX5A 4YMWA 1B6SA 2FPPB 3L6CA 4II2A 4ZRDA 3JQQA 4KYVA 5AJHA 4M36A 3K9LA 2HLDD 1QHGA 1O96A 1ZOOA 1YZVA 3IOEA 3GR6A 4KMRA 1KOLA 1ZNWA 3CLUC 1Z7EA 3VC3A 1EBUA 4JYMA 1I3OA 3DWIA 1A7KA 5F9MA 1Z5GA 4YUAA 1NQOA 5JAZA 2YS6A 4MVJM 3ZDEA 2O0KA 1P0PA 1SCDA 1X2BA 1XMSA 2ZPUA 1EVYA 5CLHA 4JLMA 3RRFA 1YOBA 5LMCA 4TWIA 3WLSA 4E4RA 1D6JA 5BT8A 3IAS1 4MIKA 2QR5A 3JZFA 3M6MD 4UQOA 5CLLA 1SUAA 5BPHA 2CUZA 2YJ3A 4RW0A 4QFDA 4ZVPA 1ST3A 4D4KA 3U81A 5BORA 2ZRHA 1UM9A 4TTQA 4YRFA 1W59A 1X8KA 2A92A 4QODA 4RESA 1XJQA 2Z4RA 1A72A 2XMGA 4NMHA 2VHVA 3WMXA 1PLJA 3NHJA 3ZU3A 5IXYA 1MO4A 3CJQA 3HKDA 1EAYA 4UVDA 4BATA 1Z18A 1QTQA 3D3EA 3TLZA 3MOGA 1DIRA 1OD6A 1RRMA 2W6ZA 2X2FA 2FPMA 2FN4A 5KYVA 3O8RA 5CFMA 1Q1GA 1L5ZA 2R7AA 4HGYA 4JQSA 4YFVA 5HRUA 4WWHA 4HGPA 1J70A 1DOAA 2VRWA 3PQCA 4B2LA 3I4FA 1JFSA 3K0AB 1AV7A 2J0EA 2DHEA 2OUIA 2WDZA 4C6SA 1MLDA 1UPBA 1KMCA 1I3LA 1PFGA 4R31A 5EFOA 2DBRA 1F6WA 1MAAA 1T9DA 1EX7A 2QORA 2JLBA 1GPMA 1PVVA 1DIHA 1SU7A 1WDKA 2JD0A 2Y4NA 3BIFA 3DR3A 3E9EA 1OXTA 1ZUNA 2GCEA 4R1LA 4LGYA 4C07A 2IYZA 3GW8A 4MTLA 2B6HA 4WXHA 5K7SA 2QD4A 2QX6A 4HQRA 1DC3A 3JWHA 5AUNB 5E7JA 1GL3A 1QHEA 2HB6A 3PYMA 2V6FA 2C5BA 5AI4A 3ZYCA 3DO8A 3Q7QA 3I1YA 2ZUUA 4UUPA 5EJAA 4JC5A 1G1MA 2G04A 4EG4A 1E20A 1OPRA 3FCXA 4NZPA 2I2BA 2DETA 1BCSA 5DM70 3F4LA 1WDMA 5CH3A 1U98A 3ZTTA 1F0KA 5HGJA 2OL4A 4JU8A 4RPCA 2QGFA 1V47A 1GZ6A 3IIIA 2YJGA 4FGSA 4M22A 2ZWIA 2WHPA 4IOKA 5DNVA 3WK7A 1KQFA 1E62A 5DMHA 1QHHA 4ER5A 3SQLA 5E4FA 2X6QA 4UTNA 4W6ZA 4DNXA 2BE7A 3D1JA 3N8DA 4ZN6A 4EYOA 3VU1A 3K8QA 1NWHA 4IRUB 4B3HA 4CF5A 1YUMA 2YHUA 4R9UC 3HJCA 1JYEA 1IATA 2WLTA 4BNDA 3ZZ0A 5FI0B 3JX9A 4EA8A 1GGKA 2AYZA 3KXIA 3RKUA 4QG3A 4M54A 1P19A 1E3WB 2VP9A 2PZJA 3O4GA 4FBLA 4HQ6A 2XTNA 4IFBA 4R2KA 2PSSA 4FHDA 1E2KA 2JFOA 3X2FA 3H1GA 5L95A 2CZCA 1JEYB 1G16A 3FUWA 4E5KA 5HKKA 4ILEA 3ZS9A 4NYMQ 1K7FB 1VL5A 3KZNA 3TDNA 3HEBA 4PG4A 4Q3AA 1QJCA 2HPAA 3PVCA 1HQCA 3I52A 4QECA 4LHVA 2J0UA 2DQZA 2XOEA 2ZIAA 4GF5A 5ALYA 4RTNA 1M0SA 3VO2A 4W63A 4E4TA 3CG4A 1ZKMA 2QTLA 2LPMA 2QN2A 3LGSA 1TD9A 3HV0A 3MSXA 3T7JA 2GYVA 3ZTYA 3DLIA 1H5NA 3K4PA 4CFYA 4F71A 1SHZA 1YRBA 1YBMA 3FWYA 3FVVA 1OH8A 3VDXA 1OROA 3SMVA 3LMKA 4EW6A 1NW4A 4Z0NA 5E7QA 2G1PA 4PS1A 1AURA 2EU8A 1K6JA 1P74A 3UWPA 2Z1DA 4JJEA 1M5RA 1XK6A 2ZSEA 1NUPA 3AUTA 3AVQA 2H4FA 3B3FA 4G5OA 1C9KA 3QYPA 4RK6A 5F5LA 1UPCA 2DX7A 4P4SA 1P2UA 1R8SA 1N0WA 4OAOA 1ZVKA 2GHIA 3KB1A 3KP1A 2J5RA 2GEFA 1HL7A 1NRWA 2AFHA 3BMOB 1N8SA 1UBEA 3D4IA 1OYOA 1M3SA 3EVEA 1NBEA 3MS4A 5K3AA 3D4BA 1EH5A 3C7KA 1P5HA 2CNKA 3FHCB 2XMZA 5K8IA 2WV9A 5HBGA 3DUWA 1H9AA 3GN1A 4IQ0A 2NZYA 2J9FB 2CVFA 2PU7A 4IXDA 4JGGA 5DBHX 5JJLA 3ZHSA 1T5TA 3BRQA 1S3FA 3FWKA 4U2FA 2FY8A 1X1RA 3DOEA 3U7QA 3ZDCA 3FDFA 4HWOA 4OQMA 4MGEA 2BF4A 4NZ9A 3BL5A 2EWWA 5KNDD 2R7LA 1N4AA 3MXOA 4LHSA 