3G9BA

Crystal structure of reduced ost6l
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
155
structure length
148
Chain Sequence
b'IDDILQLKDDTGVITVTADNYPLLSRGVPGYFNILYITMRMSCQLCHDFEKTYHAVADVIRSQAPQSLNLFFTVDVNEVPQLVKDLKLQNVPHLVVYPPAESNKQSQFEWKTSPFYQYSLVPENAENTLQFGDFLAKILNISITVPQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dolichyl-diphosphooligosaccharide-protein glycosyltransferas
publication title Oxidoreductase activity of oligosaccharyltransferase subunits Ost3p and Ost6p defines site-specific glycosylation efficiency.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 42
structure length 148
sequence length 155
ec nomenclature ec 2.4.1.119: Transferred entry: 2.4.99.18.
pdb deposition date 2009-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3g9bA00
5JCWA 2P31A 2K8SA 2L57A 5F8BA 4EDZA 4EF0A 2B5YA 4F82A 1PL1A 2OKAA 5LCZA 2RIIA 6GSSA 3KJYA 3HDCA 1O6JA 1DUGA 2FUG2 4OCEA 4QL9A 3QAWA 4POKA 3CTFA 2AJQB 3MDKA 2LSTA 1JHBA 4K0NA 4K7NA 1TJDA 1Z7RA 1TK5B 4N30A 1WWJA 2DJ2A 1F6MC 2L5OA 2FLSA 3MAKA 1YQ1A 5H5RA 3OR5A 1ZCPA 4TR1A 4BWQA 3CBUA 1TRWA 1I5GA 4KNDA 1ERWA 3UOMA 4WR4A 1PKWA 5C04A 1TOFA 5G31A 5KN0A 2H66A 3CYNA 2X8CA 3HXSA 2YZUA 4NHWA 2H0HA 1VGLA 4N11A 4ECBA 4HU7A 1SK1A 1TTZA 2CAQA 1XPVA 18GSA 1GRXA 1SJ6A 2I4AA 5E4WA 4DSSA 1ILOA 1OAZA 1G6WA 3WYWA 3IA1A 3H8QA 3VPQA 2KP2A 3KH7A 4F9ZA 2C3NA 3DEXA 2F3MA 1T00A 1U3AA 3VI5A 1FG4A 1O81A 2GS3A 2H75A 2L4QA 5ENUA 4L8EA 4GQFA 1HNBA 4EXJA 1MDJA 3TCOA 5DQYA 4YAPA 2K8VA 13GSA 5ELAA 4ML6A 2PPTA 1MD4A 1XVWA 2CQ9A 5CRHA 4DSQA 1MDKA 1LBKA 4MPGA 5GZZB 3ZVJD 6GSWA 3W8JA 2LRCA 1AW9A 1K0AA 1GNWA 3HZ4A 4KW6A 3UBKA 2FCHA 3W6GA 1F3BA 5CO3A 4NV2A 5GSSA 4PX1A 1GL8A 5JWRB 1YEPA 4ZB6A 4OMVA 4FYBA 4RQRA 4HS1A 2L6DA 2K18A 3G7YA 5IO2A 3TKRA 2H72A 1Z6MA 1X9MB 2VAFA 3KCMA 3UMAA 4ZIJA 2MMZA 3CMIA 2GSTA 3Q19A 1BX9A 4IELA 1HYUA 2OA7A 4N10A 1TRUA 3GKXA 3GTUA 5HR0A 5J3RA 5JCGA 3H93A 1BAYA 2CV4A 2B3SA 5HR3A 3U6VA 2LNTA 4MH2A 1URMA 2JACA 4RUVA 3VFIA 5HR2A 3RBTA 1ERUA 3GH9A 1JLVA 5DAKB 3EU3A 1PQNA 3WT1A 3BJ5A 4KDYA 4ZBAA 1KEBA 2I81A 3DMLA 2VL3A 1AQVA 4GRFA 1RK4A 1O73A 4Q5RA 2WRTA 3HJOA 3HVSA 1F9MA 3RAZA 4AGSA 3VPTA 4MJEA 4KDUA 3GX0A 2YOIA 3LSZA 4AJ6A 2RUEA 1B8XA 1GUHA 2VUPA 5JWQB 3EWLA 2PBJA 2OE3A 2H1AA 3ZTLA 3LYKA 1H4OA 2H0GA 5ID2B 4BVYA 1SD9A 2PN8A 1EP7A 2OE0A 4YQUA 3UAPA 1UC7A 2E0QA 2VCZA 4KCEA 3UEMA 4V1Ap 4ECJA 5J9CA 3KTLA 3TB2A 5L71A 5ECLB 3BOAA 5IIZA 4X0XA 2J9HA 2H19A 2YANA 2B5EA 1EGRA 1OVNA 5DDLA 1XWBA 2MMNA 2R5GA 2I1UA 1T7PB 4EL1A 2YV7A 5J4UA 1AQWA 2DIZA 1JFUA 2DMMA 2R2JA 4LMWA 1Q98A 3SBCA 2H76A 2D2ZA 2MMOA 3ZL5A 1SL1B 4NPBA 1PMTA 2ALBA 4HJ2A 2PERA 3LORA 4AJ8A 1QQ2A 4HI7A 2GQLA 4JEDA 2C0DA 4LL1B 4KH7A 2EIQA 4OD7A 1G0TA 1Z6NA 3HHVA 2O8VB 1AUCA 4KAEA 2LS5A 1DE1A 2LJRA 4FO5A 3L9SA 4HQZA 3TJBA 1Z3EA 2LRNA 4ZL9A 5H5SA 5F07A 4K2DA 3ZFLA 1K0BA 2VOCA 1EEMA 3Q6OA 1SJIA 2GZPA 4IP1A 3RPNA 4TXOB 5ELGA 5G2ZA 1K0CA 2RUFA 2ON5A 3UVHA 4NMUA 2FWHA 3ZITA 2E2MA 2FD3A 3LXZA 1GWCA 1ST9A 3QFAC 1V98A 4ACSA 1WE0A 3ZREA 1OKDA 4O7HA 3TUEA 3EVIA 4XS4A 3NZNA 1I9DA 3O76A 4BL7A 1PA3A 3F6DA 2DJ3A 3KMNA 1T8EB 1F2EA 3FHKA 4PUFC 1XOBA 2J23A 1U6TA 2OBKA 1PRXA 1SYRA 3D6IA 1YKCA 2YV9A 2F8AA 1TU7A 2VLUA 4GSSA 3GL5A 4AJ7A 3Q74A 5CNWA 5IQYA 3IOSA 3WGEA 17GSA 2AAWA 4IKHA 3P8WA 2YJ7A 4IJIA 1K0OA 3CXGA 1FHEA 1XW5A 2IFQA 4MJAA 3LFLA 3KIJA 3ZFBA 4JR4A 3GX8A 1ZOFA 1SENA 2CVKA 5G5FA 4IQAA 2H74A 22GSA 2AYTA 2FNOA 1XWAA 3P90A 4MJCA 3IAS2 3MWHA 3TKSC 2PVQA 5IMFA 2L4CA 3LWAA 4LMVA 3F3RA 2CX4A 3FW2A 2FWFA 3APSA 1WOUA 4TXVA 5ECOB 5A4VA 3TJGA 5ECIB 4DVCA 5INYA 3FZAA 1T4ZA 6GSXA 4MF7A 5DJMA 1TRVA 2R3XA 2WCIA 1J08A 1NHOA 1YY7A 1YZXA 2XC2A 2IMFA 2MBTA 1ZYQB 4ZBDA 1S3AA 3L9UA 1GTUA 4L0UA 4O5RA 3ME8A 2XBIA 3DIEA 1FOVA 1J0FA 1SYXA 4MLYA 1G7OA 4HUAA 5CAXA 4WR5A 3VWXA 2X99A 4BWSA 2FWGA 2R4VA 3N9JA 4TKYA 1Z7PA 1R7HA 2HRNA 2QKEA 1PSQA 5J41A 20GSA 3G7JA 1O8XA 1ERVA 1ZYEA 4WXTA 2PWJA 3F9UA 2F51A 2C1YA 2KP1A 4I6XA 1T4YA 3HA9A 1PX6A 1ACVA 2I9HA 3IR4A 3KGKA 2O7KA 3GNJA 1SD8A 3BCIA 3V1WA 2CVBA 3GKMA 1ERTA 5ECRB 4QL7A 2HI7A 4TR4A 4WF4A 1OE8A 2AB6A 1JZRA 2Z9SA 1UN2A 3CRTA 2C8UA 5HQPA 3EU4A 1THXA 1SJZA 3TJJA 5DBQA 3FRCA 1X0RA 1EV9A 2VCXA 4MZWA 3ZYWA 4WBJA 2K9FA 5F05A 1WRYA 2ES7A 1MEKA 4POBA 2A2SA 1TDIA 1JZWA 3I69A 1F3AA 4IS0A 5AGYA 4CHSA 3TDGA 2VIMA 4DSRA 2VM1A 2C3TA 3WT2A 4D73B 4BVXA 1K0MA 5CRWA 5ECSA 4F03A 5D9VA 1M9BA 4JR6A 3DKSA 2VL2C 4KUNA 3HD5A 1GNEA 3GL3A 1M0UA 5DALB 1YF1A 1QXHA 2VL9A 4HZ2A 1UVZA 2IN3A 1XWKA 3F63A 3GIXA 1TKDB 5D9XA 10GSA 1DSBA 3L78A 1GSYA 1GSEA 3FY7A 4K1FA 5A4WA 1AXDA 3KMOA 1IYHA 3RDWA 1XW6A 2GT5A 4TR3A 2PVOC 2C3QA 4MH3A 3TKSA 4NHZA 8GSSA 2VCTA 1ZZYA 1B4QA 4IN0A 1FW1A 1QUWA 1FVJA 1S3CA 4XS6A 4MMMA 1U88A 1H75A 1TI3A 4MF5A 2DJ0A 2YWIA 2I3YA 3C1SA 3HY2A 3F0IA 1ON4A 3SWLA 2H1DA 2JZTA 3GFKA 2CAIA 3TOTA 6GSTA 1GLPA 5CREA 2EC4A 2TRXA 6GSUA 4LL4B 2LKUA 1NM3A 1A8YA 4MPFA 4PQHA 4IBPA 3JCML 5ECKB 2YNXA 3HVVA 2DC5A 3IC4A 4IGJA 3FEUA 1PX7A 5EL8A 1WPIA 2HZEA 2B6MA 1UA5A 1X5EA 2F9SA 2EIOA 2HXKA 5ECMB 3MSZA 1S3DA 16GSA 1OYJA 3BBYA 4I2UA 3U5RE 1WP0A 4TR1B 4LA1A 1NHYA 1K3OA 4KX4A 5F06A 1M2AA 3BCKA 4Z7XA 2O89A 1O7UA 2VD1A 1XCCA 3HZ8A 2IJYA 3UIWA 3C7MA 1OKTA 3ZRDA 4ML1A 2PU9C 5ECHB 2VCQA 4FH8A 1X5DA 4V2LA 3WGDA 4K8MA 3GMFA 3A2VA 4WEYA 4DSSB 2L6CA 1T1VA 2ON7A 2NBSA 1DBYA 1B48A 1OC9A 3E9JB 1R5AA 3EE2A 4FYUA 2V6OA 1EZKA 4EDYA 3A3TA 2BJXA 4KSOA 3TJKA 1G7EA 4DEJA 4XCSA 4GQCA 3DVWA 4JZQA 2VL2A 3LJRA 1TK8B 4GF0A 1XOAA 3FZ4A 4IHUA 2C4JA 3D0ZA 2KLXA 2GSQA 2FHEA 1IYIA 4YAVA 2LUSA 4HU9A 4IQ1A 2MZCA 1CQGA 2MBSA 1BYEA 2GZZA 4MZBA 5EY6A 1T3BA 4PXOA 4MABA 2IMDA 1ZL9A 3GV1A 4KDXA 2YZHA 5HR1A 3UBLA 1GH2A 4XHMA 1QK8A 2B1LA 1BJXA 4YH2A 4BPYA 3UL3A 3IRAA 4GTUA 1SK2A 1K3YA 11GSA 2G0FA 1V57A 3E0UA 1N8JA 2LJAA 4NWYA 3GHAA 1GULA 4QQ7A 3CTGA 4FIWA 2H73A 5LD0A 4AF2A 3H4KA 4EVMA 2CZ2A 3GTUB 1B9YC 1Z5YE 5B8AA 2WDUA 5HFKA 9GSSA 1M2BA 1SL2B 4KGIA 3QDNA 3RPPA 2G2QA 5HFIA 3ZZXA 2C0GA 3M3MA 3O6TA 4PURA 5IOWA 3A2XA 1LU4A 1M2DA 3TGZA 2P5RA 1K3LA 2TIRA 1GSSA 2M80A 2OJLA 4OCFA 3UJ1A 5F0GA 3HCZA 4KA0A 1SU9A 1GTIA 3VURA 2JSYA 1HD2A 5DJLA 4ULXA 5IPGA 3F3QA 2AHEA 3EINA 2LRTA 3D21A 4L5LA 3A5WA 1YJ6A 1GSUA 1TP9A 5D73A 2OBIA 1PD21 3M9KA 3F4TA 3IBHA 3PH9A 4TN8A 2H70A 3EMXA 2H30A 1EEJA 3TOUA 1W89A 1TXXA 2GT6A 4EO3A 5H5QA 1GUMA 3ZMKA 1YKAA 2LNSA 1X9SB 2HFDA 2QC7A 2DMLA 4ZL7A 4WETA 2H6YA 4V1Ag 4JRRA 1ML6A 1KNGA 3FYGA 3HYPA 3KEBA 3PINA 5CP1A 4PGTA 5FHIA 1FAAA 5AIXA 1SKWB 1WMJA 3EYTA 2LTKA 4NV5A 3D4TA 2YWOA 2AUVA 2B7JA 3M8NA 3VWVA 2O85A 4XRDA 2IWTA 2RLIA 3M1GA 1A24A 1C72A 3R2QA 4MDCA 1K0DA 4HJMA 2RM6A 2KHPA 2V6KA 3M9JA 1XW9A 2IMEA 1PGTA 3C8EA 2IMIA 1DE2A 1CQHA 1A0RP 3CSHA 5HFGA 4OWYA 1Q4JA 4Q5QA 1SL0B 3I6AA 2HSYA 1OE7A 2X8GA 2IL3A 2JZRA 2ZNMA 2GQMA 3EMPA 2YPMA 2M46A 1MTCA 3IHQA 1GTAA 2F8FA 3G7IA 2HT9A 1V40A 4OO4A 2FA4A 1YF0A 3VWUA 3QAGA 3GH6A 4CW9A 2MYGA 4PQ1A 3QFBC 3TRPA 19GSA 1VF4A 2WGRA 3FZ9A 4I97A 2B5XA 3ISOA 1HNCA 3P2AA 3F4SA 1E2YA 3DYRA 3F6FA 2N5FA 3WD6A 3KP8A 3FZ5A 2JZSA 1XXUA 5A4UA 4CDOA 4MK3A 2IIYA 1A2JA 5GAPD 4GSTA 4GXZA 6GSYA 1VF2A 3AY8A 4ECIA 4L5OA 2WZ9A 2N5BA 4MZCA 5ECPB 4ID0A 3GSTA 5B6MA 2C80A 2P0GA 2KOKA 1TU8A 4XS4B 1JZOA 3D5JA 2FWEA 2IMKA 1J9BA 5GSTA 2P5QA 4XIHA 1U87A 2E2GA 4P3YB 4TOPA 2QSIA 5IMCA 1VF1A 3GRXA 3C1RA 3IK7A 3KH9A 2DBCA 1B4PA 2WB9A 5DQSA 2X8HA 2XHFA 2LQQA 4HDEA 3L9VA 3N5OA 3ZIJA 5ABRA 2OE1A 2HRFA 1R26A 3UARA 4IVFA 5ECNB 1TI1A 3O3TA 1K0NA 4Q5FA 1GP1A 5IMDA 4KB3A 1TRSA 4OFMA 1MDIA 3VI7A 2H1BA 4MF6A 3TKQA 5KN3A 3J7Yb 4ECCA 5DAKA 5CYYA 4G2EA 2PGTA 4ZXGA 2L5LA 2A2RA 2IFQB 1HNAA 1XIYA 4IJ3A 2CVDA 3LEFA 1KTEA 4HQSA 3HJMA 2VCWA 1F37A 2JADA 2V32A 1GSQA 4K7OA 1TW9A 1V9WA 2GDRA 5D8IA 4YQMA 4MCUA 5B8BA 3DD3A 1VF3A 4RI7A 4V2NA 3GURA 2NVLA 3APOA 4GCIA 4ZB8A 1ABAA 3KTBA 5DVBA 2R6KA 5ID2A 2X64A 1QFNA 3ERFA 1NSWA 5FWGA 2VLTA 3TRXA 2HYXA 4WBRD 1EOGA 3H1NA 1WJKA 3M0FA 4ILFA 2H8LA 1EV4A 2WFCA 2CX3A 4MA9A 3QAVA 4I2TA 3CSJA 5A5KA 4K6XA 4EE0A 2H6XA 2LQOA 3QD9A 3IPZA 4TRXA 3C73A 3D4MA 1VRSD 3F4RA 1U3IA 3A2WA 3ED3A 3PGTA 5AIVA 2LJKA 3QR6A 5JWOB 1OC3A 1GSDA 4ZL8A 1W4VA 5B7CA 4G19A 4XS1A 2PMTA 4F0BA 2YN1A 3HVXA 3LYPA 4K0GA 3LG6A 2CZ3A 5D96A 1RQMA 1M99A 4KE3A 1SK0A 3FR6A 3DRNA 3ZLPA 1AC1A 1EOHA 2REMA 3TKPA 2H1GA 5CRDA 4E8EA 2XBQA 1USBA 2DSAA 3NIVA 4O32A 1FB6A 5GAND 6GSVA 4XRAA 4KSMA 3ZMLA 2VM2A 5EPFA 3LXTA 2JSZA 2LV3A 1N2AA 3E3EA 4K9ZA 1FVKA 5J9BA 3HKRA 7GSSA 2R37A 2LEGA 4OFTA 1X5CA 4H86A 3GN3A 1BEDA 2HNLA 5DCGA 2MMAA 3EC3A 4JU5A 2YWMA 3RHCA 4PUAA 5AN1A 3ERGA 4NXIA 2CT6A 4F2IA 1A2MA 4TXOA 4GWRA 2VD0A 4PQIA 1GTBA 3FKFA 5AISA 4EC0A 4J56E 4YQVA 1XZOA 4IP6A 3J7Yk 1O85A 3KXOA 4G9HA 1THOA 1Y25A 4I5QA 2GQKA 2C0FA 1XFLA 3BD2A 3PR8A 5KEJA 2EIRA 4IW9A 4N0VA 5B6NA 14GSA 1PKZA 1JLWA 3DGQA 2GLRA 3TJFA 1V58A 5COHA 2GVPA 3GKKA 1AQXA 1EP8A 2HZFA 4WF5A 1A23A 2FY6A 4TR0A 2WS2A 1O8WA 1AIUA 1YEXA 2VO4A 2ZUPA 4RI6A 1A2LA 4WKWA 2WJUA 2YJHA 4EKZA 2CA8A 3F8UA 4F0CA 2A4VA 3CRUA 4FYCA 3GKNA 1XWGA 3DVXA 4PNFA 2BMXA 4OO5A 5D9WA 2GGTA 2XPDA 5IMVA 1FB0A 5KN2A 4HOJA 4MJBA 1WIKA 3I43A 1MD3A 2OADA 4Q5NA 3IAM2 5DCHA 4J2FA 1RW1A 3IE3A 1R5PA 5G30A 5IM9A 2HZEB 2H6ZA 4N0ZA 2OACA 2V2GA 2AV4A 5IMAA 5IOXA 2RM5A 4ZILA 5IO0A 2B1KA 5G1KA 1ZGNA 3H79A 3MNGA 3VLNA 2FGXA 1A0FA 4ISDA 3VK9A 2C0EA 1SKSB 2DLXA 4GSNA 4X1UA 3W8SA 3FR3A 3QOUA 5G5EA 2NDOA 2BTOT 5IPHA 5ECQB 3WGXA 2K6VA 2GZYA 2GSSA 3UVTA 2PUKC 1NW2A 3KD0A 2HE3A 3C71A 3IK9A 3ZIVA 4K7IA 3I9V2 1B9XC 4TVEA 2E7PA 1FO5A 2H0IA 4ZB9A 3L4NA 4G10A 2V41A 1QMVA 4TW5A 4NAXA 5IMZA 1QGVA 3FK8A 1OC9B 2DJ1A 4EUYA 1JZDA 2YWNA 1HQOA 1Z9HA 1YDKA 3NOFA 1TK0B 3L0HA 1XVQA 5EVOA 1PN9A 2DIYA 2M72A 2NTOA 2DJKA 3EURA 2JU5A 1AAZA 4BA7A 3KZQA 2VLVA 3DXBA 2QGVA 2JL4A 2HSHA 2GSRA 4KCAA 2GTUA 2IPAA 2YCDA 3GSSA 5J5NA 3LGCA 3GYKA 3K8NA 1KBNA 4XTSA 5D93A 1A8LA 3FR9A 3KM6A 4J57E 3RHBA 3QCPA 4JBBA 2N5AA 4MP4A 3Q18A 3ERWA 5G1LA 4L0WA 3LQ7A 2O87A 1ZMAA 4D73A 1E6BA 4JE1A 4X43A 4ZBBA 1BQ7A 2NPBA 4LLRA 2WULA 4HZ4A 5E59A 3IV4A 4PNGA 1GLQA 1XBSA 2KUCA 1EGOA 1PL2A 3TRQA 3APQA 5DALA 4V2MA 2HLSA 1M7TA 3D22A 5KN1A 2VCVA 4RQXA 5FT3A 3GA4A 2YP6A 2H01A 12GSA 3G9BA 3IXRA 3GUSA 1BG5A 3QPMA 1X9WB 4O92A 4I8BA 5D9TA 3VWWA 3DWVA 4POMA 4POLA 3KP9A 4E8HA 5C00A 1OC8A 1Y6EA 1GSFA 2H71A 1EWXA 4HEA2 4OFNA 2DJJA 5LNKe 3HJPA 1GUKA 1M9AA 2TRCP 1R4WA 2V1MA 5CRGA 4GLTA 3TKSE 3US3A 2L59A 3ME7A 1XWCA 3QMXA 3S9FA 3ZVJA 1SKRB 1LJRA 5JCUA 3IDVA 1G6YA 1V2AA 2ZCTA 2B7KA 3P7XA 3CSIA 2FA8A 2XPEA
