3G9AA

Green fluorescent protein bound to minimizer nanobody
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
227
structure length
226
Chain Sequence
GKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Green fluorescent protein
publication title Modulation of protein properties in living cells using nanobodies
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Fluorescent protein/immune system
total genus 67
structure length 226
sequence length 227
ec nomenclature
pdb deposition date 2009-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3g9aA00
5HZSA 4HQCA 4KF4A 3LS3A 5H87A 3DQLA 3GJ1A 2G6YA 1YJ2A 3NT9A 4R6BA 1OXDA 4KPIA 2WSOA 4KGFA 5F9GA 1EMCA 2EMOA 3S05A 4RTCA 1EMAA 2QLEA 4W6TA 2WIQA 1EMBA 4DXQA 1H6RA 2DUGA 3SSVA 3ZUJA 4W6PA 5HZOA 4W77A 5T3IA 1JBZA 4JGEA 4DXOA 4HE4A 4W6UA 1XMZA 3DQ4A 3ST0A 3SSPA 3NF0A 2H6VA 4LJCA 1GL4A 2DDDA 3SG3A 2AH8A 1XA9A 1Z1QA 2VZXA 4ANJA 4XVPA 1GGXA 2Z1OA 4HQ8A 4HVFA 3SG6A 3RWAA 2A50B 2A54B 3WCKA 3O77A 3DQFA 1QXTA 3EVVA 2YE1A 3DQKA 3DPXA 4W69A 3UFZA 2C9JA 2YDZA 4ZF4A 2WURA 1Q4AA 3SVRA 2FZUA 4LQTA 4XGYA 2AWMA 4J8AA 3IP2A 3NT3A 3CBEA 3LSAA 2IOVA 3ADFA 2DUIA 4DXMA 5DRFA 5DY6A 5FVIA 4W75A 1H4UA 4J88A 3PJBA 2A47A 2OGRA 4OY4A 3P8UA 4B30A 1ZGPA 5DTXA 2V4EA 2QRFA 3WLCA 2QLHA 4W72A 4XOWA 4ORNA 4W7AA 3SVBA 1RMPA 1YFPA 4U2VA 4J89A 4W6BA 4RYWA 2OKWA 1KYSA 3ST3A 4KF5C 1Q4BA 5AQBB 1Q4CA 2RH7A 5EJUA 4EULA 2HQKA 2QU1A 3SVSA 5HW9A 3DQJA 2OJKA 1RM9A 2G6XA 1Z1PA 2H9WA 1OXEA 3MGFA 1W7SA 1MYWA 4L12A 3SSLA 1RMOA 4I2YA 4ZINA 2PXSA 4W6IA 4IK9A 4EMQA 3SVCA 2GW3A 4NWSA 2POXA 1F0BA 3OSRA 4EDOA 3DQEA 4Z4KA 2DUEA 2C9IA 5DQBA 3EKHA 3CFHA 3ST2A 1KYRA 1KYPA 4KW4A 4JFGA 2H5OA 1KP5A 3DQHA 5HZTA 4XOVA 1RRXA 4ZF3A 2ICRA 3W1DA 3AI4A 5FVGA 3EVRA 3SG5A 2JADA 1YZWA 1CV7A 3TMTA 5HGEA 3LF3A 2ZO6A 3DQ7A 4LJBA 4PPJA 4W7FA 4W6SA 3DQUA 4H3NA 4W7CA 3SG4A 5DTZA 2Q57A 4JC2A 4IK8A 3GL4A 5BTTB 2Z6ZA 2Y0GA 4W7XA 3BX9A 4DKMA 2GX0A 4H47A 1EMFA 3CGLA 4LJDC 2IB6A 1QY3A 1QYFA 3U0KA 5BT0A 3GEXA 3WLDA 3GB3A 2QLGB 2ZO7A 2OKYA 3DQ6A 3AI5A 1C4FA 3SVEA 3LA1A 1G7KA 2WHUA 2AWJA 5HBDA 2Z6XA 5KTGA 2HJOA 2VVHA 5BTTA 4Z4MA 4B30B 2V4EB 3G9AA 2G5ZB 4W6FA 3H1OA 4IK4A 5EB7A 5EXBA 3EVPA 1YHHA 3NEDA 1YHGA 2ARLA 1QYOA 3SSHA 2QLGA 2B3PA 2Q6PA 3LVAA 2EMDA 3A8SA 2WHSA 1ZGOA 1B9CA 2A53B 3LVDA 4KW9A 4EN1A 3P28A 3U8AA 2HPWA 3BXBA 4OHSA 4UTSA 1JC1A 1MOVA 1RMMA 4P1QA 4JF9A 1HUYA 2VVIA 4W6MA 4B5YA 1EMEA 2A56B 2AWLA 3DQ3A 3SS0A 4PFEA 3SVOA 1HCJA 4ZIOA 3ZUFA 2WISA 3DQ1A 4EDSA 1MOUA 4W6KA 3CFFA 4W7RA 2DD7A 3E5WA 4Q7TA 5H89A 2HQZA 3U8CA 4KAGA 3CB9A 5LTRA 4W76A 3ZTFA 4N3DA 3U0LA 1Q73A 3K1KA 2DUHA 4W6OA 3GJ2A 2GW4B 3H1RA 2G2SB 2VAEA 4DXIA 3M24A 1F09A 3E5TA 2OTBA 4ZBLA 3EKJA 5DPGA 3EK7A 2G6EA 3DQDA 4W7DA 2YE0A 3PJ7A 3KCSA 5LTPA 2IB5A 4KA9A 5DRGA 3M22A 4JEOA 4KF5A 4W73A 3NEZA 5FHVA 4IK3A 4W6CA 3SG7A 1ZUXA 2HGDA 3VK1A 3SVNA 2H5RA 4W6HA 3W1CA 1JBYA 5J2OA 4KEXA 5EB6A 3E5VA 3SG2A 2H8QA 2WHTA 4BDUA 5FVFA 5EXCI 2DUFA 4ZF5A 1S6ZA 4W6RA 2QT2A 3EK4A 4IK1A 4OJ0A 4ZFSA 2DD9A 3SSTA 3ZULA 3AKOA 3SVUA 3U0MA 2ZMWA 2ZMUA 3IR8A 1BFPA 4Q7UA 3RWTA 5LK4A 3U0NA 2EMNA 5DU0A 3TMRA 5HZUA 4W7EA 2A46A 4W6AA 3CD1A 4OGSA 4W74A 3CD9A 4W6JA 1XAEA 2G3OA 2QLIA 2IE2A 2YFPA 3KCTA 4W6LA 3UG0A 2DDCA 2G3DB 3OSQA 2OTEA 5DPIA 4IZNA 2AWKA 2O24A 2FL1A 2AHAA 3SVDA 3DPWA 2O2BA 3DQNA 2A52B 4AS8A 2A48A 2HCGA 4PPLA 2QZ0A 4H3LA 1QYQA 4W6NA 4IK5A 3DQ5A 