1QIMA 9ABPA 2VDNB 2A7QA 3AWDA 4B45A 1FTQA 2Y92A 4MVJI 4QU5A 2RBKA 4JVSB 2O1EA 2Z3ZA 5BQ3A 5J2UB 1U7TA 4ZOLA 2EBHX 5EIBC 5I7OA 2EYUA 1GITA 2AOVA 2D1YA 2ORIA 4B85A 4I4LA 3RVKA 1DJPA 3MA0A 2F1IA 1KAGA 1U3WA 2I6TA 2PCJA 2YCBA 2YUIA 2ZDHA 1HORA 2JFVA 3BXHA 2B5WA 1JFVA 2YOHA 1VP9A 4HAOA 3BQ9A 2W6NA 2XIJA 3PEFA 4HGRA 3BZWA 4PRYA 5AKZA 4QYWA 2GS9A 3K96A 3QUAA 2FG5A 5DYIA 3ILYA 1S8AA 4E4YA 3PEEA 2IGBA 3EDMA 2F43A 3ITNA 4OBBA 4Z7NB 1V2HE 1GRQA 1MO5A 5WRFA 2JGJA 4QTUB 4RGVA 3RH0A 3LUAA 2MYTA 2W8BA 2XHZA 1NI4B 1QG4A 1P61B 2GCIA 4J2OA 1P4HA 2VHZA 3ETGA 4L0CA 1SXGA 5GJCA 5A5DA 4HUQA 2MSDB 4Q4JA 2FPRA 1P2GA 1E3JA 1F8YA 1QRTA 1HDYA 1HQYE 3KLPX 3PQ4A 4KZKA 1R6BX 1KNQA 4X54A 3VPXA 2AR9A 1QKJA 3GCZA 4CRWB 4DIEA 2C8KA 5GIOE 1L7VC 1Q1NA 3TNYA 1FP2A 4C04A 5KHLB 2I0FA 4IH4A 4QM7A 1Y3FE 4QOJA 3R77A 4V0QA 1Z0ZA 4FPXA 4ZHQA 4BUZA 4LF7B 3IEIA 1INLA 3S4YA 4DMGA 3WAGA 2GBLA 1J2TA 2PVCA 2FFRA 4FFDA 5KX5F 5ITZA 3KOOA 4UATA 1H5QA 2HF9A 4ZJYA 3A3PA 4NU5A 4BP1A 2I91A 5FNVA 1W8IA 3JAWA 3G88A 2PGIA 2VP2A 1L4KA 3ENNA 4CTOA 2R1TB 3AHCA 3VJMA 1D4ZA 4RORA 4R98A 3N2GB 5E9JA 5C34B 5JZBA 1YBVA 1EVKA 1F38A 2C5LA 4QARA 1ABEA 4TXHA 3WQSB 2O54A 1FP1D 2YR0A 4A10A 2YFYA 2P2CA 1A97A 2QN8A 4KUEA 1N6KA 4NX2A 5HFAA 4EGFA 3S1SA 3C1AA 3PC6A 1IFXA 4TYYA 3IVMA 2REOA 5JATA 1E3DA 2CHGA 2R5NA 2YHIB 3OCYA 1IEQA 1QO9A 2ZGVA 3D0QA 4LJ4A 4MRSA 4Q16A 4B6JA 5LJIA 3TRFA 4RKEA 4K7JA 4KIWA 1NJ8A 5JBIA 4B7AA 2CUTA 3NWEA 3LQQA 4PG8A 2QVGA 3GLFB 3F7MA 3H3FA 2N0SA 3PA8A 2AIRA 3I34X 2BM9A 2F43B 3B52X 4LXQA 4HBZA 5H68A 1X80B 2ISSD 4XDHA 2GEJA 1DEAA 3NP7A 1OHHD 3FRJA 5AR1A 4GG1A 1JEAA 3ET4A 1AKVA 1YVUA 3AU8A 3EAFA 1JPUA 5HOQA 2HL6A 4XJVA 3SYKA 4C76A 3L01A 4IICA 3U39A 1STOA 1ZNZA 2GM9A 4O4HF 4LY6A 3P2IA 3EJWA 2HLPA 4ZZ0A 1P29A 3IPCA 2WFAA 4CL2A 3RSHA 1IDN1 1AGPA 1HFEL 3K2IA 4BGIA 3N05A 4CQMD 4AP5A 4D8UA 3S0JA 2AFHB 2TRSB 5D3ZA 3HBMA 4ITUA 3I5XA 1U8UA 1JEDA 2Q0XA 4XIFA 3RUPA 4EQZA 4KFCA 5LKAA 4ENQA 4TRJA 3E58A 4PYMA 4FQ5A 3QIVA 1M7BA 3CU5A 5F98A 1FFHA 4AP6A 3PFWO 1VA5A 3ZHXA 3O9ZA 3V7UA 3AXSA 4COKA 5IM4A 4CNQA 2VT6A 2PQ6A 3M1AA 1XQ1A 1L3IA 3LHKA 5CJ2A 1XRLA 2C5EA 4QRIA 4AZ3A 4PYNA 4ZYZA 1XLWA 2R1TA 2P4UA 3LQKA 2QSJA 3MCUA 4JP2A 4UHKA 5B1DA 3VTZA 3RRYA 2IS1A 3MSCA 2A1IA 1A82A 1JP7A 1O6CA 5JXWA 3HWWA 2ODEA 4BWGA 5M2QA 3LFTA 4PG7A 1HT3A 3JYOA 4RKRA 5B58C 4PW0A 4RGYA 2KS6A 2PLWA 2I6UA 3FKSD 4WE3A 1WB5A 5IF3A 1AGXA 3OT1B 1O87A 5DI3B 2ZG6A 4ZV7A 4E09A 1QZZA 4XYGA 4ZVMA 1O9HA 3PUIA 3ZIAA 2ZBEA 4EB8A 1XUOA 3GLGB 2GXUA 1TIKA 1SC3A 3HU3A 4QDJA 1MRSA 5DBEX 1SAYA 5DHTA 3SK0A 3KKNA 1CDOA 1YB1A 1ZIXA 2BH2A 1NJ6A 3LKBA 2QLJA 3PVZA 2IDJA 4M46A 3TAHA 3F78A 4A36A 2MYPA 2ZUCA 1GLNA 3E4CA 4Q1EA 3WY9A 4OAPA 1GRRA 3EW9A 3P27A 3LVBA 4DLYA 1Z82A 4F93B 3CURA 1ZLXA 3OOEA 4FGUA 1U0GA 2A8YA 3E23A 5DN9A 3EBOA 2NQ8A 5FO1A 