3G8YA

Crystal structure of a putative hydrolase (bvu_4111) from bacteroides vulgatus atcc 8482 at 1.90 a resolution
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
391
structure length
391
Chain Sequence
GYQPEKHAVVKSDRGDGRLLSTYAIVHEMLKDTHPQYAYRSGMSAQEFTQWQDGVRAAMVEIMKFPEIKRQPSPVCVKTEKKEGYILEKWEFYPFPKSVSTFLVLKPEHLKGAVPGVLCIPGSGRTKEGLVGEPGICDKLTEDYNNPKVSMALNMVKEGYVAVAVDNAAAGEASDLECYDKGWNYDYDVVSRFLLELGWSWLGYTSYLDMQVLNWMKAQSYIRKDRIVISGFSLGTEPMMVLGVLDKDIYAFVYNDFLCQTQERAVVMTKPDKENRRPFPNSIRHLIPGYWRYFNFPDVVASLAPRPIIFTEGGLDRDFRLVQSAYAASGKPENAEFHHYPKFADKAVRKDVEHLDEGLDSKTYFEAVNVDPPSHYFKNELVIPWLRKVLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SusD/RagB-associated esterase-like protein
publication title Crystal structure of SusD/RagB-associated esterase-like protein (YP_001301335.1) from Bacteroides vulgatus ATCC 8482 at 1.90 A resolution
rcsb
source organism Bacteroides vulgatus atcc 8482
molecule tags Hydrolase
total genus 124
structure length 391
sequence length 391
ec nomenclature
pdb deposition date 2009-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12715 Abhydrolase_7 Abhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3g8yA00
3FLAA 1WB4A 1PV1A 2AJ8A 2XUGA 1TRHA 2WIDA 2XB6A 3M81A 4H7EA 3R3YA 2AJBA 5KREA 4Y2UA 1IZ7A 1UK8A 2QT9A 2WG2A 2C5FA 4FNMA 3MUOA 2ORYA 1XZAA 1DX4A 4BP8A 2J3QA 3I1IA 2O2GA 3OTQA 1VKHA 3FVTA 4BAUA 3FYUA 3ESCA 4HXEB 4AO6A 4XWGA 1GPKA 3EQ7A 4OCZA 2ACEA 1QIHA 4TPKA 2YXPX 3U1TA 1YA4A 4OU4A 3E4DA 5JADA 1CR6A 4H7KA 4AO7A 1X2EA 1C7IA 1WOMA 2DCMA 1TQHA 1QOZA 1XRLA 2ACKA 1AMNA 5EI5A 4B0PA 3WK6A 3F8SA 1XKLA 3LCRA 5HZGA 5K3DA 1QIDA 3O95A 4A5SA 4H7DA 2H9YA 1SC9A 1UWCA 2WIKA 1XZJA 2G5PA 5JAOA 3IUJA 3HZOA 2XMSA 4DNPA 5CXXA 2WUDA 5IVKA 3GELA 4K6HA 1ISPA 1XRRA 3WK4A 3GA7A 5FPPA 2XMZA 2AJLI 1JI3A 4DMFA 4AMYA 2AXEA 3PUIA 4U2DA 2BGNA 3FYUB 4J7AA 3QPDA 4Y2TA 2WUFA 1E8NA 5DYTA 4Y9SA 4M0EA 5I7UA 2JGMA 2I3ZA 2GBIA 1BCSA 2JGEA 1TCCA 1XZBA 4X92A 3RLIA 4U2BA 4I4CA 2H7CA 2ZSHA 4OPMA 4X90A 1IUNA 4DMHA 4G4IA 1CUWA 3STUA 1HQDA 3FVRA 5ALEA 4G8BA 4G4GA 4U2CA 1VXRA 3FSGA 2WFZA 4K6KA 2PL5A 3C6ZA 1U2EA 2PSEA 1GZ7A 4P08A 5JD4A 3LIIA 2VA9A 2PSHA 1EH5A 3N0TA 5IH7A 1CLEA 5EIAA 4P92A 5ALVA 4BAZA 2QVBA 2C0PA 2BUCA 2XMBA 5JANA 3G0DA 3R3ZA 3QZUA 2ZYIA 3OM8A 3ZLVA 4DGQA 3B3QA 1E3QA 3D2AA 1ACJA 3GZJA 1X2BA 1L7RA 1ZOIA 2X5XA 1CFJA 4DLNA 4FHZA 4AZ3A 2WIJA 1Y7IA 3EF3A 3C5VA 4QE3A 5CT8A 1DWQA 2OGSA 2HA3A 1VOTA 1WM1A 5AKXA 3S2ZA 2QM0A 1CUUA 1UOPA 3BF7A 5AKEA 4IHAA 3QM1A 5KWIA 5HF9A 1CUVA 2Z3ZA 2PKYX 1UK9A 1QTIA 3W2TA 2HFJA 1XZEA 2HRRA 1FFBA 5EHNA 4CG3A 1BS9A 3W9UA 4C4ZA 4L0CA 5ALKA 1QO9A 1CUBA 1W75A 4N8SA 1SCIA 2O2IA 4Q82A 1MJ5A 4B9AA 5H3HA 5AP9A 4LIPD 4FFVA 5LZ4A 1P0QA 3PF9A 1WCYA 2PBLA 7YASA 2P8SA 3P2MA 2WJ3A 4MQMA 1F0NA 4Q05A 3WWPA 3OOSA 1MX1A 2XUFA 3UMJA 1LPBB 1FFEA 4MWSA 5CBKA 1VJ5A 1TKRA 3NUZA 4MQLA 3WLAA 4B0OA 5C7YA 4UHDA 4BCDA 2XQIA 3WL8A 5EHXA 5K3FB 4BVJA 4W9RA 4Y2QA 1ZICA 4UFNA 4CIAA 2HA5A 1Z68A 3TJMA 3V1MA 2CZQA 4J3JA 3K9BA 1F8UA 3QPAA 1UOOA 1UXOA 2XUQA 3C8HA 4J0CA 4FWBA 3G9XA 2DHEA 4JNCA 2HL6A 1G5FA 3NGMA 4MEAA 5AKJA 3H18A 4EY7A 2HA7A 1ZI6A 2OCLA 4WJLA 1QGED 3L1JA 4I19A 3WKBA 1HKHA 3G0BA 4UBLA 4AX4A 2DHCA 3WWOA 3HYSA 5DNVA 1E8MA 2G63A 2BCEA 1ORWA 1CQZA 2JEYA 3AIMA 5F4ZA 1YS1X 4FKBA 3EQ8A 3B5EA 2ZYHA 2XUHA 1LGYA 3I2JA 4H0CA 4J0DA 3VKFA 4QDUA 2WLSA 4WFKA 2E3JA 1EK1A 3LP5A 5HFNA 1ZIYA 4F21A 4ITVA 4WDQA 3A6ZA 1QIFA 5A7HA 5A62A 4ZV7A 4EBBA 4MEBA 4DNQA 3BJMA 1XQWA 2C7BA 3H2IA 2QMQA 2XUIA 3H2KA 2I03A 1RYYA 2O7RA 2HU8A 3CXUA 1TCBA 3STTA 3I2FA 1QIKA 4LYEA 3ILSA 3H1BA 5HK8A 3HLKA 1VE6A 4AB1A 4UHEA 3C45A 1JT2A 4GW3A 5HQ3A 2JBWA 2OXEA 5T4BA 5CT9A 5HFAA 5JARA 3WI7A 1UKBA 2W6CX 3M83A 5ALRA 3D0KA 1N5RA 4X6XA 1AGYA 2DSNA 4AQDA 1BN7A 3HABA 1CUEA 4ROTA 4H7HA 1H2YA 3KXPA 1VA5A 4E11A 1GQSA 2HA0A 1UT6A 5K3BA 3GBSA 2HM7A 4PF1A 1BU8A 1XZFA 4Q3OA 5T4HA 3C5WP 5AHXA 1EI9A 5C8XA 5EGNA 1ETHA 3I2IA 3PDCA 3R3VA 4H7JA 4Q3KA 1GT6A 1B41A 2IITA 4Y2SA 3F97A 2ZSIA 2WFLA 3WWCA 5ALZA 3C6YA 5JD6A 5AJHA 3D7RA 1QE3A 2QJWA 4G1FA 4XX1A 4C6HA 5LZ8A 5ALGA 3WZLA 2D0DA 1DWPA 2GYWA 2OQVA 1JU4A 4V2IA 1S8OA 3G7NA 1YASA 1H2WA 3WKAA 4P9NA 1EDEA 1ZGBA 1EXWA 4UHBA 4B6GA 2WUEA 4BTVA 4RGYA 1G42A 1JMYA 1MNAA 3ICVA 2XUPA 5AK4A 5FLKA 4L3WA 2BGRA 3H17A 2WJ6A 4G8CA 4KE9A 3AFIA 3DS8A 1ZD2P 3AZPA 5FOQA 1T2NA 4DIUA 4Y2PA 4LYDA 1A8QA 1CEXA 4BATA 1WB5A 4QLOA 5E2IA 2X8BA 2DR0A 1MNQA 4RE6A 1DT3A 3G0GA 3H2JA 4BP9A 3DDUA 3PFBA 4AN1A 2B20A 2B61A 5BOVA 1W76A 4IQ4A 1XZIA 4C4YA 4E14A 4H7FA 4GWLA 5ALIA 2ZYSA 1CV2A 2ECFA 3H19A 4DTCA 3MUNA 2Q0XA 3FLBA 5JYCA 3HEAA 1A7UA 5HKAA 1ACLA 1EINA 1CUHA 3SK0A 2PU5A 4WCVA 4QNNA 5EHZA 2HA4A 3O4IA 1UFOA 1THTA 2HIHA 3YASA 4OB7A 4GXNA 2QR5A 5ALNA 4J0IA 5HF5A 4UFOA 4PSDA 1E8DA 3V9AA 4CCWA 4B84A 2XE4A 1T4MA 4X6YA 1N5MA 2VT7A 3DD5A 3MGAA 5CRIA 3G9ZA 1MX5A 4AO8A 2EEPA 1WPXA 2PUHA 2R8BA 3RARA 3DL4A 5JALA 1XQVA 4DSAA 1MO2A 3DKKA 4ZREA 1NU8A 4KACA 4Y2YA 4LXHA 2J4FA 3WL5A 5LKAA 4X71A 5HF6A 5LKRA 4GHWA 1W6RA 2PUJA 4QA9A 3K2IA 3MVEA 4PQEA 1R9NA 4CCYA 3UUEA 3R3UA 5LZ9A 4BCCA 3G9TA 5CH3A 1QFSA 5AK3A 3C43A 2GYUA 4QWWA 4NZZA 3PFCA 1E66A 1FSSA 2WM2A 5BWBA 5LYYA 