3DQMA 4Q9XA 4DXNA 5DPJA 2G16B 4TZAA 3DQIA 1EMGA 3ST4A 3DQCA 2H5QA 3U8PA 4Q9WA 4PPKA 4LJDA 3SSYA 4RYSA 3LF4B 2V4EC 4LW5A 4DKNA 4AR7A 4R6DA 4TZGA 4JRBA 2P4MA 3EK8A 1ZGQA 2WSNA 2BTJA 1EMLA 3I19A 3ED8A 1Q4DA 5EBJA 3DQ2A 1W7UA 4OQWA 3OGOA 3SRYA 2GX2A 5EXUA 4XL5A 4H3MA 4LQUA 4DXPA 2HRSA 3VICA 3PIBA 4HQ9A 5DPHA 4KW8A 1YHIA 3V3DA 1W7TA 2FWQA 2VADA 1JC0A 3DQ8A 1EMMA 1UISA 3DQAA 2HFCA 5EHUA 4L13A 3PJ5A 4KGEA 3CFAA 4ZB1A 1XSSA 2O29A 3VHTB 5BQLA 5LTQA 2H5PA 4Q7RA 2Z6YA 3DQ9A 5DTLA 3LVCA 4GOBA 4P76A 3DQOA 4GF6B 3SV5A 2PXWA 5DQMA 5H88A 2VVJA 4W6GA 4H48A 1OXFA 1Q4EA 3BXAA 3SSKA 1XQMA 3DPZA 3VHTA 1YJFA 4GESB 4W6DA 2HGYA 1GFLA 5DTYA 3O78A 3EVUA 2B3QA 3BXCA 4L1IA 1EMKA
chains in the Genus database with same CATH superfamily
5HZSA 4HQCA 4KF4A 3LS3A 5H87A 3DQLA 3GJ1A 2G6YA 1YJ2A 3NT9A 4R6BA 1OXDA 4KPIA 2WSOA 4KGFA 5F9GA 1EMCA 2EMOA 3S05A 4RTCA 1EMAA 2QLEA 4W6TA 2WIQA 1EMBA 4DXQA 1H6RA 2DUGA 3SSVA 3ZUJA 4W6PA 5HZOA 4W77A 5T3IA 1JBZA 4JGEA 4DXOA 4HE4A 4W6UA 1XMZA 3DQ4A 3ST0A 3SSPA 3NF0A 2H6VA 4LJCA 1GL4A 2DDDA 3SG3A 2AH8A 1XA9A 1Z1QA 2VZXA 4ANJA 4XVPA 1GGXA 2Z1OA 4HQ8A 4HVFA 3SG6A 3RWAA 2A50B 2A54B 3WCKA 3O77A 3DQFA 1QXTA 3EVVA 2YE1A 3DQKA 3DPXA 4W69A 3UFZA 2C9JA 2YDZA 4ZF4A 2WURA 1Q4AA 3SVRA 2FZUA 4LQTA 4XGYA 2AWMA 4J8AA 3IP2A 3NT3A 3CBEA 3LSAA 2IOVA 3ADFA 2DUIA 4DXMA 5DRFA 5DY6A 5FVIA 4W75A 1H4UA 4J88A 3PJBA 2A47A 2OGRA 4OY4A 3P8UA 4B30A 1ZGPA 5DTXA 2V4EA 2QRFA 3WLCA 2QLHA 4W72A 4XOWA 4ORNA 4W7AA 3SVBA 1RMPA 1YFPA 4U2VA 4J89A 4W6BA 4RYWA 2OKWA 1KYSA 3ST3A 4KF5C 1Q4BA 5AQBB 1Q4CA 2RH7A 5EJUA 4EULA 2HQKA 2QU1A 3SVSA 5HW9A 3DQJA 2OJKA 1RM9A 2G6XA 1Z1PA 2H9WA 1OXEA 3MGFA 1W7SA 1MYWA 4L12A 3SSLA 1RMOA 4I2YA 4ZINA 2PXSA 4W6IA 4IK9A 4EMQA 3SVCA 2GW3A 4NWSA 2POXA 1F0BA 3OSRA 4EDOA 3DQEA 4Z4KA 2DUEA 2C9IA 5DQBA 3EKHA 3CFHA 3ST2A 1KYRA 1KYPA 4KW4A 4JFGA 2H5OA 1KP5A 3DQHA 5HZTA 4XOVA 1RRXA 4ZF3A 2ICRA 3W1DA 3AI4A 5FVGA 3EVRA 3SG5A 2JADA 1YZWA 1CV7A 3TMTA 5HGEA 3LF3A 2ZO6A 3DQ7A 4LJBA 4PPJA 4W7FA 4W6SA 3DQUA 4H3NA 4W7CA 3SG4A 5DTZA 2Q57A 4JC2A 4IK8A 3GL4A 5BTTB 2Z6ZA 2Y0GA 4W7XA 3BX9A 4DKMA 2GX0A 4H47A 1EMFA 3CGLA 4LJDC 2IB6A 1QY3A 1QYFA 3U0KA 5BT0A 3GEXA 3WLDA 3GB3A 2QLGB 2ZO7A 2OKYA 3DQ6A 3AI5A 1C4FA 3SVEA 3LA1A 1G7KA 2WHUA 2AWJA 5HBDA 2Z6XA 5KTGA 2HJOA 2VVHA 5BTTA 4Z4MA 4B30B 2V4EB 3G9AA 2G5ZB 4W6FA 3H1OA 4IK4A 5EB7A 5EXBA 3EVPA 1YHHA 3NEDA 1YHGA 2ARLA 1QYOA 3SSHA 2QLGA 2B3PA 2Q6PA 3LVAA 2EMDA 3A8SA 2WHSA 1ZGOA 1B9CA 2A53B 3LVDA 4KW9A 4EN1A 3P28A 3U8AA 2HPWA 3BXBA 4OHSA 4UTSA 1JC1A 1MOVA 1RMMA 4P1QA 4JF9A 1HUYA 2VVIA 4W6MA 4B5YA 1EMEA 2A56B 2AWLA 3DQ3A 3SS0A 4PFEA 3SVOA 1HCJA 4ZIOA 3ZUFA 2WISA 3DQ1A 4EDSA 1MOUA 4W6KA 3CFFA 4W7RA 2DD7A 3E5WA 4Q7TA 5H89A 2HQZA 3U8CA 4KAGA 3CB9A 5LTRA 4W76A 3ZTFA 4N3DA 3U0LA 1Q73A 3K1KA 2DUHA 4W6OA 3GJ2A 2GW4B 3H1RA 2G2SB 2VAEA 4DXIA 3M24A 1F09A 3E5TA 2OTBA 4ZBLA 3EKJA 5DPGA 3EK7A 2G6EA 3DQDA 4W7DA 2YE0A 3PJ7A 3KCSA 5LTPA 2IB5A 4KA9A 5DRGA 3M22A 4JEOA 4KF5A 4W73A 3NEZA 5FHVA 4IK3A 4W6CA 3SG7A 1ZUXA 2HGDA 3VK1A 3SVNA 2H5RA 4W6HA 3W1CA 1JBYA 5J2OA 4KEXA 5EB6A 3E5VA 3SG2A 2H8QA 2WHTA 4BDUA 5FVFA 5EXCI 2DUFA 4ZF5A 1S6ZA 4W6RA 2QT2A 3EK4A 4IK1A 4OJ0A 4ZFSA 2DD9A 3SSTA 3ZULA 3AKOA 3SVUA 3U0MA 2ZMWA 2ZMUA 3IR8A 1BFPA 4Q7UA 3RWTA 5LK4A 3U0NA 2EMNA 5DU0A 3TMRA 5HZUA 4W7EA 2A46A 4W6AA 3CD1A 4OGSA 4W74A 3CD9A 4W6JA 1XAEA 2G3OA 2QLIA 2IE2A 2YFPA 3KCTA 4W6LA 