chains in the Genus database with same CATH superfamily
5JCWA 2P31A 2K8SA 2L57A 5F8BA 4EDZA 4EF0A 2B5YA 4F82A 1PL1A 2OKAA 4Z2RA 2RIIA 6GSSA 3KJYA 5LCZA 3HDCA 1O6JA 1DUGA 2FUG2 4OCEA 4QL9A 4O5UA 3QAWA 4POKA 3CTFA 2AJQB 3MDKA 2LSTA 3PPUA 1JHBA 4K0NA 4K7NA 1TJDA 1Z7RA 1TK5B 4N30A 1WWJA 2DJ2A 1F6MC 2L5OA 2FLSA 3MAKA 1YQ1A 5H5RA 3OR5A 1ZCPA 4TR1A 3MYDA 4BWQA 3CBUA 1TRWA 1I5GA 4KNDA 1ERWA 3UOMA 4WR4A 1PKWA 5C04A 1TOFA 5G31A 5KN0A 2H66A 3CYNA 2X8CA 3HXSA 2YZUA 4NHWA 2H0HA 1VGLA 4N11A 4ECBA 4HU7A 1SK1A 1TTZA 2CAQA 1XPVA 18GSA 1GRXA 1SJ6A 2I4AA 5E4WA 4DSSA 1ILOA 1OAZA 1G6WA 3WYWA 3IA1A 3H8QA 3VPQA 2KP2A 3KH7A 4F9ZA 2C3NA 3DEXA 2F3MA 1T00A 1U3AA 3VI5A 1FG4A 1O81A 2GS3A 2H75A 2L4QA 5ENUA 4L8EA 4GQFA 1HNBA 4EXJA 1MDJA 3TCOA 5DQYA 4YAPA 2K8VA 13GSA 5ELAA 4ML6A 2UZ8A 2PPTA 1MD4A 1XVWA 2CQ9A 5CRHA 4DSQA 1MDKA 1LBKA 4MPGA 5GZZB 3ZVJD 6GSWA 3W8JA 2LRCA 1AW9A 1K0AA 1GNWA 3HZ4A 4KW6A 3UBKA 2FCHA 3W6GA 1F3BA 5CO3A 2X4AA 4NV2A 5GSSA 4PX1A 1GL8A 5JWRB 1YEPA 4ZB6A 4OMVA 4FYBA 4RQRA 3R3EA 4HS1A 2L6DA 2K18A 3G7YA 5IO2A 3TKRA 2H72A 1Z6MA 1X9MB 2VAFA 3KCMA 3UMAA 4ZIJA 2R0GA 2MMZA 3CMIA 2GSTA 3Q19A 1BX9A 4FQUA 4IELA 1HYUA 2OA7A 4N10A 1TRUA 4CY6A 3GKXA 3GTUA 5HR0A 5J3RA 5JCGA 3H93A 1BAYA 2CV4A 2B3SA 4K5SA 5HR3A 3U6VA 2LNTA 4MH2A 1URMA 2JACA 4RUVA 3VFIA 5HR2A 3RBTA 1ERUA 3GH9A 1JLVA 5DAKB 3EU3A 1PQNA 3WT1A 3BJ5A 4KDYA 4K5RA 4ZBAA 2DKIA 1KEBA 2I81A 3DMLA 2VL3A 1AQVA 4GRFA 4Q5RA 1RK4A 1O73A 2WRTA 3HJOA 3HVSA 1F9MA 3RAZA 4AGSA 3VPTA 4MJEA 4KDUA 3GX0A 2YOIA 3LSZA 4AJ6A 2RUEA 1B8XA 4G0KA 1GUHA 2VUPA 5JWQB 3EWLA 2PBJA 2OE3A 2H1AA 3ZTLA 3LYKA 1H4OA 2H0GA 5ID2B 4BVYA 1SD9A 2PN8A 1EP7A 2OE0A 2A4HA 4YQUA 3UAPA 1UC7A 2E0QA 2VCZA 4KCEA 3UEMA 4V1Ap 4ECJA 5J9CA 3KTLA 3TB2A 5L71A 5ECLB 3BOAA 5IIZA 4X0XA 2J9HA 2H19A 2YANA 2B5EA 1EGRA 1OVNA 5DDLA 1XWBA 2MMNA 2R5GA 2I1UA 1T7PB 4EL1A 2YV7A 5J4UA 1AQWA 2DIZA 1JFUA 2DMMA 2R2JA 4LMWA 1Q98A 3SBCA 2H76A 2D2ZA 2MMOA 3ZL5A 1SL1B 4NPBA 1PMTA 2ALBA 4HJ2A 2PERA 3LORA 4AJ8A 1QQ2A 4HI7A 2GQLA 4JEDA 2C0DA 4LL1B 4KH7A 2EIQA 4OD7A 1G0TA 1Z6NA 3HHVA 2O8VB 1AUCA 4KAEA 2LS5A 1DE1A 2LJRA 1S3RA 4FO5A 3L9SA 4HQZA 3TJBA 1Z3EA 2LRNA 4ZL9A 5H5SA 5F07A 4K2DA 4EIPA 3ZFLA 1K0BA 2VOCA 1EEMA 3Q6OA 1SJIA 2GZPA 4IP1A 3RPNA 4TXOB 5ELGA 5G2ZA 1K0CA 2RUFA 2ON5A 3UVHA 4ICYA 4NMUA 2FWHA 3ZITA 2E2MA 2FD3A 3LXZA 1GWCA 2R0PA 1ST9A 3QFAC 1V98A 4ACSA 1WE0A 3ZREA 1OKDA 4O7HA 3TUEA 3EVIA 4XS4A 3NZNA 1I9DA 3O76A 4BL7A 1PA3A 3F6DA 2DJ3A 3KMNA 1T8EB 1F2EA 3FHKA 4PUFC 1XOBA 2J23A 1U6TA 2OBKA 5BRTA 1PRXA 1SYRA 3D6IA 1YKCA 2YV9A 2F8AA 1TU7A 2VLUA 4GSSA 3GL5A 4AJ7A 3Q74A 5CNWA 5IQYA 3IOSA 3WGEA 17GSA 2AAWA 4IKHA 3P8WA 2YJ7A 4IJIA 1K0OA 3CXGA 1FHEA 1XW5A 2IFQA 4MJAA 3LFLA 3KIJA 3ZFBA 4JR4A 3GX8A 1ZOFA 1SENA 2CVKA 5G5FA 4IQAA 2H74A 22GSA 2AYTA 2FNOA 1XWAA 3P90A 4MJCA 3IAS2 3MWHA 3TKSC 2PVQA 5IMFA 2L4CA 3LWAA 4LMVA 3F3RA 2CX4A 3FW2A 2FWFA 3APSA 1WOUA 4TXVA 5ECOB 5A4VA 3TJGA 5ECIB 4DVCA 5INYA 3FZAA 1T4ZA 6GSXA 4MF7A 5DJMA 4A5PA 1TRVA 2R3XA 1ZYPA 2WCIA 1J08A 1NHOA 1YY7A 1YZXA 2XC2A 2IMFA 2MBTA 1ZYQB 4ZBDA 1S3AA 3L9UA 1GTUA 4L0UA 4O5RA 3ME8A 2XBIA 3DIEA 1FOVA 1J0FA 1SYXA 4MLYA 1G7OA 4HUAA 5CAXA 4WR5A 3VWXA 2X99A 4BWSA 2FWGA 2R4VA 1FOHA 3N9JA 4TKYA 1Z7PA 1R7HA 2HRNA 2QKEA 1PSQA 5J41A 20GSA 3G7JA 1O8XA 1ERVA 1ZYEA 4WXTA 2PWJA 3F9UA 2F51A 2C1YA 2KP1A 4I6XA 1T4YA 3HA9A 1PX6A 1ACVA 2I9HA 3IR4A 3KGKA 2O7KA 3GNJA 1SD8A 3BCIA 3V1WA 2CVBA 3GKMA 1ERTA 5ECRB 4QL7A 2HI7A 4TR4A 4WF4A 1OE8A 2AB6A 1JZRA 2Z9SA 1UN2A 3CRTA 2C8UA 5HQPA 3EU4A 1THXA 1SJZA 3TJJA 5DBQA 3FRCA 1X0RA 1EV9A 2VCXA 4MZWA 3ZYWA 4WBJA 2K9FA 5F05A 1WRYA 2ES7A 1MEKA 4POBA 2A2SA 1TDIA 1JZWA 3I69A 1F3AA 3IC8A 4IS0A 5AGYA 4CHSA 3TDGA 2VIMA 4DSRA 2VM1A 2C3TA 3WT2A 4D73B 4BVXA 1K0MA 5CRWA 5ECSA 4F03A 5D9VA 1M9BA 4JR6A 3DKSA 2VL2C 4KUNA 3HD5A 1GNEA 3GL3A 1M0UA 5DALB 1YF1A 1QXHA 2VL9A 4HZ2A 1UVZA 2X49A 2IN3A 1XWKA 3F63A 3GIXA 1TKDB 5D9XA 10GSA 1DSBA 4HSCX 3L78A 1GSYA 1GSEA 3FY7A 4K1FA 5A4WA 4K2XA 1AXDA 3KMOA 3FMWA 1IYHA 3RDWA 1XW6A 2GT5A 4TR3A 2PVOC 2C3QA 4MH3A 3TKSA 4NHZA 8GSSA 2VCTA 1ZZYA 1B4QA 4IN0A 1FW1A 1QUWA 1FVJA 1S3CA 4XS6A 4Z2UA 4MMMA 1U88A 1H75A 1TI3A 4MF5A 2DJ0A 2YWIA 2I3YA 3C1SA 3HY2A 3F0IA 1ON4A 3SWLA 2H1DA 2JZTA 3GFKA 2CAIA 3TOTA 4PTSA 4MNNA 6GSTA 1GLPA 5CREA 2EC4A 2TRXA 6GSUA 4LL4B 2LKUA 1NM3A 1A8YA 4MPFA 4PQHA 4IBPA 3JCML 5ECKB 2YNXA 3HVVA 2DC5A 3IC4A 4IGJA 3FEUA 1PX7A 3HVNA 5EL8A 1WPIA 2HZEA 2B6MA 1UA5A 1X5EA 2F9SA 2EIOA 2HXKA 5ECMB 3MSZA 2QA2A 1S3DA 16GSA 1OYJA 3BBYA 4I2UA 3U5RE 1WP0A 4TR1B 4LA1A 1NHYA 1K3OA 4KX4A 5F06A 1M2AA 3BCKA 4Z7XA 2O89A 1O7UA 2VD1A 1XCCA 3HZ8A 2IJYA 3UIWA 3C7MA 1OKTA 3ZRDA 4ML1A 2PU9C 3A5IA 5ECHB 2VCQA 3EPTA 4FH8A 1X5DA 4V2LA 3WGDA 4K8MA 3GMFA 3A2VA 4WEYA 4DSSB 2L6CA 1T1VA 2ON7A 2NBSA 1DBYA 1B48A 1OC9A 3E9JB 1R5AA 3EE2A 4FYUA 2V6OA 1EZKA 4EDYA 3A3TA 2BJXA 4KSOA 3TJKA 1G7EA 4DEJA 4XCSA 4GQCA 3DVWA 2A2PA 4JZQA 2VL2A 3LJRA 1TK8B 4GF0A 1XOAA 3FZ4A 4IHUA 2C4JA 3D0ZA 2KLXA 2GSQA 2FHEA 1IYIA 4YAVA 2LUSA 4HU9A 4IQ1A 2MZCA 1CQGA 2MBSA 1BYEA 2GZZA 4MZBA 5EY6A 1T3BA 4PXOA 3CQFA 4MABA 2IMDA 1ZL9A 3GV1A 4KDXA 2YZHA 5HR1A 3UBLA 4CY8A 1GH2A 4XHMA 1QK8A 2B1LA 1BJXA 4YH2A 4BPYA 3UL3A 3IRAA 4GTUA 1SK2A 1K3YA 11GSA 2G0FA 1V57A 3E0UA 1N8JA 2LJAA 4NWYA 3GHAA 1GULA 4QQ7A 3CTGA 4FIWA 2H73A 5LD0A 4AF2A 3H4KA 4EVMA 2CZ2A 3GTUB 1B9YC 1Z5YE 5B8AA 2WDUA 5HFKA 9GSSA 1M2BA 1SL2B 4KGIA 3QDNA 3RPPA 2G2QA 5HFIA 3ZZXA 2C0GA 3M3MA 3O6TA 4PURA 5IOWA 3A2XA 1LU4A 1M2DA 3TGZA 2P5RA 1K3LA 2TIRA 1GSSA 2M80A 2OJLA 4OCFA 3UJ1A 5F0GA 3HCZA 4KA0A 1SU9A 1GTIA 3VURA 2JSYA 1HD2A 5DJLA 4ULXA 5IPGA 3F3QA 2AHEA 3EINA 2LRTA 3D21A 4L5LA 3A5WA 1YJ6A 1GSUA 1TP9A 5D73A 2OBIA 1PD21 3M9KA 3F4TA 3IBHA 3PH9A 4TN8A 2H70A 3EMXA 2H30A 1EEJA 3TOUA 1W89A 1TXXA 2GT6A 4EO3A 5H5QA 1GUMA 4BVYB 3ZMKA 1YKAA 2LNSA 1X9SB 2HFDA 2QC7A 2DMLA 4ZL7A 4WETA 2H6YA 4V1Ag 4JRRA 1ML6A 1KNGA 3FYGA 3HYPA 3KEBA 3PINA 5CP1A 4PGTA 5FHIA 1FAAA 5AIXA 1SKWB 1WMJA 3EYTA 2LTKA 4NV5A 3D4TA 2YWOA 2AUVA 2B7JA 3M8NA 3VWVA 2O85A 4XRDA 2IWTA 2RLIA 3M1GA 1A24A 1C72A 3R2QA 4MDCA 1K0DA 4G0IA 4HJMA 2RM6A 2KHPA 2V6KA 3M9JA 1XW9A 2IMEA 1PGTA 3C8EA 2IMIA 1DE2A 1CQHA 1A0RP 3CSHA 5HFGA 4OWYA 1Q4JA 4Q5QA 1SL0B 3I6AA 2HSYA 1OE7A 2X8GA 2IL3A 2JZRA 2ZNMA 2GQMA 3EMPA 2YPMA 2M46A 1MTCA 3IHQA 1GTAA 2F8FA 3G7IA 2HT9A 1V40A 2DKHA 4OO4A 2FA4A 1YF0A 3VWUA 3QAGA 3GH6A 4CW9A 2MYGA 4PQ1A 3QFBC 3TRPA 19GSA 1VF4A 2WGRA 3FZ9A 4I97A 2B5XA 3ISOA 1HNCA 3P2AA 3F4SA 1E2YA 3DYRA 3F6FA 2N5FA 3WD6A 3KP8A 3FZ5A 2JZSA 1XXUA 5A4UA 2HRAA 4CDOA 4MK3A 2IIYA 1A2JA 5GAPD 4GSTA 3IHGA 4GXZA 6GSYA 1VF2A 3AY8A 4ECIA 4L5OA 2WZ9A 2N5BA 4MZCA 4ID0A 5ECPB 3GSTA 5B6MA 2C80A 2P0GA 2KOKA 1TU8A 4XS4B 1JZOA 3D5JA 2FWEA 2IMKA 1J9BA 4BL7B 5GSTA 2P5QA 4XIHA 1U87A 2E2GA 4P3YB 4TOPA 2QSIA 2HRKA 5IMCA 1VF1A 3GRXA 3C1RA 3IK7A 3KH9A 2DBCA 1B4PA 2WB9A 5DQSA 2X8HA 2XHFA 2LQQA 4HDEA 3L9VA 3N5OA 3ZIJA 5ABRA 2OE1A 2HRFA 1R26A 3UARA 4IVFA 5ECNB 1TI1A 3O3TA 1K0NA 4Q5FA 1GP1A 5IMDA 4KB3A 1TRSA 4OFMA 1MDIA 3VI7A 2H1BA 4MF6A 3TKQA 5KN3A 3J7Yb 4KF9A 4ECCA 5DAKA 5CYYA 4G2EA 2PGTA 4ZXGA 2L5LA 2A2RA 2IFQB 1HNAA 1XIYA 4X4JA 4IJ3A 4USSA 2CVDA 3LEFA 1KTEA 1PN0A 4HQSA 3HJMA 2VCWA 1F37A 2JADA 2V32A 1GSQA 4K7OA 1TW9A 1V9WA 2GDRA 5D8IA 4YQMA 4MCUA 5B8BA 3DD3A 1VF3A 4RI7A 4V2NA 3GURA 2NVLA 3APOA 4GCIA 4ZB8A 1ABAA 3KTBA 5DVBA 2R6KA 5ID2A 2X64A 4G0LA 1QFNA 3ERFA 1NSWA 5FWGA 2VLTA 3TRXA 2HYXA 4WBRD 1EOGA 3H1NA 1WJKA 3M0FA 4ILFA 2H8LA 1EV4A 2WFCA 2CX3A 4MA9A 3QAVA 4I2TA 3CSJA 5A5KA 4K6XA 4EE0A 2H6XA 2LQOA 3QD9A 3IPZA 4TRXA 3C73A 3D4MA 1VRSD 3F4RA 1U3IA 3A2WA 3ED3A 3PGTA 5AIVA 2LJKA 3QR6A 5JWOB 1OC3A 1GSDA 4ZL8A 1W4VA 5B7CA 4G19A 4XS1A 4BIKA 2PMTA 4F0BA 2YN1A 3HVXA 3LYPA 4K0GA 3LG6A 2CZ3A 4O5QA 5D96A 1RQMA 1M99A 4KE3A 1SK0A 3FR6A 3DRNA 3ZLPA 1AC1A 1EOHA 2REMA 3TKPA 2H1GA 5CRDA 4E8EA 2XBQA 1USBA 2DSAA 3NIVA 4O32A 1FB6A 5GAND 6GSVA 4XRAA 4KSMA 3ZMLA 2VM2A 3LW9A 3LXTA 5EPFA 2JSZA 2LV3A 1N2AA 3E3EA 4K9ZA 1FVKA 5J9BA 3HKRA 7GSSA 2R37A 2LEGA 4OFTA 1X5CA 4H86A 3GN3A 1BEDA 2HNLA 5DCGA 2MMAA 3EC3A 4JU5A 2YWMA 3RHCA 4PUAA 5AN1A 3ERGA 4NXIA 2CT6A 4F2IA 1A2MA 4TXOA 4GWRA 4BVXB 2VD0A 4PQIA 1GTBA 3FKFA 5AISA 4EC0A 4J56E 4YQVA 1XZOA 4IP6A 3J7Yk 1O85A 3KXOA 4G9HA 1THOA 1Y25A 4I5QA 2GQKA 2C0FA 1XFLA 3BD2A 3PR8A 5KEJA 2EIRA 4IW9A 4N0VA 5B6NA 14GSA 1PKZA 1JLWA 3DGQA 2GLRA 3TJFA 1V58A 5COHA 2GVPA 3GKKA 3MIXA 1AQXA 1EP8A 