3G9BA

Crystal structure of reduced ost6l
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
155
structure length
148
Chain Sequence
IDDILQLKDDTGVITVTADNYPLLSRGVPGYFNILYITMRMSCQLCHDFEKTYHAVADVIRSQAPQSLNLFFTVDVNEVPQLVKDLKLQNVPHLVVYPPAESNKQSQFEWKTSPFYQYSLVPENAENTLQFGDFLAKILNISITVPQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dolichyl-diphosphooligosaccharide-protein glycosyltransferas
publication title Oxidoreductase activity of oligosaccharyltransferase subunits Ost3p and Ost6p defines site-specific glycosylation efficiency.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 42
structure length 148
sequence length 155
ec nomenclature ec 2.4.1.119: Transferred entry: 2.4.99.18.
pdb deposition date 2009-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3g9bA00
3GURA 1J0FA 2FWGA 2HXKA 4HU9A 5HR0A 1FO5A 3GNJA 5D9WA 1HQOA 2LRCA 1T8EB 2B5XA 3E0UA 1TTZA 2IMDA 2GVPA 4KNDA 2O89A 4IQAA 4L5OA 3HDCA 3KIJA 13GSA 4POKA 4PNGA 3SWLA 2LKUA 4GRFA 2IMIA 3LFLA 1F9MA 1OE8A 1THXA 4FIWA 1QQ2A 1X5CA 2XPDA 2V41A 5J3RA 1SL0B 5DCHA 1B9XC 1XWCA 2PN8A 3HZ4A 1GTBA 1M2BA 3LQ7A 1QK8A 2I3YA 3UARA 2TIRA 3ERFA 3DVXA 1BJXA 2H74A 1AC1A 5HR1A 5J4UA 2QGVA 2H73A 4V2LA 2PPTA 1GL8A 5IMDA 5CNWA 2JZSA 4KX4A 3TDGA 17GSA 5IIZA 1G0TA 1QUWA 5CYYA 4WEYA 5DQSA 4MZCA 1EWXA 3P8WA 3TCOA 3TRPA 1YQ1A 4N0VA 2HSHA 1W4VA 1LBKA 1OC8A 4KAEA 1ON4A 1B4QA 2MMZA 3W8SA 4ZB8A 5DQYA 3D0ZA 2H72A 5H5SA 2F3MA 3BCKA 1M2AA 1UVZA 5CRGA 4LL1B 1PD21 2JZTA 1SD8A 1ZOFA 1K3OA 3N9JA 1XVWA 3TJFA 2LEGA 1N2AA 4ZL8A 3GH6A 1E2YA 3WGXA 2VAFA 1OC9B 1V40A 3FHKA 3HXSA 5HR2A 5ID2B 1XVQA 4PXOA 2JU5A 2RM6A 3BCIA 1HYUA 5F06A 3M3MA 3HCZA 3GTUB 1SYXA 2G0FA 1O73A 3RPNA 3KTBA 1MDKA 4YH2A 4DSQA 1A8LA 3RAZA 2C3NA 5A5KA 3J7Yk 1Z5YE 2WGRA 2P0GA 3BOAA 1EEJA 1TXXA 1ILOA 2H6XA 1GSYA 3QDNA 4Q5QA 2RUFA 2HSYA 4YAPA 1I5GA 5FT3A 3UVTA 2IMFA 3ZVJD 4HZ2A 3KD0A 2GT5A 4TW5A 1G7OA 2QSIA 2DBCA 4GWRA 1TU7A 4KB3A 2H71A 5INYA 2BTOT 2OE1A 5CREA 5D9VA 2GZPA 4GSSA 3F3RA 5LD0A 3O6TA 3NIVA 3H1NA 3W8JA 3VPQA 2VL9A 3HKRA 1QGVA 2LV3A 4GQCA 2KOKA 1PKWA 3DD3A 1K0AA 1ZYQB 4YQVA 1GUKA 2L6DA 4CW9A 5C04A 1XPVA 1T3BA 2I1UA 1GSFA 1HNBA 1AQWA 1U3AA 1XOAA 5KN1A 3RHBA 4K6XA 4AJ7A 4BL7A 1GTAA 2PVQA 2YV7A 3HD5A 2HFDA 1VF4A 2DIYA 2FNOA 2O85A 3GKXA 3QAWA 3CRTA 4ZB6A 3LORA 6GSYA 4N0ZA 3KMOA 3TKSA 1AW9A 1RW1A 3O76A 3ZMLA 3S9FA 1UN2A 3C8EA 2PU9C 1T7PB 4NMUA 1SJZA 4N10A 2N5AA 2GGTA 2DJJA 1ST9A 2O8VB 1JZRA 3IC4A 5ELGA 5KN3A 1V9WA 1ML6A 2C0FA 5J9CA 1VF1A 3ZYWA 5G1LA 1USBA 3EVIA 5A4UA 4PGTA 3TRXA 2O7KA 1GUHA 4POBA 2VCZA 5B8BA 2KLXA 1EP8A 3TJJA 3TJBA 3MAKA 2WCIA 1PX7A 1ZL9A 4K0GA 3HJPA 4EXJA 3FEUA 1M99A 2YPMA 4JZQA 3ZITA 1O8XA 5IMFA 3ZLPA 3C73A 4E8EA 4G9HA 1X9MB 1FHEA 2BJXA 4HJMA 3MWHA 4PQIA 5H5QA 5ELAA 5ECQB 2RUEA 16GSA 3I6AA 2PWJA 4ISDA 4LA1A 2ON5A 2LQQA 5GAPD 1YF1A 2P5RA 4OWYA 1K3LA 2WJUA 1CQHA 1W89A 3MSZA 5B7CA 1Z3EA 1MTCA 4TXOB 1URMA 3IXRA 2FA4A 2MMAA 4IJ3A 4Z7XA 2DIZA 20GSA 1GLQA 5J9BA 1B48A 1B8XA 3TUEA 1O85A 2ALBA 3ERWA 1SENA 4MA9A 1O6JA 4DVCA 1HD2A 3ZVJA 2IMKA 4MLYA 2REMA 4OO5A 2I4AA 3L9UA 2X8GA 1PX6A 4ZBDA 2C4JA 1R4WA 2R5GA 3FR3A 2H1AA 1GP1A 4MABA 4EF0A 2YJ7A 1DBYA 2D2ZA 3F6DA 3LEFA 3U5RE 4GTUA 4IBPA 2LJRA 1OE7A 2DJ0A 5DALB 3G7JA 2F8FA 3CTFA 4YQMA 3TKRA 1BQ7A 2HZEA 1ZMAA 4ECBA 3KXOA 2VCQA 1A2JA 1BAYA 1SL2B 5CO3A 3KJYA 2YV9A 2IFQB 5JCGA 1SKSB 2K8SA 3HVSA 2VL2A 5COHA 3UEMA 1YEPA 3LGCA 3F8UA 1A8YA 1MDJA 1ERWA 2E2GA 5HFGA 2M72A 5CP1A 2VL3A 4XTSA 2N5FA 1MD3A 5JWQB 1F3BA 4K7OA 3HVXA 3GIXA 3QFAC 2X99A 4PUFC 2DMMA 2MYGA 3UJ1A 4I8BA 5FWGA 3FW2A 1TRWA 4O5RA 2LJAA 2J23A 1AUCA 3ME7A 1O81A 1SYRA 2GQKA 4D73A 3BBYA 4IHUA 1DUGA 2V6KA 3CTGA 2FUG2 4TR0A 3D5JA 4HOJA 4LMWA 1C72A 3FZAA 3D4TA 3GMFA 2B3SA 3DGQA 3R2QA 2TRCP 2PGTA 1GSUA 5C00A 5CAXA 3IRAA 2I81A 4KDUA 4XS4B 4FH8A 5GZZB 4O92A 2EIQA 2YWIA 4ILFA 3RHCA 1GSSA 5ECPB 5D93A 4IP6A 4CDOA 1M9BA 1CQGA 3G7IA 1SK2A 2A4VA 3IV4A 2M46A 3FR6A 4IELA 4ZXGA 1NHOA 2L5OA 4GLTA 2K9FA 4K7NA 3UBKA 4MJEA 2YANA 1XBSA 4DSSA 3FKFA 1PSQA 2GS3A 1EOGA 1S3AA 1Z9HA 2L57A 7GSSA 4MZBA 2HRFA 1QFNA 1JZDA 2FWHA 3E3EA 1K0MA 2DMLA 4IGJA 2GSQA 3EURA 3TB2A 1GWCA 5F05A 2H75A 3GX8A 1EP7A 3HYPA 1V98A 1XFLA 4XHMA 5D96A 2DJ3A 4N11A 1HNCA 4K7IA 4X1UA 1GTUA 1GSEA 4V2MA 1GULA 1U3IA 2FWEA 1RK4A 3G9BA 1HNAA 2VD0A 1GSQA 1UA5A 5B6MA 2LRNA 1YDKA 1IYHA 2VO4A 1E6BA 4L5LA 1ABAA 5F07A 5IQYA 4AGSA 4WR4A 4EDZA 2XBQA 4RUVA 5E59A 3TRQA 1FOVA 2DC5A 1XCCA 3VI7A 4PQ1A 3GA4A 1TW9A 5JWRB 3F0IA 3DXBA 4XS6A 4HZ4A 3GYKA 1SL1B 3QCPA 2YWNA 5JCUA 3TKSC 1R7HA 3APOA 2IL3A 1T1VA 4I2TA 4GQFA 3VWUA 3LWAA 1JLWA 3J7Yb 6GSVA 2GSRA 5AISA 2O87A 1AXDA 2HRNA 4BVYA 1EV4A 2OKAA 4HU7A 2M80A 1NSWA 5DJLA 3FK8A 3RBTA 1FG4A 1AQVA 1A0FA 1YEXA 2CVKA 3E9JB 2VLTA 3NZNA 2XHFA 3AY8A 2B1LA 5IOXA 3IA1A 1A2LA 3VI5A 