3UG0A 2DDCA 2G3DB 3OSQA 2OTEA 5DPIA 4IZNA 2AWKA 2O24A 2FL1A 2AHAA 3SVDA 3DPWA 2O2BA 3DQNA 2A52B 4AS8A 2A48A 2HCGA 4PPLA 2QZ0A 4H3LA 1QYQA 4W6NA 4IK5A 3DQ5A 3DQMA 4Q9XA 4DXNA 5DPJA 2G16B 4TZAA 3DQIA 1EMGA 3ST4A 3DQCA 2H5QA 3U8PA 4Q9WA 4PPKA 4LJDA 3SSYA 4RYSA 3LF4B 2V4EC 4LW5A 4DKNA 4AR7A 4R6DA 4TZGA 4JRBA 2P4MA 3EK8A 1ZGQA 2WSNA 2BTJA 1EMLA 3I19A 3ED8A 1Q4DA 5EBJA 3DQ2A 1W7UA 4OQWA 3OGOA 3SRYA 2GX2A 5EXUA 4XL5A 4H3MA 4LQUA 4DXPA 2HRSA 3VICA 3PIBA 4HQ9A 5DPHA 4KW8A 1YHIA 3V3DA 1W7TA 2FWQA 2VADA 1JC0A 3DQ8A 1EMMA 1UISA 3DQAA 2HFCA 5EHUA 4L13A 3PJ5A 4KGEA 3CFAA 4ZB1A 1XSSA 2O29A 3VHTB 5BQLA 5LTQA 2H5PA 4Q7RA 2Z6YA 3DQ9A 5DTLA 3LVCA 4GOBA 4P76A 3DQOA 4GF6B 3SV5A 2PXWA 5DQMA 5H88A 2VVJA 4W6GA 4H48A 1OXFA 1Q4EA 3BXAA 3SSKA 1XQMA 3DPZA 3VHTA 1YJFA 4GESB 4W6DA 2HGYA 1GFLA 5DTYA 3O78A 3EVUA 2B3QA 3BXCA 4L1IA 1EMKA
chains in the Genus database with same CATH topology
5HZSA 4HQCA 4KF4A 3LS3A 5H87A 3DQLA 3GJ1A 2G6YA 1YJ2A 3NT9A 4R6BA 1OXDA 4KPIA 2WSOA 4KGFA 5F9GA 1EMCA 2EMOA 3S05A 4RTCA 1EMAA 2QLEA 4W6TA 2WIQA 1EMBA 4DXQA 1H6RA 2DUGA 3SSVA 3ZUJA 4W6PA 5HZOA 4W77A 5T3IA 1JBZA 4JGEA 4DXOA 4HE4A 4W6UA 1XMZA 3DQ4A 3ST0A 3SSPA 3NF0A 2H6VA 4LJCA 1GL4A 2DDDA 3SG3A 2AH8A 1XA9A 1Z1QA 2VZXA 4ANJA 4XVPA 1GGXA 2Z1OA 4HQ8A 4HVFA 3SG6A 3RWAA 2A50B 2A54B 3WCKA 3O77A 3DQFA 1QXTA 3EVVA 2YE1A 3DQKA 3DPXA 4W69A 3UFZA 2C9JA 2YDZA 4ZF4A 2WURA 1Q4AA 3SVRA 2FZUA 4LQTA 4XGYA 2AWMA 4J8AA 3IP2A 3NT3A 3CBEA 3LSAA 2IOVA 3ADFA 2DUIA 4DXMA 5DRFA 5DY6A 5FVIA 4W75A 1H4UA 4J88A 3PJBA 2A47A 2OGRA 4OY4A 3P8UA 4B30A 1ZGPA 5DTXA 2V4EA 2QRFA 3WLCA 2QLHA 4W72A 4XOWA 4ORNA 4W7AA 3SVBA 1RMPA 1YFPA 4U2VA 4J89A 4W6BA 4RYWA 2OKWA 1KYSA 3ST3A 4KF5C 1Q4BA 5AQBB 1Q4CA 2RH7A 5EJUA 4EULA 2HQKA 2QU1A 3SVSA 5HW9A 3DQJA 2OJKA 1RM9A 2G6XA 1Z1PA 2H9WA 1OXEA 3MGFA 1W7SA 1MYWA 4L12A 3SSLA 1RMOA 4I2YA 4ZINA 2PXSA 4W6IA 4IK9A 4EMQA 3SVCA 2GW3A 4NWSA 2POXA 1F0BA 3OSRA 4EDOA 3DQEA 4Z4KA 2DUEA 2C9IA 5DQBA 3EKHA 3CFHA 3ST2A 1KYRA 1KYPA 4KW4A 4JFGA 2H5OA 1KP5A 3DQHA 5HZTA 4XOVA 1RRXA 4ZF3A 2ICRA 3W1DA 3AI4A 5FVGA 3EVRA 3SG5A 2JADA 1YZWA 1CV7A 3TMTA 5HGEA 3LF3A 2ZO6A 3DQ7A 4LJBA 4PPJA 4W7FA 4W6SA 3DQUA 4H3NA 4W7CA 3SG4A 5DTZA 2Q57A 4JC2A 4IK8A 3GL4A 5BTTB 2Z6ZA 2Y0GA 4W7XA 3BX9A 4DKMA 2GX0A 4H47A 1EMFA 3CGLA 4LJDC 2IB6A 1QY3A 1QYFA 3U0KA 5BT0A 3GEXA 3WLDA 3GB3A 2QLGB 2ZO7A 2OKYA 3DQ6A 3AI5A 1C4FA 3SVEA 3LA1A 1G7KA 2WHUA 2AWJA 5HBDA 2Z6XA 5KTGA 2HJOA 2VVHA 5BTTA 4Z4MA 4B30B 2V4EB 3G9AA 2G5ZB 4W6FA 3H1OA 4IK4A 5EB7A 5EXBA 3EVPA 1YHHA 3NEDA 1YHGA 2ARLA 1QYOA 3SSHA 2QLGA 2B3PA 2Q6PA 3LVAA 2EMDA 3A8SA 2WHSA 1ZGOA 1B9CA 2A53B 3LVDA 4KW9A 4EN1A 3P28A 3U8AA 2HPWA 3BXBA 4OHSA 4UTSA 1JC1A 1MOVA 1RMMA 4P1QA 4JF9A 1HUYA 2VVIA 4W6MA 4B5YA 1EMEA 2A56B 2AWLA 3DQ3A 3SS0A 4PFEA 3SVOA 1HCJA 4ZIOA 3ZUFA 2WISA 3DQ1A 4EDSA 1MOUA 4W6KA 3CFFA 4W7RA 2DD7A 3E5WA 4Q7TA 5H89A 2HQZA 3U8CA 4KAGA 3CB9A 5LTRA 4W76A 3ZTFA 4N3DA 3U0LA 1Q73A 3K1KA 2DUHA 4W6OA 3GJ2A 2GW4B 3H1RA 2G2SB 2VAEA 4DXIA 3M24A 1F09A 3E5TA 2OTBA 4ZBLA 3EKJA 5DPGA 3EK7A 2G6EA 3DQDA 4W7DA 2YE0A 3PJ7A 3KCSA 5LTPA 2IB5A 4KA9A 5DRGA 3M22A 4JEOA 4KF5A 4W73A 3NEZA 5FHVA 4IK3A 4W6CA 3SG7A 1ZUXA 2HGDA 3VK1A 3SVNA 2H5RA 4W6HA 3W1CA 1JBYA 5J2OA 4KEXA 5EB6A 3E5VA 3SG2A 2H8QA 2WHTA 4BDUA 5FVFA 5EXCI 2DUFA 4ZF5A 1S6ZA 4W6RA 2QT2A 3EK4A 4IK1A 4OJ0A 4ZFSA 2DD9A 3SSTA 3ZULA 3AKOA 3SVUA 3U0MA 2ZMWA 2ZMUA 3IR8A 