2HZFA 4WF5A 1A23A 2FY6A 4TR0A 2WS2A 1O8WA 1AIUA 1YEXA 2VO4A 2ZUPA 4RI6A 1A2LA 4WKWA 2WJUA 2YJHA 4EKZA 2CA8A 3F8UA 4F0CA 2A4VA 3CRUA 4FYCA 3GKNA 1XWGA 3DVXA 4PNFA 2BMXA 4OO5A 5KOXA 5D9WA 2GGTA 2XPDA 5IMVA 1FB0A 5KN2A 4HOJA 4MJBA 1WIKA 3I43A 1MD3A 2OADA 4Q5NA 3IAM2 5DCHA 4J2FA 1RW1A 3IE3A 1R5PA 5G30A 5IM9A 2HZEB 2H6ZA 4N0ZA 2OACA 2V2GA 2AV4A 4YKFA 5IMAA 5IOXA 2RM5A 4ZILA 5IO0A 2B1KA 5G1KA 1ZGNA 3H79A 3MNGA 3VLNA 2FGXA 1A0FA 4ISDA 3VK9A 2C0EA 1SKSB 2DLXA 4GSNA 4X1UA 5BMUA 3W8SA 3FR3A 3QOUA 5G5EA 2NDOA 2BTOT 5IPHA 5ECQB 3WGXA 2K6VA 1PFOA 2GZYA 2GSSA 3UVTA 2PUKC 4EIQA 1NW2A 3KD0A 2HE3A 3C71A 2R0CA 3IK9A 3ZIVA 4K7IA 2HSMA 3I9V2 1B9XC 4TVEA 2E7PA 1FO5A 2H0IA 4ZB9A 3L4NA 4G10A 5KOWA 2V41A 1QMVA 4TW5A 4NAXA 5IMZA 1QGVA 3FK8A 1OC9B 2DJ1A 4EUYA 1JZDA 2YWNA 1HQOA 1Z9HA 1YDKA 3NOFA 1TK0B 3L0HA 4Z2TA 1XVQA 5EVOA 1PN9A 2DIYA 2M72A 2NTOA 2DJKA 3EURA 2JU5A 1AAZA 4BA7A 3KZQA 2VLVA 1M3JA 3DXBA 2QGVA 2JL4A 2HSHA 2GSRA 4KCAA 2GTUA 2IPAA 2YCDA 3GSSA 5J5NA 3LGCA 3GYKA 3K8NA 1KBNA 4XTSA 5D93A 2QA1A 1A8LA 3FR9A 3KM6A 4J57E 3RHBA 3QCPA 4JBBA 4YKGA 2N5AA 4MP4A 3Q18A 3ERWA 5G1LA 4L0WA 3LQ7A 2O87A 1ZMAA 4D73A 1E6BA 4JE1A 4X43A 1M3IA 4ZBBA 1BQ7A 2NPBA 4LLRA 2WULA 4HZ4A 5E59A 3IV4A 4PNGA 1GLQA 1XBSA 2KUCA 1EGOA 1PL2A 3TRQA 3APQA 4V2MA 5DALA 2HLSA 1M7TA 3D22A 5KN1A 2VCVA 4RQXA 5FT3A 3GA4A 2YP6A 2H01A 12GSA 3G9BA 3IXRA 3GUSA 1BG5A 1XG8A 3QPMA 1X9WB 4O92A 4I8BA 5D9TA 3VWWA 3DWVA 4POMA 4POLA 3KP9A 4E8HA 5C00A 1OC8A 1Y6EA 1GSFA 2H71A 1EWXA 4HEA2 4OFNA 2DJJA 5LNKe 3HJPA 1GUKA 1ZYNA 1M9AA 2TRCP 1R4WA 2V1MA 5CRGA 4GLTA 3TKSE 3US3A 2L59A 3ME7A 1XWCA 3QMXA 3S9FA 3ZVJA 1SKRB 1LJRA 5JCUA 3IDVA 1G6YA 1V2AA 2ZCTA 2B7KA 3P7XA 3CSIA 2FA8A 2XPEA
chains in the Genus database with same CATH topology
5JCWA 2P31A 2K8SA 2L57A 5F8BA 4EDZA 4EF0A 2B5YA 4F82A 1PL1A 2OKAA 4Z2RA 2RIIA 6GSSA 3KJYA 5LCZA 3HDCA 1O6JA 1DUGA 2FUG2 4OCEA 4QL9A 4O5UA 3QAWA 4POKA 3CTFA 2AJQB 3MDKA 2LSTA 3PPUA 1JHBA 4K0NA 4K7NA 1TJDA 1Z7RA 1TK5B 4N30A 1WWJA 2DJ2A 1F6MC 2L5OA 2FLSA 3MAKA 1YQ1A 5H5RA 3OR5A 1ZCPA 4TR1A 3MYDA 4BWQA 3CBUA 1TRWA 1I5GA 4KNDA 1ERWA 3UOMA 4WR4A 1PKWA 5C04A 1TOFA 5G31A 5KN0A 2H66A 3CYNA 2X8CA 3HXSA 2YZUA 4NHWA 2H0HA 1VGLA 4N11A 4ECBA 4HU7A 1SK1A 1TTZA 2CAQA 1XPVA 18GSA 1GRXA 1SJ6A 2I4AA 5E4WA 4DSSA 1ILOA 1OAZA 1G6WA 3WYWA 3IA1A 3H8QA 3VPQA 2KP2A 3KH7A 4F9ZA 2C3NA 3DEXA 2F3MA 1T00A 1U3AA 3VI5A 1FG4A 1O81A 2GS3A 2H75A 2L4QA 5ENUA 4L8EA 4GQFA 1HNBA 4EXJA 1MDJA 3TCOA 5DQYA 4YAPA 2K8VA 13GSA 5ELAA 4ML6A 2UZ8A 2PPTA 1MD4A 1XVWA 2CQ9A 5CRHA 4DSQA 1MDKA 1LBKA 4MPGA 5GZZB 3ZVJD 6GSWA 3W8JA 2LRCA 1AW9A 1K0AA 1GNWA 3HZ4A 4KW6A 3UBKA 2FCHA 3W6GA 1F3BA 5CO3A 2X4AA 4NV2A 5GSSA 4PX1A 1GL8A 5JWRB 1YEPA 4ZB6A 4OMVA 4FYBA 4RQRA 3R3EA 4HS1A 2L6DA 2K18A 3G7YA 5IO2A 3TKRA 2H72A 1Z6MA 1X9MB 2VAFA 3KCMA 3UMAA 4ZIJA 2R0GA 2MMZA 3CMIA 2GSTA 3Q19A 1BX9A 4FQUA 4IELA 1HYUA 2OA7A 4N10A 1TRUA 4CY6A 3GKXA 3GTUA 5HR0A 5J3RA 5JCGA 3H93A 1BAYA 2CV4A 2B3SA 4K5SA 5HR3A 3U6VA 2LNTA 4MH2A 1URMA 2JACA 4RUVA 3VFIA 5HR2A 3RBTA 1ERUA 3GH9A 1JLVA 5DAKB 3EU3A 1PQNA 3WT1A 3BJ5A 4KDYA 4K5RA 4ZBAA 2DKIA 1KEBA 2I81A 3DMLA 2VL3A 1AQVA 4GRFA 1RK4A 1O73A 4Q5RA 2WRTA 3HJOA 3HVSA 1F9MA 3RAZA 4AGSA 3VPTA 4MJEA 4KDUA 3GX0A 2YOIA 3LSZA 4AJ6A 2RUEA 1B8XA 4G0KA 1GUHA 2VUPA 5JWQB 3EWLA 2PBJA 2OE3A 2H1AA 3ZTLA 3LYKA 1H4OA 2H0GA 5ID2B 4BVYA 1SD9A 2PN8A 1EP7A 2OE0A 2A4HA 4YQUA 3UAPA 1UC7A 2E0QA 2VCZA 4KCEA 3UEMA 4V1Ap 4ECJA 5J9CA 3KTLA 3TB2A 5L71A 5ECLB 3BOAA 5IIZA 4X0XA 2J9HA 2H19A 2YANA 2B5EA 1EGRA 1OVNA 5DDLA 1XWBA 2MMNA 2R5GA 2I1UA 1T7PB 4EL1A 2YV7A 5J4UA 1AQWA 2DIZA 1JFUA 2DMMA 2R2JA 4LMWA 1Q98A 3SBCA 2H76A 2D2ZA 2MMOA 3ZL5A 1SL1B 4NPBA 1PMTA 2ALBA 4HJ2A 2PERA 3LORA 4AJ8A 1QQ2A 4HI7A 2GQLA 4JEDA 2C0DA 4LL1B 4KH7A 2EIQA 4OD7A 1G0TA 1Z6NA 3HHVA 2O8VB 1AUCA 4KAEA 2LS5A 1DE1A 2LJRA 4FO5A 3L9SA 4HQZA 3TJBA 1Z3EA 2LRNA 4ZL9A 5H5SA 5F07A 4K2DA 4EIPA 3ZFLA 1K0BA 2VOCA 1EEMA 3Q6OA 1SJIA 2GZPA 4IP1A 3RPNA 4TXOB 5ELGA 5G2ZA 1K0CA 2RUFA 2ON5A 3UVHA 4ICYA 4NMUA 2FWHA 3ZITA 2E2MA 2FD3A 3LXZA 1GWCA 2R0PA 1ST9A 3QFAC 1V98A 4ACSA 1WE0A 3ZREA 1OKDA 4O7HA 3TUEA 3EVIA 4XS4A 3NZNA 1I9DA 3O76A 4BL7A 1PA3A 3F6DA 2DJ3A 3KMNA 1T8EB 1F2EA 3FHKA 4PUFC 1XOBA 2J23A 1U6TA 2OBKA 5BRTA 1PRXA 1SYRA 3D6IA 1YKCA 2YV9A 2F8AA 1TU7A 2VLUA 4GSSA 3GL5A 4AJ7A 3Q74A 5CNWA 5IQYA 3IOSA 3WGEA 17GSA 2AAWA 4IKHA 3P8WA 2YJ7A 4IJIA 1K0OA 3CXGA 1FHEA 1XW5A 2IFQA 4MJAA 3LFLA 3KIJA 3ZFBA 4JR4A 3GX8A 1ZOFA 1SENA 2CVKA 5G5FA 4IQAA 2H74A 22GSA 2AYTA 2FNOA 1XWAA 3P90A 4MJCA 3IAS2 3MWHA 3TKSC 2PVQA 5IMFA 2L4CA 3LWAA 4LMVA 3F3RA 2CX4A 3FW2A 2FWFA 3APSA 1WOUA 4TXVA 5ECOB 5A4VA 3TJGA 5ECIB 4DVCA 5INYA 3FZAA 1T4ZA 6GSXA 4MF7A 5DJMA 4A5PA 1TRVA 2R3XA 1ZYPA 2WCIA 1J08A 1NHOA 1YY7A 1YZXA 2XC2A 2IMFA 2MBTA 1ZYQB 4ZBDA 1S3AA 3L9UA 1GTUA 4L0UA 4O5RA 3ME8A 2XBIA 3DIEA 1FOVA 1J0FA 1SYXA 4MLYA 1G7OA 4HUAA 5CAXA 4WR5A 3VWXA 2X99A 4BWSA 2FWGA 2R4VA 1FOHA 3N9JA 4TKYA 1Z7PA 1R7HA 2HRNA 2QKEA 1PSQA 5J41A 20GSA 3G7JA 1O8XA 1ERVA 1ZYEA 4WXTA 2PWJA 3F9UA 2F51A 2C1YA 2KP1A 4I6XA 1T4YA 3HA9A 1PX6A 1ACVA 2I9HA 3IR4A 3KGKA 2O7KA 3GNJA 1SD8A 3BCIA 3V1WA 2CVBA 3GKMA 1ERTA 5ECRB 4QL7A 2HI7A 4TR4A 4WF4A 1OE8A 2AB6A 1JZRA 2Z9SA 1UN2A 3CRTA 2C8UA 5HQPA 3EU4A 1THXA 1SJZA 3TJJA 5DBQA 3FRCA 1X0RA 1EV9A 2VCXA 4MZWA 3ZYWA 4WBJA 2K9FA 5F05A 1WRYA 2ES7A 1MEKA 4POBA 2A2SA 1TDIA 1JZWA 3I69A 1F3AA 3IC8A 4IS0A 5AGYA 4CHSA 3TDGA 2VIMA 4DSRA 2VM1A 2C3TA 3WT2A 4D73B 4BVXA 1K0MA 5CRWA 5ECSA 4F03A 5D9VA 1M9BA 4JR6A 3DKSA 2VL2C 4KUNA 3HD5A 1GNEA 3GL3A 1M0UA 5DALB 1YF1A 1QXHA 2VL9A 4HZ2A 1UVZA 2X49A 2IN3A 1XWKA 3F63A 3GIXA 1TKDB 5D9XA 10GSA 1DSBA 3L78A 1GSYA 1GSEA 3FY7A 4K1FA 5A4WA 4K2XA 1AXDA 3KMOA 3FMWA 1IYHA 3RDWA 1XW6A 2GT5A 4TR3A 2PVOC 2C3QA 4MH3A 3TKSA 4NHZA 8GSSA 2VCTA 1ZZYA 1B4QA 4IN0A 1FW1A 1QUWA 1FVJA 1S3CA 4XS6A 4Z2UA 4MMMA 1U88A 1H75A 1TI3A 4MF5A 2DJ0A 2YWIA 2I3YA 3C1SA 3HY2A 3F0IA 1ON4A 3SWLA 2H1DA 2JZTA 3GFKA 2CAIA 3TOTA 4PTSA 4MNNA 6GSTA 1GLPA 5CREA 2EC4A 2TRXA 6GSUA 4LL4B 2LKUA 1NM3A 1A8YA 4MPFA 4PQHA 4IBPA 3JCML 5ECKB 2YNXA 3HVVA 2DC5A 3IC4A 4IGJA 3FEUA 1PX7A 5EL8A 1WPIA 2HZEA 2B6MA 1UA5A 1X5EA 2F9SA 2EIOA 2HXKA 5ECMB 3MSZA 2QA2A 1S3DA 16GSA 1OYJA 3BBYA 4I2UA 3U5RE 1WP0A 4TR1B 4LA1A 1NHYA 1K3OA 4KX4A 5F06A 1M2AA 3BCKA 4Z7XA 2O89A 1O7UA 2VD1A 1XCCA 3HZ8A 2IJYA 3UIWA 3C7MA 1OKTA 3ZRDA 4ML1A 2PU9C 3A5IA 5ECHB 2VCQA 3EPTA 4FH8A 1X5DA 4V2LA 3WGDA 4K8MA 3GMFA 3A2VA 4WEYA 4DSSB 2L6CA 1T1VA 2ON7A 2NBSA 1DBYA 1B48A 1OC9A 3E9JB 1R5AA 3EE2A 4FYUA 2V6OA 1EZKA 4EDYA 3A3TA 2BJXA 4KSOA 3TJKA 1G7EA 4DEJA 4XCSA 4GQCA 3DVWA 2A2PA 4JZQA 2VL2A 3LJRA 1TK8B 4GF0A 1XOAA 3FZ4A 4IHUA 2C4JA 3D0ZA 2KLXA 2GSQA 2FHEA 1IYIA 4YAVA 2LUSA 4HU9A 4IQ1A 2MZCA 1CQGA 2MBSA 1BYEA 2GZZA 4MZBA 5EY6A 1T3BA 4PXOA 4MABA 2IMDA 1ZL9A 3GV1A 4KDXA 2YZHA 5HR1A 3UBLA 4CY8A 1GH2A 4XHMA 1QK8A 2B1LA 1BJXA 4YH2A 4BPYA 3UL3A 3IRAA 4GTUA 1SK2A 1K3YA 11GSA 2G0FA 1V57A 3E0UA 1N8JA 2LJAA 4NWYA 3GHAA 1GULA 4QQ7A 3CTGA 4FIWA 2H73A 5LD0A 4AF2A 3H4KA 4EVMA 2CZ2A 3GTUB 1B9YC 1Z5YE 5B8AA 2WDUA 5HFKA 9GSSA 1M2BA 1SL2B 4KGIA 3QDNA 3RPPA 2G2QA 5HFIA 3ZZXA 2C0GA 3M3MA 3O6TA 4PURA 5IOWA 3A2XA 1LU4A 1M2DA 3TGZA 2P5RA 1K3LA 2TIRA 1GSSA 2M80A 2OJLA 4OCFA 3UJ1A 5F0GA 3HCZA 4KA0A 1SU9A 1GTIA 3VURA 2JSYA 1HD2A 5DJLA 4ULXA 5IPGA 3F3QA 2AHEA 3EINA 2LRTA 3D21A 4L5LA 3A5WA 1YJ6A 1GSUA 1TP9A 5D73A 2OBIA 1PD21 3M9KA 3F4TA 3IBHA 3PH9A 4TN8A 2H70A 3EMXA 2H30A 1EEJA 3TOUA 1W89A 1TXXA 2GT6A 4EO3A 5H5QA 1GUMA 4BVYB 3ZMKA 1YKAA 2LNSA 1X9SB 2HFDA 2QC7A 2DMLA 4ZL7A 4WETA 2H6YA 4V1Ag 4JRRA 1ML6A 1KNGA 3FYGA 3HYPA 3KEBA 3PINA 5CP1A 4PGTA 5FHIA 1FAAA 5AIXA 1SKWB 1WMJA 3EYTA 2LTKA 4NV5A 3D4TA 2YWOA 2AUVA 2B7JA 3M8NA 3VWVA 2O85A 4XRDA 2IWTA 2RLIA 3M1GA 1A24A 1C72A 3R2QA 4MDCA 1K0DA 4G0IA 4HJMA 2RM6A 2KHPA 2V6KA 3M9JA 1XW9A 2IMEA 1PGTA 3C8EA 2IMIA 1DE2A 1CQHA 1A0RP 3CSHA 5HFGA 4OWYA 1Q4JA 4Q5QA 1SL0B 3I6AA 2HSYA 1OE7A 2X8GA 2IL3A 2JZRA 2ZNMA 2GQMA 3EMPA 2YPMA 2M46A 1MTCA 3IHQA 1GTAA 2F8FA 3G7IA 2HT9A 1V40A 2DKHA 4OO4A 2FA4A 1YF0A 3VWUA 3QAGA 3GH6A 4CW9A 2MYGA 4PQ1A 3QFBC 3TRPA 19GSA 1VF4A 2WGRA 3FZ9A 4I97A 2B5XA 3ISOA 1HNCA 3P2AA 3F4SA 1E2YA 3DYRA 3F6FA 2N5FA 3WD6A 3KP8A 3FZ5A 2JZSA 1XXUA 5A4UA 2HRAA 4CDOA 4MK3A 2IIYA 1A2JA 5GAPD 4GSTA 3IHGA 4GXZA 6GSYA 1VF2A 3AY8A 4ECIA 4L5OA 2WZ9A 2N5BA 4MZCA 4ID0A 5ECPB 3GSTA 5B6MA 2C80A 2P0GA 2KOKA 1TU8A 4XS4B 1JZOA 3D5JA 2FWEA 2IMKA 1J9BA 4BL7B 5GSTA 2P5QA 4XIHA 1U87A 2E2GA 4P3YB 4TOPA 2QSIA 2HRKA 5IMCA 1VF1A 3GRXA 3C1RA 3IK7A 3KH9A 2DBCA 1B4PA 2WB9A 5DQSA 2X8HA 2XHFA 2LQQA 4HDEA 3L9VA 3N5OA 3ZIJA 5ABRA 2OE1A 2HRFA 1R26A 3UARA 4IVFA 5ECNB 1TI1A 3O3TA 1K0NA 4Q5FA 1GP1A 5IMDA 4KB3A 1TRSA 4OFMA 1MDIA 3VI7A 2H1BA 4MF6A 3TKQA 5KN3A 3J7Yb 4KF9A 4ECCA 5DAKA 5CYYA 4G2EA 2PGTA 4ZXGA 2L5LA 2A2RA 2IFQB 1HNAA 1XIYA 4X4JA 4IJ3A 4USSA 2CVDA 3LEFA 1KTEA 1PN0A 4HQSA 3HJMA 2VCWA 1F37A 2JADA 2V32A 1GSQA 4K7OA 1TW9A 1V9WA 2GDRA 5D8IA 4YQMA 4MCUA 5B8BA 3DD3A 1VF3A 4RI7A 4V2NA 3GURA 2NVLA 3APOA 4GCIA 4ZB8A 1ABAA 3KTBA 5DVBA 2R6KA 5ID2A 2X64A 4G0LA 1QFNA 3ERFA 1NSWA 5FWGA 2VLTA 3TRXA 2HYXA 4WBRD 1EOGA 3H1NA 1WJKA 3M0FA 4ILFA 2H8LA 1EV4A 2WFCA 2CX3A 4MA9A 3QAVA 4I2TA 3CSJA 5A5KA 4K6XA 4EE0A 2H6XA 2LQOA 3QD9A 3IPZA 4TRXA 3C73A 3D4MA 1VRSD 3F4RA 1U3IA 3A2WA 3ED3A 3PGTA 5AIVA 2LJKA 3QR6A 5JWOB 1OC3A 1GSDA 4ZL8A 1W4VA 5B7CA 4G19A 4XS1A 2PMTA 4F0BA 2YN1A 3HVXA 3LYPA 4K0GA 3LG6A 2CZ3A 