1HBJA 5HF8A 3I1YA 3KOOA 2GBGA 3I2KA 3E3AA 3WK8A 4EZIA 5K3EA 2WILA 4C88A 4ARBA 2OCIA 4FLFA 4OUKX 2DQYA 4AZ0A 3V1KA 4PSUA 1DT5A 3H0CA 4K5QA 2BFNA 2G5TA 3R3WA 4DMKA 2JGLA 2XUDA 4YX9A 3C70A 2WKWA 5AI8A 3H04A 5ALOA 4ZRDA 2ZJFA 3DOHA 4KRYA 1U8EA 2V97A 4FOLA 1CRLA 2XLBA 1CUYA 4PW0A 5JZ9A 3V48A 2QRUA 3VJLA 2VJBA 2DHDA 1QJ4A 4UPDA 5AOBA 1XRQA 5EFZA 2RHTA 1FFAA 5AI5A 3JYHA 2WG0A 1OCEA 5JZSA 1EK2A 1H2ZA 2XUAA 2XQGA 2XUOA 3KDAA 1B6GA 2QXTA 2XMDA 3I6YA 4JUIA 1M33A 3WWDA 2QS9A 5AKGA 3I28A 3FCYA 2WG1A 4TVKA 5FXMA 5D3ZA 2XMRA 3H1AA 4UHCA 1VE7A 5SYMA 3VVMA 4PO3X 3BF8A 3F96A 4ZGBA 5AM3A 2WQZA 5AH0A 3AINA 4HVTA 1THGA 4H35A 1QIIA 1A8SA 5ALQA 4PSCA 3DEAA 1LZLA 3FCXA 2HU7A 2CEKA 4HXGA 2FUKA 2WHPA 3CCCA 3AILA 2V98A 1F0PA 2O2HA 4EB0A 4RNCA 1XQYA 3DQZA 1EX9A 3I2HA 4BDSA 3AUKA 4OB6A 5KBYA 3BIXA 4KYVA 2PVSA 4EY5A 2RGUA 1J07A 4W63A 3E0XA 5ALPA 3WIOA 1XLWA 3C8DA 2DFPA 2EDAA 2AJCA 4EY8A 2XMGA 5AO9A 2HU5A 1CQWA 2R11A 1W52X 1PFQA 1ZJ5A 5ALDA 1EVEA 1DX6A 4LXIA 3JWEA 4LHEA 4LXGA 3FNBA 4E46A 4MWTA 1R9MA 4DNFA 3ZI7A 5E4TA 4FDMA 4FNGA 1OILA 5JASA 1ZD4A 4EY4A 2O7VA 5JATA 3LLCA 5JAHA 4HS9A 2OAEA 2GYVA 1O6FA 4F0JA 4NMWA 4ZXFA 5AKIA 1CUSA 4YPVA 3GUUA 2WSLA 1TIBA 2WTMA 2WHPB 4KAFA 4HZGA 5K3AA 5ALTA 1ZD3A 3D5EA 5IKXA 2PSFA 4W1SA 3HI4A 5A2GA 3SWWA 3VJKA 5C8VA 1SFRA 1JMKC 4KEAA 5AM2A 1IUOA 1QTRA 4PNZA 4GECA 4YASA 3LIPA 5DNUA 2VATA 1D07A 1UK7A 4S0XA 3W04A 2H7XA 3DCNA 3BE8A 1EHYA 5AKLA 2K2QB 4WY8A 3M3DA 1XFDA 3HC7A 1EA5A 4X3CA 2OQIA 4FLMA 5ESRA 1A8UA 2XLCA 3O4HA 3AZQA 3SC2A 4BE9A 2JF0A 2JGFA 3QH4A 3R3XA 4MYDA 2BAGA 4GI1A 4ZWNA 4C01A 4Z49A 3WYNA 1MAAA 5K3CA 2C4HA 1XRNA 2HADA 4IO0A 1UKAA 2XMCA 1CUAA 5ALFA 1JFRA 3QMMA 5C81A 3WJ2A 5K5EA 4GDMA 1CVLA 5CMLA 1XQXA 4XVCA 1SCQA 2WTNA 3I6MA 1G4HA 1WPRA 3CN9A 4A16A 1EDDA 2ZYRA 4OYYA 2CB9A 1MAHA 4UBOA 3V1NA 1GPLA 1FFCA 5DTIA 3IUMA 4KAJA 1WB6A 4KE8A 5A71A 4IH1A 2OG1A 3A2MA 4QWMA 1FFDA 2WU3A 3KWJA 2OLEA 1E89A 4WFIA 3ZLUA 3QVMA 3KSRA 3DJYA 4TGLA 5AKYA 3ESDA 1TAHA 4DNOA 4KE7A 4BAGA 3VISA 1LPNA 1JJFA 1VA4A 3GFFA 1BROA 1DQZA 2WUGA 5DWDA 2ZJ7A 3BJRA 5AM4A 1CIJA 4B81A 3NOXA 1L7AA 4KR0A 3PI6A 3BDVA 3GROA 2QZPA 4HAIA 5C8ZA 2QUBA 4BZZA 1GQRA 2RIPA 3G8YA 4OU5A 2J4CA 1WHTA 2VJAA 3C87A 1USWA 5ALYA 4DSZA 3WWEA 1ZGCA 4CG1A 1AUOA 2XI4A 1R4ZA 3A70A 2Y2VA 2GZRA 5ALLA 4J0KA 3FOBA 3WKCA 4UHHA 1YCDA 4MYSA 4BCBA 3WK5A 3WL6A 1XZMA 2RHWA 3H2GA 4X91A 5HQ3B 1KU0A 3C6XA 2IIVA 1R1DA 1BEEA 2JIDA 3IIIA 1EB9A 1ODTC 3WMRA 4H77A 2WIFA 1BE0A 3D4LA 1U65A 1SCKA 1JKMA 1PJAA 1I6WA 4QZVA 4X6UA 3WZMA 4OD0A 4UBKA 5CURA 3S8YA 1CUDA 3ZLTA 4B80A 5J3JA 5EHQA 1YR2A 5CT6A 2ZJ6A 1ODCA 2VAXA 4XIIA 1LPSA 2XQKA 4Y7DA 1LPMA 4XJVA 4WDRA 5LP1A 5AI9A 2Z3WA 3L1IA 3QITA 3VXKA 2PSJA 3O9VA 4L72A 3KWFA 1XLVA 3QBJA 5JAUA 2PPLA 5HCUA 1XZLA 3BXPA 2WFLB 1XKTA 3WA7A 2XUJA 3T52A 4JEIA 1P0PA 3STYA 2BJHA 3FYTA 4H18A 4QEKA 5ALJA 3FSGD 1TK3A 5I8PA 1MX9A 5JD5A 5AI6A 1WHSA 1XZDA 1YB7A 4W1QA 4B85A 3L1HA 4BVLA 3G02A 1Q0ZA 5AOCA 2I78A 3B12A 1GGVA 4J0GA 3TRDA 4E15A 1BCRA 4CG2A 1XZKA 2XQJA 1DQYA 3IDAA 2CBGA 3STXA 5ISMA 2Y6VA 2VEOA 3CCBA 1HDEA 3PUHA 2V9ZA 1XRMA 4B7ZA 4MXDA 4MJ3A 4JYMA 3BWXA 4B9EA 2PX6A 3IB3A 5AIBA 1L7QA 4GBGA 2WFMA 4CI9A 1IMJA 4G8DA 4DMCA 4B82A 5JIBA 5DJ5A 3FWHA 3VVLA 4BTLA 3EQ9A 2FJ0A 1LBSA 1VZ3A 4OSEA 4BE4A 3G0IA 5LIPA 1H2XA 2B9VA 4ETWA 5FV4A 1YAJA 3I6ZA 5CT5A 4W1PA 3STVA 3HACA 4Q1VA 4Y2JA 2EDCA 1CUZA 4IH4A 4X93A 4JYPA 4Y2RA 3ED1A 5FUMA 1OXMA 4FMPA 5AM0A 3QMWA 3IA2A 1C4XA 5CT4A 1CPYA 2OPHA 5BWCA 2G4LA 5AI4A 4W1RA 3SX4A 4QDXA 1JJIA 1LPPA 4IH9A 3EBLA 3OG9A 1J2EA 4WFJA 5AM5A 1DINA 1XLUA 1YS2X 5YASA 2ONCA 1N1MA 1JU3A 1QIJA 1QO7A 3W9BA 5HK9A 1XZHA 1AURA 1UZAA 4C87A 4EA6A 3RM3A 4NVRA 3TGLA 5DLPA 2ZVDA 5BV7A 1R50A 1P0IA 3R0VA 3K6KA 4D9JA 3W05A 4Y2VA 2PM8A 3R41A 4HRYA 1LZKA 2Y2UA 1NX9A 2JGIA 2LIPA 4AN0A 1U4NA 1IUPA 4U2FA 4J0HA 5KWJA 4CCYB 5LZ2A 3QMVA 2V96A 4GEGA 5ALSA 4QDTA 5A7FA 3D2BA 1LPAB 4RE5A 5IVIA 4DM7A 1Y7HA 2UZ0A 1KU6A 5AK6A 2OGZA 2WIGA 1F6WA 5EIEA 3AJAA 3OPMA 1VLQA 2GBFA 5E4YA 2QTBA 4Q3LA 5AK5A 1VXOA 3ICWA 1A88A 3BL8A 5DNWA 5FRDA 4ZV9A 4HTAA 2WU4A 3DKRA 5AKKA 3O4JA 2RAUA 2CKMA 4N5HX 1CUGA 5AM1A 1JJBA 2FX5A 3VDXA 1CUCA 1YB6A 2VJDA 1Y37A 4BRZA 3N2ZB 5FDFA 5AKZA 4UFPA 3OC0A 1XZGA 4J03A 3WJ1A 3WQHA 3PF8A 4C89A 4HXFB 3O4GA 2VJCA 4K2AA 4EY6A 4BVKA 4P93A 3IBTA 4G5XA 1ZJ4A 4G9EA 4X7BA 2QKYA 1X70A 1P0MA 3VJMA 1ZIXA 1XZCA 1RWQA 2HDWA 1IZ8A 5IVHA 4M0MA 3ZV7A 5LZ5A 3D3NA 5ALXA 1K6EA 3FAKA 1ORVA 1AC5A 4CIBA 2JGJA 5K3FA 1K63A 1LNSA 2IX9A 5CH5A 3G9UA 4X94A 4ZI5A 4AXBA 3I2GA 3IURA 3ZWQA 4X00A 5D7BA 2W22A 4YK7A 1EVQA 2HHAA 1AQLA 4FTWA 4UHFA 3M82A 2XMQA 4A23A 1G66A 4C4XA 4J0JA 2Y1KA 3CN7A 2D5LA 3QYJA 4U2GA 2I3DA 2XT0A 3ESAA 3IVMA 5FPQA 2HRQA 1H23A 2VQ6A 3C6BA 1ODSA 3W06A 2PSDA 3PICA 4UBMA 2CMFA 4EUSA 1K8QA 4KE6A 3DNMA 1VZ2A 2JEZA 4F60A 2RONA 4QDOA 1MPXA 5ALWA 3FBWA 3D2CA 4O08A 3WYDA 4BC1A 3F9CA 3A2NA 2DQZA 1AZWA 1O6GA 3ESBA 1K5PA 1LPOA 3JW8A 4FBLA 2CJPA 4UBIA 1YSCA 2H1IA 5CXUA 2XUKA 3WIBA 3IULA 4H7IA 4N8DA 1UOQA 5CW2A 4QLAA 1CUXA 3X3HA 4OYLA 4G9GA 1CUJA 3R40A 5DYYA 1GXSA 4Y2XA 4RPCA 4KAAA 5JAPA 4G4JA 4KRXA 4U2EA 5D6OA 1H22A 5ALHA 5AIAA 2Z8ZA 3AZOA 1R3DA 3EIOA 2HA6A 2X76A 3HSSA 2B4KA 3T4UA 4BB0A 