3KP8A 3HVVA 3GKNA 4MPGA 4I5QA 4KUNA 3FZ5A 4GSTA 1Z7PA 5HR3A 2C3TA 2IN3A 2F9SA 3UVHA 4MF6A 2CA8A 1GUMA 3KM6A 5KN2A 5JCWA 3V1WA 1EV9A 1FB6A 4V1Ap 4YQUA 2DSAA 4EO3A 4ZL7A 3A5WA 3QMXA 3GL3A 3ZTLA 2VCTA 3C1SA 4MJCA 4ULXA 5IOWA 3A2XA 4TN8A 3F63A 4P3YB 3ZRDA 2N5BA 2LTKA 4XCSA 5B6NA 2LNSA 4HDEA 4OFMA 3VWWA 1GH2A 5ECRB 4YAVA 1G7EA 5FHIA 4RI6A 4FYBA 2PUKC 5ECMB 4GSNA 2E2MA 3ZREA 1G6YA 2HE3A 1J08A 2L59A 4E8HA 1OKTA 1OAZA 5EVOA 3HJMA 1WRYA 2B6MA 2H30A 4PNFA 3APQA 1R26A 22GSA 4I2UA 4MP4A 4ZIJA 1GNEA 1ERTA 4F0CA 3Q74A 2GQLA 4MZWA 1WMJA 3GUSA 3EC3A 5EPFA 2I9HA 1F6MC 6GSSA 2VLVA 3HA9A 1GNWA 5CRHA 1PN9A 4MH3A 2GSTA 3GSTA 3EE2A 5J41A 2X8CA 3PR8A 4JR6A 4TKYA 3G7YA 4NV2A 1V57A 1MEKA 1U87A 1TRUA 3GKMA 1YZXA 1B4PA 1B9YC 2H0HA 4NPBA 4V1Ag 5EL8A 1BX9A 2AYTA 5E4WA 3VWXA 3ZIJA 4J2FA 3WYWA 3WD6A 4O32A 3A2VA 4MF7A 4TXVA 3KMNA 1PL1A 1OC3A 3LG6A 4KA0A 4HS1A 4PURA 2AB6A 4KSOA 2H6YA 1WOUA 2G2QA 4OCEA 1QXHA 5AIXA 4LL4B 4NXIA 2FA8A 5HFIA 5IMCA 5EY6A 5G2ZA 2VUPA 4K9ZA 1Z7RA 1K0OA 4PQHA 1TRVA 1ERUA 4NHWA 2IMEA 5ECOB 1JFUA 1EOHA 1Q98A 2C3QA 1ZZYA 2H0GA 4ID0A 5IMVA 6GSUA 4MCUA 2C0GA 3TOUA 4WF5A 9GSSA 2H66A 3A3TA 2OE0A 2EC4A 4N30A 4PUAA 3FY7A 1ERVA 1IYIA 4G2EA 2ZUPA 2DJ2A 2VM1A 4GXZA 5KEJA 4K1FA 2RM5A 1VF2A 2J9HA 2GLRA 3KP9A 3UMAA 2ON7A 2NPBA 1THOA 4ECCA 5H5RA 2MBTA 2E7PA 1SJIA 4BPYA 3ZZXA 5HFKA 2C0DA 2P5QA 5DAKA 1V58A 3DRNA 4MMMA 2PBJA 4L8EA 1PGTA 3I69A 3TJKA 1ZYEA 3MNGA 1A24A 1XWAA 2IPAA 4K0NA 2H1DA 4ZBAA 2OE3A 4HQSA 1VF3A 2HZEB 2C8UA 1XOBA 1T00A 2AV4A 1AQXA 3LXTA 3CSJA 5F0GA 4WXTA 1XIYA 2WFCA 1XXUA 2V32A 3EU4A 1H4OA 5ECKB 2NBSA 3GRXA 1LJRA 1JZWA 2V1MA 5G31A 3LXZA 3EMPA 1AAZA 1WP0A 1XZOA 3FZ9A 4J56E 2X64A 1O8WA 1TK5B 4BWSA 1VGLA 4ZB9A 4POLA 2P31A 4IS0A 2C80A 4EUYA 2YCDA 4WETA 1SU9A 3APSA 1YY7A 3PINA 2VIMA 2OACA 2VCVA 4O7HA 3W6GA 4D73B 4H86A 5G5FA 2H1GA 3IAS2 3ZFBA 5GSTA 2CAIA 3WT2A 3HZ8A 2CZ3A 1SKWB 4HI7A 3RDWA 2DJ1A 3US3A 2XPEA 2B1KA 4GF0A 5ECNB 4HUAA 4ZILA 5ECHB 1ZGNA 1QMVA 4TR1A 2CX4A 3CBUA 5DBQA 4I6XA 2LSTA 3C71A 3CSHA 5DJMA 2MMNA 1NHYA 5DCGA 1PQNA 2WS2A 3IBHA 1JHBA 3D21A 2GDRA 4KH7A 2KUCA 5AN1A 2IJYA 5B8AA 5ECLB 2KHPA 2JSZA 3L78A 3GSSA 1OKDA 3NOFA 3H79A 5L71A 3KCMA 2L4CA 1SKRB 4DSSB 2IWTA 4CHSA 3F3QA 4IN0A 1PRXA 2JACA 4OCFA 3BD2A 2TRXA 1DE1A 6GSTA 4MDCA 3DMLA 2QC7A 5IPHA 4F0BA 2LS5A 2CZ2A 3GN3A 3P2AA 3P90A 1FVKA 2R6KA 2A2SA 3BJ5A 2KP1A 5LCZA 1O7UA 1EGOA 5AIVA 3F9UA 3UOMA 4X43A 3RPPA 4TVEA 3IOSA 3C1RA 3M9JA 3ZIVA 5ABRA 4DEJA 3IK9A 4KDXA 1JZOA 1WE0A 5D9TA 1FW1A 2IIYA 3UL3A 2YZHA 2YZUA 4EE0A 3IPZA 1TKDB 3ERGA 2AHEA 2GTUA 1BYEA 2V6OA 2H6ZA 3ED3A 1TK0B 4XRDA 3QAGA 1Z6NA 3Q18A 4QL7A 3IR4A 4ZBBA 2H0IA 2X8HA 3KTLA 4JRRA 3FZ4A 3VWVA 4MH2A 1S3CA 4MF5A 3Q19A 2WRTA 3TOTA 4KCEA 3TGZA 4OFTA 3EYTA 2R37A 4Q5NA 2FY6A 2LNTA 2WULA 3WGDA 3IAM2 4X0XA 1SJ6A 3FYGA 2YOIA 4NV5A 4IVFA 4I97A 3DIEA 1XWGA 2FHEA 4XIHA 1PKZA 1J9BA 2GSSA 1M9AA 3ISOA 1KNGA 2BMXA 3HY2A 3D6IA 4FO5A 1TI3A 4KW6A 1TJDA 3D22A 2CAQA 2VM2A 1F37A 4EVMA 4MK3A 3SBCA 5IM9A 1JLVA 1TK8B 1YKAA 4RQXA 1M0UA 1PA3A 1R5PA 3GH9A 4KSMA 2XBIA 1EGRA 2Z9SA 3I9V2 3N5OA 4MJAA 2VCXA 2MZCA 3EU3A 10GSA 4IP1A 1XWBA 3PGTA 2AJQB 3HHVA 1SK1A 2C0EA 4BVXA 2HZFA 2R3XA 1S3DA 4AJ8A 2JZRA 1PL2A 3GHAA 4EDYA 3TKQA 1X5DA 4AF2A 2GZYA 1FAAA 4L0WA 3Q6OA 1WPIA 2KP2A 1OC9A 4Q5RA 4FYCA 4G10A 5ID2A 3D4MA 5J5NA 2L5LA 2R2JA 2H19A 1TOFA 4NAXA 2ES7A 4AJ6A 3GTUA 6GSWA 4KGIA 1NM3A 1U6TA 1WIKA 4LLRA 4OMVA 2FGXA 4PX1A 2CVDA 5LNKe 4Q5FA 3IK7A 2JL4A 2DJKA 2LUSA 4IKHA 4OFNA 4JBBA 4V2NA 2VOCA 4F82A 3CXGA 5ENUA 3GL5A 1X5EA 3VLNA 3L0HA 3DKSA 5G30A 1RQMA 4FYUA 2B5YA 2DLXA 4MJBA 2ZNMA 1Z6MA 3M9KA 1YKCA 1KEBA 4JE1A 4ZL9A 2VL2C 3M8NA 3WGEA 3UBLA 2AAWA 4K2DA 5D8IA 3KH9A 1F3AA 3MDKA 3IDVA 3PH9A 3GFKA 4F03A 1K0DA 5GAND 3QOUA 3JCML 1T4ZA 2YN1A 1LU4A 4EC0A 2GQMA 3I43A 3O3TA 1Y25A 2CQ9A 1A2MA 1SD9A 3ME8A 1YJ6A 1DSBA 4OO4A 5ECIB 2FLSA 3F4TA 3QPMA 3VK9A 4RI7A 2XC2A 1UC7A 3LJRA 2JADA 4JR4A 2E0QA 2VCWA 2FCHA 4OD7A 3EMXA 3VFIA 3M0FA 2L6CA 3DYRA 2MMOA 4WKWA 4F2IA 4JEDA 3QFBC 2FD3A 2YNXA 1ACVA 2PVOC 4EKZA 1XW6A 1GTIA 2AUVA 2WZ9A 4WBRD 1K3YA 1X0RA 1TDIA 2NTOA 3K8NA 2H1BA 1KTEA 2WDUA 3A2WA 4L0UA 4XRAA 3HJOA 2YP6A 3VPTA 3F6FA 2K8VA 4WR5A 1MDIA 2JSYA 5GSSA 1V2AA 3QD9A 4ECJA 2OJLA 4NWYA 2H70A 4HEA2 1VRSD 1GLPA 4BA7A 2CX3A 5JWOB 3ZL5A 2H8LA 1A23A 3UIWA 1K0NA 3OR5A 3FRCA 3TKPA 1M7TA 4MPFA 3F4SA 2NVLA 4WF4A 3KZQA 4G19A 2HT9A 3VURA 4K8MA 2HI7A 3GX0A 2OA7A 1EEMA 4TR3A 2WB9A 4WBJA 4LMVA 1WWJA 3ZFLA 4TRXA 4NHZA 2MBSA 1FB0A 5DAKB 2H01A 1TI1A 4IJIA 4TOPA 2B7KA 19GSA 1YF0A 1K0BA 4TXOA 3H4KA 8GSSA 3UAPA 3TJGA 1A0RP 5IO2A 4XS1A 2VLUA 1GRXA 2EIOA 4RQRA 2C1YA 2V2GA 1XW5A 1M2DA 4IQ1A 2CVBA 4TR4A 1N8JA 2L4QA 1TU8A 4GCIA 1T4YA 3KGKA 2HNLA 11GSA 1Q4JA 2GT6A 3DEXA 2CV4A 2EIRA 4EL1A 2YWOA 5HQPA 5DDLA 2B7JA 1EZKA 