4O5QA 5D96A 1RQMA 1M99A 4KE3A 1SK0A 3FR6A 3DRNA 3ZLPA 1AC1A 1EOHA 2REMA 3TKPA 2H1GA 5CRDA 4E8EA 2XBQA 1USBA 2DSAA 3NIVA 4O32A 1FB6A 5GAND 6GSVA 4XRAA 4KSMA 3ZMLA 2VM2A 3LW9A 3LXTA 5EPFA 2JSZA 2LV3A 1N2AA 3E3EA 4K9ZA 1FVKA 5J9BA 3HKRA 7GSSA 2R37A 2LEGA 4OFTA 1X5CA 4H86A 3GN3A 1BEDA 2HNLA 5DCGA 2MMAA 3EC3A 4JU5A 2YWMA 3RHCA 4PUAA 5AN1A 3ERGA 4NXIA 2CT6A 4F2IA 1A2MA 4TXOA 4GWRA 4BVXB 2VD0A 4PQIA 1GTBA 3FKFA 5AISA 4EC0A 4J56E 4YQVA 1XZOA 4IP6A 3J7Yk 1O85A 3KXOA 4G9HA 1THOA 1Y25A 4I5QA 2GQKA 2C0FA 1XFLA 3BD2A 3PR8A 5KEJA 2EIRA 4IW9A 4N0VA 5B6NA 14GSA 1PKZA 1JLWA 3DGQA 2GLRA 3TJFA 1V58A 5COHA 2GVPA 3GKKA 3MIXA 1AQXA 1EP8A 2HZFA 4WF5A 1A23A 2FY6A 4TR0A 2WS2A 1O8WA 1AIUA 1YEXA 2VO4A 2ZUPA 4RI6A 1A2LA 4WKWA 2WJUA 2YJHA 4EKZA 2CA8A 3F8UA 4F0CA 2A4VA 3CRUA 4FYCA 3GKNA 1XWGA 3DVXA 4PNFA 2BMXA 4OO5A 5KOXA 5D9WA 2GGTA 2XPDA 5IMVA 1FB0A 5KN2A 4HOJA 4MJBA 1WIKA 3I43A 1MD3A 2OADA 4Q5NA 3IAM2 5DCHA 4J2FA 1RW1A 3IE3A 1R5PA 5G30A 5IM9A 2HZEB 2H6ZA 4N0ZA 2OACA 2V2GA 2AV4A 4YKFA 5IMAA 5IOXA 2RM5A 4ZILA 5IO0A 2B1KA 5G1KA 1ZGNA 3H79A 3MNGA 3VLNA 2FGXA 1A0FA 4ISDA 3VK9A 2C0EA 1SKSB 2DLXA 4GSNA 4X1UA 5BMUA 3W8SA 3FR3A 3QOUA 5G5EA 2NDOA 2BTOT 5IPHA 5ECQB 3WGXA 2K6VA 2GZYA 2GSSA 3UVTA 2PUKC 4EIQA 1NW2A 3KD0A 2HE3A 3C71A 2R0CA 3IK9A 3ZIVA 4K7IA 2HSMA 3I9V2 1B9XC 4TVEA 2E7PA 1FO5A 2H0IA 4ZB9A 3L4NA 4G10A 5KOWA 2V41A 1QMVA 4TW5A 4NAXA 5IMZA 1QGVA 3FK8A 1OC9B 2DJ1A 4EUYA 1JZDA 2YWNA 1HQOA 1Z9HA 1YDKA 3NOFA 1TK0B 3L0HA 4Z2TA 1XVQA 5EVOA 1PN9A 2DIYA 2M72A 2NTOA 2DJKA 3EURA 2JU5A 1AAZA 4BA7A 3KZQA 2VLVA 3DXBA 2QGVA 2JL4A 2HSHA 2GSRA 4KCAA 2GTUA 2IPAA 2YCDA 3GSSA 5J5NA 3LGCA 3GYKA 3K8NA 1KBNA 4XTSA 5D93A 2QA1A 1A8LA 3FR9A 3KM6A 4J57E 3RHBA 3QCPA 4JBBA 4YKGA 2N5AA 4MP4A 3Q18A 3ERWA 5G1LA 4L0WA 3LQ7A 2O87A 1ZMAA 4D73A 1E6BA 4JE1A 4X43A 4ZBBA 1BQ7A 2NPBA 4LLRA 2WULA 4HZ4A 5E59A 3IV4A 4PNGA 1GLQA 1XBSA 2KUCA 1EGOA 1PL2A 3TRQA 3APQA 4V2MA 5DALA 2HLSA 1M7TA 3D22A 5KN1A 2VCVA 4RQXA 5FT3A 3GA4A 2YP6A 2H01A 12GSA 3G9BA 3IXRA 3GUSA 1BG5A 3QPMA 1X9WB 4O92A 4I8BA 5D9TA 3VWWA 3DWVA 4POMA 4POLA 3KP9A 4E8HA 5C00A 1OC8A 1Y6EA 1GSFA 2H71A 1EWXA 4HEA2 4OFNA 2DJJA 5LNKe 3HJPA 1GUKA 1ZYNA 1M9AA 2TRCP 1R4WA 2V1MA 5CRGA 4GLTA 3TKSE 3US3A 2L59A 3ME7A 1XWCA 3QMXA 3S9FA 3ZVJA 1SKRB 1LJRA 5JCUA 3IDVA 1G6YA 1V2AA 2ZCTA 2B7KA 3P7XA 3CSIA 2FA8A 2XPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JCW A;  2P31 A;  2K8S A;  2L57 A;  5F8B A;  4EDZ A;  4EF0 A;  2B5Y A;  4F82 A;  1PL1 A;  2OKA A;  5LCZ A;  2RII A;  6GSS A;  3KJY A;  3HDC A;  1O6J A;  1DUG A;  2FUG 2;  4OCE A;  4QL9 A;  3QAW A;  4POK A;  3CTF A;  2AJQ B;  3MDK A;  2LST A;  1JHB A;  4K0N A;  4K7N A;  1TJD A;  1Z7R A;  1TK5 B;  4N30 A;  1WWJ A;  2DJ2 A;  1F6M C;  2L5O A;  2FLS A;  3MAK A;  1YQ1 A;  5H5R A;  3OR5 A;  1ZCP A;  4TR1 A;  4BWQ A;  3CBU A;  1TRW A;  1I5G A;  4KND A;  1ERW A;  3UOM A;  4WR4 A;  1PKW A;  5C04 A;  1TOF A;  5G31 A;  5KN0 A;  2H66 A;  3CYN A;  2X8C A;  3HXS A;  2YZU A;  4NHW A;  2H0H A;  1VGL A;  4N11 A;  4ECB A;  4HU7 A;  1SK1 A;  1TTZ A;  2CAQ A;  1XPV A;  18GS A;  1GRX A;  1SJ6 A;  2I4A A;  5E4W A;  4DSS A;  1ILO A;  1OAZ A;  1G6W A;  3WYW A;  3IA1 A;  3H8Q A;  3VPQ A;  2KP2 A;  3KH7 A;  4F9Z A;  2C3N A;  3DEX A;  2F3M A;  1T00 A;  1U3A A;  3VI5 A;  1FG4 A;  1O81 A;  2GS3 A;  2H75 A;  2L4Q A;  5ENU A;  4L8E A;  4GQF A;  1HNB A;  4EXJ A;  1MDJ A;  3TCO A;  5DQY A;  4YAP A;  2K8V A;  13GS A;  5ELA A;  4ML6 A;  2PPT A;  1MD4 A;  1XVW A;  2CQ9 A;  5CRH A;  4DSQ A;  1MDK A;  1LBK A;  4MPG A;  5GZZ B;  3ZVJ D;  6GSW A;  3W8J A;  2LRC A;  1AW9 A;  1K0A A;  1GNW A;  3HZ4 A;  4KW6 A;  3UBK A;  2FCH A;  3W6G A;  1F3B A;  5CO3 A;  4NV2 A;  5GSS A;  4PX1 A;  1GL8 A;  5JWR B;  1YEP A;  4ZB6 A;  4OMV A;  4FYB A;  4RQR A;  4HS1 A;  2L6D A;  2K18 A;  3G7Y A;  5IO2 A;  3TKR A;  2H72 A;  1Z6M A;  1X9M B;  2VAF A;  3KCM A;  3UMA A;  4ZIJ A;  2MMZ A;  3CMI A;  2GST A;  3Q19 A;  1BX9 A;  4IEL A;  1HYU A;  2OA7 A;  4N10 A;  1TRU A;  3GKX A;  3GTU A;  5HR0 A;  5J3R A;  5JCG A;  3H93 A;  1BAY A;  2CV4 A;  2B3S A;  5HR3 A;  3U6V A;  2LNT A;  4MH2 A;  1URM A;  2JAC A;  4RUV A;  3VFI A;  5HR2 A;  3RBT A;  1ERU A;  3GH9 A;  1JLV A;  5DAK B;  3EU3 A;  1PQN A;  3WT1 A;  3BJ5 A;  4KDY A;  4ZBA A;  1KEB A;  2I81 A;  3DML A;  2VL3 A;  1AQV A;  4GRF A;  1RK4 A;  1O73 A;  4Q5R A;  2WRT A;  3HJO A;  3HVS A;  1F9M A;  3RAZ A;  4AGS A;  3VPT A;  4MJE A;  4KDU A;  3GX0 A;  2YOI A;  3LSZ A;  4AJ6 A;  2RUE A;  1B8X A;  1GUH A;  2VUP A;  5JWQ B;  3EWL A;  2PBJ A;  2OE3 A;  2H1A A;  3ZTL A;  3LYK A;  1H4O A;  2H0G A;  5ID2 B;  4BVY A;  1SD9 A;  2PN8 A;  1EP7 A;  2OE0 A;  4YQU A;  3UAP A;  1UC7 A;  2E0Q A;  2VCZ A;  4KCE A;  3UEM A;  4V1A p;  4ECJ A;  5J9C A;  3KTL A;  3TB2 A;  5L71 A;  5ECL B;  3BOA A;  5IIZ A;  4X0X A;  2J9H A;  2H19 A;  2YAN A;  2B5E A;  1EGR A;  1OVN A;  5DDL A;  1XWB A;  2MMN A;  2R5G A;  2I1U A;  1T7P B;  4EL1 A;  2YV7 A;  5J4U A;  1AQW A;  2DIZ A;  1JFU A;  2DMM A;  2R2J A;  4LMW A;  1Q98 A;  3SBC A;  2H76 A;  2D2Z A;  2MMO A;  3ZL5 A;  1SL1 B;  4NPB A;  1PMT A;  2ALB A;  4HJ2 A;  2PER A;  3LOR A;  4AJ8 A;  1QQ2 A;  4HI7 A;  2GQL A;  4JED A;  2C0D A;  4LL1 B;  4KH7 A;  2EIQ A;  4OD7 A;  1G0T A;  1Z6N A;  3HHV A;  2O8V B;  1AUC A;  4KAE A;  2LS5 A;  1DE1 A;  2LJR A;  4FO5 A;  3L9S A;  4HQZ A;  3TJB A;  1Z3E A;  2LRN A;  4ZL9 A;  5H5S A;  5F07 A;  4K2D A;  3ZFL A;  1K0B A;  2VOC A;  1EEM A;  3Q6O A;  1SJI A;  2GZP A;  4IP1 A;  3RPN A;  4TXO B;  5ELG A;  5G2Z A;  1K0C A;  2RUF A;  2ON5 A;  3UVH A;  4NMU A;  2FWH A;  3ZIT A;  2E2M A;  2FD3 A;  3LXZ A;  1GWC A;  1ST9 A;  3QFA C;  1V98 A;  4ACS A;  1WE0 A;  3ZRE A;  1OKD A;  4O7H A;  3TUE A;  3EVI A;  4XS4 A;  3NZN A;  1I9D A;  3O76 A;  4BL7 A;  1PA3 A;  3F6D A;  2DJ3 A;  3KMN A;  1T8E B;  1F2E A;  3FHK A;  4PUF C;  1XOB A;  2J23 A;  1U6T A;  2OBK A;  1PRX A;  1SYR A;  3D6I A;  1YKC A;  2YV9 A;  2F8A A;  1TU7 A;  2VLU A;  4GSS A;  3GL5 A;  4AJ7 A;  3Q74 A;  5CNW A;  5IQY A;  3IOS A;  3WGE A;  17GS A;  2AAW A;  4IKH A;  3P8W A;  2YJ7 A;  4IJI A;  1K0O A;  3CXG A;  1FHE A;  1XW5 A;  2IFQ A;  4MJA A;  3LFL A;  3KIJ A;  3ZFB A;  4JR4 A;  3GX8 A;  1ZOF A;  1SEN A;  2CVK A;  5G5F A;  4IQA A;  2H74 A;  22GS A;  2AYT A;  2FNO A;  1XWA A;  3P90 A;  4MJC A;  3IAS 2;  3MWH A;  3TKS C;  2PVQ A;  5IMF A;  2L4C A;  3LWA A;  4LMV A;  3F3R A;  2CX4 A;  3FW2 A;  2FWF A;  3APS A;  1WOU A;  4TXV A;  5ECO B;  5A4V A;  3TJG A;  5ECI B;  4DVC A;  5INY A;  3FZA A;  1T4Z A;  6GSX A;  4MF7 A;  5DJM A;  1TRV A;  2R3X A;  2WCI A;  1J08 A;  1NHO A;  1YY7 A;  1YZX A;  2XC2 A;  2IMF A;  2MBT A;  1ZYQ B;  4ZBD A;  1S3A A;  3L9U A;  1GTU A;  4L0U A;  4O5R A;  3ME8 A;  2XBI A;  3DIE A;  1FOV A;  1J0F A;  1SYX A;  4MLY A;  1G7O A;  4HUA A;  5CAX A;  4WR5 A;  3VWX A;  2X99 A;  4BWS A;  2FWG A;  2R4V A;  3N9J A;  4TKY A;  1Z7P A;  1R7H A;  2HRN A;  2QKE A;  1PSQ A;  5J41 A;  20GS A;  3G7J A;  1O8X A;  1ERV A;  1ZYE A;  4WXT A;  2PWJ A;  3F9U A;  2F51 A;  2C1Y A;  2KP1 A;  4I6X A;  1T4Y A;  3HA9 A;  1PX6 A;  1ACV A;  2I9H A;  3IR4 A;  3KGK A;  2O7K A;  3GNJ A;  1SD8 A;  3BCI A;  3V1W A;  2CVB A;  3GKM A;  1ERT A;  5ECR B;  4QL7 A;  2HI7 A;  4TR4 A;  4WF4 A;  1OE8 A;  2AB6 A;  1JZR A;  2Z9S A;  1UN2 A;  3CRT A;  2C8U A;  5HQP A;  3EU4 A;  1THX A;  1SJZ A;  3TJJ A;  5DBQ A;  3FRC A;  1X0R A;  1EV9 A;  2VCX A;  4MZW A;  3ZYW A;  4WBJ A;  2K9F A;  5F05 A;  1WRY A;  2ES7 A;  1MEK A;  4POB A;  2A2S A;  1TDI A;  1JZW A;  3I69 A;  1F3A A;  4IS0 A;  5AGY A;  4CHS A;  3TDG A;  2VIM A;  4DSR A;  2VM1 A;  2C3T A;  3WT2 A;  4D73 B;  4BVX A;  1K0M A;  5CRW A;  5ECS A;  4F03 A;  5D9V A;  1M9B A;  4JR6 A;  3DKS A;  2VL2 C;  4KUN A;  3HD5 A;  1GNE A;  3GL3 A;  1M0U A;  5DAL B;  1YF1 A;  1QXH A;  2VL9 A;  4HZ2 A;  1UVZ A;  2IN3 A;  1XWK A;  3F63 A;  3GIX A;  1TKD B;  5D9X A;  10GS A;  1DSB A;  3L78 A;  1GSY A;  1GSE A;  3FY7 A;  4K1F A;  5A4W A;  1AXD A;  3KMO A;  1IYH A;  3RDW A;  1XW6 A;  2GT5 A;  4TR3 A;  2PVO C;  2C3Q A;  4MH3 A;  3TKS A;  4NHZ A;  8GSS A;  2VCT A;  1ZZY A;  1B4Q A;  4IN0 A;  1FW1 A;  1QUW A;  1FVJ A;  1S3C A;  4XS6 A;  4MMM A;  1U88 A;  1H75 A;  1TI3 A;  4MF5 A;  2DJ0 A;  2YWI A;  2I3Y A;  3C1S A;  3HY2 A;  3F0I A;  1ON4 A;  3SWL A;  2H1D A;  2JZT A;  3GFK A;  2CAI A;  3TOT A;  6GST A;  1GLP A;  5CRE A;  2EC4 A;  2TRX A;  6GSU A;  4LL4 B;  2LKU A;  1NM3 A;  1A8Y A;  4MPF A;  4PQH A;  4IBP A;  3JCM L;  5ECK B;  2YNX A;  3HVV A;  2DC5 A;  3IC4 A;  4IGJ A;  3FEU A;  1PX7 A;  5EL8 A;  1WPI A;  2HZE A;  2B6M A;  1UA5 A;  1X5E A;  2F9S A;  2EIO A;  2HXK A;  5ECM B;  3MSZ A;  1S3D A;  16GS A;  1OYJ A;  3BBY A;  4I2U A;  3U5R E;  1WP0 A;  4TR1 B;  4LA1 A;  1NHY A;  1K3O A;  4KX4 A;  5F06 A;  1M2A A;  3BCK A;  4Z7X A;  2O89 A;  1O7U A;  2VD1 A;  1XCC A;  3HZ8 A;  2IJY A;  3UIW A;  3C7M A;  1OKT A;  3ZRD A;  4ML1 A;  2PU9 C;  5ECH B;  2VCQ A;  4FH8 A;  1X5D A;  4V2L A;  3WGD A;  4K8M A;  3GMF A;  3A2V A;  4WEY A;  4DSS B;  2L6C A;  1T1V A;  2ON7 A;  2NBS A;  1DBY A;  1B48 A;  1OC9 A;  3E9J B;  1R5A A;  3EE2 A;  4FYU A;  2V6O A;  1EZK A;  4EDY A;  3A3T A;  2BJX A;  4KSO A;  3TJK A;  1G7E A;  4DEJ A;  4XCS A;  4GQC A;  3DVW A;  4JZQ A;  2VL2 A;  3LJR A;  1TK8 B;  4GF0 A;  1XOA A;  3FZ4 A;  