1BFPA 4Q7UA 3RWTA 5LK4A 3U0NA 2EMNA 5DU0A 3TMRA 5HZUA 4W7EA 2A46A 4W6AA 3CD1A 4OGSA 4W74A 3CD9A 4W6JA 1XAEA 2G3OA 2QLIA 2IE2A 2YFPA 3KCTA 4W6LA 3UG0A 2DDCA 2G3DB 3OSQA 2OTEA 5DPIA 4IZNA 2AWKA 2O24A 2FL1A 2AHAA 3SVDA 3DPWA 2O2BA 3DQNA 2A52B 4AS8A 2A48A 2HCGA 4PPLA 2QZ0A 4H3LA 1QYQA 4W6NA 4IK5A 3DQ5A 3DQMA 4Q9XA 4DXNA 5DPJA 2G16B 4TZAA 3DQIA 1EMGA 3ST4A 3DQCA 2H5QA 3U8PA 4Q9WA 4PPKA 4LJDA 3SSYA 4RYSA 3LF4B 2V4EC 4LW5A 4DKNA 4AR7A 4R6DA 4TZGA 4JRBA 2P4MA 3EK8A 1ZGQA 2WSNA 2BTJA 1EMLA 3I19A 3ED8A 1Q4DA 5EBJA 3DQ2A 1W7UA 4OQWA 3OGOA 3SRYA 2GX2A 5EXUA 4XL5A 4H3MA 4LQUA 4DXPA 2HRSA 3VICA 3PIBA 4HQ9A 5DPHA 4KW8A 1YHIA 3V3DA 1W7TA 2FWQA 2VADA 1JC0A 3DQ8A 1EMMA 1UISA 3DQAA 2HFCA 5EHUA 4L13A 3PJ5A 4KGEA 3CFAA 4ZB1A 1XSSA 2O29A 3VHTB 5BQLA 5LTQA 2H5PA 4Q7RA 2Z6YA 3DQ9A 5DTLA 3LVCA 4GOBA 4P76A 3DQOA 4GF6B 3SV5A 2PXWA 5DQMA 5H88A 2VVJA 4W6GA 4H48A 1OXFA 1Q4EA 3BXAA 3SSKA 1XQMA 3DPZA 3VHTA 1YJFA 4GESB 4W6DA 2HGYA 1GFLA 5DTYA 3O78A 3EVUA 2B3QA 3BXCA 4L1IA 1EMKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HZS A;  4HQC A;  4KF4 A;  3LS3 A;  5H87 A;  3DQL A;  3GJ1 A;  2G6Y A;  1YJ2 A;  3NT9 A;  4R6B A;  1OXD A;  4KPI A;  2WSO A;  4KGF A;  5F9G A;  1EMC A;  2EMO A;  3S05 A;  4RTC A;  1EMA A;  2QLE A;  4W6T A;  2WIQ A;  1EMB A;  4DXQ A;  1H6R A;  2DUG A;  3SSV A;  3ZUJ A;  4W6P A;  5HZO A;  4W77 A;  5T3I A;  1JBZ A;  4JGE A;  4DXO A;  4HE4 A;  4W6U A;  1XMZ A;  3DQ4 A;  3ST0 A;  3SSP A;  3NF0 A;  2H6V A;  4LJC A;  1GL4 A;  2DDD A;  3SG3 A;  2AH8 A;  1XA9 A;  1Z1Q A;  2VZX A;  4ANJ A;  4XVP A;  1GGX A;  2Z1O A;  4HQ8 A;  4HVF A;  3SG6 A;  3RWA A;  2A50 B;  2A54 B;  3WCK A;  3O77 A;  3DQF A;  1QXT A;  3EVV A;  2YE1 A;  3DQK A;  3DPX A;  4W69 A;  3UFZ A;  2C9J A;  2YDZ A;  4ZF4 A;  2WUR A;  1Q4A A;  3SVR A;  2FZU A;  4LQT A;  4XGY A;  2AWM A;  4J8A A;  3IP2 A;  3NT3 A;  3CBE A;  3LSA A;  2IOV A;  3ADF A;  2DUI A;  4DXM A;  5DRF A;  5DY6 A;  5FVI A;  4W75 A;  1H4U A;  4J88 A;  3PJB A;  2A47 A;  2OGR A;  4OY4 A;  3P8U A;  4B30 A;  1ZGP A;  5DTX A;  2V4E A;  2QRF A;  3WLC A;  2QLH A;  4W72 A;  4XOW A;  4ORN A;  4W7A A;  3SVB A;  1RMP A;  1YFP A;  4U2V A;  4J89 A;  4W6B A;  4RYW A;  2OKW A;  1KYS A;  3ST3 A;  4KF5 C;  1Q4B A;  5AQB B;  1Q4C A;  2RH7 A;  5EJU A;  4EUL A;  2HQK A;  2QU1 A;  3SVS A;  5HW9 A;  3DQJ A;  2OJK A;  1RM9 A;  2G6X A;  1Z1P A;  2H9W A;  1OXE A;  3MGF A;  1W7S A;  1MYW A;  4L12 A;  3SSL A;  1RMO A;  4I2Y A;  4ZIN A;  2PXS A;  4W6I A;  4IK9 A;  4EMQ A;  3SVC A;  2GW3 A;  4NWS A;  2POX A;  1F0B A;  3OSR A;  4EDO A;  3DQE A;  4Z4K A;  2DUE A;  2C9I A;  5DQB A;  3EKH A;  3CFH A;  3ST2 A;  1KYR A;  1KYP A;  4KW4 A;  4JFG A;  2H5O A;  1KP5 A;  3DQH A;  5HZT A;  4XOV A;  1RRX A;  4ZF3 A;  2ICR A;  3W1D A;  3AI4 A;  5FVG A;  3EVR A;  3SG5 A;  2JAD A;  1YZW A;  1CV7 A;  3TMT A;  5HGE A;  3LF3 A;  2ZO6 A;  3DQ7 A;  4LJB A;  4PPJ A;  4W7F A;  4W6S A;  3DQU A;  4H3N A;  4W7C A;  3SG4 A;  5DTZ A;  2Q57 A;  4JC2 A;  4IK8 A;  3GL4 A;  5BTT B;  2Z6Z A;  2Y0G A;  4W7X A;  3BX9 A;  4DKM A;  2GX0 A;  4H47 A;  1EMF A;  3CGL A;  4LJD C;  2IB6 A;  1QY3 A;  1QYF A;  3U0K A;  5BT0 A;  3GEX A;  3WLD A;  3GB3 A;  2QLG B;  2ZO7 A;  2OKY A;  3DQ6 A;  3AI5 A;  1C4F A;  3SVE A;  3LA1 A;  1G7K A;  2WHU A;  2AWJ A;  5HBD A;  2Z6X A;  5KTG A;  2HJO A;  2VVH A;  5BTT A;  4Z4M A;  