5IMZA 1SK0A 5DALA 2HLSA 2VD1A 3KEBA 3TKSE 3CMIA 5KN0A 1X9SB 3L9SA 4KDYA 3DWVA 4QL9A 2IFQA 3C7MA 2R4VA 3GV1A 2FWFA 3DVWA 5IPGA 3QR6A 4JU5A 4ACSA 1U88A 5F8BA 5DVBA 4ECIA 2LJKA 2ZCTA 5AGYA 4KE3A 5A4WA 3IHQA 5D9XA 1DE2A 2GZZA 1X9WB 6GSXA 3H93A 3FR9A 3WT1A 5D73A 1KBNA 3P7XA 1WJKA 4KCAA 1XW9A 3L4NA 3QAVA 3CYNA 5IO0A 2OADA 4TR1B 1OYJA 4HQZA 5A4VA 12GSA 5G1KA 2LQOA 1TP9A 4POMA 3U6VA 2CT6A 2K18A 3IE3A 1FVJA 14GSA 1TRSA 1XWKA 3KH7A 18GSA 3H8QA 2OBIA 3L9VA 2YJHA 4ML1A 2PMTA 2NDOA 3LYPA 2RIIA 2A2RA 3CSIA 4XS4A 5CRWA 4DSRA 4BWQA 3CRUA 2OBKA 2B5EA 1I9DA 2RLIA 3LYKA 5ECSA 1BG5A 1H75A 4J57E 2PERA 1GSDA 2LRTA 3EWLA 2F51A 3LSZA 1AIUA 4HJ2A 1G6WA 3GKKA 4ML6A 3ZMKA 2YWMA 4IW9A 5G5EA 1OVNA 3M1GA 1PMTA 2QKEA 1F2EA 3EINA 5IMAA 1K0CA 1MD4A 1ZCPA 2F8AA 1R5AA 2K6VA 4QQ7A 2H76A 5CRDA 1Y6EA 4F9ZA 1NW2A 1BEDA 2HYXA 3F4RA
chains in the Genus database with same CATH superfamily
3GURA 1J0FA 2FWGA 2HXKA 4HU9A 5HR0A 1FO5A 3GNJA 5D9WA 1HQOA 2LRCA 1T8EB 2B5XA 3E0UA 1TTZA 2IMDA 2GVPA 4KNDA 2O89A 4IQAA 4L5OA 3HDCA 3KIJA 13GSA 4POKA 4PNGA 3SWLA 2LKUA 4GRFA 2IMIA 3LFLA 1F9MA 1OE8A 1THXA 4FIWA 1QQ2A 1X5CA 2XPDA 2V41A 5J3RA 1SL0B 5DCHA 1B9XC 1XWCA 2PN8A 3HZ4A 1GTBA 1M2BA 3LQ7A 1QK8A 2I3YA 3UARA 2TIRA 3ERFA 3DVXA 1BJXA 4Z2TA 2H74A 1AC1A 5HR1A 5J4UA 2QGVA 2H73A 4V2LA 2PPTA 1GL8A 5IMDA 5CNWA 2JZSA 4KX4A 3TDGA 17GSA 5IIZA 1G0TA 1QUWA 5CYYA 4WEYA 5DQSA 4MZCA 1EWXA 3P8WA 4G0KA 3TCOA 3TRPA 1YQ1A 4N0VA 2HSHA 1W4VA 1LBKA 1OC8A 4KAEA 1ON4A 1B4QA 2MMZA 3W8SA 4ZB8A 5DQYA 3D0ZA 2H72A 5H5SA 2F3MA 3BCKA 1M2AA 1UVZA 5CRGA 4CY8A 4BVXB 4LL1B 1PD21 2JZTA 1SD8A 1ZOFA 1K3OA 3N9JA 1XVWA 3TJFA 2LEGA 1N2AA 4ZL8A 3GH6A 1E2YA 4MNNA 3WGXA 2VAFA 1OC9B 1V40A 3FHKA 3HXSA 5HR2A 5ID2B 1XVQA 4PXOA 2JU5A 2RM6A 3BCIA 1HYUA 5F06A 3M3MA 3HCZA 3GTUB 1SYXA 2G0FA 1O73A 3RPNA 3KTBA 1MDKA 4YH2A 4DSQA 1A8LA 2QA1A 3RAZA 2C3NA 5A5KA 3J7Yk 1Z5YE 2WGRA 2P0GA 3BOAA 1EEJA 1TXXA 1ILOA 2H6XA 1GSYA 3QDNA 4Q5QA 2RUFA 2HSYA 4YAPA 1I5GA 5FT3A 3UVTA 2IMFA 3ZVJD 4HZ2A 3KD0A 2GT5A 4TW5A 4YKGA 1G7OA 2QSIA 2DBCA 4GWRA 1TU7A 4KB3A 2H71A 5INYA 2BTOT 2OE1A 5CREA 5D9VA 2GZPA 4GSSA 3F3RA 5LD0A 3O6TA 3NIVA 3H1NA 3W8JA 3VPQA 2VL9A 3HKRA 1QGVA 2LV3A 4PTSA 4GQCA 2KOKA 1PKWA 3DD3A 1K0AA 1ZYQB 4YQVA 1GUKA 2L6DA 4CW9A 5C04A 1XPVA 1T3BA 2I1UA 1GSFA 1HNBA 1AQWA 1U3AA 1XOAA 5KN1A 3RHBA 4K6XA 4AJ7A 4BL7A 1GTAA 4K2XA 2PVQA 2YV7A 3HD5A 2HFDA 1VF4A 2DIYA 2FNOA 2O85A 3GKXA 3QAWA 3IHGA 3CRTA 4ZB6A 3LORA 6GSYA 4N0ZA 3KMOA 3TKSA 1AW9A 1RW1A 3O76A 3ZMLA 3S9FA 1UN2A 3C8EA 2PU9C 1T7PB 4NMUA 1SJZA 4N10A 2N5AA 2GGTA 2DJJA 1ST9A 2O8VB 1JZRA 3IC4A 5ELGA 5KN3A 1V9WA 1ML6A 2C0FA 5J9CA 1VF1A 3ZYWA 5G1LA 1USBA 3EVIA 5A4UA 4PGTA 3TRXA 2O7KA 1GUHA 4POBA 2VCZA 5B8BA 2KLXA 1EP8A 3TJJA 3TJBA 3MAKA 2WCIA 1PX7A 1ZL9A 4K0GA 3HJPA 4EXJA 3FEUA 1M99A 2YPMA 4ICYA 4JZQA 3ZITA 2A4HA 1O8XA 5IMFA 3ZLPA 3C73A 4E8EA 4G9HA 1X9MB 1FHEA 2BJXA 4HJMA 3MWHA 4PQIA 5H5QA 5ECQB 2RUEA 3I6AA 16GSA 5ELAA 2PWJA 4ISDA 4LA1A 2ON5A 2LQQA 5GAPD 5KOWA 1YF1A 2P5RA 4OWYA 1K3LA 2WJUA 1CQHA 2DKIA 1W89A 3MSZA 5B7CA 1Z3EA 1M3IA 1MTCA 4TXOB 1URMA 3IXRA 2FA4A 3PPUA 2MMAA 4IJ3A 4Z7XA 3MIXA 2DIZA 20GSA 1GLQA 5J9BA 1B48A 1B8XA 3TUEA 1O85A 2ALBA 3ERWA 1SENA 4MA9A 1O6JA 4DVCA 1HD2A 3ZVJA 2IMKA 4MLYA 2REMA 4OO5A 2I4AA 3L9UA 2X8GA 1PX6A 4ZBDA 2C4JA 1R4WA 2R5GA 3FR3A 2H1AA 1GP1A 4MABA 4EF0A 2YJ7A 1DBYA 2D2ZA 3F6DA 3LEFA 3U5RE 4GTUA 4CY6A 4IBPA 2LJRA 1OE7A 2DJ0A 5DALB 3G7JA 2F8FA 3CTFA 4YQMA 3TKRA 1BQ7A 2HZEA 1ZMAA 4ECBA 3KXOA 2VCQA 1A2JA 1BAYA 1SL2B 5CO3A 3KJYA 2YV9A 2IFQB 5JCGA 1SKSB 2K8SA 3HVSA 2VL2A 5COHA 3UEMA 1YEPA 3LGCA 3F8UA 1A8YA 1MDJA 1ERWA 2E2GA 5HFGA 2M72A 5CP1A 2VL3A 4XTSA 2N5FA 1MD3A 5JWQB 1F3BA 4K7OA 3HVXA 3GIXA 3QFAC 2X99A 4PUFC 2DMMA 2MYGA 3UJ1A 4I8BA 5FWGA 3FW2A 1TRWA 4O5RA 2LJAA 2J23A 1AUCA 3ME7A 1O81A 1SYRA 2GQKA 4D73A 3BBYA 4IHUA 1DUGA 2V6KA 3CTGA 2FUG2 4TR0A 2R0CA 3D5JA 4HOJA 4LMWA 4Z2UA 1C72A 3FZAA 3D4TA 3GMFA 2B3SA 3DGQA 3R2QA 2TRCP 2PGTA 1GSUA 5C00A 5CAXA 3IRAA 2I81A 4KDUA 4XS4B 4FH8A 5GZZB 4O92A 2EIQA 2YWIA 4ILFA 3RHCA 1GSSA 5ECPB 5D93A 4IP6A 4CDOA 1M9BA 1CQGA 3G7IA 1SK2A 2A4VA 3IV4A 2M46A 3FR6A 4IELA 4ZXGA 1NHOA 2L5OA 4GLTA 2K9FA 4K7NA 3UBKA 4MJEA 2YANA 1XBSA 4DSSA 3FKFA 1PSQA 2GS3A 1EOGA 1S3AA 1Z9HA 4Z2RA 2L57A 7GSSA 4MZBA 2HRFA 1QFNA 1JZDA 2FWHA 3E3EA 1K0MA 2DMLA 4IGJA 2GSQA 3EURA 3TB2A 1GWCA 5F05A 2H75A 3GX8A 1EP7A 3HYPA 1V98A 1XFLA 4XHMA 5D96A 2DJ3A 4N11A 1HNCA 4K7IA 4X1UA 4EIPA 1GTUA 1GSEA 4V2MA 1GULA 1U3IA 2FWEA 1RK4A 3G9BA 1HNAA 2VD0A 1GSQA 1UA5A 5B6MA 2LRNA 1YDKA 1IYHA 2VO4A 2X4AA 3IC8A 1E6BA 4L5LA 1ABAA 5F07A 5IQYA 4AGSA 4WR4A 4EDZA 2XBQA 4RUVA 5E59A 3TRQA 1FOVA 2DC5A 1XCCA 3VI7A 4PQ1A 3GA4A 1TW9A 5JWRB 3F0IA 3DXBA 4XS6A 4HZ4A 3GYKA 1SL1B 3QCPA 2UZ8A 2YWNA 5JCUA 3TKSC 1R7HA 3APOA 