2O5EA 4BP9A 1Q17A 1F7UA 3HDHA 2QN6A 4Y9TA 4WNIA 3PGLA 2YZGA 3MUFA 5ISMA 2QUJA 4O4JA 4EPRA 2WYHA 4HOYA 4U0KA 1EK6A 3CNLA 4CG1A 3JQAA 1JQBA 1N6IA 2WFLB 3I62A 3AVTA 2WWIA 1ZL0A 1WR8A 5EP3A 1GRCA 2O7SA 1NN5A 3MJTA 4DV4B 5HCNA 2CMFA 3EA0A 1E2BA 2IQIA 2YXEA 2FZ4A 1GL9B 5K8CA 1P75A 3FVTA 2XB8A 1GCAA 1OA0A 2YN0A 4EKYA 1B73A 4R83A 2VDRB 1ISRA 4DEVA 3KKOA 3RTAA 3LFUA 1NF3A 2ZTSA 2EKBA 2FKAA 1U1GA 2PJDA 2Z2YA 3N1UA 4HQNA 3OEEA 1LLDA 1Y3DE 3EQ2A 4RJIA 2X41A 4RBNA 5J4KA 3FYSA 5CEJA 1K98A 4ND2A 5SZKB 1A95A 2PQ0A 4MEBA 3ERCA 1CUCA 2F90A 1J9GA 3JSXA 4H7EA 3L5OA 5EZYA 4XOUA 3NZEA 1YZHA 4KN8A 4NZZA 4JXJA 1SPBS 2EERA 4IXMA 2J09A 4O8ZA 2L0XA 2R11A 3P0EA 5CT5A 1WXXA 2WVHA 1KMHB 1EINA 1DO0A 5I9LA 1ZHOA 4F9GA 1IQRA 1ID1A 1XZEA 5HCIA 1O54A 2OCIA 4INOA 3SG0A 5A4MS 4W6QA 4LF9B 4AURA 3FIUA 3VR4A 2OHIA 3ZWYA 1QGAA 3TUIC 3CGGA 5C8XA 2NVUB 1TMKA 5HJEA 3I12A 2HYIC 3UB2A 4P53A 2MR6A 1E2LA 1IM2A 1ESZA 2Q5CA 3VU8A 1A7UA 5C31A 1QGZA 2PKQP 3B2QA 4NG5A 5EWMA 2YINC 3CH7A 3EH2A 5BQFA 1NXVA 3U7FB 2R84A 1H2AS 1P0CA 3C3WA 3SXUA 3JZMA 3E0QA 2BEJA 5ALRA 4JA0A 4ZMSA 3Q4GA 2CL6X 5DLYA 4ZGWA 3WVNA 3K1AB 2CN1A 3DTVD 4D2IA 4DYHA 4FDVA 4KXQA 2QQEA 3NEYA 4PQRA 4PZDA 1A4XA 1I2CA 1PRYA 2WJHA 1CJMA 3KHSA 1G98A 4X41A 3UXHA 2NO5A 3HKDB 6LDHA 2ZIUB 3ZE6A 2ZBVA 1UC8A 5JJKA 1CULC 1AA9A 3C6BA 1P7YA 4M9XA 4GNRA 3ZHTA 1JU9A 4TLCA 1Z4IA 1FFYA 4M9UA 1X1QA 4GSKA 4GZ3A 3A9VA 3EG5A 3QBJA 4LPSA 5JAOA 3QUQA 2YJ6A 1KQNA 5I3CA 4NNPA 4BP3A 1DAHA 5CK4A 1GCOA 1FX1A 3N0RA 5E4YA 1FFEA 3IPYA 1I4OA 3IQFA 1FYXA 1XLVA 1MMFB 1EGHA 1H0KA 1UP4A 2PV7A 1M0TA 4IOLA 1YKGA 2BE9A 5I47A 4K6MA 2PZLA 4GLLA 4YAGA 3EZ7A 1XVUA 3ITDA 3WGIA 4MP3A 3HGQA 3CGWA 1YJ8A 2XWBF 3RTBA 2BFEB 2RHHA 3RT1A 4N01A 3GRCA 3WLKX 4D80A 1WX1A 4DTCA 4O08A 1JAXA 3JQ8B 4J94A 3FGZA 4H0FA 1JN0A 3UW1A 3QQPA 4D81A 5J2TB 1NVFA 1IG3A 1QOPB 1QZXA 4XB2A 3BIXA 1KEVA 3D0OA 4S2UA 5F35A 1K6IA 1V0JA 1VL1A 2FDCA 4WGFA 1QYIA 1F8GA 4KOEC 8ABPA 1S7CA 3U09A 1JAIA 1E3SA 1X8XA 3Q0IA 1QR6A 4A27A 3O4RA 2PSFA 5G4KB 2Q45A 1NQVA 4RMHA 4HD8A 5A3SA 5K3OA 2E49A 2HV9A 4NZNA 4PLTA 3IUJA 2DR2A 4ZOBA 3UMJA 2V7GA 3BMCA 3NAMA 3R3XA 5FOTA 4Z1MA 4ZO4A 3DMNA 2BZ1A 2PV0A 2VA9A 2VHCA 1E5QA 3DDSA 3ND5A 1TJ4A 1JMYA 2P90A 2XX3A 3GGSA 4JWTA 3M70A 1YA8A 4GKVA 4KU4A 4R6WA 3ZZUA 4XGRA 4EEZA 4N7JA 5JYDA 1TFUA 2WM3A 2XD9A 4DLBA 3KOXA 3LC0A 4Q34A 2H4HA 5D87A 2YVAA 5DCWA 3OJWA 3G2MA 3IA7A 2GX6A 4M1EA 4ZI7F 4DZRA 3B8EA 3FDIA 2IEBA 3HYSA 2ZI6A 3I8SA 16PKA 4N9WA 5TIIA 4QQRA 1IQ0A 3JYQA 2OV1A 2QNBA 4PNHA 4CNBA 3N2NA 1UKEA 3SVLA 1EKXA 1I9CA 3I09A 3LUJA 2GSWA 3JU3A 2ZRDA 4DCOA 3MHTA 2BL4A 3KSZO 3UTCA 1P7VA 2ZSDA 3KLMX 1SZDA 3NEJA 4LYHA 1ULZA 4G5QA 1VL6A 4AWBA 3WWZA 2CXTA 3QX7A 1NQWA 4EECA 1SMKA 4G1EB 4RO0A 3LA6A 4ZQHA 1VFPA 1Y1RA 3DAYA 2RH4A 3GCGA 4EIWA 4DCVA 2VHXA 1PUIA 1PL8A 2JGFA 