4B30 B;  2V4E B;  3G9A A;  2G5Z B;  4W6F A;  3H1O A;  4IK4 A;  5EB7 A;  5EXB A;  3EVP A;  1YHH A;  3NED A;  1YHG A;  2ARL A;  1QYO A;  3SSH A;  2QLG A;  2B3P A;  2Q6P A;  3LVA A;  2EMD A;  3A8S A;  2WHS A;  1ZGO A;  1B9C A;  2A53 B;  3LVD A;  4KW9 A;  4EN1 A;  3P28 A;  3U8A A;  2HPW A;  3BXB A;  4OHS A;  4UTS A;  1JC1 A;  1MOV A;  1RMM A;  4P1Q A;  4JF9 A;  1HUY A;  2VVI A;  4W6M A;  4B5Y A;  1EME A;  2A56 B;  2AWL A;  3DQ3 A;  3SS0 A;  4PFE A;  3SVO A;  1HCJ A;  4ZIO A;  3ZUF A;  2WIS A;  3DQ1 A;  4EDS A;  1MOU A;  4W6K A;  3CFF A;  4W7R A;  2DD7 A;  3E5W A;  4Q7T A;  5H89 A;  2HQZ A;  3U8C A;  4KAG A;  3CB9 A;  5LTR A;  4W76 A;  3ZTF A;  4N3D A;  3U0L A;  1Q73 A;  3K1K A;  2DUH A;  4W6O A;  3GJ2 A;  2GW4 B;  3H1R A;  2G2S B;  2VAE A;  4DXI A;  3M24 A;  1F09 A;  3E5T A;  2OTB A;  4ZBL A;  3EKJ A;  5DPG A;  3EK7 A;  2G6E A;  3DQD A;  4W7D A;  2YE0 A;  3PJ7 A;  3KCS A;  5LTP A;  2IB5 A;  4KA9 A;  5DRG A;  3M22 A;  4JEO A;  4KF5 A;  4W73 A;  3NEZ A;  5FHV A;  4IK3 A;  4W6C A;  3SG7 A;  1ZUX A;  2HGD A;  3VK1 A;  3SVN A;  2H5R A;  4W6H A;  3W1C A;  1JBY A;  5J2O A;  4KEX A;  5EB6 A;  3E5V A;  3SG2 A;  2H8Q A;  2WHT A;  4BDU A;  5FVF A;  5EXC I;  2DUF A;  4ZF5 A;  1S6Z A;  4W6R A;  2QT2 A;  3EK4 A;  4IK1 A;  4OJ0 A;  4ZFS A;  2DD9 A;  3SST A;  3ZUL A;  3AKO A;  3SVU A;  3U0M A;  2ZMW A;  2ZMU A;  3IR8 A;  1BFP A;  4Q7U A;  3RWT A;  5LK4 A;  3U0N A;  2EMN A;  5DU0 A;  3TMR A;  5HZU A;  4W7E A;  2A46 A;  4W6A A;  3CD1 A;  4OGS A;  4W74 A;  3CD9 A;  4W6J A;  1XAE A;  2G3O A;  2QLI A;  2IE2 A;  2YFP A;  3KCT A;  4W6L A;  3UG0 A;  2DDC A;  2G3D B;  3OSQ A;  2OTE A;  5DPI A;  4IZN A;  2AWK A;  2O24 A;  2FL1 A;  2AHA A;  3SVD A;  3DPW A;  2O2B A;  3DQN A;  2A52 B;  4AS8 A;  2A48 A;  2HCG A;  4PPL A;  2QZ0 A;  4H3L A;  1QYQ A;  4W6N A;  4IK5 A;  3DQ5 A;  3DQM A;  4Q9X A;  4DXN A;  5DPJ A;  2G16 B;  4TZA A;  3DQI A;  1EMG A;  3ST4 A;  3DQC A;  2H5Q A;  3U8P A;  4Q9W A;  4PPK A;  4LJD A;  3SSY A;  4RYS A;  3LF4 B;  2V4E C;  4LW5 A;  4DKN A;  4AR7 A;  4R6D A;  4TZG A;  4JRB A;  2P4M A;  3EK8 A;  1ZGQ A;  2WSN A;  2BTJ A;  1EML A;  3I19 A;  3ED8 A;  1Q4D A;  5EBJ A;  3DQ2 A;  1W7U A;  4OQW A;  3OGO A;  3SRY A;  2GX2 A;  5EXU A;  4XL5 A;  4H3M A;  4LQU A;  4DXP A;  2HRS A;  3VIC A;  3PIB A;  4HQ9 A;  5DPH A;  4KW8 A;  1YHI A;  3V3D A;  1W7T A;  2FWQ A;  2VAD A;  1JC0 A;  3DQ8 A;  1EMM A;  1UIS A;  3DQA A;  2HFC A;  5EHU A;  4L13 A;  3PJ5 A;  4KGE A;  3CFA A;  4ZB1 A;  1XSS A;  2O29 A;  3VHT B;  5BQL A;  5LTQ A;  2H5P A;  4Q7R A;  2Z6Y A;  3DQ9 A;  5DTL A;  3LVC A;  4GOB A;  4P76 A;  3DQO A;  4GF6 B;  3SV5 A;  2PXW A;  5DQM A;  5H88 A;  2VVJ A;  4W6G A;  4H48 A;  1OXF A;  1Q4E A;  3BXA A;  3SSK A;  1XQM A;  3DPZ A;  3VHT A;  1YJF A;  4GES B;  4W6D A;  2HGY A;  1GFL A;  5DTY A;  3O78 A;  3EVU A;  2B3Q A;  3BXC A;  4L1I A;  1EMK A; 
#chains in the Genus database with same CATH topology
