3G98A

Crystal structure of the c-ala domain from aquifex aeolicus alanyl-trna synthetase
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
111
structure length
111
Chain Sequence
MKEENVGDFTLHYGVFEEVEPEELRNLADMLRQRTKKDVVFIASRKGDKINFVIGVSKEISDKVNAKEVIREVGKVLKGGGGGRADLAQGGGKAPDKFPEAVKLLKEILSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The C-Ala domain brings together editing and aminoacylation functions on one tRNA.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Ligase
molecule keywords Alanyl-tRNA synthetase
total genus 39
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 6.1.1.7: Alanine--tRNA ligase.
pdb deposition date 2009-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.40 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 3g98A00
3WQZA 3G98A 2ZVFA
chains in the Genus database with same CATH superfamily
2AZPA 3PVHA 1IR6A 1YM5A 2KPTA 2LT2A 1XUBA 2HAWA 4K7XA 3PW9A 1U1XA 2Q9HA 4DUNA 1W62A 1QY9A 2IW4A 2YMAA 4JBDA 3IGHX 2ZXOA 3W5WA 2QB7A 1U1VA 4LS9A 1K20A 1XUAA 1WPPA 5IWEA 2ZXRA 3WQZA 2QB6A 4RPAA 3G7KA 5H2YA 4JD7A 1K23A 4J9XA 2ZVFA 3FVEA 3EKMA 2GKEA 4IK0A 2KW7A 2QB8A 4K8LA 2ENXA 1T6KA 4J9WA 1GQZA 2Q9JA 2MPBA 1I74A 5H2GA 3DEVA 3PTJA 1U0KA 2OTNA 4K7GB 1QYAA 4LB0A 3EDNA 2PW0A 4GL6A 4Q60A 1TM0A 3ICJA 4JUUA 5ANPA 2ZXPA 2H9FA 4LG3A 4JCIA 4OA3A 5M47A 2EB0A 5HA4A 2GKJA 4Q2HA 4PY9A 1S7JA 3G98A 1WPMA 3EJXA 1W61A 1U1WA 1BWZA 4IJZA 1SDJA 2PVZA
chains in the Genus database with same CATH topology
2AZPA 3PVHA 1IR6A 1YM5A 2KPTA 2LT2A 1XUBA 2HAWA 4K7XA 3PW9A 1U1XA 2Q9HA 4DUNA 1W62A 1QY9A 2IW4A 2YMAA 4JBDA 3IGHX 2ZXOA 3W5WA 2QB7A 1U1VA 4LS9A 1K20A 1XUAA 1WPPA 5IWEA 2ZXRA 3WQZA 2QB6A 4RPAA 3G7KA 5H2YA 4JD7A 1K23A 4J9XA 2ZVFA 3FVEA 3EKMA 2GKEA 4IK0A 2KW7A 2QB8A 4K8LA 2ENXA 1T6KA 4J9WA 1GQZA 2Q9JA 2MPBA 1I74A 5H2GA 3DEVA 3PTJA 1U0KA 2OTNA 4K7GB 1QYAA 4LB0A 3EDNA 2PW0A 4GL6A 4Q60A 1TM0A 3ICJA 4JUUA 5ANPA 2ZXPA 2H9FA 4LG3A 4JCIA 4OA3A 5M47A 2EB0A 5HA4A 2GKJA 4Q2HA 4PY9A 1S7JA 3G98A 1WPMA 3EJXA 1W61A 1U1WA 1BWZA 4IJZA 1SDJA 2PVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WQZ A;  3G98 A;  2ZVF A; 
#chains in the Genus database with same CATH topology
 2AZP A;  3PVH A;  1IR6 A;  1YM5 A;  2KPT A;  2LT2 A;  1XUB A;  2HAW A;  4K7X A;  3PW9 A;  1U1X A;  2Q9H A;  4DUN A;  1W62 A;  1QY9 A;  2IW4 A;  2YMA A;  4JBD A;  3IGH X;  2ZXO A;  3W5W A;  2QB7 A;  1U1V A;  4LS9 A;  1K20 A;  1XUA A;  1WPP A;  5IWE A;  2ZXR A;  3WQZ A;  2QB6 A;  4RPA A;  3G7K A;  5H2Y A;  4JD7 A;  1K23 A;  4J9X A;  2ZVF A;  3FVE A;  3EKM A;  2GKE A;  4IK0 A;  2KW7 A;  2QB8 A;  4K8L A;  2ENX A;  1T6K A;  4J9W A;  1GQZ A;  2Q9J A;  2MPB A;  1I74 A;  5H2G A;  3DEV A;  3PTJ A;  1U0K A;  2OTN A;  4K7G B;  1QYA A;  4LB0 A;  3EDN A;  2PW0 A;  4GL6 A;  4Q60 A;  1TM0 A;  3ICJ A;  4JUU A;  5ANP A;  2ZXP A;  2H9F A;  4LG3 A;  4JCI A;  4OA3 A;  5M47 A;  2EB0 A;  5HA4 A;  2GKJ A;  4Q2H A;  4PY9 A;  1S7J A;  3G98 A;  1WPM A;  3EJX A;  1W61 A;  1U1W A;  1BWZ A;  4IJZ A;  1SDJ A;  2PVZ A; 
#chains in the Genus database with same CATH homology
 2AZP A;  3PVH A;  1IR6 A;  1YM5 A;  2KPT A;  2LT2 A;  1XUB A;  2HAW A;  4K7X A;  3PW9 A;  1U1X A;  2Q9H A;  4DUN A;  1W62 A;  1QY9 A;  2IW4 A;  2YMA A;  4JBD A;  3IGH X;  2ZXO A;  3W5W A;  2QB7 A;  1U1V A;  4LS9 A;  1K20 A;  1XUA A;  1WPP A;  5IWE A;  2ZXR A;  3WQZ A;  2QB6 A;  4RPA A;  3G7K A;  5H2Y A;  4JD7 A;  1K23 A;  4J9X A;  2ZVF A;  3FVE A;  3EKM A;  2GKE A;  4IK0 A;  2KW7 A;  2QB8 A;  4K8L A;  2ENX A;  1T6K A;  4J9W A;  1GQZ A;  2Q9J A;  2MPB A;  1I74 A;  5H2G A;  3DEV A;  3PTJ A;  1U0K A;  2OTN A;  4K7G B;  1QYA A;  4LB0 A;  3EDN A;  2PW0 A;  4GL6 A;  4Q60 A;  1TM0 A;  3ICJ A;  4JUU A;  5ANP A;  2ZXP A;  2H9F A;  4LG3 A;  4JCI A;  4OA3 A;  5M47 A;  2EB0 A;  5HA4 A;  2GKJ A;  4Q2H A;  4PY9 A;  1S7J A;  3G98 A;  1WPM A;  3EJX A;  1W61 A;  1U1W A;  1BWZ A;  4IJZ A;  1SDJ A;  2PVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...