4IHU A;  2C4J A;  3D0Z A;  2KLX A;  2GSQ A;  2FHE A;  1IYI A;  4YAV A;  2LUS A;  4HU9 A;  4IQ1 A;  2MZC A;  1CQG A;  2MBS A;  1BYE A;  2GZZ A;  4MZB A;  5EY6 A;  1T3B A;  4PXO A;  4MAB A;  2IMD A;  1ZL9 A;  3GV1 A;  4KDX A;  2YZH A;  5HR1 A;  3UBL A;  1GH2 A;  4XHM A;  1QK8 A;  2B1L A;  1BJX A;  4YH2 A;  4BPY A;  3UL3 A;  3IRA A;  4GTU A;  1SK2 A;  1K3Y A;  11GS A;  2G0F A;  1V57 A;  3E0U A;  1N8J A;  2LJA A;  4NWY A;  3GHA A;  1GUL A;  4QQ7 A;  3CTG A;  4FIW A;  2H73 A;  5LD0 A;  4AF2 A;  3H4K A;  4EVM A;  2CZ2 A;  3GTU B;  1B9Y C;  1Z5Y E;  5B8A A;  2WDU A;  5HFK A;  9GSS A;  1M2B A;  1SL2 B;  4KGI A;  3QDN A;  3RPP A;  2G2Q A;  5HFI A;  3ZZX A;  2C0G A;  3M3M A;  3O6T A;  4PUR A;  5IOW A;  3A2X A;  1LU4 A;  1M2D A;  3TGZ A;  2P5R A;  1K3L A;  2TIR A;  1GSS A;  2M80 A;  2OJL A;  4OCF A;  3UJ1 A;  5F0G A;  3HCZ A;  4KA0 A;  1SU9 A;  1GTI A;  3VUR A;  2JSY A;  1HD2 A;  5DJL A;  4ULX A;  5IPG A;  3F3Q A;  2AHE A;  3EIN A;  2LRT A;  3D21 A;  4L5L A;  3A5W A;  1YJ6 A;  1GSU A;  1TP9 A;  5D73 A;  2OBI A;  1PD2 1;  3M9K A;  3F4T A;  3IBH A;  3PH9 A;  4TN8 A;  2H70 A;  3EMX A;  2H30 A;  1EEJ A;  3TOU A;  1W89 A;  1TXX A;  2GT6 A;  4EO3 A;  5H5Q A;  1GUM A;  3ZMK A;  1YKA A;  2LNS A;  1X9S B;  2HFD A;  2QC7 A;  2DML A;  4ZL7 A;  4WET A;  2H6Y A;  4V1A g;  4JRR A;  1ML6 A;  1KNG A;  3FYG A;  3HYP A;  3KEB A;  3PIN A;  5CP1 A;  4PGT A;  5FHI A;  1FAA A;  5AIX A;  1SKW B;  1WMJ A;  3EYT A;  2LTK A;  4NV5 A;  3D4T A;  2YWO A;  2AUV A;  2B7J A;  3M8N A;  3VWV A;  2O85 A;  4XRD A;  2IWT A;  2RLI A;  3M1G A;  1A24 A;  1C72 A;  3R2Q A;  4MDC A;  1K0D A;  4HJM A;  2RM6 A;  2KHP A;  2V6K A;  3M9J A;  1XW9 A;  2IME A;  1PGT A;  3C8E A;  2IMI A;  1DE2 A;  1CQH A;  1A0R P;  3CSH A;  5HFG A;  4OWY A;  1Q4J A;  4Q5Q A;  1SL0 B;  3I6A A;  2HSY A;  1OE7 A;  2X8G A;  2IL3 A;  2JZR A;  2ZNM A;  2GQM A;  3EMP A;  2YPM A;  2M46 A;  1MTC A;  3IHQ A;  1GTA A;  2F8F A;  3G7I A;  2HT9 A;  1V40 A;  4OO4 A;  2FA4 A;  1YF0 A;  3VWU A;  3QAG A;  3GH6 A;  4CW9 A;  2MYG A;  4PQ1 A;  3QFB C;  3TRP A;  19GS A;  1VF4 A;  2WGR A;  3FZ9 A;  4I97 A;  2B5X A;  3ISO A;  1HNC A;  3P2A A;  3F4S A;  1E2Y A;  3DYR A;  3F6F A;  2N5F A;  3WD6 A;  3KP8 A;  3FZ5 A;  2JZS A;  1XXU A;  5A4U A;  4CDO A;  4MK3 A;  2IIY A;  1A2J A;  5GAP D;  4GST A;  4GXZ A;  6GSY A;  1VF2 A;  3AY8 A;  4ECI A;  4L5O A;  2WZ9 A;  2N5B A;  4MZC A;  5ECP B;  4ID0 A;  3GST A;  5B6M A;  2C80 A;  2P0G A;  2KOK A;  1TU8 A;  4XS4 B;  1JZO A;  3D5J A;  2FWE A;  2IMK A;  1J9B A;  5GST A;  2P5Q A;  4XIH A;  1U87 A;  2E2G A;  4P3Y B;  4TOP A;  2QSI A;  5IMC A;  1VF1 A;  3GRX A;  3C1R A;  3IK7 A;  3KH9 A;  2DBC A;  1B4P A;  2WB9 A;  5DQS A;  2X8H A;  2XHF A;  2LQQ A;  4HDE A;  3L9V A;  3N5O A;  3ZIJ A;  5ABR A;  2OE1 A;  2HRF A;  1R26 A;  3UAR A;  4IVF A;  5ECN B;  1TI1 A;  3O3T A;  1K0N A;  4Q5F A;  1GP1 A;  5IMD A;  4KB3 A;  1TRS A;  4OFM A;  1MDI A;  3VI7 A;  2H1B A;  4MF6 A;  3TKQ A;  5KN3 A;  3J7Y b;  4ECC A;  5DAK A;  5CYY A;  4G2E A;  2PGT A;  4ZXG A;  2L5L A;  2A2R A;  2IFQ B;  1HNA A;  1XIY A;  4IJ3 A;  2CVD A;  3LEF A;  1KTE A;  4HQS A;  3HJM A;  2VCW A;  1F37 A;  2JAD A;  2V32 A;  1GSQ A;  4K7O A;  1TW9 A;  1V9W A;  2GDR A;  5D8I A;  4YQM A;  4MCU A;  5B8B A;  3DD3 A;  1VF3 A;  4RI7 A;  4V2N A;  3GUR A;  2NVL A;  3APO A;  4GCI A;  4ZB8 A;  1ABA A;  3KTB A;  5DVB A;  2R6K A;  5ID2 A;  2X64 A;  1QFN A;  3ERF A;  1NSW A;  5FWG A;  2VLT A;  3TRX A;  2HYX A;  4WBR D;  1EOG A;  3H1N A;  1WJK A;  3M0F A;  4ILF A;  2H8L A;  1EV4 A;  2WFC A;  2CX3 A;  4MA9 A;  3QAV A;  4I2T A;  3CSJ A;  5A5K A;  4K6X A;  4EE0 A;  2H6X A;  2LQO A;  3QD9 A;  3IPZ A;  4TRX A;  3C73 A;  3D4M A;  1VRS D;  3F4R A;  1U3I A;  3A2W A;  3ED3 A;  3PGT A;  5AIV A;  2LJK A;  3QR6 A;  5JWO B;  1OC3 A;  1GSD A;  4ZL8 A;  1W4V A;  5B7C A;  4G19 A;  4XS1 A;  2PMT A;  4F0B A;  2YN1 A;  3HVX A;  3LYP A;  4K0G A;  3LG6 A;  2CZ3 A;  5D96 A;  1RQM A;  1M99 A;  4KE3 A;  1SK0 A;  3FR6 A;  3DRN A;  3ZLP A;  1AC1 A;  1EOH A;  2REM A;  3TKP A;  2H1G A;  5CRD A;  4E8E A;  2XBQ A;  1USB A;  2DSA A;  3NIV A;  4O32 A;  1FB6 A;  5GAN D;  6GSV A;  4XRA A;  4KSM A;  3ZML A;  2VM2 A;  5EPF A;  3LXT A;  2JSZ A;  2LV3 A;  1N2A A;  3E3E A;  4K9Z A;  1FVK A;  5J9B A;  3HKR A;  7GSS A;  2R37 A;  2LEG A;  4OFT A;  1X5C A;  4H86 A;  3GN3 A;  1BED A;  2HNL A;  5DCG A;  2MMA A;  3EC3 A;  4JU5 A;  2YWM A;  3RHC A;  4PUA A;  5AN1 A;  3ERG A;  4NXI A;  2CT6 A;  4F2I A;  1A2M A;  4TXO A;  4GWR A;  2VD0 A;  4PQI A;  1GTB A;  3FKF A;  5AIS A;  4EC0 A;  4J56 E;  4YQV A;  1XZO A;  4IP6 A;  3J7Y k;  1O85 A;  3KXO A;  4G9H A;  1THO A;  1Y25 A;  4I5Q A;  2GQK A;  2C0F A;  1XFL A;  3BD2 A;  3PR8 A;  5KEJ A;  2EIR A;  4IW9 A;  4N0V A;  5B6N A;  14GS A;  1PKZ A;  1JLW A;  3DGQ A;  2GLR A;  3TJF A;  1V58 A;  5COH A;  2GVP A;  3GKK A;  1AQX A;  1EP8 A;  2HZF A;  4WF5 A;  1A23 A;  2FY6 A;  4TR0 A;  2WS2 A;  1O8W A;  1AIU A;  1YEX A;  2VO4 A;  2ZUP A;  4RI6 A;  1A2L A;  4WKW A;  2WJU A;  2YJH A;  4EKZ A;  2CA8 A;  3F8U A;  4F0C A;  2A4V A;  3CRU A;  4FYC A;  3GKN A;  1XWG A;  3DVX A;  4PNF A;  2BMX A;  4OO5 A;  5D9W A;  2GGT A;  2XPD A;  5IMV A;  1FB0 A;  5KN2 A;  4HOJ A;  4MJB A;  1WIK A;  3I43 A;  1MD3 A;  2OAD A;  4Q5N A;  3IAM 2;  5DCH A;  4J2F A;  1RW1 A;  3IE3 A;  1R5P A;  5G30 A;  5IM9 A;  2HZE B;  2H6Z A;  4N0Z A;  2OAC A;  2V2G A;  2AV4 A;  5IMA A;  5IOX A;  2RM5 A;  4ZIL A;  5IO0 A;  2B1K A;  5G1K A;  1ZGN A;  3H79 A;  3MNG A;  3VLN A;  2FGX A;  1A0F A;  4ISD A;  3VK9 A;  2C0E A;  1SKS B;  2DLX A;  4GSN A;  4X1U A;  3W8S A;  3FR3 A;  3QOU A;  5G5E A;  2NDO A;  2BTO T;  5IPH A;  5ECQ B;  3WGX A;  2K6V A;  2GZY A;  2GSS A;  3UVT A;  2PUK C;  1NW2 A;  3KD0 A;  2HE3 A;  3C71 A;  3IK9 A;  3ZIV A;  4K7I A;  3I9V 2;  1B9X C;  4TVE A;  2E7P A;  1FO5 A;  2H0I A;  4ZB9 A;  3L4N A;  4G10 A;  2V41 A;  1QMV A;  4TW5 A;  4NAX A;  5IMZ A;  1QGV A;  3FK8 A;  1OC9 B;  2DJ1 A;  4EUY A;  1JZD A;  2YWN A;  1HQO A;  1Z9H A;  1YDK A;  3NOF A;  1TK0 B;  3L0H A;  1XVQ A;  5EVO A;  1PN9 A;  2DIY A;  2M72 A;  2NTO A;  2DJK A;  3EUR A;  2JU5 A;  1AAZ A;  4BA7 A;  3KZQ A;  2VLV A;  3DXB A;  2QGV A;  2JL4 A;  2HSH A;  2GSR A;  4KCA A;  2GTU A;  2IPA A;  2YCD A;  3GSS A;  5J5N A;  3LGC A;  3GYK A;  3K8N A;  1KBN A;  4XTS A;  5D93 A;  1A8L A;  3FR9 A;  3KM6 A;  4J57 E;  3RHB A;  3QCP A;  4JBB A;  2N5A A;  4MP4 A;  3Q18 A;  3ERW A;  5G1L A;  4L0W A;  3LQ7 A;  2O87 A;  1ZMA A;  4D73 A;  1E6B A;  4JE1 A;  4X43 A;  4ZBB A;  1BQ7 A;  2NPB A;  4LLR A;  2WUL A;  4HZ4 A;  5E59 A;  3IV4 A;  4PNG A;  1GLQ A;  1XBS A;  2KUC A;  1EGO A;  1PL2 A;  3TRQ A;  3APQ A;  5DAL A;  4V2M A;  2HLS A;  1M7T A;  3D22 A;  5KN1 A;  2VCV A;  4RQX A;  5FT3 A;  3GA4 A;  2YP6 A;  2H01 A;  12GS A;  3G9B A;  3IXR A;  3GUS A;  1BG5 A;  3QPM A;  1X9W B;  4O92 A;  4I8B A;  5D9T A;  3VWW A;  3DWV A;  4POM A;  4POL A;  3KP9 A;  4E8H A;  5C00 A;  1OC8 A;  1Y6E A;  1GSF A;  2H71 A;  1EWX A;  4HEA 2;  4OFN A;  2DJJ A;  5LNK e;  3HJP A;  1GUK A;  1M9A A;  2TRC P;  1R4W A;  2V1M A;  5CRG A;  4GLT A;  3TKS E;  3US3 A;  2L59 A;  3ME7 A;  1XWC A;  3QMX A;  3S9F A;  3ZVJ A;  1SKR B;  1LJR A;  5JCU A;  3IDV A;  1G6Y A;  1V2A A;  2ZCT A;  2B7K A;  3P7X A;  3CSI A;  2FA8 A;  2XPE A; 
#chains in the Genus database with same CATH topology
 5JCW A;  2P31 A;  2K8S A;  2L57 A;  5F8B A;  4EDZ A;  4EF0 A;  2B5Y A;  4F82 A;  1PL1 A;  2OKA A;  4Z2R A;  2RII A;  6GSS A;  3KJY A;  5LCZ A;  3HDC A;  1O6J A;  1DUG A;  2FUG 2;  4OCE A;  4QL9 A;  4O5U A;  3QAW A;  4POK A;  3CTF A;  2AJQ B;  3MDK A;  2LST A;  3PPU A;  1JHB A;  4K0N A;  4K7N A;  1TJD A;  1Z7R A;  1TK5 B;  4N30 A;  1WWJ A;  2DJ2 A;  1F6M C;  2L5O A;  2FLS A;  3MAK A;  1YQ1 A;  5H5R A;  3OR5 A;  1ZCP A;  4TR1 A;  3MYD A;  4BWQ A;  3CBU A;  1TRW A;  1I5G A;  4KND A;  1ERW A;  3UOM A;  4WR4 A;  1PKW A;  5C04 A;  1TOF A;  5G31 A;  5KN0 A;  2H66 A;  3CYN A;  2X8C A;  3HXS A;  2YZU A;  4NHW A;  2H0H A;  1VGL A;  4N11 A;  4ECB A;  4HU7 A;  1SK1 A;  1TTZ A;  2CAQ A;  1XPV A;  18GS A;  1GRX A;  1SJ6 A;  2I4A A;  5E4W A;  4DSS A;  1ILO A;  1OAZ A;  1G6W A;  3WYW A;  3IA1 A;  3H8Q A;  3VPQ A;  2KP2 A;  3KH7 A;  4F9Z A;  2C3N A;  3DEX A;  2F3M A;  1T00 A;  1U3A A;  3VI5 A;  1FG4 A;  1O81 A;  2GS3 A;  2H75 A;  2L4Q A;  5ENU A;  4L8E A;  4GQF A;  1HNB A;  4EXJ A;  1MDJ A;  3TCO A;  5DQY A;  4YAP A;  2K8V A;  13GS A;  5ELA A;  4ML6 A;  2UZ8 A;  2PPT A;  1MD4 A;  1XVW A;  2CQ9 A;  5CRH A;  4DSQ A;  1MDK A;  1LBK A;  4MPG A;  5GZZ B;  3ZVJ D;  6GSW A;  3W8J A;  2LRC A;  1AW9 A;  1K0A A;  1GNW A;  3HZ4 A;  4KW6 A;  3UBK A;  2FCH A;  3W6G A;  1F3B A;  5CO3 A;  2X4A A;  4NV2 A;  5GSS A;  4PX1 A;  1GL8 A;  5JWR B;  1YEP A;  4ZB6 A;  4OMV A;  4FYB A;  4RQR A;  3R3E A;  4HS1 A;  2L6D A;  2K18 A;  3G7Y A;  5IO2 A;  3TKR A;  2H72 A;  1Z6M A;  1X9M B;  2VAF A;  3KCM A;  3UMA A;  4ZIJ A;  2R0G A;  2MMZ A;  3CMI A;  2GST A;  3Q19 A;  1BX9 A;  4FQU A;  4IEL A;  1HYU A;  2OA7 A;  4N10 A;  1TRU A;  4CY6 A;  3GKX A;  3GTU A;  5HR0 A;  5J3R A;  5JCG A;  3H93 A;  1BAY A;  2CV4 A;  2B3S A;  4K5S A;  5HR3 A;  3U6V A;  2LNT A;  4MH2 A;  1URM A;  2JAC A;  4RUV A;  3VFI A;  5HR2 A;  3RBT A;  1ERU A;  3GH9 A;  1JLV A;  5DAK