2WTXA 3FPAA 2Z8XA 3LBHA 4JBHA 5JNWA 3WHKA 1LVGA 1ZU5A 4WKBA 1IY8A 2GJSA 2YWJA 5BMOA 2MJLA 3F90A 1GPWB 1EXMA 1G17A 3PTZA 4TWJA 5FEMA 4C0XA 2C1ZA 2BY4A 4BDTA 2A57A 2C9CA 1H6CA 1C8VB 2GA9A 4GMDA 4ICIA 4MV1A 4WZBE 3T8YA 3JTMA 4EY4A 2GOYA 2MYNA 1JQKA 3VM6A 1NM5A 4RFSA 5JLJA 1MR3F 4HNGA 5ALDA 3E61A 2DR0A 1FVOA 4MWEA 3IP6A 1YB5A 3BDAA 4R1MA 1LSUA 2Y1KA 1NUHA 5EGSA 4AN1A 1L5VA 3DFKA 1QPZA 4NAUA 3OIWA 4AG5A 1NJFA 1XRNA 3RIYA 5BXQC 1EGAA 4RH1A 4YV2A 3ZQ4A 2VOEA 2TECE 5KTRA 3NNDA 3HE3A 2O8NA 3OEYA 1X8JA 2MMCA 2BFDA 3BD9A 1LBEA 3NM5A 3Q8WA 4GZMA 1OH7A 1P33A 5A5VA 5B58T 1E9CA 1UBMS 1QVZA 3T1TA 4MS4A 2B69A 1Y1SA 2QD3A 4I55A 4F91B 2B4KA 3BD6A 3JCZA 1ABBA 1S4MA 4X1KA 2Q3HA 5BN1A 4OVKA 3BFJA 3F7OA 4AY6A 1ODKA 1VJTA 2QVXX 1GG5A 5JRZA 2QQGA 2Q6LA 4URZR 2GKGA 2DB3A 1E99A 3EXHC 4RZQA 4ZXFA 3WGNA 1Y4SA 4FILA 2AD5A 5A3QA 4HEQA 1H23A 2B4TO 1OIVA 3WWEA 5BQXA 3TK1A 4CCAA 4I2NA 3DJYA 3VU9B 2C99A 1IOLA 3ADDA 4DMLA 4TWAA 1JHOA 3HXQA 1GFZA 2F3SA 3BXGA 2B21A 3WKEA 2D74A 2DTXA 3CKLA 2QMOA 3DE0X 3EXHB 3H4TA 1E8MA 4CEIB 4D9JA 5EP4A 1K3TA 2G28A 3PKJA 4LV6A 3H8SA 1A5BB 1PWYE 2QZPA 2EYQA 1LBSA 3CNHA 1YT5A 1FMCA 1Z5VA 5HUHA 3DHEA 4PLHA 1KJ9A 1P2FA 1ZXXA 4J9UE 4X1YB 1J2YA 1SWVA 3BFKA 3IAHA 4GOMD 4NPCA 5P8WA 3R44A 1YQXA 1NKTA 3KWFA 1GG8A 2J9ZB 4GXRA 5LYYA 3TF5A 4BXOA 1E6MA 1KDOA 2Z2JA 5EERA 5A6SB 2VUTA 5ITZB 4MICA 4HAYA 2IUTA 4BO4A 5EG5A 4CCSA 3GEIA 1WXDA 3GRRA 1SZCA 2CNDA 4M0EA 3QYAA 4KB5A 1WUKS 3DD5A 5HRAA 2D7DA 4DIKA 1T9BA 5EL0A 2IS6A 3SP1A 2J41A 4B4VA 3LHDA 1KAQA 4YDHB 5BNWA 1CEYA 2ZR9A 1DXOA 1WUTA 2GI4A 4DSTA 3QJYA 4G0MA 3FMGA 1KA9H 5E0KB 1HEIA 121PA 4NDAA 4RNDB 3B51X 3IRVA 1TAGA 3TIIA 2JGIA 3EH1A 2NYRA 2F4VB 1E2EA 1JE0A 1ZJYA 2F1RA 3PQ2A 1QLWA 1NQAO 2J6CA 3LQRA 3UFBA 3V8NA 3VDMA 4B3DA 1WJGA 1KDTA 3BHMA 2EW1A 4CQLA 1UM9B 2VRCD 5I9IA 1RXVA 4DABA 1JSZA 2L18A 1RPTA 3VR3D 5J63A 4C4TA 4MQBA 1Z83A 1LK7A 3BB3A 4KQJA 3KK0A 4S04A 4QEZA 5LP6A 1JXAA 5IC5A 3EDCA 1MDFA 1E2JA 1GKLA 4MVCA 3ZTWA 1DRJA 4YRNA 1PJRA 1GZHB 3QITA 4N4AA 5LDDC 2FWJA 3B5IA 4I5GA 4HADA 4ZVVA 2IT1A 3L4SO 3R6GA 5EXPA 5NLLA 2W2KA 1O97D 2QL6A 4MLCA 3MTDA 3V97A 3WISA 2GFIA 2W2LD 4QA9A 1E5VA 4Z86A 3NBZC 3S70A 1R66A 5KX5B 1IPHA 3G0CA 3PD1A 2OCBA 5AVRA 4O2BB 2PANA 2F4NA 1BG6A 4BYGA 1BWPA 1TUEA 3N75A 4WOPA 2Q2QA 3QWBA 1Z3IX 4FR5A 3H75A 1RQ2A 4NMMA 3TAUA 3OCUA 2FUCA 1VG1A 3FDXA 2B8JA 2RHDA 3GLIA 2ZE7A 4KPEC 1AH2A 1LV7A 3RF6A 4X1YA 3FCUB 4D96A 3W06A 3R6LA 4CM8A 1KQGA 5I9SA 4BMSA 2UYQA 1AF7A 1MZVA 2F9MA 2LCFA 2ONYA 4J7UA 2W70A 4MR8B 2M6RA 2QPOA 1G60A 4ZTBA 5EHGA 4BMYA 1S9DA 5FUMA 1EFVA 1PI3A 1PJZA 2F67A 1LBHA 1QGED 1REQB 1TA9A 4IXNA 5IABA 5IEJA 5GP1A 4CM5A 2YX1A 4DWOA 5AM5A 2OY0A 1Y6RA 3THOA 4IAOA 4YRSA 1P45A 2WAOA 4BJ3A 2FSIA 3A6LA 3U17A 4IYJA 4GXNA 3ZWOA 5BOVA 3G2KA 4UVIA 3U0BA 3EGCA 4DSOA 4PBRA 3DUFB 