2IL3A 1T1VA 4I2TA 4GQFA 3VWUA 3LWAA 1JLWA 3J7Yb 6GSVA 2GSRA 5AISA 2O87A 1AXDA 2HRNA 4BVYA 1EV4A 2OKAA 4HU7A 2M80A 1NSWA 5DJLA 3FK8A 3RBTA 1FG4A 1AQVA 1A0FA 1YEXA 2CVKA 3E9JB 2VLTA 3NZNA 2XHFA 3AY8A 2B1LA 5IOXA 3IA1A 4HSCX 1A2LA 3VI5A 3KP8A 3HVVA 3GKNA 4MPGA 4I5QA 4KUNA 3FZ5A 4GSTA 1Z7PA 5HR3A 2C3TA 2IN3A 2F9SA 3UVHA 4MF6A 3CQFA 2CA8A 1GUMA 3KM6A 5KN2A 5JCWA 3V1WA 1EV9A 1FB6A 4V1Ap 4YQUA 2DSAA 4EO3A 4K5SA 4ZL7A 3A5WA 3QMXA 3GL3A 3ZTLA 2VCTA 3C1SA 4MJCA 4ULXA 5IOWA 3A2XA 4TN8A 3F63A 4P3YB 3ZRDA 2N5BA 2LTKA 4XCSA 5B6NA 2LNSA 4HDEA 4OFMA 3VWWA 1GH2A 5ECRB 4YAVA 1G7EA 5FHIA 4RI6A 4FYBA 2PUKC 5ECMB 4GSNA 2E2MA 3ZREA 1G6YA 2HE3A 1J08A 2L59A 4E8HA 1OKTA 1OAZA 5EVOA 3HJMA 1WRYA 2B6MA 3R3EA 2H30A 4PNFA 3APQA 1R26A 22GSA 4I2UA 4MP4A 4ZIJA 1GNEA 1ERTA 4F0CA 3Q74A 2GQLA 4MZWA 1WMJA 3GUSA 3EC3A 4X4JA 5EPFA 2I9HA 4BL7B 1F6MC 6GSSA 2VLVA 3HA9A 1GNWA 5CRHA 1PN9A 4MH3A 3FMWA 2GSTA 3GSTA 3EE2A 5J41A 2X8CA 3PR8A 4JR6A 4TKYA 3G7YA 4NV2A 1V57A 1MEKA 1U87A 1TRUA 3GKMA 1YZXA 1B4PA 1B9YC 2H0HA 4NPBA 4V1Ag 5EL8A 1BX9A 2AYTA 5E4WA 3VWXA 3ZIJA 2DKHA 4J2FA 2X49A 3WYWA 3WD6A 4O32A 3A2VA 4MF7A 4TXVA 3KMNA 1PL1A 1OC3A 3LG6A 4KA0A 4HS1A 4PURA 2AB6A 4KSOA 2H6YA 1WOUA 2G2QA 4OCEA 1QXHA 5AIXA 4LL4B 4NXIA 2FA8A 5HFIA 5IMCA 5EY6A 5G2ZA 2VUPA 4K9ZA 1Z7RA 1K0OA 4PQHA 1TRVA 1ERUA 4NHWA 2IMEA 5ECOB 1JFUA 1EOHA 4YKFA 1ZYNA 1Q98A 2C3QA 1ZZYA 2H0GA 4ID0A 5IMVA 6GSUA 4MCUA 2C0GA 3TOUA 4WF5A 9GSSA 2H66A 3A3TA 2OE0A 2EC4A 4N30A 4PUAA 3FY7A 1ERVA 1IYIA 4G2EA 2ZUPA 2DJ2A 4O5QA 2VM1A 4GXZA 5KEJA 4K1FA 2RM5A 1VF2A 2J9HA 2GLRA 3KP9A 3UMAA 2ON7A 2NPBA 1THOA 4ECCA 5H5RA 2MBTA 2E7PA 1SJIA 4BPYA 3ZZXA 5HFKA 2C0DA 2P5QA 5DAKA 1V58A 3DRNA 4MMMA 2PBJA 4L8EA 1PGTA 3I69A 3TJKA 1ZYEA 3MNGA 4FQUA 1A24A 1XWAA 2IPAA 4K0NA 2H1DA 4ZBAA 2OE3A 4HQSA 1VF3A 2HZEB 2C8UA 1XOBA 1T00A 2AV4A 1AQXA 3LXTA 3CSJA 5F0GA 4WXTA 1XIYA 2WFCA 3A5IA 1XXUA 2V32A 3EU4A 1H4OA 5ECKB 2NBSA 1FOHA 3GRXA 1LJRA 4K5RA 1JZWA 2V1MA 5G31A 3LXZA 3EMPA 1AAZA 1WP0A 1XZOA 3FZ9A 4J56E 2X64A 1O8WA 1TK5B 4BWSA 1VGLA 4ZB9A 4POLA 2P31A 4IS0A 2C80A 4EUYA 2YCDA 4WETA 1SU9A 3APSA 1YY7A 3PINA 2VIMA 2OACA 2VCVA 4O7HA 1PN0A 3W6GA 4D73B 4H86A 5G5FA 2H1GA 3IAS2 3ZFBA 5GSTA 2CAIA 3WT2A 3HZ8A 2CZ3A 1SKWB 4HI7A 3RDWA 2DJ1A 3US3A 2XPEA 2B1KA 4GF0A 5ECNB 4HUAA 4ZILA 5ECHB 1ZGNA 1QMVA 4TR1A 2CX4A 3CBUA 2HRKA 5DBQA 4I6XA 2LSTA 3C71A 3CSHA 5DJMA 2MMNA 1NHYA 5DCGA 1PQNA 2WS2A 3IBHA 1JHBA 3D21A 2GDRA 4KH7A 2KUCA 1ZYPA 5AN1A 2IJYA 5B8AA 5ECLB 2KHPA 2JSZA 3L78A 3GSSA 1OKDA 3NOFA 3H79A 5L71A 3KCMA 2L4CA 1SKRB 4DSSB 2IWTA 4CHSA 3F3QA 4IN0A 1PRXA 2JACA 4OCFA 3BD2A 2TRXA 1DE1A 6GSTA 1XG8A 4MDCA 3DMLA 2QC7A 5IPHA 4F0BA 2LS5A 4BIKA 3EPTA 2CZ2A 3GN3A 3P2AA 3P90A 1FVKA 2R6KA 2A2SA 3BJ5A 2KP1A 5LCZA 1O7UA 1EGOA 5AIVA 3F9UA 3UOMA 4X43A 3RPPA 4TVEA 3IOSA 3C1RA 3M9JA 3ZIVA 5ABRA 4DEJA 3IK9A 4KDXA 1JZOA 1WE0A 5D9TA 1FW1A 2IIYA 3UL3A 2YZHA 2YZUA 4EE0A 3IPZA 1TKDB 3ERGA 2AHEA 2GTUA 1BYEA 2V6OA 2H6ZA 3ED3A 1TK0B 4XRDA 3QAGA 1Z6NA 3Q18A 4QL7A 3IR4A 4ZBBA 2H0IA 2X8HA 3KTLA 4JRRA 3FZ4A 3VWVA 4G0IA 4MH2A 1S3CA 4MF5A 3Q19A 4O5UA 2WRTA 2R0GA 3TOTA 4KCEA 3TGZA 4OFTA 3EYTA 1M3JA 2R37A 4Q5NA 2FY6A 2LNTA 2WULA 3WGDA 3IAM2 4X0XA 1SJ6A 3FYGA 2YOIA 4NV5A 4IVFA 4I97A 3DIEA 1XWGA 2FHEA 4XIHA 1PKZA 1J9BA 4BVYB 2GSSA 1M9AA 3ISOA 4EIQA 1KNGA 2BMXA 3HY2A 3D6IA 4FO5A 1TI3A 4KW6A 1TJDA 3D22A 2CAQA 2VM2A 1F37A 4EVMA 4MK3A 3SBCA 5IM9A 1JLVA 1TK8B 1YKAA 4RQXA 1M0UA 1PA3A 1R5PA 3GH9A 4KSMA 2XBIA 1EGRA 2Z9SA 3I9V2 3N5OA 4MJAA 2VCXA 2MZCA 3EU3A 4KF9A 10GSA 4IP1A 1XWBA 3PGTA 2AJQB 3HHVA 1SK1A 2C0EA 4BVXA 2HZFA 2R3XA 1S3DA 4AJ8A 2JZRA 1PL2A 3GHAA 4A5PA 4EDYA 3TKQA 1X5DA 4AF2A 2GZYA 1FAAA 4L0WA 3Q6OA 1WPIA 2KP2A 1OC9A 4Q5RA 4FYCA 4G10A 5ID2A 3D4MA 5J5NA 2L5LA 2R2JA 2HSMA 2H19A 1TOFA 4NAXA 2ES7A 4AJ6A 3GTUA 6GSWA 4KGIA 1NM3A 1U6TA 1WIKA 4LLRA 4OMVA 2FGXA 4PX1A 2CVDA 5LNKe 4Q5FA 3IK7A 2JL4A 2DJKA 2LUSA 4IKHA 4OFNA 4JBBA 4V2NA 2VOCA 1PFOA 4F82A 3CXGA 5ENUA 3GL5A 1X5EA 3VLNA 3L0HA 3DKSA 5G30A 1RQMA 4FYUA 2B5YA 2R0PA 2DLXA 3MYDA 4MJBA 2ZNMA 1Z6MA 3M9KA 1S3RA 1YKCA 1KEBA 4JE1A 4ZL9A 5BMUA 2VL2C 3M8NA 3WGEA 3UBLA 2AAWA 4K2DA 5D8IA 3KH9A 1F3AA 3MDKA 3IDVA 3PH9A 3GFKA 4F03A 1K0DA 5GAND 3QOUA 3JCML 1T4ZA 2YN1A 1LU4A 4EC0A 2GQMA 3I43A 3O3TA 1Y25A 2CQ9A 1A2MA 1SD9A 3ME8A 1YJ6A 1DSBA 4OO4A 5ECIB 2FLSA 3F4TA 3QPMA 3VK9A 4RI7A 2QA2A 2XC2A 1UC7A 3LJRA 2JADA 4JR4A 2E0QA 2VCWA 2FCHA 4OD7A 3EMXA 3VFIA 3M0FA 2L6CA 3DYRA 2MMOA 4WKWA 4F2IA 4JEDA 3QFBC 2FD3A 2YNXA 1ACVA 2PVOC 4EKZA 1XW6A 1GTIA 2AUVA 2WZ9A 4WBRD 1K3YA 1X0RA 1TDIA 2NTOA 3K8NA 2H1BA 1KTEA 2WDUA 3A2WA 4L0UA 4XRAA 3HJOA 2YP6A 3VPTA 3F6FA 2K8VA 4WR5A 1MDIA 2JSYA 5GSSA 1V2AA 3QD9A 4ECJA 2OJLA 4NWYA 2H70A 4HEA2 1VRSD 1GLPA 4BA7A 2CX3A 5JWOB 3ZL5A 2H8LA 1A23A 3UIWA 1K0NA 