B;  3EU3 A;  1PQN A;  3WT1 A;  3BJ5 A;  4KDY A;  4K5R A;  4ZBA A;  2DKI A;  1KEB A;  2I81 A;  3DML A;  2VL3 A;  1AQV A;  4GRF A;  4Q5R A;  1RK4 A;  1O73 A;  2WRT A;  3HJO A;  3HVS A;  1F9M A;  3RAZ A;  4AGS A;  3VPT A;  4MJE A;  4KDU A;  3GX0 A;  2YOI A;  3LSZ A;  4AJ6 A;  2RUE A;  1B8X A;  4G0K A;  1GUH A;  2VUP A;  5JWQ B;  3EWL A;  2PBJ A;  2OE3 A;  2H1A A;  3ZTL A;  3LYK A;  1H4O A;  2H0G A;  5ID2 B;  4BVY A;  1SD9 A;  2PN8 A;  1EP7 A;  2OE0 A;  2A4H A;  4YQU A;  3UAP A;  1UC7 A;  2E0Q A;  2VCZ A;  4KCE A;  3UEM A;  4V1A p;  4ECJ A;  5J9C A;  3KTL A;  3TB2 A;  5L71 A;  5ECL B;  3BOA A;  5IIZ A;  4X0X A;  2J9H A;  2H19 A;  2YAN A;  2B5E A;  1EGR A;  1OVN A;  5DDL A;  1XWB A;  2MMN A;  2R5G A;  2I1U A;  1T7P B;  4EL1 A;  2YV7 A;  5J4U A;  1AQW A;  2DIZ A;  1JFU A;  2DMM A;  2R2J A;  4LMW A;  1Q98 A;  3SBC A;  2H76 A;  2D2Z A;  2MMO A;  3ZL5 A;  1SL1 B;  4NPB A;  1PMT A;  2ALB A;  4HJ2 A;  2PER A;  3LOR A;  4AJ8 A;  1QQ2 A;  4HI7 A;  2GQL A;  4JED A;  2C0D A;  4LL1 B;  4KH7 A;  2EIQ A;  4OD7 A;  1G0T A;  1Z6N A;  3HHV A;  2O8V B;  1AUC A;  4KAE A;  2LS5 A;  1DE1 A;  2LJR A;  1S3R A;  4FO5 A;  3L9S A;  4HQZ A;  3TJB A;  1Z3E A;  2LRN A;  4ZL9 A;  5H5S A;  5F07 A;  4K2D A;  4EIP A;  3ZFL A;  1K0B A;  2VOC A;  1EEM A;  3Q6O A;  1SJI A;  2GZP A;  4IP1 A;  3RPN A;  4TXO B;  5ELG A;  5G2Z A;  1K0C A;  2RUF A;  2ON5 A;  3UVH A;  4ICY A;  4NMU A;  2FWH A;  3ZIT A;  2E2M A;  2FD3 A;  3LXZ A;  1GWC A;  2R0P A;  1ST9 A;  3QFA C;  1V98 A;  4ACS A;  1WE0 A;  3ZRE A;  1OKD A;  4O7H A;  3TUE A;  3EVI A;  4XS4 A;  3NZN A;  1I9D A;  3O76 A;  4BL7 A;  1PA3 A;  3F6D A;  2DJ3 A;  3KMN A;  1T8E B;  1F2E A;  3FHK A;  4PUF C;  1XOB A;  2J23 A;  1U6T A;  2OBK A;  5BRT A;  1PRX A;  1SYR A;  3D6I A;  1YKC A;  2YV9 A;  2F8A A;  1TU7 A;  2VLU A;  4GSS A;  3GL5 A;  4AJ7 A;  3Q74 A;  5CNW A;  5IQY A;  3IOS A;  3WGE A;  17GS A;  2AAW A;  4IKH A;  3P8W A;  2YJ7 A;  4IJI A;  1K0O A;  3CXG A;  1FHE A;  1XW5 A;  2IFQ A;  4MJA A;  3LFL A;  3KIJ A;  3ZFB A;  4JR4 A;  3GX8 A;  1ZOF A;  1SEN A;  2CVK A;  5G5F A;  4IQA A;  2H74 A;  22GS A;  2AYT A;  2FNO A;  1XWA A;  3P90 A;  4MJC A;  3IAS 2;  3MWH A;  3TKS C;  2PVQ A;  5IMF A;  2L4C A;  3LWA A;  4LMV A;  3F3R A;  2CX4 A;  3FW2 A;  2FWF A;  3APS A;  1WOU A;  4TXV A;  5ECO B;  5A4V A;  3TJG A;  5ECI B;  4DVC A;  5INY A;  3FZA A;  1T4Z A;  6GSX A;  4MF7 A;  5DJM A;  4A5P A;  1TRV A;  2R3X A;  1ZYP A;  2WCI A;  1J08 A;  1NHO A;  1YY7 A;  1YZX A;  2XC2 A;  2IMF A;  2MBT A;  1ZYQ B;  4ZBD A;  1S3A A;  3L9U A;  1GTU A;  4L0U A;  4O5R A;  3ME8 A;  2XBI A;  3DIE A;  1FOV A;  1J0F A;  1SYX A;  4MLY A;  1G7O A;  4HUA A;  5CAX A;  4WR5 A;  3VWX A;  2X99 A;  4BWS A;  2FWG A;  2R4V A;  1FOH A;  3N9J A;  4TKY A;  1Z7P A;  1R7H A;  2HRN A;  2QKE A;  1PSQ A;  5J41 A;  20GS A;  3G7J A;  1O8X A;  1ERV A;  1ZYE A;  4WXT A;  2PWJ A;  3F9U A;  2F51 A;  2C1Y A;  2KP1 A;  4I6X A;  1T4Y A;  3HA9 A;  1PX6 A;  1ACV A;  2I9H A;  3IR4 A;  3KGK A;  2O7K A;  3GNJ A;  1SD8 A;  3BCI A;  3V1W A;  2CVB A;  3GKM A;  1ERT A;  5ECR B;  4QL7 A;  2HI7 A;  4TR4 A;  4WF4 A;  1OE8 A;  2AB6 A;  1JZR A;  2Z9S A;  1UN2 A;  3CRT A;  2C8U A;  5HQP A;  3EU4 A;  1THX A;  1SJZ A;  3TJJ A;  5DBQ A;  3FRC A;  1X0R A;  1EV9 A;  2VCX A;  4MZW A;  3ZYW A;  4WBJ A;  2K9F A;  5F05 A;  1WRY A;  2ES7 A;  1MEK A;  4POB A;  2A2S A;  1TDI A;  1JZW A;  3I69 A;  1F3A A;  3IC8 A;  4IS0 A;  5AGY A;  4CHS A;  3TDG A;  2VIM A;  4DSR A;  2VM1 A;  2C3T A;  3WT2 A;  4D73 B;  4BVX A;  1K0M A;  5CRW A;  5ECS A;  4F03 A;  5D9V A;  1M9B A;  4JR6 A;  3DKS A;  2VL2 C;  4KUN A;  3HD5 A;  1GNE A;  3GL3 A;  1M0U A;  5DAL B;  1YF1 A;  1QXH A;  2VL9 A;  4HZ2 A;  1UVZ A;  2X49 A;  2IN3 A;  1XWK A;  3F63 A;  3GIX A;  1TKD B;  5D9X A;  10GS A;  1DSB A;  4HSC X;  3L78 A;  1GSY A;  1GSE A;  3FY7 A;  4K1F A;  5A4W A;  4K2X A;  1AXD A;  3KMO A;  3FMW A;  1IYH A;  3RDW A;  1XW6 A;  2GT5 A;  4TR3 A;  2PVO C;  2C3Q A;  4MH3 A;  3TKS A;  4NHZ A;  8GSS A;  2VCT A;  1ZZY A;  1B4Q A;  4IN0 A;  1FW1 A;  1QUW A;  1FVJ A;  1S3C A;  4XS6 A;  4Z2U A;  4MMM A;  1U88 A;  1H75 A;  1TI3 A;  4MF5 A;  2DJ0 A;  2YWI A;  2I3Y A;  3C1S A;  3HY2 A;  3F0I A;  1ON4 A;  3SWL A;  2H1D A;  2JZT A;  3GFK A;  2CAI A;  3TOT A;  4PTS A;  4MNN A;  6GST A;  1GLP A;  5CRE A;  2EC4 A;  2TRX A;  6GSU A;  4LL4 B;  2LKU A;  1NM3 A;  1A8Y A;  4MPF A;  4PQH A;  4IBP A;  3JCM L;  5ECK B;  2YNX A;  3HVV A;  2DC5 A;  3IC4 A;  4IGJ A;  3FEU A;  1PX7 A;  3HVN A;  5EL8 A;  1WPI A;  2HZE A;  2B6M A;  1UA5 A;  1X5E A;  2F9S A;  2EIO A;  2HXK A;  5ECM B;  3MSZ A;  2QA2 A;  1S3D A;  16GS A;  1OYJ A;  3BBY A;  4I2U A;  3U5R E;  1WP0 A;  4TR1 B;  4LA1 A;  1NHY A;  1K3O A;  4KX4 A;  5F06 A;  1M2A A;  3BCK A;  4Z7X A;  2O89 A;  1O7U A;  2VD1 A;  1XCC A;  3HZ8 A;  2IJY A;  3UIW A;  3C7M A;  1OKT A;  3ZRD A;  4ML1 A;  2PU9 C;  3A5I A;  5ECH B;  2VCQ A;  3EPT A;  4FH8 A;  1X5D A;  4V2L A;  3WGD A;  4K8M A;  3GMF A;  3A2V A;  4WEY A;  4DSS B;  2L6C A;  1T1V A;  2ON7 A;  2NBS A;  1DBY A;  1B48 A;  1OC9 A;  3E9J B;  1R5A A;  3EE2 A;  4FYU A;  2V6O A;  1EZK A;  4EDY A;  3A3T A;  2BJX A;  4KSO A;  3TJK A;  1G7E A;  4DEJ A;  4XCS A;  4GQC A;  3DVW A;  2A2P A;  4JZQ A;  2VL2 A;  3LJR A;  1TK8 B;  4GF0 A;  1XOA A;  3FZ4 A;  4IHU A;  2C4J A;  3D0Z A;  2KLX A;  2GSQ A;  2FHE A;  1IYI A;  4YAV A;  2LUS A;  4HU9 A;  4IQ1 A;  2MZC A;  1CQG A;  2MBS A;  1BYE A;  2GZZ A;  4MZB A;  5EY6 A;  1T3B A;  4PXO A;  3CQF A;  4MAB A;  2IMD A;  1ZL9 A;  3GV1 A;  4KDX A;  2YZH A;  5HR1 A;  3UBL A;  4CY8 A;  1GH2 A;  4XHM A;  1QK8 A;  2B1L A;  1BJX A;  4YH2 A;  4BPY A;  3UL3 A;  3IRA A;  4GTU A;  1SK2 A;  1K3Y A;  11GS A;  2G0F A;  1V57 A;  3E0U A;  1N8J A;  2LJA A;  4NWY A;  3GHA A;  1GUL A;  4QQ7 A;  3CTG A;  4FIW A;  2H73 A;  5LD0 A;  4AF2 A;  3H4K A;  4EVM A;  2CZ2 A;  3GTU B;  1B9Y C;  1Z5Y E;  5B8A A;  2WDU A;  5HFK A;  9GSS A;  1M2B A;  1SL2 B;  4KGI A;  3QDN A;  3RPP A;  2G2Q A;  5HFI A;  3ZZX A;  2C0G A;  3M3M A;  3O6T A;  4PUR A;  5IOW A;  3A2X A;  1LU4 A;  1M2D A;  3TGZ A;  2P5R A;  1K3L A;  2TIR A;  1GSS A;  2M80 A;  2OJL A;  4OCF A;  3UJ1 A;  5F0G A;  3HCZ A;  4KA0 A;  1SU9 A;  1GTI A;  3VUR A;  2JSY A;  1HD2 A;  5DJL A;  4ULX A;  5IPG A;  3F3Q A;  2AHE A;  3EIN A;  2LRT A;  3D21 A;  4L5L A;  3A5W A;  1YJ6 A;  1GSU A;  1TP9 A;  5D73 A;  2OBI A;  1PD2 1;  3M9K A;  3F4T A;  3IBH A;  3PH9 A;  4TN8 A;  2H70 A;  3EMX A;  2H30 A;  1EEJ A;  3TOU A;  1W89 A;  1TXX A;  2GT6 A;  4EO3 A;  5H5Q A;  1GUM A;  4BVY B;  3ZMK A;  1YKA A;  2LNS A;  1X9S B;  2HFD A;  2QC7 A;  2DML A;  4ZL7 A;  4WET A;  2H6Y A;  4V1A g;  4JRR A;  1ML6 A;  1KNG A;  3FYG A;  3HYP A;  3KEB A;  3PIN A;  5CP1 A;  4PGT A;  5FHI A;  1FAA A;  5AIX A;  1SKW B;  1WMJ A;  3EYT A;  2LTK A;  4NV5 A;  3D4T A;  2YWO A;  2AUV A;  2B7J A;  3M8N A;  3VWV A;  2O85 A;  4XRD A;  2IWT A;  2RLI A;  3M1G A;  1A24 A;  1C72 A;  3R2Q A;  4MDC A;  1K0D A;  4G0I A;  4HJM A;  2RM6 A;  2KHP A;  2V6K A;  3M9J A;  1XW9 A;  2IME A;  1PGT A;  3C8E A;  2IMI A;  1DE2 A;  1CQH A;  1A0R P;  3CSH A;  5HFG A;  4OWY A;  1Q4J A;  4Q5Q A;  1SL0 B;  3I6A A;  2HSY A;  1OE7 A;  2X8G A;  2IL3 A;  2JZR A;  2ZNM A;  2GQM A;  3EMP A;  2YPM A;  2M46 A;  1MTC A;  3IHQ A;  1GTA A;  2F8F A;  3G7I A;  2HT9 A;  1V40 A;  2DKH A;  4OO4 A;  2FA4 A;  1YF0 A;  3VWU A;  3QAG A;  3GH6 A;  4CW9 A;  2MYG A;  4PQ1 A;  3QFB C;  3TRP A;  19GS A;  1VF4 A;  2WGR A;  3FZ9 A;  4I97 A;  2B5X A;  3ISO A;  1HNC A;  3P2A A;  3F4S A;  1E2Y A;  3DYR A;  3F6F A;  2N5F A;  3WD6 A;  3KP8 A;  3FZ5 A;  2JZS A;  1XXU A;  5A4U A;  2HRA A;  4CDO A;  4MK3 A;  2IIY A;  1A2J A;  5GAP D;  4GST A;  3IHG A;  4GXZ A;  6GSY A;  1VF2 A;  3AY8 A;  4ECI A;  4L5O A;  2WZ9 A;  2N5B A;  4MZC A;  4ID0 A;  5ECP B;  3GST A;  5B6M A;  2C80 A;  2P0G A;  2KOK A;  1TU8 A;  4XS4 B;  1JZO A;  3D5J A;  2FWE A;  2IMK A;  1J9B A;  4BL7 B;  5GST A;  2P5Q A;  4XIH A;  1U87 A;  2E2G A;  4P3Y B;  4TOP A;  2QSI A;  2HRK A;  5IMC A;  1VF1 A;  3GRX A;  3C1R A;  3IK7 A;  3KH9 A;  2DBC A;  1B4P A;  2WB9 A;  5DQS A;  2X8H A;  2XHF A;  2LQQ A;  4HDE A;  3L9V A;  3N5O A;  3ZIJ A;  5ABR A;  2OE1 A;  2HRF A;  1R26 A;  3UAR A;  4IVF A;  5ECN B;  1TI1 A;  3O3T A;  1K0N A;  4Q5F A;  1GP1 A;  5IMD A;  4KB3 A;  1TRS A;  4OFM A;  1MDI A;  3VI7 A;  2H1B A;  4MF6 A;  3TKQ A;  5KN3 A;  3J7Y b;  4KF9 A;  4ECC A;  5DAK A;  5CYY A;  4G2E A;  2PGT A;  4ZXG A;  2L5L A;  2A2R A;  2IFQ B;  1HNA A;  1XIY A;  4X4J A;  4IJ3 A;  4USS A;  2CVD A;  3LEF A;  1KTE A;  1PN0 A;  4HQS A;  3HJM A;  2VCW A;  1F37 A;  2JAD A;  2V32 A;  1GSQ A;  4K7O A;  1TW9 A;  1V9W A;  2GDR A;  5D8I A;  4YQM A;  4MCU A;  5B8B A;  3DD3 A;  1VF3 A;  4RI7 A;  4V2N A;  3GUR A;  2NVL A;  3APO A;  4GCI A;  4ZB8 A;  1ABA A;  3KTB A;  5DVB A;  2R6K A;  5ID2 A;  2X64 A;  4G0L A;  1QFN A;  3ERF A;  1NSW A;  5FWG A;  2VLT A;  3TRX A;  2HYX A;  4WBR D;  1EOG A;  3H1N A;  1WJK A;  3M0F A;  4ILF A;  2H8L A;  1EV4 A;  2WFC A;  2CX3 A;  4MA9 A;  3QAV A;  4I2T A;  3CSJ A;  5A5K A;  4K6X A;  4EE0 A;  2H6X A;  2LQO A;  3QD9 A;  3IPZ A;  4TRX A;  3C73 A;  3D4M A;  1VRS D;  3F4R A;  1U3I A;  3A2W A;  3ED3 A;  3PGT A;  5AIV A;  2LJK A;  3QR6 A;  5JWO B;  1OC3 A;  1GSD