2BTQB 4IJQA 4Q01A 4I9UA 3RFCA 3JQRA 5EIAA 1CETA 4DQVA 3TG8A 1DXQA 3C6ZA 3B53X 5ADVA 1P0FA 1ZYUA 3IOCA 3LBAA 2G1JA 4I55B 3OKAA 3KQHA 2PGNA 1PFWA 3K9CA 4RY2A 5EWLB 1AUVA 2CLSA 2QP3A 2O1XA 2XRYA 5KDDA 3K6SA 3FF1A 4KRYA 5CFNA 5L3SB 2WJVA 3QUBA 1QK4A 2JC3A 2WSSA 4BBAA 4CT0A 2RGGA 4UBNA 4DE5A 5AJZA 1IM8A 4CF4A 2WOJA 1D0VA 2IYFA 5EWJB 5GV8A 2ODBA 3UK6A 1N5RA 3PCRB 4E7OA 1W94A 2ZRBA 4FYVA 1YJXA 2RHCA 2QDKA 3GEGA 2J0UB 2C4MA 1LRKA 2YTZA 3I73A 4KPFC 4QPZA 3DP9A 3PJRA 1YI8A 5KVQA 4A91A 4C03A 3DV9A 1N77A 3JQGB 4X6XA 1BVUA 1VJ0A 1V39A 4LE0A 4BLVA 4WL0A 4K9QA 4A03A 3ET5A 3MWLA 4UBMA 2V7XA 1V4NA 2X58A 3FHOA 1E1YA 1YVPA 1EEXB 1C7IA 1MN6A 1NJSA 4EHIA 1I24A 3Q9UA 4E5VA 4BNXA 3HVJA 1KVRA 3ORFA 2P2NA 1POXA 2CDAA 3KE9A 2GO7A 3GH3A 2QI9C 4LGMA 3Q7EA 4V0ME 1H9BA 4IIXA 1C9JA 1QDLB 1WETA 3R8XA 2I3BA 3RVPA 2I4LA 3TX2A 5KNCA 1XWIA 4MCAA 3RNOA 1EGQA 1LTHR 2CE2X 2QMZA 2ZSBA 2AUMA 3AJAA 1DCKA 2XYGA 2RMKA 3HBJA 2BZSA 3IUYA 1JAZA 2XCQA 3ZBUA 4P38A 4YHHB 2D5CA 3KIPA 2M1ZA 1QHNA 2YW2A 1U7HA 3KAQA 3N2EA 4IYRA 4M9CA 4DR7B 4GSLA 3EEFA 3LDAA 1QYXA 2CNWA 3E2MA 4KUGA 4S0XA 4H4DA 3LH5A 1J2JA 1C4WA 2Q3EA 1JDNA 4Y98A 4HLQB 1G20E 2GEBA 3QU5A 3OZGA 4LYYA 3WIOA 5KNDH 3QNUA 4LF6B 3EPHA 2XOKA 2XZDA 4JZKA 3OKFA 2MR5A 1F5SA 2CGEA 1DIAA 4W82A 1RRPA 2B2XA 4XASA 3BGWA 1FLVA 5EXSA 2Z56A 1Q44A 1M1YB 3FYTA 4F1WA 1MV5A 2PMDA 3DBLB 2WU4A 3GA5A 1XEXA 1T3ZA 1OV6A 3FWZA 1ZJ4A 2GK3A 2VF4X 4IVNA 4EKIA 1DC7A 4I66A 1GHTA 4HH3C 1TF2A 4RF3A 2C00A 3H3XA 2LCQA 5GIPE 3ZE1B 3E48A 4MVJP 2V6JA 1WHTA 4N12A 2DPLA 5IEBA 3A11A 4HYTA 4KWTA 1KIMA 3BAZA 5FUYA 1YNSA 3J81k 2LP4Y 2QAGC 2QSUA 3TO5A 1LC0A 5KQMA 2ZU6A 1ADJA 1U2ZA 3D7NA 4R9VA 3BB4A 3PQEA 1KYTA 4W1QA 1CC1S 2VAXA 1DI0A 3VHRA 3OHMA 2HEGA 2WY2D 1KZ4A 1E5TA 2XODA 3KB2A 1AF4A 2ZBGA 3I2GA 3HL0A 1F14A 3B7PA 2MMGA 1JQ5A 3QM1A 1PYDA 4JOQA 4K05A 3WK9A 3X1DA 4B87A 1ZL2A 4MWGA 2IELA 3IR6A 5HNKA 1XZHA 2II6A 3BM5A 3DBIA 5CFOA 1COWD 3GUCA 3OEHD 1JXOA 3QVKA 3CT4A 3DZKA 4KQ6A 4LHYA 1CUZA 4D57A 4I4NA 4PPQA 4UOQA 2OE2A 2R4QA 2C2OA 1EDOA 2W5UA 3HYNA 1DRVA 3WV5A 4YCMA 4GKAA 2C7GA 1WF6A 3C3DA 1HTBA 4NYIR 4LF4B 2QYSA 3BE8A 4IDNA 4QHSA 3T5BA 1C3EA 2AOUB 4TV9F 1QTRA 2C2MA 4AN4A 1Y9DA 5TF4A 3LPLA 3PJEA 2VKQA 1I33A 5JARA 1JDSA 2QJTA 1W1WA 2YJZA 1R8QA 1SKAA 3Q3EA 1BCRB 2FAXA 3DSRA 3L6DA 4B3SB 1NR1A 2WIKA 1F4VA 2X3UA 1YGYA 3CKKA 9ATCA 2ZCVA 2ZRQA 3GRYA 3N2IA 5HZGA 3VYSB 5DTIA 3U4DA 4E3ZA 1YTUA 2I71A 1MEEA 4N03A 1OCEA 4K3UA 4MI6A 3X2EA 1Y5RA 2X7XA 4IDPA 1ML4A 5CB4A 3NHUA 3W5JA 1J2EA 3OO1A 1E2MA 3K8YA 1EFDN 1Q0ZA 4Z2AA 1UXOA 5CVVA 4FE7A 2B0JA 2HMVA 4GPD1 1P44A 1FYWA 1OREA 1U02A 4MUNA 6PFKA 3E1GA 4W5TA 3K0CA 3SEZA 2H54A 2J6BA 2OLKA 3QXJA 2AVDA 2QEQA 5HEKA 4YJ2A 1P0QA 1LRLA 3KETA 3SF8A 3MZ0A 3N5CA 1QGYA 4MI9A 3OQMA 5BWOA 4D42A 3JZDA 5EHXA 3I23A 3CLTC 3EGXA 3PC3A 3K5HA 