3OR5A 3FRCA 3TKPA 1M7TA 4MPFA 3F4SA 2NVLA 4WF4A 3KZQA 4G19A 2HT9A 3VURA 4K8MA 2HI7A 3GX0A 2OA7A 1EEMA 4TR3A 2WB9A 4WBJA 4LMVA 1WWJA 3ZFLA 4TRXA 4NHZA 2MBSA 1FB0A 5DAKB 2H01A 1TI1A 4IJIA 4TOPA 2B7KA 19GSA 1YF0A 1K0BA 4TXOA 3H4KA 8GSSA 3UAPA 3TJGA 1A0RP 5IO2A 4XS1A 2VLUA 1GRXA 2EIOA 3HVNA 4RQRA 2C1YA 2V2GA 1XW5A 1M2DA 4IQ1A 2CVBA 4TR4A 1N8JA 2A2PA 2L4QA 1TU8A 4GCIA 1T4YA 3KGKA 2HNLA 11GSA 1Q4JA 2GT6A 3DEXA 2CV4A 2EIRA 4EL1A 2YWOA 5HQPA 5DDLA 2B7JA 5KOXA 1EZKA 5IMZA 1SK0A 5DALA 2HLSA 2VD1A 3KEBA 3TKSE 3CMIA 5KN0A 1X9SB 3L9SA 4KDYA 3DWVA 4QL9A 2IFQA 3C7MA 2R4VA 3GV1A 2FWFA 3DVWA 5IPGA 3QR6A 4JU5A 4ACSA 1U88A 2HRAA 5F8BA 5DVBA 4ECIA 2LJKA 2ZCTA 5AGYA 4KE3A 5A4WA 3IHQA 5D9XA 1DE2A 2GZZA 1X9WB 6GSXA 3H93A 3FR9A 3WT1A 5D73A 5BRTA 1KBNA 3P7XA 1WJKA 4KCAA 1XW9A 3L4NA 3QAVA 3CYNA 5IO0A 2OADA 4TR1B 1OYJA 4HQZA 3LW9A 5A4VA 4G0LA 12GSA 5G1KA 2LQOA 1TP9A 4POMA 3U6VA 2CT6A 2K18A 3IE3A 1FVJA 14GSA 1TRSA 1XWKA 3KH7A 18GSA 3H8QA 2OBIA 3L9VA 2YJHA 4ML1A 2PMTA 2NDOA 3LYPA 2RIIA 2A2RA 3CSIA 4XS4A 5CRWA 4DSRA 4BWQA 3CRUA 2OBKA 2B5EA 1I9DA 2RLIA 3LYKA 5ECSA 1BG5A 1H75A 4J57E 2PERA 1GSDA 2LRTA 3EWLA 2F51A 3LSZA 1AIUA 4HJ2A 1G6WA 3GKKA 4ML6A 3ZMKA 4USSA 2YWMA 4IW9A 5G5EA 1OVNA 3M1GA 1PMTA 2QKEA 1F2EA 3EINA 5IMAA 1K0CA 1MD4A 1ZCPA 2F8AA 1R5AA 2K6VA 4QQ7A 2H76A 5CRDA 1Y6EA 4F9ZA 1NW2A 1BEDA 2HYXA 3F4RA
chains in the Genus database with same CATH topology
3GURA 1J0FA 2FWGA 2HXKA 4HU9A 5HR0A 1FO5A 3GNJA 5D9WA 1HQOA 2LRCA 1T8EB 2B5XA 3E0UA 1TTZA 2IMDA 2GVPA 4KNDA 2O89A 4IQAA 4L5OA 3HDCA 3KIJA 13GSA 4POKA 4PNGA 3SWLA 2LKUA 4GRFA 2IMIA 3LFLA 1F9MA 1OE8A 1THXA 4FIWA 1QQ2A 1X5CA 2XPDA 2V41A 5J3RA 1SL0B 5DCHA 1B9XC 1XWCA 2PN8A 3HZ4A 1GTBA 1M2BA 3LQ7A 1QK8A 2I3YA 3UARA 2TIRA 3ERFA 3DVXA 1BJXA 4Z2TA 2H74A 1AC1A 5HR1A 5J4UA 2QGVA 2H73A 4V2LA 2PPTA 1GL8A 5IMDA 5CNWA 2JZSA 4KX4A 3TDGA 17GSA 5IIZA 1G0TA 1QUWA 5CYYA 4WEYA 5DQSA 4MZCA 1EWXA 3P8WA 4G0KA 3TCOA 3TRPA 1YQ1A 4N0VA 2HSHA 1W4VA 1LBKA 1OC8A 4KAEA 1ON4A 1B4QA 2MMZA 3W8SA 4ZB8A 5DQYA 3D0ZA 2H72A 5H5SA 2F3MA 3BCKA 1M2AA 1UVZA 5CRGA 4CY8A 4BVXB 4LL1B 1PD21 2JZTA 1SD8A 1ZOFA 1K3OA 3N9JA 1XVWA 3TJFA 2LEGA 1N2AA 4ZL8A 3GH6A 1E2YA 4MNNA 3WGXA 2VAFA 1OC9B 1V40A 3FHKA 3HXSA 5HR2A 5ID2B 1XVQA 4PXOA 2JU5A 2RM6A 3BCIA 1HYUA 5F06A 3M3MA 3HCZA 3GTUB 1SYXA 2G0FA 1O73A 3RPNA 3KTBA 1MDKA 4YH2A 4DSQA 1A8LA 2QA1A 3RAZA 2C3NA 5A5KA 3J7Yk 1Z5YE 2WGRA 2P0GA 3BOAA 1EEJA 1TXXA 1ILOA 2H6XA 1GSYA 3QDNA 4Q5QA 2RUFA 2HSYA 4YAPA 1I5GA 5FT3A 3UVTA 2IMFA 3ZVJD 4HZ2A 3KD0A 2GT5A 4TW5A 4YKGA 1G7OA 2QSIA 2DBCA 4GWRA 1TU7A 4KB3A 2H71A 5INYA 2BTOT 2OE1A 5CREA 5D9VA 2GZPA 4GSSA 3F3RA 5LD0A 3O6TA 3NIVA 3H1NA 3W8JA 3VPQA 2VL9A 3HKRA 1QGVA 2LV3A 4PTSA 4GQCA 2KOKA 1PKWA 3DD3A 1K0AA 1ZYQB 4YQVA 1GUKA 2L6DA 4CW9A 5C04A 1XPVA 1T3BA 2I1UA 1GSFA 1HNBA 1AQWA 1U3AA 1XOAA 5KN1A 3RHBA 4K6XA 4AJ7A 4BL7A 1GTAA 4K2XA 2PVQA 2YV7A 3HD5A 2HFDA 1VF4A 2DIYA 2FNOA 2O85A 3GKXA 3QAWA 3IHGA 3CRTA 4ZB6A 3LORA 6GSYA 4N0ZA 3KMOA 3TKSA 1AW9A 1RW1A 3O76A 3ZMLA 3S9FA 1UN2A 3C8EA 2PU9C 1T7PB 4NMUA 1SJZA 4N10A 2N5AA 2GGTA 2DJJA 1ST9A 2O8VB 1JZRA 3IC4A 5ELGA 5KN3A 1V9WA 1ML6A 2C0FA 5J9CA 1VF1A 3ZYWA 5G1LA 1USBA 3EVIA 5A4UA 4PGTA 3TRXA 2O7KA 1GUHA 4POBA 2VCZA 5B8BA 2KLXA 1EP8A 3TJJA 3TJBA 3MAKA 2WCIA 1PX7A 1ZL9A 4K0GA 3HJPA 4EXJA 3FEUA 1M99A 2YPMA 4ICYA 4JZQA 3ZITA 2A4HA 1O8XA 5IMFA 3ZLPA 3C73A 4E8EA 4G9HA 1X9MB 1FHEA 2BJXA 4HJMA 3MWHA 4PQIA 5H5QA 5ECQB 2RUEA 3I6AA 16GSA 5ELAA 2PWJA 4ISDA 4LA1A 2ON5A 2LQQA 5GAPD 5KOWA 1YF1A 2P5RA 4OWYA 1K3LA 2WJUA 1CQHA 2DKIA 1W89A 3MSZA 5B7CA 1Z3EA 1MTCA 4TXOB 1URMA 3IXRA 2FA4A 3PPUA 2MMAA 4IJ3A 4Z7XA 3MIXA 2DIZA 20GSA 1GLQA 5J9BA 1B48A 1B8XA 3TUEA 1O85A 2ALBA 3ERWA 1SENA 4MA9A 1O6JA 4DVCA 1HD2A 3ZVJA 2IMKA 4MLYA 2REMA 4OO5A 2I4AA 3L9UA 2X8GA 1PX6A 4ZBDA 2C4JA 1R4WA 2R5GA 3FR3A 2H1AA 1GP1A 4MABA 4EF0A 2YJ7A 1DBYA 2D2ZA 3F6DA 3LEFA 3U5RE 4GTUA 4CY6A 4IBPA 2LJRA 1OE7A 2DJ0A 5DALB 3G7JA 2F8FA 3CTFA 4YQMA 3TKRA 1BQ7A 2HZEA 1ZMAA 4ECBA 3KXOA 2VCQA 1A2JA 1BAYA 1SL2B 5CO3A 3KJYA 2YV9A 2IFQB 5JCGA 1SKSB 2K8SA 3HVSA 2VL2A 5COHA 3UEMA 1YEPA 3LGCA 3F8UA 1A8YA 1MDJA 1ERWA 2E2GA 5HFGA 2M72A 5CP1A 2VL3A 4XTSA 2N5FA 1MD3A 5JWQB 1F3BA 4K7OA 3HVXA 3GIXA 3QFAC 2X99A 4PUFC 2DMMA 2MYGA 3UJ1A 4I8BA 5FWGA 3FW2A 1TRWA 4O5RA 2LJAA 2J23A 1AUCA 3ME7A 1O81A 1SYRA 2GQKA 4D73A 3BBYA 4IHUA 1DUGA 2V6KA 3CTGA 2FUG2 4TR0A 2R0CA 3D5JA 4HOJA 4LMWA 4Z2UA 1C72A 3FZAA 3D4TA 3GMFA 2B3SA 3DGQA 3R2QA 2TRCP 2PGTA 1GSUA 5C00A 5CAXA 3IRAA 2I81A 4KDUA 4XS4B 4FH8A 5GZZB 4O92A 2EIQA 2YWIA 4ILFA 3RHCA 1GSSA 5ECPB 5D93A 4IP6A 4CDOA 1M9BA 1CQGA 3G7IA 1SK2A 2A4VA 3IV4A 2M46A 3FR6A 4IELA 4ZXGA 1NHOA 2L5OA 4GLTA 2K9FA 4K7NA 3UBKA 4MJEA 2YANA 1XBSA 4DSSA 3FKFA 1PSQA 2GS3A 1EOGA 1S3AA 1Z9HA 4Z2RA 2L57A 7GSSA 