 5HZS A;  4HQC A;  4KF4 A;  3LS3 A;  5H87 A;  3DQL A;  3GJ1 A;  2G6Y A;  1YJ2 A;  3NT9 A;  4R6B A;  1OXD A;  4KPI A;  2WSO A;  4KGF A;  5F9G A;  1EMC A;  2EMO A;  3S05 A;  4RTC A;  1EMA A;  2QLE A;  4W6T A;  2WIQ A;  1EMB A;  4DXQ A;  1H6R A;  2DUG A;  3SSV A;  3ZUJ A;  4W6P A;  5HZO A;  4W77 A;  5T3I A;  1JBZ A;  4JGE A;  4DXO A;  4HE4 A;  4W6U A;  1XMZ A;  3DQ4 A;  3ST0 A;  3SSP A;  3NF0 A;  2H6V A;  4LJC A;  1GL4 A;  2DDD A;  3SG3 A;  2AH8 A;  1XA9 A;  1Z1Q A;  2VZX A;  4ANJ A;  4XVP A;  1GGX A;  2Z1O A;  4HQ8 A;  4HVF A;  3SG6 A;  3RWA A;  2A50 B;  2A54 B;  3WCK A;  3O77 A;  3DQF A;  1QXT A;  3EVV A;  2YE1 A;  3DQK A;  3DPX A;  4W69 A;  3UFZ A;  2C9J A;  2YDZ A;  4ZF4 A;  2WUR A;  1Q4A A;  3SVR A;  2FZU A;  4LQT A;  4XGY A;  2AWM A;  4J8A A;  3IP2 A;  3NT3 A;  3CBE A;  3LSA A;  2IOV A;  3ADF A;  2DUI A;  4DXM A;  5DRF A;  5DY6 A;  5FVI A;  4W75 A;  1H4U A;  4J88 A;  3PJB A;  2A47 A;  2OGR A;  4OY4 A;  3P8U A;  4B30 A;  1ZGP A;  5DTX A;  2V4E A;  2QRF A;  3WLC A;  2QLH A;  4W72 A;  4XOW A;  4ORN A;  4W7A A;  3SVB A;  1RMP A;  1YFP A;  4U2V A;  4J89 A;  4W6B A;  4RYW A;  2OKW A;  1KYS A;  3ST3 A;  4KF5 C;  1Q4B A;  5AQB B;  1Q4C A;  2RH7 A;  5EJU A;  4EUL A;  2HQK A;  2QU1 A;  3SVS A;  5HW9 A;  3DQJ A;  2OJK A;  1RM9 A;  2G6X A;  1Z1P A;  2H9W A;  1OXE A;  3MGF A;  1W7S A;  1MYW A;  4L12 A;  3SSL A;  1RMO A;  4I2Y A;  4ZIN A;  2PXS A;  4W6I A;  4IK9 A;  4EMQ A;  3SVC A;  2GW3 A;  4NWS A;  2POX A;  1F0B A;  3OSR A;  4EDO A;  3DQE A;  4Z4K A;  2DUE A;  2C9I A;  5DQB A;  3EKH A;  3CFH A;  3ST2 A;  1KYR A;  1KYP A;  4KW4 A;  4JFG A;  2H5O A;  1KP5 A;  3DQH A;  5HZT A;  4XOV A;  1RRX A;  4ZF3 A;  2ICR A;  3W1D A;  3AI4 A;  5FVG A;  3EVR A;  3SG5 A;  2JAD A;  1YZW A;  1CV7 A;  3TMT A;  5HGE A;  3LF3 A;  2ZO6 A;  3DQ7 A;  4LJB A;  4PPJ A;  4W7F A;  4W6S A;  3DQU A;  4H3N A;  4W7C A;  3SG4 A;  5DTZ A;  2Q57 A;  4JC2 A;  4IK8 A;  3GL4 A;  5BTT B;  2Z6Z A;  2Y0G A;  4W7X A;  3BX9 A;  4DKM A;  2GX0 A;  4H47 A;  1EMF A;  3CGL A;  4LJD C;  2IB6 A;  1QY3 A;  1QYF A;  3U0K A;  5BT0 A;  3GEX A;  3WLD A;  3GB3 A;  2QLG B;  2ZO7 A;  2OKY A;  3DQ6 A;  3AI5 A;  1C4F A;  3SVE A;  3LA1 A;  1G7K A;  2WHU A;  2AWJ A;  5HBD A;  2Z6X A;  5KTG A;  2HJO A;  2VVH A;  5BTT A;  4Z4M A;  4B30 B;  2V4E B;  3G9A A;  2G5Z B;  4W6F A;  3H1O A;  4IK4 A;  5EB7 A;  5EXB A;  3EVP A;  1YHH A;  3NED A;  1YHG A;  2ARL A;  1QYO A;  3SSH A;  2QLG A;  2B3P A;  2Q6P A;  3LVA A;  2EMD A;  3A8S A;  2WHS A;  1ZGO A;  1B9C A;  2A53 B;  3LVD A;  4KW9 A;  4EN1 A;  3P28 A;  3U8A A;  2HPW A;  3BXB A;  4OHS A;  4UTS A;  1JC1 A;  1MOV A;  1RMM A;  4P1Q A;  4JF9 A;  1HUY A;  2VVI A;  4W6M A;  4B5Y A;  1EME A;  2A56 B;  2AWL A;  3DQ3 A;  3SS0 A;  4PFE A;  3SVO A;  1HCJ A;  4ZIO A;  3ZUF A;  2WIS A;  3DQ1 A;  4EDS A;  1MOU A;  4W6K A;  3CFF A;  4W7R A;  2DD7 A;  3E5W A;  4Q7T A;  5H89 A;  2HQZ A;  3U8C A;  4KAG A;  3CB9 A;  5LTR A;  4W76 A;  3ZTF A;  4N3D A;  3U0L A;  1Q73 A;  3K1K A;  2DUH A;  4W6O A;  3GJ2 A;  2GW4 B;  3H1R A;  2G2S B;  2VAE A;  4DXI A;  3M24 A;  1F09 A;  3E5T A;  2OTB A;  4ZBL A;  3EKJ A;  5DPG A;  3EK7 A;  2G6E A;  3DQD A;  4W7D A;  2YE0 A;  3PJ7 A;  3KCS A;  5LTP A;  2IB5 A;  4KA9 A;  5DRG A;  3M22 A;  4JEO A;  4KF5 A;  4W73 A;  3NEZ A;  5FHV A;  4IK3 A;  4W6C A;  3SG7 A;  1ZUX A;  2HGD A;  3VK1 A;  3SVN A;  2H5R A;  4W6H A;  3W1C A;  1JBY A;  5J2O A;  4KEX A;  5EB6 A;  3E5V A;  3SG2 A;  2H8Q A;  2WHT A;  4BDU A;  5FVF A;  5EXC I;  2DUF A;  4ZF5 A;  1S6Z A;  4W6R A;  2QT2 A;  3EK4 A;  4IK1 A;  4OJ0 A;  4ZFS A;  2DD9 A;  3SST A;  3ZUL A;  3AKO A;  3SVU A;  3U0M A;  2ZMW A;  2ZMU A;  3IR8 A;  1BFP A;  4Q7U A;  3RWT A;  5LK4 A;  3U0N A;  2EMN A;  5DU0 A;  3TMR A;  5HZU A;  4W7E