4YPFA 3GP5A 4XB1A 2OPBA 5EWJA 3I9V6 1JJAA 3G5UA 3IESA 2NUTA 2R2AA 4DR2B 2PGOA 2ZUDA 5I9TA 1SKMA 2PSHA 2V7UA 4TUYA 5JWHA 3OJXA 1KO4A 4WJZA 1KRXA 1KZ7B 3WSTA 1GN8A 4R7TA 2E6UX 5ALMA 3MJHA 3T52A 4D9KA 4MRRA 4DY4A 3RVSA 3BOSA 4I5EA 3V4OA 4FOPA 5T7BA 3G0HA 2PKEA 5DK6A 4J4HA 1K4YA 2AJBA 1JEOA 4KO8A 5AOBA 4FD3A 5JSZA 1K7YA 4LZPA 2X4IA 3EXAA 2X23A 4H1HA 3X1ZA 1NJGA 2PUHA 1UBSB 1BX3A 2FPXA 1RI1A 2H16A 4K6KA 5B36A 1UJ4A 1T1GA 1GPUA 1WHSB 1I5OA 1UWCA 3N7UA 3DXYA 3GEDA 5F64A 4L9WA 4MTCA 1SG6A 2WRZA 1LLQA 4Q3OA 3NPMA 4YGYA 1TVKA 4MYSA 4WQMA 3WBFA 4QU0A 1XGKA 1ZH4A 4KR0A 4F3NA 5J4HA 3LVQE 4Q3NA 3R20A 3TR6A 4FFMA 4LHZA 2BFFA 4IZOA 2FGKA 1ZIYA 3OFKA 5BVGB 2CXPA 5G3ZA 4AKSA 4XPZA 1U0NA 4CF7A 5CT9A 2P91A 2W6IA 3GUUA 5LU8A 1V48A 1YJAA 4OXXA 5LQSA 3CWQA 4FYXA 3SS7X 3V1MA 4HKTA 1MAHA 4URFA 1CPYA 1QC5B 1NIPA 1OFUX 3U7JA 4CE6A 2VQFB 4JEMA 2ZIEA 2DMRA 1XEWX 1MB9A 1ACLA 3P9QA 5DRYA 4FGZA 2R25B 4I50B 4P93A 3ECAA 4IIGA 3C87A 4BMPB 2GESA 4JKOA 3AETB 4K6HA 2P1RA 4WFKA 1NNI1 4ZOQI 1DCFA 3QFTA 4YWHA 2DSTA 1KDVA 4CMKA 1ODJA 1RKVA 1RM3A 3RRMA 2FPGB 3QYJA 4KYTA 5C4GB 1A2OA 3VI3B 5I45A 4F9TA 2ZS9A 1QTNA 1SUFA 1E1QD 3ZVLA 2CZQA 5A4IS 1C0KA 1DUIA 4MUEA 2P6RA 1NR5A 1UWLA 2IS2A 1OSNA 1CUYA 1C7JA 2A0FA 2CC2A 2GR9A 2ZRGA 3GGJA 4NC9A 4CYMA 4CIAA 1A5ZA 1GTRA 2FV8A 5B57C 5U4QA 3HFGA 4DV7B 1U8AA 1IN7A 3P2JA 1RXCA 4FDUA 2UDPA 3DKVA 2ZWPA 1HSZA 3RWOA 4FHZA 1CRLA 3MBKA 4G37A 1L7AA 2ZU0C 3GXBA 1EQUA 2HA3A 1PGPA 2HJ9A 3MCVA 4MX8A 1ZJJA 1OLSB 4I46A 2I9PA 1J0CA 2OV2A 5G41A 3ZQUA 3OQIB 4B9EA 3TQOA 4EO7A 3CF6R 1MX3A 1R1DA 3CH4B 3IHTA 4QSMA 2BSAA 1CUUA 2BKUA 4R3WA 1X87A 4HFJA 4EEKA 1NQTA 3DE1X 5TSDA 5IWAB 5EXEA 5G53C 1YFZA 4ZAXA 3ZJYA 1LPOA 1Q0QA 4S35A 5A03A 2GT1A 2WTAA 4C89A 1GUYA 1KJYA 4UMDA 1BU5A 1T1IA 2ISCA 1MB3A 3RROA 4Y1RB 5JHGB 3DM9B 3ZWKA 4HMQA 5FWNA 5JH7A 1KOGA 3PUJA 4P7BA 1Z7GA 4HPJB 4Z3OA 2P3SA 1GUZA 1Y9EA 1YAHA 3ICVA 5DYYA 3I9LA 4H1VA 5LYJA 4RDIA 2DPXA 2E9SA 2YFHA 1BCRA 4XVQA 1IXYA 2YNMC 5AKHA 1ZWLA 3CX4A 2ZE8A 3HUUA 1PU2A 4C3ZA 1F3OA 2A5YB 5AHKA 3WMFA 1Z36A 2EBWA 3E5MA 3MWDB 1G9SA 4JI5B 2WIGA 4Y2QA 4IIJA 5HUQA 4DMUB 5B64A 3CHYA 1Z0DA 2TS1A 4QX6A 2Y93A 4BKPA 1N2CE 1G19A 2YJ5A 2QYTA 1USKA 1EE1A 5DTQA 4F85A 3V3KA 2BM8A 2PJZA 4FDMA 1EP2B 3P20A 4KLCA 5AMXA 4IJ5A 5ULLA 5AJVB 3HRHA 5MGBA 1WV1A 2ONZA 3U16A 1DRUA 1C7FA 3HWRA 2DF8A 1Y48E 2HJRA 2PRJA 4OYHA 3R3WA 2JHFA 1D2CA 1Q16A 2G9ZA 4GSYA 4MWOA 2PUWA 4QUHA 1QP8A 3IP7A 2X0DA 2HWKA 3EGXB 3EWIA 1OXBB 4V0NA 4TVOA 1YR3A 4BX9A 5B30A 4KX5A 1MNAA 3H19A 4C21A 5F4BA 4TMKA 5CBPB 5TGZA 1Q7TA 5AJUA 3HACA 3KT3A 2IX9A 5SZIA 3L1VA 4TMWA 1YR1A 3QWAA 2PZFA 2YY6A 4HTAA 4YASA 3HXMA 7ADHA 3A3NA 3CEAA 3W9YA 4WVLA 3FNBA 5CB4F 3I2HA 3ZCUA 5ALQA 1II9A 1QH0A 2OD2A 3R76A 3LCUA 4LJ8A 1IG0A 1QB8A 1P7WA 5EJ4A 4WOBA 2AXQA 2G08A 1YBAA 3FGPA 