4MZBA 2HRFA 1QFNA 1JZDA 2FWHA 3E3EA 1K0MA 2DMLA 4IGJA 2GSQA 3EURA 3TB2A 1GWCA 5F05A 2H75A 3GX8A 1EP7A 3HYPA 1V98A 1XFLA 4XHMA 5D96A 2DJ3A 4N11A 1HNCA 4K7IA 4X1UA 4EIPA 1GTUA 1GSEA 4V2MA 1GULA 1U3IA 2FWEA 1RK4A 3G9BA 1HNAA 2VD0A 1GSQA 1UA5A 5B6MA 2LRNA 1YDKA 1IYHA 2VO4A 2X4AA 3IC8A 1E6BA 4L5LA 1ABAA 5F07A 5IQYA 4AGSA 4WR4A 4EDZA 2XBQA 4RUVA 5E59A 3TRQA 1FOVA 2DC5A 1XCCA 3VI7A 4PQ1A 3GA4A 1TW9A 5JWRB 3F0IA 3DXBA 4XS6A 4HZ4A 3GYKA 1SL1B 3QCPA 2UZ8A 2YWNA 5JCUA 3TKSC 1R7HA 3APOA 2IL3A 1T1VA 4I2TA 4GQFA 3VWUA 3LWAA 1JLWA 3J7Yb 6GSVA 2GSRA 5AISA 2O87A 1AXDA 2HRNA 4BVYA 1EV4A 2OKAA 4HU7A 2M80A 1NSWA 5DJLA 3FK8A 3RBTA 1FG4A 1AQVA 1A0FA 1YEXA 2CVKA 3E9JB 2VLTA 3NZNA 2XHFA 3AY8A 2B1LA 5IOXA 3IA1A 1A2LA 3VI5A 3KP8A 3HVVA 3GKNA 4MPGA 4I5QA 4KUNA 3FZ5A 4GSTA 1Z7PA 5HR3A 2C3TA 2IN3A 2F9SA 3UVHA 4MF6A 2CA8A 1GUMA 3KM6A 5KN2A 5JCWA 3V1WA 1EV9A 1FB6A 4V1Ap 4YQUA 2DSAA 4EO3A 4K5SA 4ZL7A 3A5WA 3QMXA 3GL3A 3ZTLA 2VCTA 3C1SA 4MJCA 4ULXA 5IOWA 3A2XA 4TN8A 3F63A 4P3YB 3ZRDA 2N5BA 2LTKA 4XCSA 5B6NA 2LNSA 4HDEA 4OFMA 3VWWA 1GH2A 5ECRB 4YAVA 1G7EA 5FHIA 4RI6A 4FYBA 2PUKC 5ECMB 4GSNA 2E2MA 3ZREA 1G6YA 2HE3A 1J08A 2L59A 4E8HA 1OKTA 1OAZA 5EVOA 3HJMA 1WRYA 2B6MA 3R3EA 2H30A 4PNFA 3APQA 1R26A 22GSA 4I2UA 4MP4A 4ZIJA 1GNEA 1ERTA 4F0CA 3Q74A 2GQLA 4MZWA 1WMJA 3GUSA 3EC3A 4X4JA 5EPFA 2I9HA 4BL7B 1F6MC 6GSSA 2VLVA 3HA9A 1GNWA 5CRHA 1PN9A 4MH3A 3FMWA 2GSTA 3GSTA 3EE2A 5J41A 2X8CA 3PR8A 4JR6A 4TKYA 3G7YA 4NV2A 1V57A 1MEKA 1U87A 1TRUA 3GKMA 1YZXA 1B4PA 1B9YC 2H0HA 4NPBA 4V1Ag 5EL8A 1BX9A 2AYTA 5E4WA 3VWXA 3ZIJA 2DKHA 4J2FA 2X49A 3WYWA 3WD6A 4O32A 3A2VA 4MF7A 4TXVA 3KMNA 1PL1A 1OC3A 3LG6A 4KA0A 4HS1A 4PURA 2AB6A 4KSOA 2H6YA 1WOUA 2G2QA 4OCEA 1QXHA 5AIXA 4LL4B 4NXIA 2FA8A 5HFIA 5IMCA 5EY6A 5G2ZA 2VUPA 4K9ZA 1Z7RA 1K0OA 4PQHA 1TRVA 1ERUA 4NHWA 2IMEA 5ECOB 1JFUA 1EOHA 4YKFA 1ZYNA 1Q98A 2C3QA 1ZZYA 2H0GA 4ID0A 5IMVA 6GSUA 4MCUA 2C0GA 3TOUA 4WF5A 9GSSA 2H66A 3A3TA 2OE0A 2EC4A 4N30A 4PUAA 3FY7A 1ERVA 1IYIA 4G2EA 2ZUPA 2DJ2A 4O5QA 2VM1A 4GXZA 5KEJA 4K1FA 2RM5A 1VF2A 2J9HA 2GLRA 3KP9A 3UMAA 2ON7A 2NPBA 1THOA 4ECCA 5H5RA 2MBTA 2E7PA 1SJIA 4BPYA 3ZZXA 5HFKA 2C0DA 2P5QA 5DAKA 1V58A 3DRNA 4MMMA 2PBJA 4L8EA 1PGTA 3I69A 3TJKA 1ZYEA 3MNGA 4FQUA 1A24A 1XWAA 2IPAA 4K0NA 2H1DA 4ZBAA 2OE3A 4HQSA 1VF3A 2HZEB 2C8UA 1XOBA 1T00A 2AV4A 1AQXA 3LXTA 3CSJA 5F0GA 4WXTA 1XIYA 2WFCA 3A5IA 1XXUA 2V32A 3EU4A 1H4OA 5ECKB 2NBSA 1FOHA 3GRXA 1LJRA 4K5RA 1JZWA 2V1MA 5G31A 3LXZA 3EMPA 1AAZA 1WP0A 1XZOA 3FZ9A 4J56E 2X64A 1O8WA 1TK5B 4BWSA 1VGLA 4ZB9A 4POLA 2P31A 4IS0A 2C80A 4EUYA 2YCDA 4WETA 1SU9A 3APSA 1YY7A 3PINA 2VIMA 2OACA 2VCVA 4O7HA 1PN0A 3W6GA 4D73B 4H86A 5G5FA 2H1GA 3IAS2 3ZFBA 5GSTA 2CAIA 3WT2A 3HZ8A 2CZ3A 1SKWB 4HI7A 3RDWA 2DJ1A 3US3A 2XPEA 2B1KA 4GF0A 5ECNB 4HUAA 4ZILA 5ECHB 1ZGNA 1QMVA 4TR1A 2CX4A 3CBUA 2HRKA 5DBQA 4I6XA 2LSTA 3C71A 3CSHA 5DJMA 2MMNA 1NHYA 5DCGA 1PQNA 2WS2A 3IBHA 1JHBA 3D21A 2GDRA 4KH7A 2KUCA 1ZYPA 5AN1A 2IJYA 5B8AA 5ECLB 2KHPA 2JSZA 3L78A 3GSSA 1OKDA 3NOFA 3H79A 5L71A 3KCMA 2L4CA 1SKRB 4DSSB 2IWTA 4CHSA 3F3QA 4IN0A 1PRXA 2JACA 4OCFA 3BD2A 2TRXA 1DE1A 6GSTA 4MDCA 3DMLA 2QC7A 5IPHA 4F0BA 2LS5A 3EPTA 2CZ2A 3GN3A 3P2AA 3P90A 1FVKA 2R6KA 2A2SA 3BJ5A 2KP1A 5LCZA 1O7UA 1EGOA 5AIVA 3F9UA 3UOMA 4X43A 3RPPA 4TVEA 3IOSA 3C1RA 3M9JA 3ZIVA 5ABRA 4DEJA 3IK9A 4KDXA 1JZOA 1WE0A 5D9TA 1FW1A 2IIYA 3UL3A 2YZHA 2YZUA 4EE0A 3IPZA 1TKDB 3ERGA 2AHEA 2GTUA 1BYEA 2V6OA 2H6ZA 3ED3A 1TK0B 4XRDA 3QAGA 1Z6NA 3Q18A 4QL7A 3IR4A 4ZBBA 2H0IA 2X8HA 3KTLA 4JRRA 3FZ4A 3VWVA 4G0IA 4MH2A 1S3CA 4MF5A 3Q19A 4O5UA 2WRTA 2R0GA 3TOTA 4KCEA 3TGZA 4OFTA 3EYTA 2R37A 4Q5NA 2FY6A 2LNTA 2WULA 3WGDA 3IAM2 4X0XA 1SJ6A 3FYGA 2YOIA 4NV5A 4IVFA 4I97A 3DIEA 1XWGA 2FHEA 4XIHA 1PKZA 1J9BA 4BVYB 2GSSA 1M9AA 3ISOA 4EIQA 1KNGA 2BMXA 3HY2A 3D6IA 4FO5A 1TI3A 4KW6A 1TJDA 3D22A 2CAQA 2VM2A 1F37A 4EVMA 4MK3A 3SBCA 5IM9A 1JLVA 1TK8B 1YKAA 4RQXA 1M0UA 1PA3A 1R5PA 3GH9A 4KSMA 2XBIA 1EGRA 2Z9SA 3I9V2 3N5OA 4MJAA 2VCXA 2MZCA 3EU3A 4KF9A 10GSA 4IP1A 1XWBA 3PGTA 2AJQB 3HHVA 1SK1A 2C0EA 4BVXA 2HZFA 2R3XA 1S3DA 4AJ8A 2JZRA 1PL2A 3GHAA 4A5PA 4EDYA 3TKQA 1X5DA 4AF2A 2GZYA 1FAAA 4L0WA 3Q6OA 1WPIA 2KP2A 1OC9A 4Q5RA 4FYCA 4G10A 5ID2A 3D4MA 5J5NA 2L5LA 2R2JA 2HSMA 2H19A 1TOFA 4NAXA 2ES7A 4AJ6A 3GTUA 6GSWA 4KGIA 1NM3A 1U6TA 1WIKA 4LLRA 4OMVA 2FGXA 4PX1A 2CVDA 5LNKe 4Q5FA 3IK7A 2JL4A 2DJKA 2LUSA 4IKHA 4OFNA 4JBBA 4V2NA 2VOCA 4F82A 3CXGA 5ENUA 3GL5A 1X5EA 3VLNA 3L0HA 3DKSA 5G30A 1RQMA 4FYUA 2B5YA 2R0PA 2DLXA 3MYDA 4MJBA 2ZNMA 1Z6MA 3M9KA 1YKCA 1KEBA 4JE1A 4ZL9A 5BMUA 2VL2C 3M8NA 3WGEA 3UBLA 2AAWA 4K2DA 5D8IA 3KH9A 1F3AA 3MDKA 3IDVA 3PH9A 3GFKA 4F03A 1K0DA 5GAND 3QOUA 3JCML 1T4ZA 2YN1A 1LU4A 4EC0A 2GQMA 3I43A 3O3TA 1Y25A 2CQ9A 1A2MA 1SD9A 3ME8A 1YJ6A 1DSBA 