3G98A

Crystal structure of the c-ala domain from aquifex aeolicus alanyl-trna synthetase
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
111
structure length
111
Chain Sequence
MKEENVGDFTLHYGVFEEVEPEELRNLADMLRQRTKKDVVFIASRKGDKINFVIGVSKEISDKVNAKEVIREVGKVLKGGGGGRADLAQGGGKAPDKFPEAVKLLKEILSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The C-Ala domain brings together editing and aminoacylation functions on one tRNA.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Ligase
molecule keywords Alanyl-tRNA synthetase
total genus 39
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 6.1.1.7: Alanine--tRNA ligase.
pdb deposition date 2009-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.40 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 3g98A00
3G98A 3WQZA 2ZVFA
chains in the Genus database with same CATH superfamily
2ZXPA 4LB0A 3G7KA 3ICJA 2EB0A 4K7XA 4LG3A 2H9FA 2KPTA 4JD7A 1S7JA 3WQZA 5H2YA 2ZXRA 3DEVA 2HAWA 5M47A 4RPAA 1XUBA 2KW7A 3PVHA 3FVEA 2IW4A 4J9WA 1K20A 1IR6A 2QB6A 4DUNA 1U1VA 4JBDA 1U1WA 3W5WA 3PW9A 2QB7A 4Q60A 2GKJA 2ENXA 3EKMA 2LT2A 2ZXOA 4K7GB 2GKEA 1T6KA 1W61A 2PW0A 2PVZA 5HA4A 1TM0A 1I74A 3IGHX 4PY9A 1K23A 2QB8A 2YMAA 1SDJA 3G98A 2Q9JA 5ANPA 1YM5A 2ZVFA 1W62A 1WPMA 4K8LA 2MPBA 4LS9A 1U0KA 5IWEA 5H2GA 2Q9HA 2OTNA 4JCIA 1QYAA 4IJZA 3EDNA 3PTJA 4OA3A 1WPPA 4Q2HA 4IK0A 2AZPA 1QY9A 4JUUA 1GQZA 4GL6A 1BWZA 3EJXA 1U1XA 1XUAA 4J9XA
chains in the Genus database with same CATH topology
2ZXPA 4LB0A 3G7KA 3ICJA 2EB0A 4K7XA 4LG3A 2H9FA 2KPTA 4JD7A 1S7JA 3WQZA 5H2YA 2ZXRA 3DEVA 2HAWA 5M47A 4RPAA 1XUBA 2KW7A 3PVHA 3FVEA 2IW4A 4J9WA 1K20A 1IR6A 2QB6A 4DUNA 1U1VA 4JBDA 1U1WA 3W5WA 3PW9A 2QB7A 4Q60A 2GKJA 2ENXA 3EKMA 2LT2A 2ZXOA 4K7GB 2GKEA 1T6KA 1W61A 2PW0A 2PVZA 5HA4A 1TM0A 1I74A 3IGHX 4PY9A 1K23A 2QB8A 2YMAA 1SDJA 3G98A 2Q9JA 5ANPA 1YM5A 2ZVFA 1W62A 1WPMA 4K8LA 2MPBA 4LS9A 1U0KA 5IWEA 5H2GA 2Q9HA 2OTNA 4JCIA 1QYAA 4IJZA 3EDNA 3PTJA 4OA3A 1WPPA 4Q2HA 4IK0A 2AZPA 1QY9A 4JUUA 1GQZA 4GL6A 1BWZA 3EJXA 1U1XA 1XUAA 4J9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G98 A;  3WQZ A;  2ZVF A; 
#chains in the Genus database with same CATH topology
 2ZXP A;  4LB0 A;  3G7K A;  3ICJ A;  2EB0 A;  4K7X A;  4LG3 A;  2H9F A;  2KPT A;  4JD7 A;  1S7J A;  3WQZ A;  5H2Y A;  2ZXR A;  3DEV A;  2HAW A;  5M47 A;  4RPA A;  1XUB A;  2KW7 A;  3PVH A;  3FVE A;  2IW4 A;  4J9W A;  1K20 A;  1IR6 A;  2QB6 A;  4DUN A;  1U1V A;  4JBD A;  1U1W A;  3W5W A;  3PW9 A;  2QB7 A;  4Q60 A;  2GKJ A;  2ENX A;  3EKM A;  2LT2 A;  2ZXO A;  4K7G B;  2GKE A;  1T6K A;  1W61 A;  2PW0 A;  2PVZ A;  5HA4 A;  1TM0 A;  1I74 A;  3IGH X;  4PY9 A;  1K23 A;  2QB8 A;  2YMA A;  1SDJ A;  3G98 A;  2Q9J A;  5ANP A;  1YM5 A;  2ZVF A;  1W62 A;  1WPM A;  4K8L A;  2MPB A;  4LS9 A;  1U0K A;  5IWE A;  5H2G A;  2Q9H A;  2OTN A;  4JCI A;  1QYA A;  4IJZ A;  3EDN A;  3PTJ A;  4OA3 A;  1WPP A;  4Q2H A;  4IK0 A;  2AZP A;  1QY9 A;  4JUU A;  1GQZ A;  4GL6 A;  1BWZ A;  3EJX A;  1U1X A;  1XUA A;  4J9X A; 
#chains in the Genus database with same CATH homology
 2ZXP A;  4LB0 A;  3G7K A;  3ICJ A;  2EB0 A;  4K7X A;  4LG3 A;  2H9F A;  2KPT A;  4JD7 A;  1S7J A;  3WQZ A;  5H2Y A;  2ZXR A;  3DEV A;  2HAW A;  5M47 A;  4RPA A;  1XUB A;  2KW7 A;  3PVH A;  3FVE A;  2IW4 A;  4J9W A;  1K20 A;  1IR6 A;  2QB6 A;  4DUN A;  1U1V A;  4JBD A;  1U1W A;  3W5W A;  3PW9 A;  2QB7 A;  4Q60 A;  2GKJ A;  2ENX A;  3EKM A;  2LT2 A;  2ZXO A;  4K7G B;  2GKE A;  1T6K A;  1W61 A;  2PW0 A;  2PVZ A;  5HA4 A;  1TM0 A;  1I74 A;  3IGH X;  4PY9 A;  1K23 A;  2QB8 A;  2YMA A;  1SDJ A;  3G98 A;  2Q9J A;  5ANP A;  1YM5 A;  2ZVF A;  1W62 A;  1WPM A;  4K8L A;  2MPB A;  4LS9 A;  1U0K A;  5IWE A;  5H2G A;  2Q9H A;  2OTN A;  4JCI A;  1QYA A;  4IJZ A;  3EDN A;  3PTJ A;  4OA3 A;  1WPP A;  4Q2H A;  4IK0 A;  2AZP A;  1QY9 A;  4JUU A;  1GQZ A;  4GL6 A;  1BWZ A;  3EJX A;  1U1X A;  1XUA A;  4J9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...