1OX5A 2K2WA 3HKBA 3JVUA 3ROMA 2BCJQ 4KV9A 1H8ED 5ALTA 4HVLA 1DJQA 1GYQA 3WWPA 4HDRB 3ZS8A 2GN6A 2WP0A 2GNOA 4OHWA 4YUXA 2YL2A 3KZXA 1PKEA 3V4SA 3ZXIA 4KE7A 4NBLA 5ED4A 4LF8B 3D2BA 3TQQA 2JGKA 3SOZA 4N41A 3TTSA 4N7MA 4TV9A 4FE4A 3ZWDA 2JW5A 4KO1S 4FHEA 3C85A 4MWDA 4ONEA 4YIKA 2C77A 2CB0A 1Z39A 2ZUTA 3RAFC 1ZONA 2UXBB 3GCWA 3GEEA 4R9NA 3GYGA 4DC0A 3G9XA 4DDKA 1DX6A 5AFSA 4D0NA 5J4LA 3OU6A 2K7FA 3VDNB 1UK6A 1YU9A 3VYRB 4FMDF 1K9VF 2X5JO 1T4GA 4TMTA 2VA8A 4XIYA 2G8LA 4BY9E 3HTXA 2CCKA 2RI0A 1J9ZA 3IDAA 1C50A 5CA1A 4JT2A 3UCEA 3HB1A 4M7WA 1PGJA 4NE2A 1OWLA 1J2RA 1UADA 5H3CA 5BSKA 4AB1A 1KARA 4MKXA 3NHKA 1HEUA 4J4TA 1UKAA 1WF3A 1YU6A 3ZJVA 1SD1A 4F96A 1QGUA 2YZMA 1B8PA 1UEJA 4JI2B 2HQOA 4EW3A 3V1UA 5LBIA 3AUAA 1WU8A 5U9CA 4X44A 4ZO7A 2XCSB 5B1HA 1UQUA 4XM0A 1XQVA 2FWMX 3UJDA 1NJ2A 1MH1A 3AESA 1HWYA 3C3CA 3VR3A 1TL7C 2QUAA 3AV3A 3CLTD 4WCDA 3WC4A 2ZREA 2XMDA 2XNSA 3OC6A 4UULA 3P32A 1V8ZA 2OQVA 1YONA 4DCNA 3I3SR 4CLRA 4ABTA 2JS7A 1I14A 3FPCA 1AO3A 1UOPA 1YKFA 5B7QA 4WKNA 1SVMA 5E1OA 5FLEX 4JLSA 2F62A 1R6AA 4WZAA 1K89A 4C14A 2RKWA 2O8DB 1PSWA 1WTAA 3QVSA 4L08A 1N5OX 1M7HA 3CSDA 3ANXA 2YV2A 2HQBA 3HR4A 2X77A 4R2JA 3BBLA 2BH9A 4K0KB 3SX2A 1ZNXA 4L6AA 3BH6A 2JIZA 3V46A 3OPYI 4WESA 1WM1A 2BHSA 2H51A 1GGVA 1JQ3A 1NWCA 2BBOA 3HDGA 1WCXA 1Y9JA 5AWFC 3DO5A 3SQMA 4AUKA 4C7VA 2XTZA 1E59A 2GZDA 5J3JA 4GE3A 1PG2A 5EMLA 4D4GA 4WFJA 4WKOA 1DIBA 5BYKA 2O7NA 4AJEA 4RGBA 5BT9A 1XMPA 3UKJA 4EFNA 3UMSA 3HB5X 1O77A 2FX2A 1CEQA 1WEKA 4HG2A 4V02A 1Z74A 5AKJA 3SI7A 3FYUB 1X1TA 4B3RB 4ZO9A 2RHTA 2V55B 4KLRA 3TL2A 3ZWXA 4ZCMA 2Z6AA 2C9YA 3BGDA 1ORVA 3GD7A 3TCNA 5JZOA 1NOIA 1BJTA 1DXHA 4K6OA 1JR3A 2X9GA 1IB0A 3LZ6A 4KJXA 3UQZA 2VVTA 2CL5A 2XUOA 3EW7A 4Z3DA 1EHCA 4UJ3A 2WJPA 2EARA 3THYB 3WMEA 3OIYA 1PWXA 3TW4A 5K03A 1RAIA 1MIHA 1ACJA 2R1ZA 4XB6B 2UUOA 4EUHA 2CF5A 2HU7A 3I4LA 5ITSA 8ATCA 5K01A 3ONEA 1QIHA 4BNMA 1ZICA 3G0OA 5JW6A 3WP1B 4TYPA 5IN4A 3LP8A 2UZ3A 3MVEA 3OIFA 5BSTA 1QJ4A 3AUKA 3EIHA 3UWSA 4LDAA 1T8UA 3OM8A 4OOEA 2WPDD 3DDCA 2VJMB 2XT9A 3RJMA 4CLHA 3LLCA 1DE0A 4MPJA 3WYBA 2QTMA 2R8OA 2XGSA 5CFZA 1Y8CA 4OMUA 1JZQA 3HM9A 1N2IA 4B6RA 3QEJA 2H65A 3NVMB 4GZLA 4BRSA 3VO1A 5KU7A 1GQRA 5TT0A 1XDDA 4X3PA 5DX8A 5T6MA 2OCAA 4RF4A 2O8DA 1CS0A 3CZCA 1T4CA 5A9RA 4GM1A 1T2VA 4IV8A 3INTA 4NCIA 4AUMA 4TVSA 4XH9B 1HYBA 1XAJA 5FI3A 1O5TA 2RB4A 4HLCA 4LSMA 4CZ2A 2QQ5A 3Q5DA 1Z2AA 2O8VA 3QELA 3ZWCA 1O6BA 1ZD1A 3HCRA 1O08A 3EGIA 5HF6A 3ZGXA 4AUNA 4A2QA 2XUQA 1A27A 3N7AA 2H9IA 3DZDA 3PFFA 2BC9A 2OC4A 4JR2A 1ECBA 2ZAGA 1LLFA 3IVGA 3L7AA 3X44A 4BNWA 1DBWA 4RQBA 2L2QA 4AJJA 1T4MA 4CG0A 2O48X 4P4TA 1QS0B 4QD3A 3WZ2A 4EYSA 2JJMA 5LUAA 2GF0A 3IS3A 4EKDA 5J1SB 4E22A 2F64A 1APBA 3F9RA 2XTJA 5LU9A 5KDLA 1KEPA 1ZK0A 4C6TB 3RTCA 3LECA 5KYWB 5IBCA 1C9MA 1MJGM 3HU1A 4YRAA 5JY1A 