5AICA 1BEZA 3O9MA 1ZI9A 3RKSA 5T4EA 2Z8XA 5SYNA 3PE6A 2C58A 3DYIA 2YYSA 2JGKA 2VT6A 2J3DA 3WK9A 5ALUA 1J1IA 2RI6A 1CUFA 1GKKA 2PU7A 4ARAA 3HXKA 1MN6A 2FJPA 3V1LA 1Q0RA 2AJDA 3WL7A 3HJUA 2OCGA 1Q83A 1XRPA 3FLEA 4M0FA 1QIGA 3HRHA 1FJ2A 4BDTA 3DOIA 4FLEA 4BC0A 1AKNA 1Q84A 2OCKA 5EIHA 1KEZA 4UBNA 3ANTA 2ROQA 4FFWA 4K6GA 2GZSA 2WJ4A 1EDBA 4KJXA 3RK4A 5ALMA 3NWOA 1MT3A 1LBTA 3WA6A 3IUNA 2CUTA 1HLGA 3WKDA 2QXUA 2VSQA 2WHQA 4CFSA 3STWA 1N8SA 1NU6A 4PV7A 1BN6A 6YASA 3BIWA 1UK6A 2Y6UA 4HRXA 2VTVA 1RP1A 5AOAA 1K4YA 1MTZA 1ZD5A 3DYVA 2OAGA 5AKHA 3Q0TA 4DYHA 1HPLA 3A2LA 2BKLA 3ZPXA 2C0QA 2QJRA 2HFKA 4AMZA 2XQFA 1DU4A 1GPNA 4GLBA 4BZWA 3AIOA 3WKEA 1CUIA 4F5ZA 5A6VA 2OGTA 3G0CA 3U0VA 5FP0A 1W4LA 2VF2A 5D3KA 2QOEA 4EHBA 1IVYA 4OB8A 5T4FA 3O0DA 1QZ3A 2HA2A 5AI0A 5FKJA 3AIKA 5IVDA 3LS2A 3E1GA 3WK7A 3BDIA 2WHRA 1TCAA 2BUAA 4NS4A 4B83A 4INZA 2C5GA 3OURA 1ZI8A 5HKBA 3F67A 3QPCA 4X97A 1QLWA 1QIMA 1UKCA 4UBJA 1R88A 5LLSA 3DLTA 1C7JA 5I9IA 2YH2A 4LKOA 1QONA 1EB8A 1W1IA 3ANSA 2NW6A 4UUQA 3DL7A 1LLFA 4N8EA 1YAHA 1BRTA 5JZBA 2Z5GA 1AX9A 3F98A 1QIEA 2XDWA 1DWOA 5DTJA 3H2HA 5E4JA 3IUQA 1SOMA 3D59A 4Q34A 1YA8A 1HL7A 4QDZA 4BRSA 2H7YA 1J06A 3Q8WA 4I3FA 4N5IX 2YASA 4JH0A 5CH8A 5LZ7A 4X85A 1XROA 2VAVA 4WY5A 4BBZA 5CTAA 3KD2A 4BYMA 1QFMA 4L9AA 4FBMA 5DYWA 5A7GA 1E5TA 3FYUC 2BUBA 2QUAA 1GKLA 2ES4A 4X95A 3UUFA 1DTEA 3TEJA 2GBCA 1MU0A
chains in the Genus database with same CATH superfamily
3FLAA 1Z3IX 1C9KA 2AFRA 4K9LA 4MV6A 2P9CA 1YI0A 3QKSA 2AJ8A 4XSVA 3GUVA 5JBNA 1E99A 1Z8DA 5JRDS 1DDOA 1TRHA 3Q7PA 2XB6A 1U9CA 1AU9A 3KD3A 4JMPA 3RU7A 3HZZA 4M86A 3L41A 4HQFA 4CL3A 1EDZA 4H6WA 1G38A 3ESQA 1O58A 3UV7A 1SG6A 1ZG3A 2XXBA 4MIEA 4BLRA 4KFUA 2J32A 5KREA 1DEOA 1M76A 4JLSA 2BKUA 1T0PA 1J2RA 3ESZA 4XM2A 5IZCC 1LS6A 2OOSA 4ES6A 3IIKA 3IR7A 1U6KA 1UZMA 3QI2A 5JRZA 5BYAA 3VR4D 4NYJR 1AQJA 5CVVA 3NT4A 5COBA 2FLWA 1Q0TA 1LRLA 1NNLA 4FNMA 4LN1A 4CNBA 3TGPA 5CXQA 3MUOA 2ORYA 4KZKA 3TQHA 4ILEA 1V39A 4RJJA 1V1MA 4KUEA 1M2FA 3I1IA 4J4BA 4L3OA 5DHSA 1I6LA 2VNHA 4UUOA 3M6XA 2XCUA 3B53X 5DDIP 2QN7A 2BCGY 4ZCPA 2HRBA 3LUFA 4D4IA 6NULA 1Y6RA 2RGAA 5FFNA 3T8YA 3FYUA 1FLDA 3G49A 4L8VA 2NQ2C 2XADA 2ZTMA 3THYB 1TQ2A 3OMLA 5J59A 3ZD7A 2XYHA 2BEVA 3PVSA 4AS2A 1NMZA 2QL7A 3DEJA 1V8ZA 3JYQA 3M0EA 5EVJA 4AROA 1EGMB 1ENYA 3UT6A 1S2LA 5ELLA 4JB0A 1L5MA 4BGDA 2ACEA 3U4QA 1ZAYA 1QIHA 1MABA 4KDRA 4QU5A 5TEWA 5TXGA 1P1RA 1RKQA 1V96A 1HGXA 1Y9EA 2FK8A 4OU4A 4RF3A 3U1TA 2XDYA 4L7QA 1J8VA 2J08A 2YRWA 3BHIA 3EXHC 3R5SA 5GM1A 4NG4A 5DYGA 1HURA 4KSBA 1OVMA 3NB0A 3JQAA 4QXQA 1Z8FA 1WOMA 4BLUA 2GK4A 4RCYA 3E9RA 1N6PA 3UV3A 3OCWA 3KKEA 3L7JA 2XRYA 2WI8A 3MYYA 4OHXA 3TR5A 2PUEA 1LY1A 3F8SA 2BP7B 4A0FA 2UXDB 1KYYA 1XKLA 2ZRQA 4R1QA 4MDFA 2R8RA 3KEGA 1TO2E 3L79A 5HZGA 1K5HA 1R00A 5K3DA 1UFQA 2AMJA 3JQ9C 1ZINA 1QIDA 4Y6PA 5M7EA 1RYHA 2H29A 4XD7A 3PDIA 4L5BA 4YRCA 4CQNA 2IZ6A 3IB6A 4PYNA 4JCOA 4W5HA 4TTTS 1TZBA 1M8PA 2H9YA 1O5IA 1UWCA 3RIXA 2G5PA 2A5YB 1ZZEA 2B94A 1SPBS 2XGGA 4GXTA 4JP2A 1HDGO 4DLVA 4LZWA 2B2CA 3II6X 3GZTB 3OPXA 1T3HA 2XYPA 3GELA 5FO0A 3HFSA 1O6CA 1ODKA 3PNSA 1ISPA 4QJ4A 3WK4A 2NVOA 5GJCA 1W25A 2VYVD 4B31A 1GYPA 1ZCZA 4L4RA 1J5XA 1QR2A 4OJKA 4JI7B 4U7WA 4LF6B 4NU5A 4NBTA 3FPHA 4BTEA 2GQ0A 2WWVD 2O1XA 4BLWA 1JI3A 3FPGA 1E4EA 1EQUA 2BTQB 2AVNA 2WNSA 1LLCA 1CE8A 3F46A 2QP4A 3OFJA 4Y2TA 4K26A 3IODA 4GX0A 4HB2A 1QF9A 3F3KA 5KYXB 5FBKA 5BWMA 4LWOA 5K4HA 3G59A 5DYTA 2RHGB 1DRJA 4N18A 3LSTA 4F6LA 2ZQ5A 5L9AA 4R1TA 3D7MA 3NQ41 2ZR7A 2GT1A 1CY7A 2GBIA 5DNCA 1K88A 2GD2A 4Y1FA 3GLIE 2XOXA 3V00A 4QYIB 3WGIA 4MKGA 4LVCA 2YIJA 4YCDA 2MJLA 2H7CA 4MNTA 3EVZA 1R6VA 3K0KA 1NP6A 2X8AA 3I5XA 1D0IA 3H2SA 3QEKA 1XXHA 3Q9LA 4HGNA 1OLSB 1JKXA 3KKQA 4IDFA 5ENVA 4CQMD 2NZUG 4JT9A 3KQNA 3C3EA 1BS1A 3OPYB 1PLLA 4N5NA 4YJ3A 4YVFA 4G4IA 4Q1EA 2AGVA 5BNFA 3X1WA 1A9XA 2XZOA 3MJVA 4PQYA 3T5BA 3FVRA 1PSDA 1GCIA 1A8PA 2FSUA 2PFGA 3L4BA 3Q3IA 3BD9A 3DGEC 1JW9B 2A6PA 1OZAA 1GO2A 3OJEA 5ALEA 3LWNA 3RANA 5AJZA 3HP7A 3T1VA 3WGNA 4G8BA 3LLUA 1Y8QB 4G07A 4QSHA 3VZQA 2PAFA 1K27A 2OOKA 4C6SA 4IAOA 2DM6A 2FU5C 1PBNA 2NNWB 2X3UA 3O8OB 4XDZA 1DCKA 1WZIA 4DWJA 4WEOA 1OKKA 1CY2A 2CVHA 3DWIA 2PL5A 1E2QA 1T1GA 6ABPA 2V3VA 3RVDA 5C5IA 2IYVA 3OLCX 4I4LA 1LQTA 2QRMA 1KVRA 2QN6A 3WAJA 3W3AA 4P08A 4R1PA 2QGFA 3U5TA 1HQCA 4R8VA 1HT3A 4I46A 4C4TA 1L1QA 1AHHA 4KGVA 3T9BA 3JR7A 4WY2A 1RYZA 3CWCA 1EH5A 2WICA 4YT2A 4QGSA 2H85A 1YC5A 3B9PA 1W6UA 5D8DA 5LP6F 2QEQA 1QYIA 4P92A 4X3OA 5DM2A 1VPVA 5EIAA 2G83A 3WNVA 1QG6A 2F90A 2GARA 2PL1A 4DZTA 4EYKA 2QVBA 2QRQA 1Y3HA 2C0PA 1T5HX 1YRHA 1ISRA 3IV6A 2QZJA 4V0SA 1RDFA 4ZP1A 1JSCA 3VZPA 3K5WA 1OE0A 3G0DA 4YREA 1KJ9A 3PG5A 1V11B 4EMBA 2VF4X 3ABSB 3EXHB 1E5DA 5IC4A 3KZ1E 4C5CA 3WDSA 1NNI1 4ZDKA 3ZLVA 3D2AA 1O94C 2W11A 1L8OA 3GZJA 4BEVA 4N4AA 4DLRA 3OT5A 5JCOC 1OC4A 4EG7A 3W5BA 3FBGA 4QDKA 4Y6GB 1VLMA 2AEMA 4OHPA 5JVDA 4DLNA 4AZ3A 5IJ0A 1Y7IA 3ENWA 3GFQA 4FEEA 1OFTA 3SXUA 2NACA 1DWQA 2D3TA 1CG6A 4PXSA 3GT4A 2H1LA 2A1UB 1GUAA 2C88A 1L4BA 1U0SY 4IX9A 2YINC 3DGFC 4OUDB 1VKJA 3F47A 1IXKA 3NT2A 1WM1A 3LQ2A 2GCOB 2W2LA 1NSTA 3MUFA 5AKXA 2CVQA 1CUUA 1TF5A 3L5KA 3AOGA 2R8EA 3BF7A 3F5QA 4IHJF 4HT3B 1EXVA 1IBKB 