A;  4ZL8 A;  1W4V A;  5B7C A;  4G19 A;  4XS1 A;  4BIK A;  2PMT A;  4F0B A;  2YN1 A;  3HVX A;  3LYP A;  4K0G A;  3LG6 A;  2CZ3 A;  4O5Q A;  5D96 A;  1RQM A;  1M99 A;  4KE3 A;  1SK0 A;  3FR6 A;  3DRN A;  3ZLP A;  1AC1 A;  1EOH A;  2REM A;  3TKP A;  2H1G A;  5CRD A;  4E8E A;  2XBQ A;  1USB A;  2DSA A;  3NIV A;  4O32 A;  1FB6 A;  5GAN D;  6GSV A;  4XRA A;  4KSM A;  3ZML A;  2VM2 A;  3LW9 A;  3LXT A;  5EPF A;  2JSZ A;  2LV3 A;  1N2A A;  3E3E A;  4K9Z A;  1FVK A;  5J9B A;  3HKR A;  7GSS A;  2R37 A;  2LEG A;  4OFT A;  1X5C A;  4H86 A;  3GN3 A;  1BED A;  2HNL A;  5DCG A;  2MMA A;  3EC3 A;  4JU5 A;  2YWM A;  3RHC A;  4PUA A;  5AN1 A;  3ERG A;  4NXI A;  2CT6 A;  4F2I A;  1A2M A;  4TXO A;  4GWR A;  4BVX B;  2VD0 A;  4PQI A;  1GTB A;  3FKF A;  5AIS A;  4EC0 A;  4J56 E;  4YQV A;  1XZO A;  4IP6 A;  3J7Y k;  1O85 A;  3KXO A;  4G9H A;  1THO A;  1Y25 A;  4I5Q A;  2GQK A;  2C0F A;  1XFL A;  3BD2 A;  3PR8 A;  5KEJ A;  2EIR A;  4IW9 A;  4N0V A;  5B6N A;  14GS A;  1PKZ A;  1JLW A;  3DGQ A;  2GLR A;  3TJF A;  1V58 A;  5COH A;  2GVP A;  3GKK A;  3MIX A;  1AQX A;  1EP8 A;  2HZF A;  4WF5 A;  1A23 A;  2FY6 A;  4TR0 A;  2WS2 A;  1O8W A;  1AIU A;  1YEX A;  2VO4 A;  2ZUP A;  4RI6 A;  1A2L A;  4WKW A;  2WJU A;  2YJH A;  4EKZ A;  2CA8 A;  3F8U A;  4F0C A;  2A4V A;  3CRU A;  4FYC A;  3GKN A;  1XWG A;  3DVX A;  4PNF A;  2BMX A;  4OO5 A;  5KOX A;  5D9W A;  2GGT A;  2XPD A;  5IMV A;  1FB0 A;  5KN2 A;  4HOJ A;  4MJB A;  1WIK A;  3I43 A;  1MD3 A;  2OAD A;  4Q5N A;  3IAM 2;  5DCH A;  4J2F A;  1RW1 A;  3IE3 A;  1R5P A;  5G30 A;  5IM9 A;  2HZE B;  2H6Z A;  4N0Z A;  2OAC A;  2V2G A;  2AV4 A;  4YKF A;  5IMA A;  5IOX A;  2RM5 A;  4ZIL A;  5IO0 A;  2B1K A;  5G1K A;  1ZGN A;  3H79 A;  3MNG A;  3VLN A;  2FGX A;  1A0F A;  4ISD A;  3VK9 A;  2C0E A;  1SKS B;  2DLX A;  4GSN A;  4X1U A;  5BMU A;  3W8S A;  3FR3 A;  3QOU A;  5G5E A;  2NDO A;  2BTO T;  5IPH A;  5ECQ B;  3WGX A;  2K6V A;  1PFO A;  2GZY A;  2GSS A;  3UVT A;  2PUK C;  4EIQ A;  1NW2 A;  3KD0 A;  2HE3 A;  3C71 A;  2R0C A;  3IK9 A;  3ZIV A;  4K7I A;  2HSM A;  3I9V 2;  1B9X C;  4TVE A;  2E7P A;  1FO5 A;  2H0I A;  4ZB9 A;  3L4N A;  4G10 A;  5KOW A;  2V41 A;  1QMV A;  4TW5 A;  4NAX A;  5IMZ A;  1QGV A;  3FK8 A;  1OC9 B;  2DJ1 A;  4EUY A;  1JZD A;  2YWN A;  1HQO A;  1Z9H A;  1YDK A;  3NOF A;  1TK0 B;  3L0H A;  4Z2T A;  1XVQ A;  5EVO A;  1PN9 A;  2DIY A;  2M72 A;  2NTO A;  2DJK A;  3EUR A;  2JU5 A;  1AAZ A;  4BA7 A;  3KZQ A;  2VLV A;  1M3J A;  3DXB A;  2QGV A;  2JL4 A;  2HSH A;  2GSR A;  4KCA A;  2GTU A;  2IPA A;  2YCD A;  3GSS A;  5J5N A;  3LGC A;  3GYK A;  3K8N A;  1KBN A;  4XTS A;  5D93 A;  2QA1 A;  1A8L A;  3FR9 A;  3KM6 A;  4J57 E;  3RHB A;  3QCP A;  4JBB A;  4YKG A;  2N5A A;  4MP4 A;  3Q18 A;  3ERW A;  5G1L A;  4L0W A;  3LQ7 A;  2O87 A;  1ZMA A;  4D73 A;  1E6B A;  4JE1 A;  4X43 A;  1M3I A;  4ZBB A;  1BQ7 A;  2NPB A;  4LLR A;  2WUL A;  4HZ4 A;  5E59 A;  3IV4 A;  4PNG A;  1GLQ A;  1XBS A;  2KUC A;  1EGO A;  1PL2 A;  3TRQ A;  3APQ A;  4V2M A;  5DAL A;  2HLS A;  1M7T A;  3D22 A;  5KN1 A;  2VCV A;  4RQX A;  5FT3 A;  3GA4 A;  2YP6 A;  2H01 A;  12GS A;  3G9B A;  3IXR A;  3GUS A;  1BG5 A;  1XG8 A;  3QPM A;  1X9W B;  4O92 A;  4I8B A;  5D9T A;  3VWW A;  3DWV A;  4POM A;  4POL A;  3KP9 A;  4E8H A;  5C00 A;  1OC8 A;  1Y6E A;  1GSF A;  2H71 A;  1EWX A;  4HEA 2;  4OFN A;  2DJJ A;  5LNK e;  3HJP A;  1GUK A;  1ZYN A;  1M9A A;  2TRC P;  1R4W A;  2V1M A;  5CRG A;  4GLT A;  3TKS E;  3US3 A;  2L59 A;  3ME7 A;  1XWC A;  3QMX A;  3S9F A;  3ZVJ A;  1SKR B;  1LJR A;  5JCU A;  3IDV A;  1G6Y A;  1V2A A;  2ZCT A;  2B7K A;  3P7X A;  3CSI A;  2FA8 A;  2XPE A; 
#chains in the Genus database with same CATH homology
 5JCW A;  2P31 A;  2K8S A;  2L57 A;  5F8B A;  4EDZ A;  4EF0 A;  2B5Y A;  4F82 A;  1PL1 A;  2OKA A;  4Z2R A;  2RII A;  6GSS A;  3KJY A;  5LCZ A;  3HDC A;  1O6J A;  1DUG A;  2FUG 2;  4OCE A;  4QL9 A;  4O5U A;  3QAW A;  4POK A;  3CTF A;  2AJQ B;  3MDK A;  2LST A;  3PPU A;  1JHB A;  4K0N A;  4K7N A;  1TJD A;  1Z7R A;  1TK5 B;  4N30 A;  1WWJ A;  2DJ2 A;  1F6M C;  2L5O A;  2FLS A;  3MAK A;  1YQ1 A;  5H5R A;  3OR5 A;  1ZCP A;  4TR1 A;  3MYD A;  4BWQ A;  3CBU A;  1TRW A;  1I5G A;  4KND A;  1ERW A;  3UOM A;  4WR4 A;  1PKW A;  5C04 A;  1TOF A;  5G31 A;  5KN0 A;  2H66 A;  3CYN A;  2X8C A;  3HXS A;  2YZU A;  4NHW A;  2H0H A;  1VGL A;  4N11 A;  4ECB A;  4HU7 A;  1SK1 A;  1TTZ A;  2CAQ A;  1XPV A;  18GS A;  1GRX A;  1SJ6 A;  2I4A A;  5E4W A;  4DSS A;  1ILO A;  1OAZ A;  1G6W A;  3WYW A;  3IA1 A;  3H8Q A;  3VPQ A;  2KP2 A;  3KH7 A;  4F9Z A;  2C3N A;  3DEX A;  2F3M A;  1T00 A;  1U3A A;  3VI5 A;  1FG4 A;  1O81 A;  2GS3 A;  2H75 A;  2L4Q A;  5ENU A;  4L8E A;  4GQF A;  1HNB A;  4EXJ A;  1MDJ A;  3TCO A;  5DQY A;  4YAP A;  2K8V A;  13GS A;  5ELA A;  4ML6 A;  2UZ8 A;  2PPT A;  1MD4 A;  1XVW A;  2CQ9 A;  5CRH A;  4DSQ A;  1MDK A;  1LBK A;  4MPG A;  5GZZ B;  3ZVJ D;  6GSW A;  3W8J A;  2LRC A;  1AW9 A;  1K0A A;  1GNW A;  3HZ4 A;  4KW6 A;  3UBK A;  2FCH A;  3W6G A;  1F3B A;  5CO3 A;  2X4A A;  4NV2 A;  5GSS A;  4PX1 A;  1GL8 A;  5JWR B;  1YEP A;  4ZB6 A;  4OMV A;  4FYB A;  4RQR A;  3R3E A;  4HS1 A;  2L6D A;  2K18 A;  3G7Y A;  5IO2 A;  3TKR A;  2H72 A;  1Z6M A;  1X9M B;  2VAF A;  3KCM A;  3UMA A;  4ZIJ A;  2R0G A;  2MMZ A;  3CMI A;  2GST A;  3Q19 A;  1BX9 A;  4FQU A;  4IEL A;  1HYU A;  2OA7 A;  4N10 A;  1TRU A;  4CY6 A;  3GKX A;  3GTU A;  5HR0 A;  5J3R A;  5JCG A;  3H93 A;  1BAY A;  2CV4 A;  2B3S A;  4K5S A;  5HR3 A;  3U6V A;  2LNT A;  4MH2 A;  1URM A;  2JAC A;  4RUV A;  3VFI A;  5HR2 A;  3RBT A;  1ERU A;  3GH9 A;  1JLV A;  5DAK B;  3EU3 A;  1PQN A;  3WT1 A;  3BJ5 A;  4KDY A;  4K5R A;  4ZBA A;  2DKI A;  1KEB A;  2I81 A;  3DML A;  2VL3 A;  1AQV A;  4GRF A;  1RK4 A;  1O73 A;  4Q5R A;  2WRT A;  3HJO A;  3HVS A;  1F9M A;  3RAZ A;  4AGS A;  3VPT A;  4MJE A;  4KDU A;  3GX0 A;  2YOI A;  3LSZ A;  4AJ6 A;  2RUE A;  1B8X A;  4G0K A;  1GUH A;  2VUP A;  5JWQ B;  3EWL A;  2PBJ A;  2OE3 A;  2H1A A;  3ZTL A;  3LYK A;  1H4O A;  2H0G A;  5ID2 B;  4BVY A;  1SD9 A;  2PN8 A;  1EP7 A;  2OE0 A;  2A4H A;  4YQU A;  3UAP A;  1UC7 A;  2E0Q A;  2VCZ A;  4KCE A;  3UEM A;  4V1A p;  4ECJ A;  5J9C A;  3KTL A;  3TB2 A;  5L71 A;  5ECL B;  3BOA A;  5IIZ A;  4X0X A;  2J9H A;  2H19 A;  2YAN A;  2B5E A;  1EGR A;  1OVN A;  5DDL A;  1XWB A;  2MMN A;  2R5G A;  2I1U A;  1T7P B;  4EL1 A;  2YV7 A;  5J4U A;  1AQW A;  2DIZ A;  1JFU A;  2DMM A;  2R2J A;  4LMW A;  1Q98 A;  3SBC A;  2H76 A;  2D2Z A;  2MMO A;  3ZL5 A;  1SL1 B;  4NPB A;  1PMT A;  2ALB A;  4HJ2 A;  2PER A;  3LOR A;  4AJ8 A;  1QQ2 A;  4HI7 A;  2GQL A;  4JED A;  2C0D A;  4LL1 B;  4KH7 A;  2EIQ A;  4OD7 A;  1G0T A;  1Z6N A;  3HHV A;  2O8V B;  1AUC A;  4KAE A;  2LS5 A;  1DE1 A;  2LJR A;  4FO5 A;  3L9S A;  4HQZ A;  3TJB A;  1Z3E A;  2LRN A;  4ZL9 A;  5H5S A;  5F07 A;  4K2D A;  4EIP A;  3ZFL A;  1K0B A;  2VOC A;  1EEM A;  3Q6O A;  1SJI A;  2GZP A;  4IP1 A;  3RPN A;  4TXO B;  5ELG A;  5G2Z A;  1K0C A;  2RUF A;  2ON5 A;  3UVH A;  4ICY A;  4NMU A;  2FWH A;  3ZIT A;  2E2M A;  2FD3 A;  3LXZ A;  1GWC A;  2R0P A;  1ST9 A;  3QFA C;  1V98 A;  4ACS A;  1WE0 A;  3ZRE A;  1OKD A;  4O7H A;  3TUE A;  3EVI A;  4XS4 A;  3NZN A;  1I9D A;  3O76 A;  4BL7 A;  1PA3 A;  3F6D A;  2DJ3 A;  3KMN A;  1T8E B;  1F2E A;  3FHK A;  4PUF C;  1XOB A;  2J23 A;  1U6T A;  2OBK A;  5BRT A;  1PRX A;  1SYR A;  3D6I A;  1YKC A;  2YV9 A;  2F8A A;  1TU7 A;  2VLU A;  4GSS A;  3GL5 A;  4AJ7 A;  3Q74 A;  5CNW A;  5IQY A;  3IOS A;  3WGE A;  17GS A;  2AAW A;  4IKH A;  3P8W A;  2YJ7 A;  4IJI A;  1K0O A;  3CXG A;  1FHE A;  1XW5 A;  2IFQ A;  4MJA A;  3LFL A;  3KIJ A;  3ZFB A;  4JR4 A;  3GX8 A;  1ZOF A;  1SEN A;  2CVK A;  5G5F A;  4IQA A;  2H74 A;  22GS A;  2AYT A;  2FNO A;  1XWA A;  3P90 A;  4MJC A;  3IAS 2;  3MWH A;  3TKS C;  2PVQ A;  5IMF A;  2L4C A;  3LWA A;  4LMV A;  3F3R A;  2CX4 A;  3FW2 A;  2FWF A;  3APS A;  1WOU A;  4TXV A;  5ECO B;  5A4V A;  3TJG A;  5ECI B;  4DVC A;  5INY A;  3FZA A;  1T4Z A;  6GSX A;  4MF7 A;  5DJM A;  4A5P A;  1TRV A;  2R3X A;  1ZYP A;  2WCI A;  1J08 A;  1NHO A;  1YY7 A;  1YZX A;  2XC2 A;  2IMF A;  2MBT A;  1ZYQ B;  4ZBD A;  1S3A A;  3L9U A;  1GTU A;  4L0U A;  4O5R A;  3ME8 A;  2XBI A;  3DIE A;  1FOV A;  1J0F A;  1SYX A;  4MLY A;  1G7O A;  4HUA A;  5CAX A;  4WR5 A;  3VWX A;  2X99 A;  4BWS A;  2FWG A;  2R4V A;  1FOH A;  3N9J A;  4TKY A;  1Z7P A;  1R7H A;  2HRN A;  2QKE A;  1PSQ A;  5J41 A;  20GS A;  3G7J A;  1O8X A;  1ERV A;  1ZYE A;  4WXT A;  2PWJ A;  3F9U A;  2F51 A;  2C1Y A;  2KP1 A;  4I6X A;  1T4Y A;  3HA9 A;  1PX6 A;  1ACV A;  2I9H A;  3IR4 A;  3KGK A;  2O7K A;  3GNJ A;  1SD8 A;  3BCI A;  3V1W A;  2CVB A;  3GKM A;  1ERT A;  5ECR B;  4QL7 A;  2HI7 A;  4TR4 A;  4WF4 A;  1OE8 A;  2AB6 A;  1JZR A;  2Z9S A;  1UN2 A;  3CRT A;  2C8U A;  5HQP A;  3EU4 A;  1THX A;  1SJZ A;  3TJJ A;  5DBQ A;  3FRC A;  1X0R A;  1EV9 A;  2VCX A;  4MZW A;  3ZYW A;  4WBJ A;  2K9F A;  5F05 A;  1WRY A;  2ES7 A;  1MEK A;  4POB A;  2A2S A;  1TDI A;  1JZW A;  3I69 A;  1F3A A;  3IC8 A;  4IS0 A;  5AGY A;  4CHS A;  3TDG A;  2VIM A;  4DSR A;  2VM1 A;  2C3T A;  3WT2 A;  4D73 B;  4BVX A;  1K0M A;  5CRW A;  5ECS A;  4F03 A;  5D9V A;  1M9B A;  4JR6 A;  3DKS A;  2VL2 C;  4KUN A;  3HD5 