4OO4A 5ECIB 2FLSA 3F4TA 3QPMA 3VK9A 4RI7A 2QA2A 2XC2A 1UC7A 3LJRA 2JADA 4JR4A 2E0QA 2VCWA 2FCHA 4OD7A 3EMXA 3VFIA 3M0FA 2L6CA 3DYRA 2MMOA 4WKWA 4F2IA 4JEDA 3QFBC 2FD3A 2YNXA 1ACVA 2PVOC 4EKZA 1XW6A 1GTIA 2AUVA 2WZ9A 4WBRD 1K3YA 1X0RA 1TDIA 2NTOA 3K8NA 2H1BA 1KTEA 2WDUA 3A2WA 4L0UA 4XRAA 3HJOA 2YP6A 3VPTA 3F6FA 2K8VA 4WR5A 1MDIA 2JSYA 5GSSA 1V2AA 3QD9A 4ECJA 2OJLA 4NWYA 2H70A 4HEA2 1VRSD 1GLPA 4BA7A 2CX3A 5JWOB 3ZL5A 2H8LA 1A23A 3UIWA 1K0NA 3OR5A 3FRCA 3TKPA 1M7TA 4MPFA 3F4SA 2NVLA 4WF4A 3KZQA 4G19A 2HT9A 3VURA 4K8MA 2HI7A 3GX0A 2OA7A 1EEMA 4TR3A 2WB9A 4WBJA 4LMVA 1WWJA 3ZFLA 4TRXA 4NHZA 2MBSA 1FB0A 5DAKB 2H01A 1TI1A 4IJIA 4TOPA 2B7KA 19GSA 1YF0A 1K0BA 4TXOA 3H4KA 8GSSA 3UAPA 3TJGA 1A0RP 5IO2A 4XS1A 2VLUA 1GRXA 2EIOA 4RQRA 2C1YA 2V2GA 1XW5A 1M2DA 4IQ1A 2CVBA 4TR4A 1N8JA 2A2PA 2L4QA 1TU8A 4GCIA 1T4YA 3KGKA 2HNLA 11GSA 1Q4JA 2GT6A 3DEXA 2CV4A 2EIRA 4EL1A 2YWOA 5HQPA 5DDLA 2B7JA 5KOXA 1EZKA 5IMZA 1SK0A 5DALA 2HLSA 2VD1A 3KEBA 3TKSE 3CMIA 5KN0A 1X9SB 3L9SA 4KDYA 3DWVA 4QL9A 2IFQA 3C7MA 2R4VA 3GV1A 2FWFA 3DVWA 5IPGA 3QR6A 4JU5A 4ACSA 1U88A 2HRAA 5F8BA 5DVBA 4ECIA 2LJKA 2ZCTA 5AGYA 4KE3A 5A4WA 3IHQA 5D9XA 1DE2A 2GZZA 1X9WB 6GSXA 3H93A 3FR9A 3WT1A 5D73A 5BRTA 1KBNA 3P7XA 1WJKA 4KCAA 1XW9A 3L4NA 3QAVA 3CYNA 5IO0A 2OADA 4TR1B 1OYJA 4HQZA 3LW9A 5A4VA 4G0LA 12GSA 5G1KA 2LQOA 1TP9A 4POMA 3U6VA 2CT6A 2K18A 3IE3A 1FVJA 14GSA 1TRSA 1XWKA 3KH7A 18GSA 3H8QA 2OBIA 3L9VA 2YJHA 4ML1A 2PMTA 2NDOA 3LYPA 2RIIA 2A2RA 3CSIA 4XS4A 5CRWA 4DSRA 4BWQA 3CRUA 2OBKA 2B5EA 1I9DA 2RLIA 3LYKA 5ECSA 1BG5A 1H75A 4J57E 2PERA 1GSDA 2LRTA 3EWLA 2F51A 3LSZA 1AIUA 4HJ2A 1G6WA 3GKKA 4ML6A 3ZMKA 4USSA 2YWMA 4IW9A 5G5EA 1OVNA 3M1GA 1PMTA 2QKEA 1F2EA 3EINA 5IMAA 1K0CA 1MD4A 1ZCPA 2F8AA 1R5AA 2K6VA 4QQ7A 2H76A 5CRDA 1Y6EA 4F9ZA 1NW2A 1BEDA 2HYXA 3F4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GUR A;  1J0F A;  2FWG A;  2HXK A;  4HU9 A;  5HR0 A;  1FO5 A;  3GNJ A;  5D9W A;  1HQO A;  2LRC A;  1T8E B;  2B5X A;  3E0U A;  1TTZ A;  2IMD A;  2GVP A;  4KND A;  2O89 A;  4IQA A;  4L5O A;  3HDC A;  3KIJ A;  13GS A;  4POK A;  4PNG A;  3SWL A;  2LKU A;  4GRF A;  2IMI A;  3LFL A;  1F9M A;  1OE8 A;  1THX A;  4FIW A;  1QQ2 A;  1X5C A;  2XPD A;  2V41 A;  5J3R A;  1SL0 B;  5DCH A;  1B9X C;  1XWC A;  2PN8 A;  3HZ4 A;  1GTB A;  1M2B A;  3LQ7 A;  1QK8 A;  2I3Y A;  3UAR A;  2TIR A;  3ERF A;  3DVX A;  1BJX A;  2H74 A;  1AC1 A;  5HR1 A;  5J4U A;  2QGV A;  2H73 A;  4V2L A;  2PPT A;  1GL8 A;  5IMD A;  5CNW A;  2JZS A;  4KX4 A;  3TDG A;  17GS A;  5IIZ A;  1G0T A;  1QUW A;  5CYY A;  4WEY A;  5DQS A;  4MZC A;  1EWX A;  3P8W A;  3TCO A;  3TRP A;  1YQ1 A;  4N0V A;  2HSH A;  1W4V A;  1LBK A;  1OC8 A;  4KAE A;  1ON4 A;  1B4Q A;  2MMZ A;  3W8S A;  4ZB8 A;  5DQY A;  3D0Z A;  2H72 A;  5H5S A;  2F3M A;  3BCK A;  1M2A A;  1UVZ A;  5CRG A;  4LL1 B;  1PD2 1;  2JZT A;  1SD8 A;  1ZOF A;  1K3O A;  3N9J A;  1XVW A;  3TJF A;  2LEG A;  1N2A A;  4ZL8 A;  3GH6 A;  1E2Y A;  3WGX A;  2VAF A;  1OC9 B;  1V40 A;  3FHK A;  3HXS A;  5HR2 A;  5ID2 B;  1XVQ A;  4PXO A;  2JU5 A;  2RM6 A;  3BCI A;  1HYU A;  5F06 A;  3M3M A;  3HCZ A;  3GTU B;  1SYX A;  2G0F A;  1O73 A;  3RPN A;  3KTB A;  1MDK A;  4YH2 A;  4DSQ A;  1A8L A;  3RAZ A;  2C3N A;  5A5K A;  3J7Y k;  1Z5Y E;  2WGR A;  2P0G A;  3BOA A;  1EEJ A;  1TXX A;  1ILO A;  2H6X A;  1GSY A;  3QDN A;  4Q5Q A;  2RUF A;  2HSY A;  4YAP A;  1I5G A;  5FT3 A;  3UVT A;  2IMF A;  3ZVJ D;  4HZ2 A;  3KD0 A;  2GT5 A;  4TW5 A;  1G7O A;  2QSI A;  2DBC A;  4GWR A;  1TU7 A;  4KB3 A;  2H71 A;  5INY A;  2BTO T;  2OE1 A;  5CRE A;  5D9V A;  2GZP A;  4GSS A;  3F3R A;  5LD0 A;  3O6T A;  3NIV A;  3H1N A;  3W8J A;  3VPQ A;  2VL9 A;  3HKR A;  1QGV A;  2LV3 A;  4GQC A;  2KOK A;  1PKW A;  3DD3 A;  1K0A A;  1ZYQ B;  4YQV A;  1GUK A;  2L6D A;  4CW9 A;  5C04 A;  1XPV A;  1T3B A;  2I1U A;  1GSF A;  1HNB A;  1AQW A;  1U3A A;  1XOA A;  5KN1 A;  3RHB A;  4K6X A;  4AJ7 A;  4BL7 A;  1GTA A;  2PVQ A;  2YV7 A;  3HD5 A;  2HFD A;  1VF4 A;  2DIY A;  2FNO A;  2O85 A;  3GKX A;  3QAW A;  3CRT A;  4ZB6 A;  3LOR A;  6GSY A;  4N0Z A;  3KMO A;  3TKS A;  1AW9 A;  1RW1 A;  3O76 A;  3ZML A;  3S9F A;  1UN2 A;  3C8E A;  2PU9 C;  1T7P B;  4NMU A;  1SJZ A;  4N10 A;  2N5A A;  2GGT A;  2DJJ A;  1ST9 A;  2O8V B;  1JZR A;  3IC4 A;  5ELG A;  5KN3 A;  1V9W A;  1ML6 A;  2C0F A;  5J9C A;  1VF1 A;  3ZYW A;  5G1L A;  1USB A;  3EVI A;  5A4U A;  4PGT A;  3TRX A;  2O7K A;  1GUH A;  4POB A;  2VCZ A;  5B8B A;  2KLX A;  1EP8 A;  3TJJ A;  3TJB A;  3MAK A;  2WCI A;  1PX7 A;  1ZL9 A;  4K0G A;  3HJP A;  4EXJ A;  3FEU A;  1M99 A;  2YPM A;  4JZQ A;  3ZIT A;  1O8X A;  5IMF A;  3ZLP A;  3C73 A;  4E8E A;  4G9H A;  1X9M B;  1FHE A;  2BJX A;  4HJM A;  3MWH A;  4PQI