1SXJA 3EDOA 1CUVA 1C8VB 1EM8A 1QZTA 1R8SA 2BFDA 3F8WA 4D4MA 1N78A 5EA2A 3BBPA 2AMLA 4F7DA 5TDHA 3A26A 2OHXA 1FFSA 3IP7A 3DVSX 4G0OA 1TLLA 4M6WB 3W2TA 5IANA 2O05A 1OF1A 2FKAA 3N8DA 1CXZA 1I14A 2X9LA 1XCJA 2H2DA 3PNPA 1VPDA 2HRRA 4Q7MB 5CX4A 4FE3A 4ZKDA 3TLZA 4JYZA 3ET4A 1LU9A 3FY4A 4CEHA 1P1IA 2O2XA 1UPAA 4OIFA 1V5FA 3UICA 1G1AA 5FPKA 2LUOA 2OHVA 2MHCA 4OAQA 4IILA 2D7DA 1WW3A 4WX2B 2JAXA 3QBEA 5C3MA 3D3JA 1TA4A 1CP2A 1PHRA 1PF7E 2CNDA 1CEYA 5DASA 1SCIA 3OJXA 1FDIA 1PJZA 3ZWVA 1Q2XA 5GQSA 4WNCA 5EUQB 3DT8A 1XE3A 4FFVA 4XLZA 3P9CA 4JLWA 2YW2A 4YT5A 4NKRA 2WTUA 5LZ4A 1DTWA 2GJSA 3OCCA 3JAWA 1L3CA 3M4JA 4O4LF 3QVKA 1C8LA 2PRIA 3VAYA 2QUHA 2YJGA 2Y1DA 5F23A 2F64A 2PBLA 7YASA 2NYUA 4TKUA 3HVIA 3SMVA 3CKLA 3AERA 2WJ3A 3HKDA 1F0NA 4MQMA 4Q4HA 2JGRA 3E23A 3NEPX 3WWPA 1Y1QA 3R0JA 4QJ3A 1VJRA 1FYDA 5HVNA 2R25B 3EJ6A 1UXIA 2ON6A 2D5IA 4O4LA 3FNRA 1ONBA 2WSMA 2VL7A 3EMVA 1FFEA 1WOYA 1AN0A 4E94A 4MWSA 5CBKA 4FOPA 1TKRA 5DBIA 4WAUA 5E6SB 2HDNB 4CKEB 1OFVA 4BCDA 2Q6TA 4LJYA 1SXPA 3IO3A 1I0ZA 1E5XA 1XVVA 3JVUA 1KXZA 2FPUA 4C7BA 5EHXA 3COVA 1R4MB 1KHHA 2RBEA 4XX0A 3EVAA 3LGSA 2NP7A 1CEEA 3CE9A 4H3VA 3GEMA 1PR1A 2Q3DA 3B3FA 2ESRA 1VL5A 3TRJA 4PGFA 3ZGOA 4DLTA 5JRJA 2H0AA 3ESYA 3PUJA 1R0CA 1LS1A 2GFQA 4KO1S 2TSYB 1WZEA 1Z0ZA 4LA4A 1WSWA 5BXQC 3C4VA 4ZOLF 1WG8A 1Q14A 3G13A 1JFTA 4J3JA 3WNCA 5CLFA 3EAQA 4OI2A 2P0YA 2XNDD 3OIFA 2XUQA 1N0UA 1Y8AA 2Q49A 3HKEA 1MAVA 2P6OA 4UVIA 4Z0NA 1QU2A 1AS2A 2FPMA 4BEWA 1UPBA 4RVOA 3WMFA 4EUEA 1UZLA 3K6SB 3O8LA 4KXNA 4MJXA 1QMPA 2HCTA 4LNUB 4RD6A 5A6SA 1Z0JA 3HUUA 2O4CA 2WAAA 1YRAA 1SRRA 1NW8A 1P29A 4EF6A 4ABTA 4UM5A 3TL3A 4Z0HO 5A06A 5JAMA 4QM7A 5EKUA 1RXUA 3VDRA 2PSSA 2WT4A 5AKJA 4B3SB 2GILA 2HXSA 2V7QA 2Y99A 1FX1A 1NJSA 3A7EA 3IAEA 4V0OA 4EY7A 3ERCA 3EVFA 2HA7A 1WXIA 4JR0A 2NO7A 1JHUA 2H1SA 1RQRA 3C97A 3HJHA 5A5EA 3QUSA 1QGED 4R31A 3IQZA 2X8WA 4Z9YA 2C96A 5TGDA 2ZWPA 1PEKE 2ID7A 2VHWA 2Z4RA 3G0BA 4UBLA 4UHJA 1XXHE 4AX4A 3WWOA 1Z62A 2C4TA 1SIUA 3WGLA 2GN1A 1YQTA 1D1SA 3GEDA 3EMDA 1E8MA 3BIJA 1L5RA 1YKSA 1HTBA 3CYFA 2BCEA 3IVGA 4O59O 3PGKA 5EIBC 4BEJA 5C8YA 2HR1A 4RPIA 1C30B 5EN4A 3Q3HA 1U8TA 2ZRKA 4M7OA 2QRVB 3GYBA 3RVBA 4B3MB 2R85A 4YJKA 4H3KB 4NCBA 1RWOA 3RC2A 4BFXA 5H5JA 3OF5A 1EXMA 2P90A 5HCNA 4E07A 5F4ZA 2OHHA 3AKCA 5JS6A 1DAMA 4OH1A 4U9HS 1GG8A 1T5DX 4NYMQ 2HDOA 3OEED 1X7ZB 4KO2S 5HS6A 1OIWA 1G7RA 2VK2A 1G19A 1T0HB 3K9GA 4QELA 4J0DA 3JD2A 1EJ0A 3VKFA 3E8XA 2JAPA 3GJ8A 3DF7A 2E3JA 3JVIA 4NCIA 3OD1A 1WETA 2QP3A 2WSIA 3HBLA 5ILGA 2CN1A 3A1CA 3ODPA 1U3CA 1Y8RA 3KXKA 5KYVA 3LP5A 4MW2A 3T7KA 1XPUA 1ZIYA 1U9YA 3C7CB 2I55A 3QOFA 3AONB 4TUYA 3HL4A 1GARA 3FUUA 3FWNA 4PU0A 4PQFA 2BC9A 4ITVA 4UULA 2QV0A 4WDQA 2QWXA 1A5TA 3BC1A 5A7HA 5T64A 2ZSFA 3V4ZA 2WA1A 3DHYA 4Q03A 5DEOA 3TFWA 4U00A 3LUGA 3ZKWB 1GNRA 4MEBA 5FR2A 4OI0A 2W6ZA 4I50A 3ZU2A 1XQWA 4O2RA 1PQUA 3KKPA 5BOSA 2QMQA 1VPLA 3OFKA 4K86A 2BSXA 1QQ6A 1T36A 2ATVA 5T3UA 1P1HA 2XUIA 1YR3A 3UMVA 1AUXA 3SR3A 2X1HA 1Z2OX 4EW2A 3RREA 3D43A 4N40A 4GX5A 5I7SA 4ND3A 2X0RA 2E37A 1GAEO 2A14A 1L8XA 3QBDA 4BWFB 5BMVA 5LQAA 1HV8A 4HG2A 1ECLA 2B36A 2R6GA 2DCUA 1M2EA 4I36A 1QIKA 3SDSA 4TLCA 5HK8A 3E4CA 3ND5A 4OMFG 2CFTA 1ABFA 1ZMXA 2FEOA 1JH8A 1DFHA 3L0IB 4KMSA 3D2LA 4WLEA 2EJUA 4QPZA 4AG6A 2NU9A 3FDIA 3ONFA 4PHCA 3TB4A 4X45A 2JBWA 4OK3A 3QFCA 4O4JF 4EGSA 3ZCQA 1A1SA 1QVAA 2OXEA 3GDFA 4Q4JA 4AZTA 5H80A 3OFVA 4URVR 1GLNA 3R1IA 1Y7LA 3A05A 5LMZA 1DIRA 2NMVA 2ANBA 1NUSA 1SXJE 3HDYA 4PO8A 3QELA 4ID9A 3EIUA 2Q62A 2QE6A 1E4YA 3GJ7A 3WHLA 4NZPA 4E30A 1DKRA 2Q5IA 5LB4A 1N1EA 1OBHA 1CS4C 1SZPA 3D5QA 3PPXA 4O4JA 1N5RA 1ADYA 4Q0MA 5D5QA 5B3AA 1AGYA 4ZJYA 5I3CA 5L7WA 2C42A 1GQQA 4P5DA 3THWB 1UIMA 4RLSA 3EZXA 2JVJA 3U7QB 1QTNA 2FZWA 2IL1A 1RXWA 1ZEMA 1BN7A 3LE8A 2O50A 4II2A 1HNZB 4TSKA 4GD3Q 1CUEA 4K9PA 3TZLA 3ZZ1A 4ROTA 2Q2WA 5T67A 2FPIB 3H84A 1GSIA 4H7HA 4YR9A 3SLKA 4EUKA 3O8DA 4UUNA 2E18A 2R8PA 1BWRA 2PNFA 1F3OA 5F35A 2IXDA 5K3BA 2P3QA 5AVYA 1U3TA 1FNSA 1YZGA 2G4CA 2A30A 5IG2A 3JYPA 1JHRA 2OBYA 2ZT7A 4Q3OA 5T4HA 4H9GA 4NESA 2R6ZA 2OHIA 4I2VA 5U4XA 3VKUA 5HRCA 3MLEA 2XA9A 4YAKA 1NVVR 3Q72A 3Q0IA 3DCJA 3PDCA 3BTUA 1KSFX 5L53A 4TM7A 2VG8A 1K2WA 4F2DA 1G20A 5KNDH 5EERA 1GT6A 1O0BA 2V7VA 1R4NA 5K0TA 3TSOA 3D0RA 5FI1B 5K4AA 1KWKA 2ODWA 1PKXA 1QS0A 2EEZA 3ZZ0A 3D6MA 1KMIY 3C6YA 1Z08A 1ORTA 4JQYA 4B5LA 1IZZA 1T1EA 2O8DA 3UG7A 4J4TA 2Q3EA 4ME6A 4F5EA 1JE0A 2Q4TA 4ONEA 3K94A 3DXXA 4G1FA 4OX9B 1NMQA 2FRDC 3WGMA 5J4HA 1U3WA 3QXHA 5ALGA 4JD5A 4NC9A 4JP8A 1KK0A 1DWPA 2BGKA 2NSHA 3OP4A 4Z86A 5DULA 3HS3A 3RJMA 4OI4A 1XA3A 3B78A 2QYOA 4K6FA 4MUFA 3N05A 3G7NA 4REOA 4EHDA 1ZGAA 2H2GA 2OCBA 4MW5A 1DRWA 1JQBA 3EGDA 2HWKA 3GHYA 5U1PA 3WKAA 4NBRA 3KSBC 2PUCA 4C7OB 3R7AA 3TOXA 1RP7A 1YVUA 1JDZA 1LCIA 221PA 4B6GA 2WUEA 1AJEA 4N39A 3NH6A 1ZWLA 4RK1A 2H2AA 1FPMA 4Q1DA 2JJ8A 1MNAA 5AJWA 1QOPB 4WXEA 3AR5A 3HG7A 4EI9A 2R1VA 3SC6A 3NWBA 4WBNF 4R1UA 4CKXA 3O03A 2I6TA 2XUPA 5AK4A 1WV0A 4MI6A 5JSFA 1FEZA 1Y82A 4RY8A 3BMXA 2WJ6A 3G89A 2H18A 3FCSB 1J20A 1Q2UA 2HOQA 3GLRA 4KE9A 3OE7D 3AFIA 4AECA 1YF3A 1EGVB 2QUJA 2AZXA 3S7TA 3HB5X 4Y1RA 4TLEA 2PGXA 3B89A 3AZPA 3WMEA 1OPRA 4V38A 1BFDA 3N2NA 4I8DA 4WBNA 5HM6A 