A;  1GNE A;  3GL3 A;  1M0U A;  5DAL B;  1YF1 A;  1QXH A;  2VL9 A;  4HZ2 A;  1UVZ A;  2X49 A;  2IN3 A;  1XWK A;  3F63 A;  3GIX A;  1TKD B;  5D9X A;  10GS A;  1DSB A;  3L78 A;  1GSY A;  1GSE A;  3FY7 A;  4K1F A;  5A4W A;  4K2X A;  1AXD A;  3KMO A;  3FMW A;  1IYH A;  3RDW A;  1XW6 A;  2GT5 A;  4TR3 A;  2PVO C;  2C3Q A;  4MH3 A;  3TKS A;  4NHZ A;  8GSS A;  2VCT A;  1ZZY A;  1B4Q A;  4IN0 A;  1FW1 A;  1QUW A;  1FVJ A;  1S3C A;  4XS6 A;  4Z2U A;  4MMM A;  1U88 A;  1H75 A;  1TI3 A;  4MF5 A;  2DJ0 A;  2YWI A;  2I3Y A;  3C1S A;  3HY2 A;  3F0I A;  1ON4 A;  3SWL A;  2H1D A;  2JZT A;  3GFK A;  2CAI A;  3TOT A;  4PTS A;  4MNN A;  6GST A;  1GLP A;  5CRE A;  2EC4 A;  2TRX A;  6GSU A;  4LL4 B;  2LKU A;  1NM3 A;  1A8Y A;  4MPF A;  4PQH A;  4IBP A;  3JCM L;  5ECK B;  2YNX A;  3HVV A;  2DC5 A;  3IC4 A;  4IGJ A;  3FEU A;  1PX7 A;  5EL8 A;  1WPI A;  2HZE A;  2B6M A;  1UA5 A;  1X5E A;  2F9S A;  2EIO A;  2HXK A;  5ECM B;  3MSZ A;  2QA2 A;  1S3D A;  16GS A;  1OYJ A;  3BBY A;  4I2U A;  3U5R E;  1WP0 A;  4TR1 B;  4LA1 A;  1NHY A;  1K3O A;  4KX4 A;  5F06 A;  1M2A A;  3BCK A;  4Z7X A;  2O89 A;  1O7U A;  2VD1 A;  1XCC A;  3HZ8 A;  2IJY A;  3UIW A;  3C7M A;  1OKT A;  3ZRD A;  4ML1 A;  2PU9 C;  3A5I A;  5ECH B;  2VCQ A;  3EPT A;  4FH8 A;  1X5D A;  4V2L A;  3WGD A;  4K8M A;  3GMF A;  3A2V A;  4WEY A;  4DSS B;  2L6C A;  1T1V A;  2ON7 A;  2NBS A;  1DBY A;  1B48 A;  1OC9 A;  3E9J B;  1R5A A;  3EE2 A;  4FYU A;  2V6O A;  1EZK A;  4EDY A;  3A3T A;  2BJX A;  4KSO A;  3TJK A;  1G7E A;  4DEJ A;  4XCS A;  4GQC A;  3DVW A;  2A2P A;  4JZQ A;  2VL2 A;  3LJR A;  1TK8 B;  4GF0 A;  1XOA A;  3FZ4 A;  4IHU A;  2C4J A;  3D0Z A;  2KLX A;  2GSQ A;  2FHE A;  1IYI A;  4YAV A;  2LUS A;  4HU9 A;  4IQ1 A;  2MZC A;  1CQG A;  2MBS A;  1BYE A;  2GZZ A;  4MZB A;  5EY6 A;  1T3B A;  4PXO A;  4MAB A;  2IMD A;  1ZL9 A;  3GV1 A;  4KDX A;  2YZH A;  5HR1 A;  3UBL A;  4CY8 A;  1GH2 A;  4XHM A;  1QK8 A;  2B1L A;  1BJX A;  4YH2 A;  4BPY A;  3UL3 A;  3IRA A;  4GTU A;  1SK2 A;  1K3Y A;  11GS A;  2G0F A;  1V57 A;  3E0U A;  1N8J A;  2LJA A;  4NWY A;  3GHA A;  1GUL A;  4QQ7 A;  3CTG A;  4FIW A;  2H73 A;  5LD0 A;  4AF2 A;  3H4K A;  4EVM A;  2CZ2 A;  3GTU B;  1B9Y C;  1Z5Y E;  5B8A A;  2WDU A;  5HFK A;  9GSS A;  1M2B A;  1SL2 B;  4KGI A;  3QDN A;  3RPP A;  2G2Q A;  5HFI A;  3ZZX A;  2C0G A;  3M3M A;  3O6T A;  4PUR A;  5IOW A;  3A2X A;  1LU4 A;  1M2D A;  3TGZ A;  2P5R A;  1K3L A;  2TIR A;  1GSS A;  2M80 A;  2OJL A;  4OCF A;  3UJ1 A;  5F0G A;  3HCZ A;  4KA0 A;  1SU9 A;  1GTI A;  3VUR A;  2JSY A;  1HD2 A;  5DJL A;  4ULX A;  5IPG A;  3F3Q A;  2AHE A;  3EIN A;  2LRT A;  3D21 A;  4L5L A;  3A5W A;  1YJ6 A;  1GSU A;  1TP9 A;  5D73 A;  2OBI A;  1PD2 1;  3M9K A;  3F4T A;  3IBH A;  3PH9 A;  4TN8 A;  2H70 A;  3EMX A;  2H30 A;  1EEJ A;  3TOU A;  1W89 A;  1TXX A;  2GT6 A;  4EO3 A;  5H5Q A;  1GUM A;  4BVY B;  3ZMK A;  1YKA A;  2LNS A;  1X9S B;  2HFD A;  2QC7 A;  2DML A;  4ZL7 A;  4WET A;  2H6Y A;  4V1A g;  4JRR A;  1ML6 A;  1KNG A;  3FYG A;  3HYP A;  3KEB A;  3PIN A;  5CP1 A;  4PGT A;  5FHI A;  1FAA A;  5AIX A;  1SKW B;  1WMJ A;  3EYT A;  2LTK A;  4NV5 A;  3D4T A;  2YWO A;  2AUV A;  2B7J A;  3M8N A;  3VWV A;  2O85 A;  4XRD A;  2IWT A;  2RLI A;  3M1G A;  1A24 A;  1C72 A;  3R2Q A;  4MDC A;  1K0D A;  4G0I A;  4HJM A;  2RM6 A;  2KHP A;  2V6K A;  3M9J A;  1XW9 A;  2IME A;  1PGT A;  3C8E A;  2IMI A;  1DE2 A;  1CQH A;  1A0R P;  3CSH A;  5HFG A;  4OWY A;  1Q4J A;  4Q5Q A;  1SL0 B;  3I6A A;  2HSY A;  1OE7 A;  2X8G A;  2IL3 A;  2JZR A;  2ZNM A;  2GQM A;  3EMP A;  2YPM A;  2M46 A;  1MTC A;  3IHQ A;  1GTA A;  2F8F A;  3G7I A;  2HT9 A;  1V40 A;  2DKH A;  4OO4 A;  2FA4 A;  1YF0 A;  3VWU A;  3QAG A;  3GH6 A;  4CW9 A;  2MYG A;  4PQ1 A;  3QFB C;  3TRP A;  19GS A;  1VF4 A;  2WGR A;  3FZ9 A;  4I97 A;  2B5X A;  3ISO A;  1HNC A;  3P2A A;  3F4S A;  1E2Y A;  3DYR A;  3F6F A;  2N5F A;  3WD6 A;  3KP8 A;  3FZ5 A;  2JZS A;  1XXU A;  5A4U A;  2HRA A;  4CDO A;  4MK3 A;  2IIY A;  1A2J A;  5GAP D;  4GST A;  3IHG A;  4GXZ A;  6GSY A;  1VF2 A;  3AY8 A;  4ECI A;  4L5O A;  2WZ9 A;  2N5B A;  4MZC A;  4ID0 A;  5ECP B;  3GST A;  5B6M A;  2C80 A;  2P0G A;  2KOK A;  1TU8 A;  4XS4 B;  1JZO A;  3D5J A;  2FWE A;  2IMK A;  1J9B A;  4BL7 B;  5GST A;  2P5Q A;  4XIH A;  1U87 A;  2E2G A;  4P3Y B;  4TOP A;  2QSI A;  2HRK A;  5IMC A;  1VF1 A;  3GRX A;  3C1R A;  3IK7 A;  3KH9 A;  2DBC A;  1B4P A;  2WB9 A;  5DQS A;  2X8H A;  2XHF A;  2LQQ A;  4HDE A;  3L9V A;  3N5O A;  3ZIJ A;  5ABR A;  2OE1 A;  2HRF A;  1R26 A;  3UAR A;  4IVF A;  5ECN B;  1TI1 A;  3O3T A;  1K0N A;  4Q5F A;  1GP1 A;  5IMD A;  4KB3 A;  1TRS A;  4OFM A;  1MDI A;  3VI7 A;  2H1B A;  4MF6 A;  3TKQ A;  5KN3 A;  3J7Y b;  4KF9 A;  4ECC A;  5DAK A;  5CYY A;  4G2E A;  2PGT A;  4ZXG A;  2L5L A;  2A2R A;  2IFQ B;  1HNA A;  1XIY A;  4X4J A;  4IJ3 A;  4USS A;  2CVD A;  3LEF A;  1KTE A;  1PN0 A;  4HQS A;  3HJM A;  2VCW A;  1F37 A;  2JAD A;  2V32 A;  1GSQ A;  4K7O A;  1TW9 A;  1V9W A;  2GDR A;  5D8I A;  4YQM A;  4MCU A;  5B8B A;  3DD3 A;  1VF3 A;  4RI7 A;  4V2N A;  3GUR A;  2NVL A;  3APO A;  4GCI A;  4ZB8 A;  1ABA A;  3KTB A;  5DVB A;  2R6K A;  5ID2 A;  2X64 A;  4G0L A;  1QFN A;  3ERF A;  1NSW A;  5FWG A;  2VLT A;  3TRX A;  2HYX A;  4WBR D;  1EOG A;  3H1N A;  1WJK A;  3M0F A;  4ILF A;  2H8L A;  1EV4 A;  2WFC A;  2CX3 A;  4MA9 A;  3QAV A;  4I2T A;  3CSJ A;  5A5K A;  4K6X A;  4EE0 A;  2H6X A;  2LQO A;  3QD9 A;  3IPZ A;  4TRX A;  3C73 A;  3D4M A;  1VRS D;  3F4R A;  1U3I A;  3A2W A;  3ED3 A;  3PGT A;  5AIV A;  2LJK A;  3QR6 A;  5JWO B;  1OC3 A;  1GSD A;  4ZL8 A;  1W4V A;  5B7C A;  4G19 A;  4XS1 A;  2PMT A;  4F0B A;  2YN1 A;  3HVX A;  3LYP A;  4K0G A;  3LG6 A;  2CZ3 A;  4O5Q A;  5D96 A;  1RQM A;  1M99 A;  4KE3 A;  1SK0 A;  3FR6 A;  3DRN A;  3ZLP A;  1AC1 A;  1EOH A;  2REM A;  3TKP A;  2H1G A;  5CRD A;  4E8E A;  2XBQ A;  1USB A;  2DSA A;  3NIV A;  4O32 A;  1FB6 A;  5GAN D;  6GSV A;  4XRA A;  4KSM A;  3ZML A;  2VM2 A;  3LW9 A;  3LXT A;  5EPF A;  2JSZ A;  2LV3 A;  1N2A A;  3E3E A;  4K9Z A;  1FVK A;  5J9B A;  3HKR A;  7GSS A;  2R37 A;  2LEG A;  4OFT A;  1X5C A;  4H86 A;  3GN3 A;  1BED A;  2HNL A;  5DCG A;  2MMA A;  3EC3 A;  4JU5 A;  2YWM A;  3RHC A;  4PUA A;  5AN1 A;  3ERG A;  4NXI A;  2CT6 A;  4F2I A;  1A2M A;  4TXO A;  4GWR A;  4BVX B;  2VD0 A;  4PQI A;  1GTB A;  3FKF A;  5AIS A;  4EC0 A;  4J56 E;  4YQV A;  1XZO A;  4IP6 A;  3J7Y k;  1O85 A;  3KXO A;  4G9H A;  1THO A;  1Y25 A;  4I5Q A;  2GQK A;  2C0F A;  1XFL A;  3BD2 A;  3PR8 A;  5KEJ A;  2EIR A;  4IW9 A;  4N0V A;  5B6N A;  14GS A;  1PKZ A;  1JLW A;  3DGQ A;  2GLR A;  3TJF A;  1V58 A;  5COH A;  2GVP A;  3GKK A;  3MIX A;  1AQX A;  1EP8 A;  2HZF A;  4WF5 A;  1A23 A;  2FY6 A;  4TR0 A;  2WS2 A;  1O8W A;  1AIU A;  1YEX A;  2VO4 A;  2ZUP A;  4RI6 A;  1A2L A;  4WKW A;  2WJU A;  2YJH A;  4EKZ A;  2CA8 A;  3F8U A;  4F0C A;  2A4V A;  3CRU A;  4FYC A;  3GKN A;  1XWG A;  3DVX A;  4PNF A;  2BMX A;  4OO5 A;  5KOX A;  5D9W A;  2GGT A;  2XPD A;  5IMV A;  1FB0 A;  5KN2 A;  4HOJ A;  4MJB A;  1WIK A;  3I43 A;  1MD3 A;  2OAD A;  4Q5N A;  3IAM 2;  5DCH A;  4J2F A;  1RW1 A;  3IE3 A;  1R5P A;  5G30 A;  5IM9 A;  2HZE B;  2H6Z A;  4N0Z A;  2OAC A;  2V2G A;  2AV4 A;  4YKF A;  5IMA A;  5IOX A;  2RM5 A;  4ZIL A;  5IO0 A;  2B1K A;  5G1K A;  1ZGN A;  3H79 A;  3MNG A;  3VLN A;  2FGX A;  1A0F A;  4ISD A;  3VK9 A;  2C0E A;  1SKS B;  2DLX A;  4GSN A;  4X1U A;  5BMU A;  3W8S A;  3FR3 A;  3QOU A;  5G5E A;  2NDO A;  2BTO T;  5IPH A;  5ECQ B;  3WGX A;  2K6V A;  2GZY A;  2GSS A;  3UVT A;  2PUK C;  4EIQ A;  1NW2 A;  3KD0 A;  2HE3 A;  3C71 A;  2R0C A;  3IK9 A;  3ZIV A;  4K7I A;  2HSM A;  3I9V 2;  1B9X C;  4TVE A;  2E7P A;  1FO5 A;  2H0I A;  4ZB9 A;  3L4N A;  4G10 A;  5KOW A;  2V41 A;  1QMV A;  4TW5 A;  4NAX A;  5IMZ A;  1QGV A;  3FK8 A;  1OC9 B;  2DJ1 A;  4EUY A;  1JZD A;  2YWN A;  1HQO A;  1Z9H A;  1YDK A;  3NOF A;  1TK0 B;  3L0H A;  4Z2T A;  1XVQ A;  5EVO A;  1PN9 A;  2DIY A;  2M72 A;  2NTO A;  2DJK A;  3EUR A;  2JU5 A;  1AAZ A;  4BA7 A;  3KZQ A;  2VLV A;  3DXB A;  2QGV A;  2JL4 A;  2HSH A;  2GSR A;  4KCA A;  2GTU A;  2IPA A;  2YCD A;  3GSS A;  5J5N A;  3LGC A;  3GYK A;  3K8N A;  1KBN A;  4XTS A;  5D93 A;  2QA1 A;  1A8L A;  3FR9 A;  3KM6 A;  4J57 E;  3RHB A;  3QCP A;  4JBB A;  4YKG A;  2N5A A;  4MP4 A;  3Q18 A;  3ERW A;  5G1L A;  4L0W A;  3LQ7 A;  2O87 A;  1ZMA A;  4D73 A;  1E6B A;  4JE1 A;  4X43 A;  4ZBB A;  1BQ7 A;  2NPB A;  4LLR A;  2WUL A;  4HZ4 A;  5E59 A;  3IV4 A;  4PNG A;  1GLQ A;  1XBS A;  2KUC A;  1EGO A;  1PL2 A;  3TRQ A;  3APQ A;  4V2M A;  5DAL A;  2HLS A;  1M7T A;  3D22 A;  5KN1 A;  2VCV A;  4RQX A;  5FT3 A;  3GA4 A;  2YP6 A;  2H01 A;  12GS A;  3G9B A;  3IXR A;  3GUS A;  1BG5 A;  3QPM A;  1X9W B;  4O92 A;  4I8B A;  5D9T A;  3VWW A;  3DWV A;  4POM A;  4POL A;  3KP9 A;  4E8H A;  5C00 A;  1OC8 A;  1Y6E A;  1GSF A;  2H71 A;  1EWX A;  4HEA 2;  4OFN A;  2DJJ A;  5LNK e;  3HJP A;  1GUK A;  1ZYN A;  1M9A A;  2TRC P;  1R4W A;  2V1M A;  5CRG A;  4GLT A;  3TKS E;  3US3 A;  2L59 A;  3ME7 A;  1XWC A;  3QMX A;  3S9F A;  3ZVJ A;  1SKR B;  1LJR A;  5JCU A;  3IDV A;  1G6Y A;  1V2A A;  2ZCT A;  2B7K A;  3P7X A;  3CSI A;  2FA8 A;  2XPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...