A;  2A46 A;  4W6A A;  3CD1 A;  4OGS A;  4W74 A;  3CD9 A;  4W6J A;  1XAE A;  2G3O A;  2QLI A;  2IE2 A;  2YFP A;  3KCT A;  4W6L A;  3UG0 A;  2DDC A;  2G3D B;  3OSQ A;  2OTE A;  5DPI A;  4IZN A;  2AWK A;  2O24 A;  2FL1 A;  2AHA A;  3SVD A;  3DPW A;  2O2B A;  3DQN A;  2A52 B;  4AS8 A;  2A48 A;  2HCG A;  4PPL A;  2QZ0 A;  4H3L A;  1QYQ A;  4W6N A;  4IK5 A;  3DQ5 A;  3DQM A;  4Q9X A;  4DXN A;  5DPJ A;  2G16 B;  4TZA A;  3DQI A;  1EMG A;  3ST4 A;  3DQC A;  2H5Q A;  3U8P A;  4Q9W A;  4PPK A;  4LJD A;  3SSY A;  4RYS A;  3LF4 B;  2V4E C;  4LW5 A;  4DKN A;  4AR7 A;  4R6D A;  4TZG A;  4JRB A;  2P4M A;  3EK8 A;  1ZGQ A;  2WSN A;  2BTJ A;  1EML A;  3I19 A;  3ED8 A;  1Q4D A;  5EBJ A;  3DQ2 A;  1W7U A;  4OQW A;  3OGO A;  3SRY A;  2GX2 A;  5EXU A;  4XL5 A;  4H3M A;  4LQU A;  4DXP A;  2HRS A;  3VIC A;  3PIB A;  4HQ9 A;  5DPH A;  4KW8 A;  1YHI A;  3V3D A;  1W7T A;  2FWQ A;  2VAD A;  1JC0 A;  3DQ8 A;  1EMM A;  1UIS A;  3DQA A;  2HFC A;  5EHU A;  4L13 A;  3PJ5 A;  4KGE A;  3CFA A;  4ZB1 A;  1XSS A;  2O29 A;  3VHT B;  5BQL A;  5LTQ A;  2H5P A;  4Q7R A;  2Z6Y A;  3DQ9 A;  5DTL A;  3LVC A;  4GOB A;  4P76 A;  3DQO A;  4GF6 B;  3SV5 A;  2PXW A;  5DQM A;  5H88 A;  2VVJ A;  4W6G A;  4H48 A;  1OXF A;  1Q4E A;  3BXA A;  3SSK A;  1XQM A;  3DPZ A;  3VHT A;  1YJF A;  4GES B;  4W6D A;  2HGY A;  1GFL A;  5DTY A;  3O78 A;  3EVU A;  2B3Q A;  3BXC A;  4L1I A;  1EMK A; 
#chains in the Genus database with same CATH homology
 5HZS A;  4HQC A;  4KF4 A;  3LS3 A;  5H87 A;  3DQL A;  3GJ1 A;  2G6Y A;  1YJ2 A;  3NT9 A;  4R6B A;  1OXD A;  4KPI A;  2WSO A;  4KGF A;  5F9G A;  1EMC A;  2EMO A;  3S05 A;  4RTC A;  1EMA A;  2QLE A;  4W6T A;  2WIQ A;  1EMB A;  4DXQ A;  1H6R A;  2DUG A;  3SSV A;  3ZUJ A;  4W6P A;  5HZO A;  4W77 A;  5T3I A;  1JBZ A;  4JGE A;  4DXO A;  4HE4 A;  4W6U A;  1XMZ A;  3DQ4 A;  3ST0 A;  3SSP A;  3NF0 A;  2H6V A;  4LJC A;  1GL4 A;  2DDD A;  3SG3 A;  2AH8 A;  1XA9 A;  1Z1Q A;  2VZX A;  4ANJ A;  4XVP A;  1GGX A;  2Z1O A;  4HQ8 A;  4HVF A;  3SG6 A;  3RWA A;  2A50 B;  2A54 B;  3WCK A;  3O77 A;  3DQF A;  1QXT A;  3EVV A;  2YE1 A;  3DQK A;  3DPX A;  4W69 A;  3UFZ A;  2C9J A;  2YDZ A;  4ZF4 A;  2WUR A;  1Q4A A;  3SVR A;  2FZU A;  4LQT A;  4XGY A;  2AWM A;  4J8A A;  3IP2 A;  3NT3 A;  3CBE A;  3LSA A;  2IOV A;  3ADF A;  2DUI A;  4DXM A;  5DRF A;  5DY6 A;  5FVI A;  4W75 A;  1H4U A;  4J88 A;  3PJB A;  2A47 A;  2OGR A;  4OY4 A;  3P8U A;  4B30 A;  1ZGP A;  5DTX A;  2V4E A;  2QRF A;  3WLC A;  2QLH A;  4W72 A;  4XOW A;  4ORN A;  4W7A A;  3SVB A;  1RMP A;  1YFP A;  4U2V A;  4J89 A;  4W6B A;  4RYW A;  2OKW A;  1KYS A;  3ST3 A;  4KF5 C;  1Q4B A;  5AQB B;  1Q4C A;  2RH7 A;  5EJU A;  4EUL A;  2HQK A;  2QU1 A;  3SVS A;  5HW9 A;  3DQJ A;  2OJK A;  1RM9 A;  2G6X A;  1Z1P A;  2H9W A;  1OXE A;  3MGF A;  1W7S A;  1MYW A;  4L12 A;  3SSL A;  1RMO A;  4I2Y A;  4ZIN A;  2PXS A;  4W6I A;  4IK9 A;  4EMQ A;  3SVC A;  2GW3 A;  4NWS A;  2POX A;  1F0B A;  3OSR A;  4EDO A;  3DQE A;  4Z4K A;  2DUE A;  2C9I A;  5DQB A;  3EKH A;  3CFH A;  3ST2 A;  1KYR A;  1KYP A;  4KW4 A;  4JFG A;  2H5O A;  1KP5 A;  3DQH A;  5HZT A;  4XOV A;  1RRX A;  4ZF3 A;  2ICR A;  3W1D A;  3AI4 A;  5FVG A;  3EVR A;  3SG5 A;  2JAD A;  1YZW A;  1CV7 A;  3TMT A;  5HGE A;  3LF3 A;  2ZO6 A;  3DQ7 A;  4LJB A;  4PPJ A;  4W7F A;  4W6S A;  3DQU A;  4H3N A;  