4MB0A 1TKAA 1I3NA 3OUZA 4Y2PA 5HA5A 4DILA 4LYDA 2OZVA 4XUCA 3TIFA 4R9SA 1BOFA 1OROA 1N6NA 1L4EA 1UCFA 4BATA 3WHPA 2O0JA 3DFFA 3NHKA 1BMQA 2VH2A 2VPIA 4FEAA 1P7ZA 4OM7A 3F6CA 4HH0A 4M87A 5BV1A 2VF5X 1GGNA 3N53A 3O75A 4AXXA 4CWAA 1XZ8A 4POOA 1S3GA 1SOUA 2DR0A 3X0DA 3FDZA 3OPNA 4CKZA 1NSFA 5IMBA 1MNQA 2J7PD 3BKWA 3DHWC 4MV7A 2JDIA 4HWGA 2B69A 2JLXA 4KYUA 4G8JA 4H31A 3UOWA 2CV2A 3O92A 1BMDA 2B20A 2B61A 1J2TA 2FEKA 3L8ZA 3IBGA 4FGKA 1QFYA 4FW9A 1MJGA 2YTZA 4TSFD 4KVFA 4PVCA 4TSRA 3PEFA 4IQ4A 4MRSA 2PBZA 1N0IA 4ZHQB 3D3WB 5JC8A 4DLLA 4GWLA 2EKQA 3UHPA 3LPLA 2NSYA 1BQEA 2ECFA 4JJ8A 3H19A 4RPHA 1G8KA 5LJIA 3D1JA 2DUWA 1YJAA 4R3WA 4WNIA 4NXMB 1Z38A 4HDNA 4JUFA 2LIVA 3R5KA 4G23A 4K1XA 3FNGA 3CH4B 2Q0XA 16PKA 5CYFA 3B6MA 4JR1A 4HN4B 5JYCA 3HEAA 3ESXA 5EJ8A 4OGFA 3KTAA 1A7UA 3KX2A 4AJ4A 3HBAA 1U7OA 3A58B 3UQYS 1LV7A 4MZXA 3ZCRA 5KOJB 5BMOA 1BQ3A 1I36A 5GTDA 1CUHA 1TGYA 3OTIA 5ITSA 4AUEA 4GQAA 2PU5A 1Z4OA 5IBQA 1TE2A 2E0IA 5CVCA 5EHZA 2HA4A 3PRYA 1ZVVA 2JLVA 1TU0A 3KPYA 2FMHA 3BA1A 4KI7A 2WTEA 1NULA 3MMZA 3RS5A 1THTA 4DBLC 2HIHA 5LFAA 3UGJA 1A77A 1IEWA 3AI1A 3IQFA 2JH3A 1H0HA 3NPMA 3QMPA 4CTOA 3P94A 4ENSA 3MCAA 1DQSA 1RHUA 3VSEA 2A84A 1A2OA 4N3AA 1LVUA 5ALNA 1FXWF 2Q0QA 3AFOA 1D2NA 3QE9Y 1THZA 2B2NA 1EDOA 1KIAA 3G68A 2IHNA 4PSDA 4JB8A 2ZWOA 3CO5A 3ZXXA 4X20B 4CCWA 1NBOA 4RAQA 3OX4A 4TROA 2D7JA 4GZ3A 4WXHA 4X6YA 5BSWA 1Z0DA 1D7AA 1ZQ9A 1DJNA 3OESA 4LOAA 1SRQA 4YCLA 3CU5A 2RKBA 5EWMA 3I3SR 3DLPX 2G17A 1FXWA 3G9ZA 3KC2A 4QUBA 3HDHA 2PZ8A 4UTZA 1SA0A 2CNBA 4GMKA 1OWLA 2KE5A 4RKYA 1SBNE 1OZFA 4H3SA 1WPXA 3HUTA 1ZWKA 2QUKA 2PUHA 2YVUA 3QFFA 4KNYA 1EG2A 5FCDA 4O1MA 3SBOA 3UO8B 4B3BA 2G6TA 3DKKA 4NYIR 8ADHA 4ZREA 4EGQA 1R0KA 1NU8A 2IA5A 2VRCD 3T54A 5DSXA 1TU3A 2ZJ0A 1XWFA 1D3AA 2UAGA 2ENUA 3IPAA 4Y2YA 4LQLA 4MDYA 5CA0B 1HE5A 1GCUA 4HI0E 4KOEC 8AT1A 1JLMA 2J4FA 1JR2A 3G5MA 4L74A 5DGIA 3ORFA 2O8FA 4NCNA 5GONA 4PBSA 3DA8A 4ETNA 2OM2A 3QOWA 2HWYA 2ZVQX 4RHEA 5KWVA 1APBA 4TXLA 4KPYA 2A7QA 2R96A 2HBYA 1W6RA 4QA9A 1TU4A 2H17A 4O8CA 4KU4A 3UB2A 5IYZF 3F2IA 1QDUA 4XPZA 3R3UA 5LZ9A 3E0QA 2H1OA 1HXHA 3NTRA 3AUXA 5CDYA 2PUGA 1UFRA 1ZJ6A 1MZVA 2PRSA 3G9TA 4K40A 3UXMA 4EEKA 5MDHA 1QFSA 3PDWA 2WD9A 5K01A 2YNMD 1C0PA 1BXRA 3MTDA 1P1BA 1AK1A 4NZZA 1Y1PA 3QKSB 1KKUA 1NVMB 3N8IA 4YBRA 5IYZA 5HILA 5JFGA 1W2HA 2AN9A 4UE2A 3VQTA 1WS6A 4JDUA 4E2WA 6PFKA 3A3YA 4EF5A 4N03A 3RSLA 1M0SA 2W0MA 1UPFA 5EJGA 1EX7A 1Z5OA 4RC9A 5BVHA 1XD8A 2IBSA 1BYUA 1JLHA 1ZK4A 2FW8A 3GNLA 1LLQA 1R0RE 3DEZA 3L4BC 3SYTA 1TVMA 4GPD1 5HF8A 1FSPA 3ACCA 2CNNA 2IP4A 1G20E 1K7YA 1N0VC 4OHBA 2VP3A 3EIWA 5T57A 3WK8A 4JLPA 4B3CA 1GZUA 1U0FA 4ZAWA 3LXUX 1J49A 3WJ7A 5ADHA 3USCS 1PNVA 1BVRA 1JHPA 4MPPA 3UT0A 2FPRA 2VAPA 4EMTA 1OGJA 1BHO1 1V1MB 3CEJA 3VO9A 3E84A 4IQGA 2KPOA 1PJTA 2RGXA 3K4QA 4LDRA 1MOZA 2DQYA 3IOMA 3KLPX 4S05A 3V1KA 3DVLA 2P2GA 1PWHA 5M29A 4FJ0A 4S0ZA 3FB1A 1A9TA 1MUUA 4F4UA 2G5TA 2BEVB 2HJVA 3TI9A 4NWIA 1YKGA 3AHJA 4U6SA 3BH7A 3SHTA 3V3KA 3I52A 2WKQA 2JGLA 2JH9A 3U4QB 2J9FB 3A1DA 3A8TA 1CNEA 1MABB 3HCDA 2BBOA 1NWHA 1EXDA 5G0WA 3PSAA 2AI3A 5D00A 1S8AA 1W0KD 5ALOA 4IO1A 3SYMA 4ZRDA 3KUDA 1TYBE 3VH2A 3A9WA 4NIMA 1H8ED 1KQ3A 4HDMA 4XDGA 3VYTB 5GP1A 1VP9A 4TS9A 4DQKA 3CO0S 3LCCA 4ON9A 1ZUWA 5JSZA 2AEJA 1KEKA 3MELA 2XLBA 1XP8A 2HJ9A 5DNAA 3VU1A 3GARA 4HQRA 1YB2A 4PW0A 3I1FA 1L5VA 3ZBQA 3IQIX 3PYXA 2F9LA 2UZ1B 4HN2A 1GNPA 1F38A 1UF9A 3HSYA 5JQGB 2EWVA 3MBOA 1PWZA 2YDXA 3RHSA 3SGLA 5JBQA 2HRDA 4JL5A 4QOFA 3X1XA 2BE9A 2R7NA 3MSCA 1FFGA 2IU6A 3N07A 3P7MA 2FQ1A 3VR3A 4AMUA 4DEXA 2YXEA 3PITA 5AI5A 3R9WA 5LIRA 1OCEA 2ZI3A 3BWVA 5JZSA 1TXGA 2A0KA 3KDAA 1SXJC 2II6A 4IY1A 3WX0A 3VR6D 1P17A 4JUIA 4JV5B 2WP0A 4QU9A 1V6CA 4R1LA 5IJXA 1R8XA 4PIVA 5KNDA 4KFSA 4EUHA 2UVDA 5AKGA 3ZOZA 1XA4A 2JGAA 4HQNA 2WWRA 1ONPA 2WG1A 4JITA 1QHHB 3T4XA 5CCXA 3FOCA 1P81A 4RETA 3HEBA 1JIIA 3IL2A 2ATCA 4IIYA 1G8HA 1T9AA 2H54A 4HYYA 4EAQA 3AIIA 1XUOA 2RG7A 4OM8A 1P6XA 3H1AA 1VBMA 1ZU4A 2PGIA 1N8TA 1SUSA 2H0RA 2ZBEA 5SYMA 1FBNA 4Y2GA 2CC2A 4PO3X 4FI3C 3C15C 4ZGBA 1NE7A 1Q12A 4LDQA 1U28C 5AH0A 4ROSA 3UFBA 3AINA 4IZIA 5A3QA 1FUKA 3GFSA 5FV7A 4GYYA 1YR9A 1E4EB 4H35A 2OCAA 1MC4A 3L43A 1UC4B 4NBLA 4TLBA 2WU1A 1Z4MA 2VHVA 3COPA 2R6AA 4NDAA 5F5NA 1L9XA 4DSNA 2WDPA 1T5LA 3QYFA 1IM5A 1V2GA 3PHJA 1VIVA 4PSCA 3K09C 4YQEA 1T9GR 1BJTA 3DEAA 3CSUA 5LMUB 3VO8A 2FWNA 3SE0A 1KZHA 2GCNA 3FCXA 3GVCA 1YD7A 4ZVUA 4EA8A 1HOXA 1EHIA 1QG0A 4WESB 1C7ZA 1SKMA 4AKGA 4J2OA 4UUAA 1KBZA 2YNMC 3LOQA 3FCAA 2WHPA 1YFJA 3CCCA 3TZKA 5EJ7A 4A0HA 3SS7X 3D6AA 1WXFA 1BDBA 3LT2A 4K3UA 4YCMA 1XLTA 1F0PA 1KMHB 1HETA 1KAGA 2OZPA 2V98A 5T8KA 5KJ6A 4EB0A 5JTUA 1S5PA 4JX8A 4RNCA 1CJUC 1RC1A 1DBRA 2CVOA 1RWVA 1XXHB 2I2BA 1GLGA 3MCZA 3NNDA 4I1UA 1RE0A 2W71A 2WSBA 3C3JA 3EH1A 4Q47A 4TTJA 3T1QA 4Q3AA 4YJ3B 5TEVA 3DW1X 1A9XB 3IT1A 1SVUA 1U2GA 1K97A 1TX4B 1CY6A 2DRIA 2H4HA 5TR9A 3UH0A 5CVEA 3QA9A 4OQPA 4J9UE 1JGTA 1BU5A 4KYVA 5EEHA 2I99A 3Q5DA 3M4NA 2C2GA 1MRNA 1RZ3A 4FIDA 4EY5A 1Z4QA 4NCAA 4A8PA 1ID8A 1J07A 2H4JA 4FGZA 5BNZA 4BB6A 1AV7A 1B14A 2GESA 2GHQA 1DPGA 2PGJA 2EDAA 4DEYA 2IJGX 2ZWIA 1N6RA 1RXSA 4KLZA 4EY8A 2A33A 5AO9A 5J63A 2E5WA 4MUIA 4WJKB 5EMMA 4Z7QB 2D7CA 