2H7XA 4GDMA 2QN9A 1V1MA 4FYKA 2NV6A 3LYHA 2WB4A 5ALEA 5IC4A 2ZYWX 5F76A 4JGBA 2IYXA 1IY1A 2NXEA 4BNYA 1HH4A 4CG3A 3U9TA 1A9PA 2FX3A 4CLDA 1E4EB 1Z4MA 1YRLA 2ZETA 1ZUHA 2LIVA 2Z43A 3N07A 4MJ7A 5EKUA 3OC0A 4G84A 1CE8A 4QUAA 1W75A 5IC6A 1U0BB 2W83A 2QMQA 3QA9A 5ENVA 2A33A 3UAYA 3RAGA 4O2LA 3NRCA 2BOVA 4ZI5A 3ZK7A 2JFBA 1JHPA 2GEUA 2I6XA 5CG2A 3ABOB 1I1QB 4UCWA 3PHGA 1V3VA 1NW7A 1UBTS 5A6SA 2GEKA 3QBDA 2DUJA 1UWKA 5EMMA 4ANFA 3W5AA 1T3SA 4YCLA 2RAVA 4ZT4A 4PRZA 1T3GA 4XCQA 2YHAA 5T41A 4I1VA 3MINB 4EI9A 5FYQA 4C4AA 2IHNA 2ECKA 1G66A 2HKIA 1A9ZA 3LUHA 1JWAB 1QH1B 3VPDA 3WHPA 1BWSA 1E92A 2PN1A 3C8UA 3PXBA 4QO8A 1T2CA 1YACA 5AQEA 4UM9B 3CUTA 1E4VA 1YD7A 3GGDA 1B43A 1RVDA 1TU3A 1CY8A 3EHDA 4NEQA 4YP9A 4FLEA 4I5IA 3VPSA 4E12A 4C4SA 1W1UA 1X19A 4YALA 1JKMA 4YRKA 1ULUA 5FAXA 2YWDA 4CL0A 1T35A 3R3ZA 1CIJA 2EJWA 3MJFA 3H16A 4YI5A 3SX0A 2DH5A 2HC9A 1RLJA 4DBLE 4EG6A 4EG3A 3FAKA 2CLCX 4LYDA 2GMWA 2FPIA 2XAAA 5EQDA 4ETIA 3GK3A 5A1TA 2QXUA 4K46A 1IN6A 1ZC4A 4XWTA 3MC1A 2Q1XA 2GGSA 3G2LA 5E0OA 3BWEA 3OLVA 4LRTB 2Z5LA 5KYXB 4MMYB 2G25A 3Q85A 4QUGA 3RVBA 4J6FA 3SHTA 1Y8QB 5ESWA 4HDNA 4JJ8A 4E5YA 1LTKA 3MMSA 1XXHB 3OX2A 1R0SA 5FFMA 5JISA 1M2OA 4FI3C 1C0LA 1C80A 2B4YA 3E7WA 2HCJB 3BX1A 1E9DA 1NMZA 1O0SA 2JFGA 3D3WA 3GGCA 4MKRA 4RA9B 4X92A 2YMPA 3MYRA 3GLHE 1A1VA 1G8KA 1PT8A 1VKNA 2G76A 4F4FA 1E4YA 5LNK6 1ITZA 2G40A 4QPCA 3B2NA 3T6KA 2BGRA 3G7UA 4WADA 3ILVA 2IOQA 4J91A 3A14A 3ASUA 2PUBA 4JJKA 2F1KA 4IVRA 4MV8A 2CFSA 1GU0A 1YGPA 1QPGA 3FH0A 3WDLA 5D5QA 1SKQA 2R8XA 2G0AA 3EIFA 3EXEB 1KZHA 4L8VA 3H87A 4M3NA 5I8ZA 4A26A 3TIXB 2XWQA 5HM6A 1HG0A 1KZ9A 3MCZA 4M49A 4NLLA 2IEYA 4MR8A 1ORTA 4PTLA 1YOVA 1GPH1 1NQUA 4EH1A 2DM6A 1QU3A 1W25A 2JJ2A 3ED5A 2Z09A 3KRTA 5GOZA 1KBZA 1CUVA 4FK8A 5KQPA 5LOVF 5ELLA 5CFRA 4P8RA 2ZBFA 4R54A 1AB6A 2VP4A 3HZHA 4AG3A 3DHWC 3JV7A 1GUDA 1N34B 1GZVA 3LWNA 4PYLA 1GVHA 3O84A 2E4AA 3FNQA 5CW2A 4BMOB 3SBDA 4QOFA 5FFFA 5BMVB 3BCRA 4XLLA 4DIUA 1E79D 3H5WA 4Z4CA 2J3MA 2J67A 2DT8A 2OORA 2OVBA 4N8DA 3TLYA 4X24A 3S44A 1HKHA 1U0SY 4EENA 3UA4A 4V1CI 5JNUA 2ZYSA 4AJ9A 3UGJA 1PNRA 4YRGA 3AHHA 1J97A 2B8NA 1LPBB 4IO1A 3RYFA 2IITA 4WD3A 4MV0A 2YVKA 5KJ6A 1WQ4A 4N9QA 1SBQA 3DNMA 1VB5A 4F5WA 1FZQA 1EBFA 2QN7A 2YWBA 3HG7A 4IBOA 1DBRA 2GASA 2QENA 1ODTC 2W58A 1BJKA 2V4UA 3BIOA 3TW0A 3EDRA 4BNIA 3ER8A 1ZISA 1SXPA 1YCGA 3NWPA 2ZXEA 3R3UA 1DB3A 1PJ4A 4M1MA 3SEQA 2CWDA 3IT3A 4AF8A 5B2FA 1UFQA 4GR9A 1Z6GA 4K9MA 1UM8A 2C5SA 4FSDA 4GGMX 3VA7A 2PPVA 3ORQA 1TUIA 3JXEA 1FS4A 9GPBA 2QL9A 1XXHA 1J5EB 5INTA 3OVMA 4BFXA 4KAXA 2C4WA 1YZFA 5JI2E 1W52X 1SK8A 2EHJA 1AUPA 5K1ZA 4L4RA 5KMGA 1ZH2A 1SCAA 3FW1A 2ZIZA 1KKLA 5B55A 1HL3A 1X2EA 2A9KA 1UC4B 3HP1A 1UK9A 3A9SA 1FNMA 2KYRA 3BK7A 3KNZA 1A71A 4GO1A 5CX4A 3KB6A 5F7OA 5A5FA 1OW3B 3R5FA 2J48A 3JWIA 1NV9A 3DE7X