4W7C A;  3SG4 A;  5DTZ A;  2Q57 A;  4JC2 A;  4IK8 A;  3GL4 A;  5BTT B;  2Z6Z A;  2Y0G A;  4W7X A;  3BX9 A;  4DKM A;  2GX0 A;  4H47 A;  1EMF A;  3CGL A;  4LJD C;  2IB6 A;  1QY3 A;  1QYF A;  3U0K A;  5BT0 A;  3GEX A;  3WLD A;  3GB3 A;  2QLG B;  2ZO7 A;  2OKY A;  3DQ6 A;  3AI5 A;  1C4F A;  3SVE A;  3LA1 A;  1G7K A;  2WHU A;  2AWJ A;  5HBD A;  2Z6X A;  5KTG A;  2HJO A;  2VVH A;  5BTT A;  4Z4M A;  4B30 B;  2V4E B;  3G9A A;  2G5Z B;  4W6F A;  3H1O A;  4IK4 A;  5EB7 A;  5EXB A;  3EVP A;  1YHH A;  3NED A;  1YHG A;  2ARL A;  1QYO A;  3SSH A;  2QLG A;  2B3P A;  2Q6P A;  3LVA A;  2EMD A;  3A8S A;  2WHS A;  1ZGO A;  1B9C A;  2A53 B;  3LVD A;  4KW9 A;  4EN1 A;  3P28 A;  3U8A A;  2HPW A;  3BXB A;  4OHS A;  4UTS A;  1JC1 A;  1MOV A;  1RMM A;  4P1Q A;  4JF9 A;  1HUY A;  2VVI A;  4W6M A;  4B5Y A;  1EME A;  2A56 B;  2AWL A;  3DQ3 A;  3SS0 A;  4PFE A;  3SVO A;  1HCJ A;  4ZIO A;  3ZUF A;  2WIS A;  3DQ1 A;  4EDS A;  1MOU A;  4W6K A;  3CFF A;  4W7R A;  2DD7 A;  3E5W A;  4Q7T A;  5H89 A;  2HQZ A;  3U8C A;  4KAG A;  3CB9 A;  5LTR A;  4W76 A;  3ZTF A;  4N3D A;  3U0L A;  1Q73 A;  3K1K A;  2DUH A;  4W6O A;  3GJ2 A;  2GW4 B;  3H1R A;  2G2S B;  2VAE A;  4DXI A;  3M24 A;  1F09 A;  3E5T A;  2OTB A;  4ZBL A;  3EKJ A;  5DPG A;  3EK7 A;  2G6E A;  3DQD A;  4W7D A;  2YE0 A;  3PJ7 A;  3KCS A;  5LTP A;  2IB5 A;  4KA9 A;  5DRG A;  3M22 A;  4JEO A;  4KF5 A;  4W73 A;  3NEZ A;  5FHV A;  4IK3 A;  4W6C A;  3SG7 A;  1ZUX A;  2HGD A;  3VK1 A;  3SVN A;  2H5R A;  4W6H A;  3W1C A;  1JBY A;  5J2O A;  4KEX A;  5EB6 A;  3E5V A;  3SG2 A;  2H8Q A;  2WHT A;  4BDU A;  5FVF A;  5EXC I;  2DUF A;  4ZF5 A;  1S6Z A;  4W6R A;  2QT2 A;  3EK4 A;  4IK1 A;  4OJ0 A;  4ZFS A;  2DD9 A;  3SST A;  3ZUL A;  3AKO A;  3SVU A;  3U0M A;  2ZMW A;  2ZMU A;  3IR8 A;  1BFP A;  4Q7U A;  3RWT A;  5LK4 A;  3U0N A;  2EMN A;  5DU0 A;  3TMR A;  5HZU A;  4W7E A;  2A46 A;  4W6A A;  3CD1 A;  4OGS A;  4W74 A;  3CD9 A;  4W6J A;  1XAE A;  2G3O A;  2QLI A;  2IE2 A;  2YFP A;  3KCT A;  4W6L A;  3UG0 A;  2DDC A;  2G3D B;  3OSQ A;  2OTE A;  5DPI A;  4IZN A;  2AWK A;  2O24 A;  2FL1 A;  2AHA A;  3SVD A;  3DPW A;  2O2B A;  3DQN A;  2A52 B;  4AS8 A;  2A48 A;  2HCG A;  4PPL A;  2QZ0 A;  4H3L A;  1QYQ A;  4W6N A;  4IK5 A;  3DQ5 A;  3DQM A;  4Q9X A;  4DXN A;  5DPJ A;  2G16 B;  4TZA A;  3DQI A;  1EMG A;  3ST4 A;  3DQC A;  2H5Q A;  3U8P A;  4Q9W A;  4PPK A;  4LJD A;  3SSY A;  4RYS A;  3LF4 B;  2V4E C;  4LW5 A;  4DKN A;  4AR7 A;  4R6D A;  4TZG A;  4JRB A;  2P4M A;  3EK8 A;  1ZGQ A;  2WSN A;  2BTJ A;  1EML A;  3I19 A;  3ED8 A;  1Q4D A;  5EBJ A;  3DQ2 A;  1W7U A;  4OQW A;  3OGO A;  3SRY A;  2GX2 A;  5EXU A;  4XL5 A;  4H3M A;  4LQU A;  4DXP A;  2HRS A;  3VIC A;  3PIB A;  4HQ9 A;  5DPH A;  4KW8 A;  1YHI A;  3V3D A;  1W7T A;  2FWQ A;  2VAD A;  1JC0 A;  3DQ8 A;  1EMM A;  1UIS A;  3DQA A;  2HFC A;  5EHU A;  4L13 A;  3PJ5 A;  4KGE A;  3CFA A;  4ZB1 A;  1XSS A;  2O29 A;  3VHT B;  5BQL A;  5LTQ A;  2H5P A;  4Q7R A;  2Z6Y A;  3DQ9 A;  5DTL A;  3LVC A;  4GOB A;  4P76 A;  3DQO A;  4GF6 B;  3SV5 A;  2PXW A;  5DQM A;  5H88 A;  2VVJ A;  4W6G A;  4H48 A;  1OXF A;  1Q4E A;  3BXA A;  3SSK A;  1XQM A;  3DPZ A;  3VHT A;  1YJF A;  4GES B;  4W6D A;  2HGY A;  1GFL A;  5DTY A;  3O78 A;  3EVU A;  2B3Q A;  3BXC A;  4L1I A;  1EMK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...