3N87A 1I7DA 3HQ4O 1Y4ZA 5ALDA 4RZXA 4DVJA 2QTMA 1QAQA 1EVEA 1DX6A 2C54A 2HN9A 3JWEA 3LA6A 4LXIA 4D8TA 1FFYA 1GPMA 4LXGA 1FS6A 3QE2A 4QVIA 1FTNA 5BSTA 5KKCA 2ZB4A 3FNBA 1C9JA 3F5MA 2OD7A 2P6PA 2RKWA 4GKBA 3UFXA 3L0OA 2FOLA 2GM4A 3H99A 1PSZA 4FNGA 1P1KA 4OOFA 1JBQA 2YN0A 4WXPA 3VSAA 2XHEA 4OJMX 1COWA 3C1OA 3GDHA 4NI5A 2FSFA 3DWEX 1BZYA 3C8ZA 3OSUA 2FPLA 2P5UA 2ZRJA 3OIYA 1W5EA 4TLMB 1VHQA 1YE8A 3NBAA 2YZKA 4RPGA 4DUGA 1XN4A 4YRMA 4TV9F 4ZXFA 3PWKA 2XCLA 4UU8A 1FMLA 5KVSA 1RWNA 3QENA 1KDVA 1PWXA 5JVDB 1R27A 1T91A 4A03A 4AZ3B 1GCOA 3IHLA 1P2TA 4IXNA 1V2HE 4R9NA 1O97C 3X2SA 4PG8A 4QTYA 1U7XA 4CMJA 3B1VA 4IIJF 5IDXA 1EFVA 4TV9A 3B6EA 3R7WB 1FTQA 2VYVA 4KAFA 3TM4A 5JOQA 2BZ1A 1R16A 5HIJA 4PINA 3KQLA 2ILTA 2P6NA 3O2JA 2F9MA 4Q4DA 2QLLA 5AXAA 1MB2A 3F7NA 3FRHA 4AY3A 4F84A 3PTZA 3HKBA 5A2GA 1IY2A 5IJ9B 4N5DA 3WOHA 5FLXA 1Q92A 2P9HA 3GRYA 1SXJB 2BFDB 1EM8B 4CI0B 1NQWA 4OHMA 1VIDA 3VJKA 3AVVA 1TEVA 1JMKC 1P4AA 3IXQA 4N0PA 4ZQEA 4YASA 2V6GA 1GAQA 3I05A 3B2EA 4V3BA 2HV8A 1VGVA 3LDFA 4IQFA 2R6JA 4TWZA 4ISBA 4CEHB 2AS0A 1RU3A 2C5SA 2J8ZA 2JL1A 1D07A 1UK7A 4C3ZA 4N65A 6REQA 4NZYA 5A4DA 3HXPA 2H7XA 2YV1A 2JLWA 1JALA 3AGPA 3ESRA 1UXKA 2L0XA 2C5AA 2CZGA 1XFDA 3T7CA 5C51B 1P5JA 3T15A 3ZS9A 3BWYA 3PGJA 3NWEA 4BLQA 3PRHA 1A8UA 1EVLA 1KFJB 3CSDA 4R8KA 4RSRA 1E20A 1USIA 1RPNA 3AZQA 2HCJB 5IULC 4BE9A 3AETB 4OOEA 1FE8A 4WI1A 4EVRA 5A5FA 2IGBA 3H8VA 3AT1A 1A2KC 3WOVA 2W2TA 1A3CA 3BTOA 3MINA 4EVIA 4GAEA 3V1TC 1FXUA 1WMFA 3ZUGA 2BAGA 2NQ8A 4FMDB 4HLUA 3GGDA 1DTWB 1NLFA 2WAXA 3JAWB 2W6ID 2D62A 4MVXA 2PXXA 4Z49A 5EPUA 1C9DB 3N74A 1YZNA 3JR3A 2PNJA 1PD1A 5B3JA 4O0MA 5BWOA 5K3CA 4ZAXA 2F3TA 3CB4A 4DS3A 1N92A 1W4ZA 2B5OA 5HR5A 4LXYA 2C4HA 2IDMA 2C9DA 1RAAA 2FFQA 1EJBA 2B2XA 1RQGA 3NC0C 3TN7A 2ZQZA 5L40A 2XMCA 4O4LB 3LUKA 1CUAA 1GKUB 2WRZA 4ACAA 5KOHA 2UU9B 2R62A 4WUVA 1TMKA 3RFCA 3O8CA 1KGSA 3AB3A 2TMYA 3ZBUA 4BVHA 4G09A 5K2OA 1XIVA 3WJ2A 5K5EA 3SCZA 4GDMA 5DYIA 4JY7A 1EVYA 4XVCA 3ZDFA 4HNAA 4XX0B 3TNDA 4HEA1 1SCQA 1P4HA 4JBYA 3V2HA 1GNVA 4YI3A 1G6KA 2C8LA 3I6MA 1L2TA 1YHZA 2X19A 2CGEA 4BNDA 1L4NA 4A16A 2G1AA 4ENTA 3VGJA 3K53A 1CJMA 4XVRA 3NANA 5LXTF 1J24A 1NVAA 5H82A 2D0PB 5JJIA 3DMTA 2EP7A 2CB9A 2CFSA 2IUFA 2JFVA 1MAHA 2IEIA 1J33A 2OO5A 3MFYA 3HKEB 4A15A 1GPLA 1XNGA 2B82A 3TVDA 1IY9A 1UBRS 1UP4A 4FMBB 2Q2QA 5BW6B 2VHTA 4Q18A 2OFXA 3LW7A 4F4HA 4M83A 5DTIA 3G3EA 3QOYA 4IV8A 4PYIA 1F9EA 5ESWA 4GG1A 4S1OA 1U5CA 5LXTA 3TG2A 3MD9A 3QV1A 4E4YA 5TMDA 4KAJA 4RVDA 4D0SA 3A32A 5JY1A 1EFKA 1W29A 5A71A 5AWFC 5CCBA 4L0DA 4BMZA 2CMDA 1TT5B 1L3BA 2UYQA 3A6DA 1GL3A 2VSOA 4P7JA 1EVZA 4M8KA 4PZ0A 1YJQA 2H57A 5KQPA 2DPLA 2OLEA 1E89A 2G07A 3EA0A 4XWOA 2EKZA 4C08A 1Z8NA 2H31A 1Q0LA 2JFZA 1BXZA 3DJYA 4U7FA 1HZZC 2WPDD 5FEMA 3RVNA 3VDMA 1TAHA 3C39A 1M2JA 2GAOA 2GAFA 3L0DA 4RJTA 1ZMBA 5CG2A 2WT9A 1QNLA 3VISA 1AO0A 5GPBA 2KB0A 2AX4A 4OATA 2IF2A 2X9QA 1AO3A 1ONOA 3FB4A 3S29A 2XGMA 2VJMA 1JI0A 5FIUA 2EIXA 4MUEA 4YHHB 1JJFA 1V4NA 3GFFA 4LISA 2QVGA 5IAEA 3W8FA 1X7GA 5C8YB 1VLJA 2G0TA 1I4EB 4R41A 1B0AA 1C3VA 1JXMA 1PR4A 1XB2A 2KJQA 4TS3A 2CD9A 4HYEA 1JIUA 4GLFA 3I62A 2I6QA 4DLBA 3SJ7A 2N0SA 1C1XA 1LW6E 1NAHA 5T5QA 3QP9A 1E6CA 4I08A 3UNXA 4EI2A 1RJDA 3BJRA 2AF4C 2LRHA 4YRKA 4KPEC 1NZJA 2VPWA 5JNSA 3I58A 1CIJA 2BFFB 2NUTA 3NOXA 4BMPB 2ZI7A 5I9SA 5B7QA 3JZMA 4ND8A 1Y8RB 4B3RB 2QXYA 1UEXC 1WWKA 3U9TA 2E85A 2IXAA 5CFZA 1KK1A 4TUYB 4BZZA 2C61A 4NOKA 4LVOA 2PX0A 3NTUA 2QAJA 4EVQA 2I0FA 4CIYA 2UXBB 1WBJB 1Q7BA 4OU5A 4AUNA 5BV2P 3CZMA 1YQDA 1O3YA 1WHTA 5J47A 2BOVA 3W6NA 1EQ2A 1BG6A 4QOEA 3C3XA 1RE1A 1VCHA 3EGOA 4I50B 4RULA 4YJGA 5BOSB 4BUJA 2DBYA 4HEQA 2A9QA 1HDZA 3IQGX 1T36B 3M5WA 1J70A 1UXJA 2CSUA 3RTBA 3K0AB 4R68A 2Q9BA 3E22A 4KVGA 4B5KA 4FFSA 1PUXA 3NIFB 2Y66A 1ZGCA 3NBFA 1AUOA 1K0UA 4QU0A 4CG1A 5CB8A 1POWA 2QX7A 1F7VA 1W46A 5BMVB 2HUNA 1U3FA 1PT9A 3P9ZA 2I7VA 5EE9A 1LK5A 1NJGA 1IATA 1NXPA 1RPTA 7REQA 1R0ZA 3IH5A 3OECA 3FOBA 1A5SB 2J3HA 1GYRA 2FSIA 4BCBA 2G67A 5E7JA 2CXTA 1NVTA 3I12A 5C0OE 5DK4A 2RC6A 1O0CA 2JCYA 3FGOA 3WL6A 1EM6A 4MUGA 3IAS1 4Y7CA 4GOND 1B74A 4LMPA 4NE7A 3AJRA 1E1MA 2Q2OA 3HNOA 2NU9B 2R8ZA 1NTRA 2HCRA 1A71A 1FTSA 1KSJA 1Z36A 4GR4A 1CHNA 4L95C 4HWTA 1H2HA 4W82A 2ZI5A 5FL7A 4Q4JB 3QG5A 2ZUDA 2IV7A 5CA1F 2PQ6A 1Z6YA 2JLUA 3C6XA 1X7YB 4YRNA 3BJEA 1MDBA 3KVOA 1BEEA 4LS3A 2UXCB 3X1DA 1FMCA 1Q7TA 4L1KA 2P4EA 1H0SA 1C2YA 5ECDA 3R7FA 4AJ9A 2RGEA 2O5RA 1EB9A 3R20A 2EATA 4BN0A 3GFRA 3CUYA 1CK4A 4WXRA 5CA1A 3D1VA 2JJ1D 4LY6A 4RM3A 2H5LA 3OQ6A 3WLHA 3D4LA 3T35A 3ZHTA 5IJWA 2OC9A 2V0GA 1SOWA 4TS1A 3EDYA 1L1EA 1CTQA 1JKMA 1I6WA 1WMAA 4OXYA 2FN9A 4OJYA 1ESZA 3S8YA 2OQ2A 2ZRBA 1MQ8B 1LI4A 2F1RA 2QD2A 3L1UA 2F3QA 2FPGA 2EFEB 4LZZA 4QGBA 5FLEX 5J3JA 3HO1A 4JXZA 1R3UA 2ZK7A 1RYBA 2ZSJA 3R9KA 1JILA 1ODCA 3NI2A 4OF4A 4YLEA 1B2RA 3IDSA 2C1EA 1JG2A 3UXHA 1XT6A 1L4MA 1ARZA 1V8FA 3QW4B 4WJZA 2AD5A 4Y7DA 4YRQA 1X94A 1XAHA 2H06A 5CHEA 4F7WA 3T3GA 4ZCRA 1EX1A 4WDRA 1CDDA 1UEIA 2EW1A 5AI9A 2MSDB 3VC7A 2F17A 3COYA 2DEUA 4NQZA 5HWSA 1YBHA 2OO7A 5KQSA 1OLUB 1S2NA 1N6KA 1X86B 3MWYW 2AN1A 1G20B 1CY4A 1QUEA 4OMDA 2JFQA 3QKRB 5CNMA 4DQLA 4EHLA 4AG3A 3QVTA 1EFPA 1T6BY 1XZLA 3BXPA 5DF1A 5EXTA 5SYAA 3UUGA 3E5MA 5JNTA 5KVAA 1FNNA 1QS0B 1KAQA 2IE8A 1J56A 1WEKA 1FQWA 4HXYA 1FUIA 4PGGA 3DE5X 3AXSA 4TL9A 4X8MA 2HYIC 4JEIA 2YY5A 1LDNA 3OPQA 1YBMA 5F64A 3G0HA 2C3PA 1EBUA 3OMXA 2VF8A 2HMYB 5ELMA 5EVCA 3M1AA 1RWMA 3AF0A 3M6UA 1IAVA 5PNTA 3FSRA 4QEKA 1N25A 3OP1A 4MVWA 2BHRA 3CW8X 5A5DA 4RABA 3O38A 2IEBA 3IQHX 2POCA 3MMXA 5GINE 3T9FA 1QQBA 2FSPA 5CDHA 4RK0A 4A4DA 1JWLA 3QX8A 4COKA 1Z35A 1UMCA 3EGDB 4MW1A 5EP2A 3MS7A 3NDRA 4M38A 2ICAA 1G64A 1M2NA 5I6DA 2VDVE 4BFSA 2W58A 1I4WA 3G79A 4RMHA 3T61A 4EKDA 4ZYTA 1AT1A 2UUBB 3N75A 4KIJA 1MO5A 1IB0A 3E9MA 1E1LA 4GKKB 3VNQA 1RJFA 1U4OA 2NPOA 1DIOB 1OI7A 2LWIA 4I1SA 4EABA 3RAEC 1M3SA 1PL8A 3N2GB 3MWFA 3OIUA 4PEVA 4CG2A 2X7XA 1U3DA 3OWOA 3L8YA 5CLLA 1XMJA 2R1TA 1EBFA 1OXBB 2XY4A 1TM3E 2IPLA 2FX3A 4IKOA 1JNYA 3UHOA 3P2EA 3FUCA 4DZRA 1PGJA 2DT8A 4FUTA 4M9SA 4WERA 1E4VA 4Y1RB 1RVV1 2VEOA 3PQ8A 4R71A 4IFTA 3PUHA 3KV3O 2IUEA 2B98A 1G8GA 3HCBA 4I9HA 5EP3A 4DIKA 3V32A 1GCAA 1T9ZA 3HRIA 4TZTA 4B7ZA 5IF9A 1XPRA 2IEYA 3GJXC 4R1NA 4MXDA 1Z6TA 1A4XA 2IXGA 1JAHA 4JYMA 3IELA 4R01A 1YB5A 2WHXA 2PX6A 3D81A 3VPGA 2XGOA 2AN3A 1KZ9A 2HJHA 2ZIAA 2HGZA 5ERGB 3RS0A 1L7QA 3RE1A 2BM0A 2E4YA 1FNBA 4O2AF 1D1QA 1PNQA 2AG5A 2YQZA 1IMJA 3E7PA 4MO9A 4X84A 5A9RA 3ZJVA 3OBIA 3PDUA 4BO4A 4KX3A 1MZPA 3W6PA 1FFXB 3FDZB 2WJGA 3WRVA 1MIHA 4CODB 2JCSA 5LYJB 2VCEA 3GP8A 2W00A 4UU7A 3ZTTA 4D3ZA 3WGHA 2B4YA 2VP4A 3EXFA 3G0IA 3NASA 4M2LA 4NK4A 2C2YA 3V8NA 3HKCA 3C7DB 5LIPA 5KTRA 2C7RA 4EECA 1YL6A 4O2AA 3JRWA 1KMMA 1MO3A 4INOA 3HDGA 4RHYA 2F59A 3L6DA 1GAXA 1T2UA 3KVNA 2V65A 3FYDA 4X3PA 3RHFA 5CT5A 4BBJA 3TKYA 5ES3A 1V8OA 3OU7A 2C9CA 4XIJA 5HE9A 4Q1VA 5LDHA 3U44B 1L1RA 3FW1A 1S4QA 3W8NA 5KHAA 4HDNB 3UW3A 2HXGA 3DR3A 1O5OA 5KQMA 4ANFA 4BKUA 3DXFA 3EFEA 4BU0A 1Z4NA 3FIJA 3KTAB 2FF7A 2J4DA 1BWSA 4HX9A 3REFA 5FUMA 3TZ6A 1OJ7A 5I8ZA 1A7AA 1A50B 1RRMA 5THXA 5LQDA 4B7AA 3FKJA 5JAQA 2C5EA 1Q50A 3WHIA 4YYEA 1SKBA 2XOKA 4J0EA 1EFHA 3OT1A 3V4LA 5F5XA 1ZGHA 2RG1A 3AV0B 1KYIA 4DPLA 4HFRA 5CPFA 5LB2A 3L0PA 1C4XA 2PH3A 1CPYA 1O57A 1VGQA 2RHJA 3A1TA 3B9QA 2OPHA 1NVKA 2G4LA 1EVIA 2GXSA 3CE6A 1K66A 3FNFA 5HG0A 3D6TB 2MYPA 1TVKA 4NDNE 1JJIA 1YCHA 4P84A 1LPPA 2Z2IA 1BCRB 3IKLA 3OG9A 1L6RA 4R4JA 4JI0B 4NBKA 1TF2A 1SD1A 5AM5A 2R751 2B92A 1U02A 2ZITA 1NJ5A 2GFHA 5C1PA 2RAFA 1DINA 4FVTA 5KJCA 1W1WA 3IAM6 3AM1A 1YS2X 2P41A 2WY2D 4D57A 5EZ6B 3KL4A 1EZZA 4U9UA 3UJ3X 2ZBUA 1WBDA 1F1JA 4RSGA 1UBOS 1JU3A 1XAIA 1U6JA 1EMDA 1YRYE 5KPJA 2C03A 2C31A 2LTAA 4BGUA 1C7EA 4Q9IA 2X2FA 4DDTA 4F12A 3FOFC 2WB2A 2YC2C 1OH5A 4P4NA 5HK9A 4RMNA 4U6NA 1P3DA 1W1UA 1I1HA 4B4VA 3JSXA 2G9VA 1AURA 1UZAA 3DZBA 5EWMB 3TLYA 1XWWA 1ISJA 3RM3A 4MS3B 2VNAA 2QTNA 4QXAA 5DLPA 1P45A 3AOEC 1KJIA 1ZJJA 1H9BA 3OH8A 3BYZA 3VNBA 3L8HA 3B85A 3GQVA 5BV7A 1ULZA 3I1JA 4IMJB 3B2NA 4TL6A 1PUIA 4Y2VA 3L93A 5D3MB 1IPHA 1J39A 2JHPA 4ZVSA 3RABA 4OGKA 1CJTC 3ROFA 1D6JA 1KERA 3CX3A 1LB1B 3EZ6A 4Z3DA 2Z1NA 5C4MA 3PR1A 1JVSA 1P1JA 2B7BA 3AWDA 3P5BA 3R3HA 4YMUA 1HSZA 4BPBA 1YVPA 2LIPA 2OM6A 2ZSDA 4RO0A 3AB8A 1U4NA 4A6EA 5GONB 4PQGA 2VBIA 1OXXK 4KXYA 3VZCA 1BE1A 1JG7A 1PX0A 1PGNA 1URPA 1BTOA 1GSOA 3DWGA 1EFAA 1QF7A 3IEXA 3M1YA 4FHEA 2R1UA 4LGCA 5FO1A 1H2FA 2I87A 2HIGA 1VHWA 1V5IA 2ZE7A 4A8TA 2O3JA 4FHFA 2V96A 1HOTA 1DAKA 3H05A 3DE4X 2IOFK 5JNUA 3BDAA 2G9UA 4MKRA 5BSUA 4RE5A 3L02A 2WD7A 2UUAB 2NO4A 2JS7A 1DXHA 1OIVA 1T0UA 5E8JA 2PFKA 5GJVC 3U3RA 3JAKA 5HZMA 1M2KA 4B73A 3VH3A 3I64A 3QU5A 3KHKA 4C30A 1XKXA 1Y9AA 2KM1A 5DI9A 5EIEA 1RKVA 1Y3AA 5E9QA 5BVHB 5DTQA 5J43A 2C9OA 4R3NA 1IN8A 4KXFB 2D4HA 3LDUA 2GBFA 4H27A 5E4YA 2QTBA 2EJWA 4R6XA 3FYHA 4YO7A 3ADCA 4KNWA 1H4VB 5AVOA 1CB0A 2HSZA 4FEGA 1O9HA 5EFOA 1SURA 5FRDA 1X15A 5A04A 1AGPA 1H94A 1SB9A 4FFBA 5B36A 5IMSA 4O4IA 5H83A 2IEGA 5AKKA 3O4JA 4FT4A 4AY2A 3UHFA 4D3FA 2ZJ2A 2PCJA 1N1DA 3KE9A 2ZAIA 3JYNA 2CWWA 2R0QC 5ECWA 1I5RA 1J0DA 4NCXA 3VDXA 3HBFA 1CUCA 3VMFA 3CF4G 2XCRB 1O95C 2JLZA 1S4MA 1OI3A 2HXYA 4UPVA 3RSSA 3HYTA 1RZRD 2KW5A 3N2ZB 4ZAYA 2H00A 4RVSA 1E6KA 5AKZA 2GJ8A 3AY7A 1QPBA 4LF9B 1WZ2A 1BXGB 1IIBA 1QH8A 4LHVA 3K0SA 2LCIA 3N70A 2HF7A 3AEUA 5ERYA 1DMRA 4EJ0A 1IC6A 2PAAA 3EBPA 1US8B 4ZQHA 5DNDA 1ZJ4A 4DJFC 2BEUA 1I7QB 1GZHB 1KORA 4DV4B 1B93A 3BXHA 4OQXA 3LVRE 5HTOA 1H93A 2HMAA 1JB1A 4G36A 1PD0A 3L8CA 4F6CA 4MV1A 3NT5A 1YCGA 3KG2A 5DSZA 1KYXA 1V47A 4ZVMA 1ZIXA 1TW3A 1K8YB 1PFGA 3O74A 3OVMA 4B4OA 1RWQA 4XRGA 4Z99A 3OEWA 3E7WA 4B45A 1ECPA 3F78A 3IUPA 3K4PA 3K71B 4CV1A 1E1NA 4ID3A 2VA8A 3HK2A 4N6OA 2JATA 1U8AA 2OB1A 1Q74A 1H42A 3HUEA 3WWYA 2N42A 4MV5A 2D2IA 2HLDD 1KO4A 3JATB 3ZDQA 5KTTA 3G2KA 2W98A 1ORVA 2GVZC 2JGJA 4M0UA 2G7ZA 3DDCA 4IIVA 2QNRA 4R51A 2ZUSA 4BMDA 3R6GA 4CLDA 2C2XA 2PZGA 3IMCA 1B0UA 2YY7A 2ZFUA 3WGOA 3GX1A 4GLOA 3WNBA 5JCPA 4ZI5A 3Q3CA 4R2WA 4RL4A 3R0QA 2C9ZA 3SX2A 2VDPB 1T1RA 1IG0A 4F8JA 3A9VA 5F76A 1Z7BA 1X87A 2JJMA 4QHTA 4X00A 3ZLJA 4CM1A 1T4DA 2ZCUA 2Q4RA 4BQRA 1EVQA 1XALA 5HDQA 4IZOA 4X54A 4RQAA 2DUUA 5SZKB 4ATNA 3OSZA 2ZXEA 4BX3A 2YOHA 2QDXA 5E9JA 4BP3A 2HHAA 3RSZA 3RDPA 1R66A 2GO7A 3RJTA 4OHRA 3AVWA 1ZCJA 1GILA 3GH3A 3H65A 4YDSA 5E1OA 3H8WA 4DCTA 3NHBA 1Y42X 2GWRA 2XMQA 3BMCB 3P0RA 2XBLA 3EPJA 1P2BA 1MIOA 2JA1A 5BSEA 3K1AA 3JD4A 2ARKA 3TIVA 1SEPA 2D5LA 3QYJA 3K35A 2OILA 4F2WA 5JWHA 3KPWA 3NXKA 4EPTA 3SI7A 4FHGA 5FWXA 2HRQA 5G53C 1H23A 1PV2A 1VLLA 4ACBA 2HEGA 1YK0A 3FFTA 2BKVA 2IELA 1XDSA 3W06A 4IDBA 3QVOA 3D8SA 2PL9A 3UCXA 3ZVLA 1PT8A 3HN6A 5CW1A 3ROGA 4TMKA 4O3MA 3FZEA 3IQEA 1W96A 4ZMSA 1KI8A 2W5UA 1VZ2A 1V48A 2JEZA 3KOUA 4IDOA 2K4MA 4J1NA 3KR2A 3GNQA 1TI7A 1Y3FE 3IR6A 4QDOA 3FROA 2SKDA 1ORRA 5MN4A 3FBWA 2R4UA 3R7NA 5I48A 4CMCA 2FTKE 1DNPA 3M70A 4O08A 1M2OA 3UOAB 4OQQA 1HFJA 1HE3A 5DBHX 1TADA 5ICGA 2PXHA 1K5PA 3JW8A 1A7JA 1DXQA 3AUSA 3EF1A 3GBPA 4KIUA 4WZBB 3RUPA 4BWGA 3OKCA 4LMBA 3M6WA 1CF2O 1ODFA 4H7IA 1Q0HA 2A3NA 3GWZA 1UOQA 2L82A 1YQUA 1XCPA 3DYBA 3HL0A 5KAPA 2CLMB 2NTEA 1O7JA 2FP4A 1GRRA 2B8EA 2ZULA 4OYLA 1XEAA 4PHGA 3ENNA 4AZSA 1QQAA 4JVNA 5TGTA 3R40A 1XF9A 3PPYA 1H8EA 3ER8A 2EWMA 1Q44A 5B55A 1VB3A 1RRKA 2XX3A 2F2TA 3LUBA 3DOUA 3F90A 4GFDA 4TYPA 4I3HA 1PDVA 2V55B 4P3PA 1DBQA 2FB9A 4KAAA 3ADDA 2R68A 3Q1KA 4HNVA 4MW6A 2XWJI 3K0FB 2APJA 3SHQA 1VPWA 2ZBFA 4PHFA 3H7AA 4U2EA 2GF2A 5IASA 4W8HA 3DBVO 4NONA 1W49A 3T4PA 5AIAA 5ITZB 4E3ZA 1JHYA 2HK9A 4TMYA 3HBNA 1NKVA 1U90A 3PIDA 5ENZA 3NDJA 5I9BA 1M5RA 5DW3A 3PFHA 2J3JA 3S2IA 1PSWA 2IYZA 2X76A 2XCIA 3HSSA 3PQ3A 4HJXA 1R6TA 2GDZA 4KKVA 3AR2A 2B4KA 1QDLB 1XEWX 3QX9A 4IIUA 4P82A 1J90A 2WF6A 4FZ3A 1MQAA 1BEZA 1IXSB 2FK7A 2HEIA 2BFWA 2MTBA 3OA2A 5SY4A 3Q10A 3HVRA 2CV0A 2CHUA 5GWXA 3VO2A 1IPFA 1ZI9A 1Z5WA 2RBGA 2X1LA 3RTGA 1PL7A 2FR8A 3T38A 4AJPA 5EKTA 1M6EX 3E81A 1FYVA 5SYNA 2F8MA 3PE6A 2HIMA 2YXLA 1Q20A 1CZKA 1X7WA 2OYSA 3TS1A 1ZVKA 4E03A 1XU4A 4NFHA 1EUQA 2ID9A 2IYOA 3UJ9A 2DYKA 3FBTA 1DCFA 2ZCJA 4TV9B 4EG5A 4TTVA 1UC9A 4WK2B 1Y1SA 3WICA 3GPIA 4QGAA 1FP1D 3L6UA 3TDKA 3WK9A 1Q1ZA 4EARA 1A8IA 4KXXA 1W88B 2RI6A 3N0RA 4OLHA 1OX5A 3LF1A 3HKBB 3I9OA 4CM9A 1DO0A 4KQFA 1M1NB 3OZSA 3TAHA 3CSSA 1RAEA 4W5WA 4GI7A 1Z06A 2PU7A 3SQMA 4ZOEA 1HSOA 2C7VA 3OEHA 3LPDA 2GFIA 1MC1A 3IBFA 1MVOA 2JFXA 4FOSA 3PB3A 4QGHA 3N2KA 1SCNE 2QGZA 1J7JA 4FQ8A 1Q3HA 3HGQA 3OPVA 2NVUA 2Q5QA 4RMIA 4WZAB 3GL9A 4AZWA 3PL5A 4HDKA 2O1SA 3FLEA 4S1VA 2BHSA 3VFDA 2IS1A 4FLEA 1EKXA 1TMYA 2RARA 3M49A 2JIZD 4NJEA 4D44A 4EEXA 1UL1X 4PSVA 1JJAA 2OP0A 1Q84A 4RORA 2P78A 3NW9A 5FH9A 3ZXIA 2NUAA 2BPOA 2GJAA 1TZJA 4MIOA 4BWYA 5J2TB 3ANTA 2IRWA 3JRXA 5G0SA 3HVUA 4K6GA 1Z4IA 3CZ4A 3SHOA 2EJTA 4J07A 1PJ4A 3AFHA 3PU6A 1H8HD 3ZG6A 5FUYA 1XTKA 4HL6A 3MINB 4P36A 1EDBA 2WYWA 4P81A 621PA 1OAOA 4KJXA 1KYWA 4K9SA 3ZLBA 1J9EA 3NWOA 3VNAA 5AW9A 1VRCA 1MT3A 3WA6A 4AP5A 1GFSA 3SJUA 5JC1A 1KKMA 2KBFA 2D3WA 3QLUA 4JN6B 2EQBA 2LCFA 3MWKA 2VYND 2XZDA 1NASA 4CGZA 1NQ5A 1HLGA 4P1ZA 3HYNA 1CC1S 4WFQA 2GPYA 5KHLB 1NW4A 3KVRA 3DVQX 5LD2C 1UM9B 3R24A 3STWA 5EZYA 4JSYA 2QM8A 4AL4A 5KOHB 1CD5A 2ZJ1A 1HC7A 2P77A 1IZ9A 1IEVA 2HMWA 5L7TA 1AMNA 2LPMA 4HRXA 1E1YA 4BNIA 2G40A 2WPNA 5IF3A 2VTVA 3QTLA 3JZFA 4OO3A 1H4TA 3WV4A 3Q0EA 2A5DA 1BRMA 4MW9A 3NM5A 1K4YA 3WG9A 3I92A 2VP2A 1VG8A 4HNAB 4DR7B 3PP8A 3PC8A 4B3TB 3DKPA 3WLTA 4K88A 1ZD5A 3IT2A 3NEJA 2Z0MA 3BZWA 4GZMA 1BVUA 5AKHA 2C1XA 1ZAKA 1P8AA 2BW0A 1Y1LA 1M8FA 1K68A 3P96A 4MGYR 3WFIA 4DYHA 1V8PA 4BNDB 3ITDA 1J23A 2WD8A 4Y30A 3AYZB 5AFSA 1NVBA 2CLFB 3GJ0A 3O83A 4DA7A 2C5HA 5C1BA 3TQSA 3BE4A 4IDPA 3PGMA 1E60A 2EZ8A 1H3NA 3O3MB 4FCCA 3MMPA 5CLGA 3TRFA 5C4IA 3IT3A 1ZITA 1C7QA 2E21A 2XQFA 9ATCA 4JJ6A 4QXMA 4TKVA 1TPZA 3FM9A 3OMWA 3OZXA 2ZJZA 3CX6A 4IL5A 1UKVY 4TV8A 2YN4A 1Q7RA 3LTNC 4WCFA 5JO9A 4L4SA 2OSVA 3VO1A 3HB7A 4BZWA 4E31A 1CUIA 2AC4A 3Q8MA 1JDPA 3IRUA 2RCNA 3G0CA 3MJTA 1JZQA 2W70A 1W4LA 2QOEA 3DUFA 2H9IA 1P75A 1G2IA 1KJ8A 1QZ3A 1QUFA 3A6EA 2MSKA 5DFAA 2BMEA 5FQNA 1ZXBA 2I6FA 2VDJA 2WYUA 3I4LA 4JC8A 4M22A 5DT2A 3UKOA 3UOGA 4ADSG 3H5NA 3AHHA 5JFOA 2JFOA 5G41A 5LU9A 4QG7A 1YBAA 3E7FA 5JS8A 2W37A 3WK7A 1SC3A 3LYUA 3FTFA 2Y8EA 1FLVA 2GX6A 3JQBC 3R7BA 4ARZA 4GP9A 4N9WA 2E7ZA 4LUCA 4F2PA 2WYOA 4XDYA 3CRW1 2A57A 3UENA 4A0GA 4EQ6A 5AUNB 1VL1A 3CONA 1M67A 1ISSA 5FBLB 2GN2A 2UV8A 1G8YA 5TF0A 1MT0A 2BMAA 3FHCB 3OLZA 2CCKA 2GEBA 2WVGA 3F67A 1J8MF 1QH9A 3H9GA 1N8NA 2IK8A 3HJRA 4J29A 4ZDWA 1UKCA 2DC1A 3M5PA 3W5VA 1VJGA 1OXKB 3PFKA 2E4UA 3FVVA 4KIWA 4BLPA 1IEQA 1X19A 2HDHA 3T0GA 4CV2A 1Z5NA 2OSBA 2JFHA 2NXWA 1I2MA 1UC8A 1PGPA 4JENA 5AW2A 5I7EA 1Z6AA 1AIPA 1F2DA 2OXIA 2N1BA 1C1XB 4KGZA 1NA5A 5CM2Z 3WIEA 3UBTA 1UPTA 4JC4A 2QN1A 2PKEA 1CP3A 2GLTA 1L5OA 3HA5A 1DBVO 3EZ2A 4UUQA 3DL7A 4A3SA 2C9YA 1PWEA 4FT2A 1U9IC 3SIXA 2IYUA 2V6BA 3GMSA 1NI5A 2UVPB 3HB1A 5J5AA 3LL7A 3CF2A 4W7SA 1CR2A 2ECKA 2IC5A 4M88A 2BIFA 4DFDA 1GEEA 1L4FA 2FGJA 5FF9A 2BGIA 4GM1A 5DYNA 1KY4A 1OASA 1Y63A 3GOHA 3LTEA 4Z5XA 4INPA 4M98A 1V7QA 2VK4A 4O4HA 1E9SA 1U99A 4E5YA 5FB3A 4QQFA 2G09A 2Y0CA 1CYDA 2RDMA 3ED5A 3IUQA 1SOMA 1AKUA 5CTJA 4YJGB 1FTWA 5JFTA 4PZEA 3LV8A 4LY0A 6CHYA 1E2NA 1W0JD 1P80A 4NNJA 1HL7A 4AIIA 5B2FA 3E22B 2VDMB 5BW4A 1A82A 3N58A 4MQBA 1IY1A 5HSGA 3U48A 4E7PA 2OMEA 3Q85A 3TJZA 2VQFB 3Q8WA 5I4KA 2H4FA 2REBA 7REQB 3IEVA 3QUAA 3I09A 2GEUA 3ST7A 4X85A 3WYAA 1XROA 4JXKA 4EG4A 2OKCA 1R5NA 2VAVA 4OA8A 4YUYA 5CTAA 3PC7A 1JECA 2P4HX 4HH1A 3PXXA 3KJFA 1E6MA 4P4SA 4YIKA 3WRYC 1RQNA 3DCIA 3KJXA 3SOPA 3JAMA 5JHHB 5K0FA 9MHTA 4ZOQI 3AL3A 3V4VB 5LD2B 4OQNA 1J8QA 2X6TA