A;  5H5Q A;  5ELA A;  5ECQ B;  2RUE A;  16GS A;  3I6A A;  2PWJ A;  4ISD A;  4LA1 A;  2ON5 A;  2LQQ A;  5GAP D;  1YF1 A;  2P5R A;  4OWY A;  1K3L A;  2WJU A;  1CQH A;  1W89 A;  3MSZ A;  5B7C A;  1Z3E A;  1MTC A;  4TXO B;  1URM A;  3IXR A;  2FA4 A;  2MMA A;  4IJ3 A;  4Z7X A;  2DIZ A;  20GS A;  1GLQ A;  5J9B A;  1B48 A;  1B8X A;  3TUE A;  1O85 A;  2ALB A;  3ERW A;  1SEN A;  4MA9 A;  1O6J A;  4DVC A;  1HD2 A;  3ZVJ A;  2IMK A;  4MLY A;  2REM A;  4OO5 A;  2I4A A;  3L9U A;  2X8G A;  1PX6 A;  4ZBD A;  2C4J A;  1R4W A;  2R5G A;  3FR3 A;  2H1A A;  1GP1 A;  4MAB A;  4EF0 A;  2YJ7 A;  1DBY A;  2D2Z A;  3F6D A;  3LEF A;  3U5R E;  4GTU A;  4IBP A;  2LJR A;  1OE7 A;  2DJ0 A;  5DAL B;  3G7J A;  2F8F A;  3CTF A;  4YQM A;  3TKR A;  1BQ7 A;  2HZE A;  1ZMA A;  4ECB A;  3KXO A;  2VCQ A;  1A2J A;  1BAY A;  1SL2 B;  5CO3 A;  3KJY A;  2YV9 A;  2IFQ B;  5JCG A;  1SKS B;  2K8S A;  3HVS A;  2VL2 A;  5COH A;  3UEM A;  1YEP A;  3LGC A;  3F8U A;  1A8Y A;  1MDJ A;  1ERW A;  2E2G A;  5HFG A;  2M72 A;  5CP1 A;  2VL3 A;  4XTS A;  2N5F A;  1MD3 A;  5JWQ B;  1F3B A;  4K7O A;  3HVX A;  3GIX A;  3QFA C;  2X99 A;  4PUF C;  2DMM A;  2MYG A;  3UJ1 A;  4I8B A;  5FWG A;  3FW2 A;  1TRW A;  4O5R A;  2LJA A;  2J23 A;  1AUC A;  3ME7 A;  1O81 A;  1SYR A;  2GQK A;  4D73 A;  3BBY A;  4IHU A;  1DUG A;  2V6K A;  3CTG A;  2FUG 2;  4TR0 A;  3D5J A;  4HOJ A;  4LMW A;  1C72 A;  3FZA A;  3D4T A;  3GMF A;  2B3S A;  3DGQ A;  3R2Q A;  2TRC P;  2PGT A;  1GSU A;  5C00 A;  5CAX A;  3IRA A;  2I81 A;  4KDU A;  4XS4 B;  4FH8 A;  5GZZ B;  4O92 A;  2EIQ A;  2YWI A;  4ILF A;  3RHC A;  1GSS A;  5ECP B;  5D93 A;  4IP6 A;  4CDO A;  1M9B A;  1CQG A;  3G7I A;  1SK2 A;  2A4V A;  3IV4 A;  2M46 A;  3FR6 A;  4IEL A;  4ZXG A;  1NHO A;  2L5O A;  4GLT A;  2K9F A;  4K7N A;  3UBK A;  4MJE A;  2YAN A;  1XBS A;  4DSS A;  3FKF A;  1PSQ A;  2GS3 A;  1EOG A;  1S3A A;  1Z9H A;  2L57 A;  7GSS A;  4MZB A;  2HRF A;  1QFN A;  1JZD A;  2FWH A;  3E3E A;  1K0M A;  2DML A;  4IGJ A;  2GSQ A;  3EUR A;  3TB2 A;  1GWC A;  5F05 A;  2H75 A;  3GX8 A;  1EP7 A;  3HYP A;  1V98 A;  1XFL A;  4XHM A;  5D96 A;  2DJ3 A;  4N11 A;  1HNC A;  4K7I A;  4X1U A;  1GTU A;  1GSE A;  4V2M A;  1GUL A;  1U3I A;  2FWE A;  1RK4 A;  3G9B A;  1HNA A;  2VD0 A;  1GSQ A;  1UA5 A;  5B6M A;  2LRN A;  1YDK A;  1IYH A;  2VO4 A;  1E6B A;  4L5L A;  1ABA A;  5F07 A;  5IQY A;  4AGS A;  4WR4 A;  4EDZ A;  2XBQ A;  4RUV A;  5E59 A;  3TRQ A;  1FOV A;  2DC5 A;  1XCC A;  3VI7 A;  4PQ1 A;  3GA4 A;  1TW9 A;  5JWR B;  3F0I A;  3DXB A;  4XS6 A;  4HZ4 A;  3GYK A;  1SL1 B;  3QCP A;  2YWN A;  5JCU A;  3TKS C;  1R7H A;  3APO A;  2IL3 A;  1T1V A;  4I2T A;  4GQF A;  3VWU A;  3LWA A;  1JLW A;  3J7Y b;  6GSV A;  2GSR A;  5AIS A;  2O87 A;  1AXD A;  2HRN A;  4BVY A;  1EV4 A;  2OKA A;  4HU7 A;  2M80 A;  1NSW A;  5DJL A;  3FK8 A;  3RBT A;  1FG4 A;  1AQV A;  1A0F A;  1YEX A;  2CVK A;  3E9J B;  2VLT A;  3NZN A;  2XHF A;  3AY8 A;  2B1L A;  5IOX A;  3IA1 A;  1A2L A;  3VI5 A;  3KP8 A;  3HVV A;  3GKN A;  4MPG A;  4I5Q A;  4KUN A;  3FZ5 A;  4GST A;  1Z7P A;  5HR3 A;  2C3T A;  2IN3 A;  2F9S A;  3UVH A;  4MF6 A;  2CA8 A;  1GUM A;  3KM6 A;  5KN2 A;  5JCW A;  3V1W A;  1EV9 A;  1FB6 A;  4V1A p;  4YQU A;  2DSA A;  4EO3 A;  4ZL7 A;  3A5W A;  3QMX A;  3GL3 A;  3ZTL A;  2VCT A;  3C1S A;  4MJC A;  4ULX A;  5IOW A;  3A2X A;  4TN8 A;  3F63 A;  4P3Y B;  3ZRD A;  2N5B A;  2LTK A;  4XCS A;  5B6N A;  2LNS A;  4HDE A;  4OFM A;  3VWW A;  1GH2 A;  5ECR B;  4YAV A;  1G7E A;  5FHI A;  4RI6 A;  4FYB A;  2PUK C;  5ECM B;  4GSN A;  2E2M A;  3ZRE A;  1G6Y A;  2HE3 A;  1J08 A;  2L59 A;  4E8H A;  1OKT A;  1OAZ A;  5EVO A;  3HJM A;  1WRY A;  2B6M A;  2H30 A;  4PNF A;  3APQ A;  1R26 A;  22GS A;  4I2U A;  4MP4 A;  4ZIJ A;  1GNE A;  1ERT A;  4F0C A;  3Q74 A;  2GQL A;  4MZW A;  1WMJ A;  3GUS A;  3EC3 A;  5EPF A;  2I9H A;  1F6M C;  6GSS A;  2VLV A;  3HA9 A;  1GNW A;  5CRH A;  1PN9 A;  4MH3 A;  2GST A;  3GST A;  3EE2 A;  5J41 A;  2X8C A;  3PR8 A;  4JR6 A;  4TKY A;  3G7Y A;  4NV2 A;  1V57 A;  1MEK A;  1U87 A;  1TRU A;  3GKM A;  1YZX A;  1B4P A;  1B9Y C;  2H0H A;  4NPB A;  4V1A g;  5EL8 A;  1BX9 A;  2AYT A;  5E4W A;  3VWX A;  3ZIJ A;  4J2F A;  3WYW A;  3WD6 A;  4O32 A;  3A2V A;  4MF7 A;  4TXV A;  3KMN A;  1PL1 A;  1OC3 A;  3LG6 A;  4KA0 A;  4HS1 A;  4PUR A;  2AB6 A;  4KSO A;  2H6Y A;  1WOU A;  2G2Q A;  4OCE A;  1QXH A;  5AIX A;  4LL4 B;  4NXI A;  2FA8 A;  5HFI A;  5IMC A;  5EY6 A;  5G2Z A;  2VUP A;  4K9Z A;  1Z7R A;  1K0O A;  4PQH A;  1TRV A;  1ERU A;  4NHW A;  2IME A;  5ECO B;  1JFU A;  1EOH A;  1Q98 A;  2C3Q A;  1ZZY A;  2H0G A;  4ID0 A;  5IMV A;  6GSU A;  4MCU A;  2C0G A;  3TOU A;  4WF5 A;  9GSS A;  2H66 A;  3A3T A;  2OE0 A;  2EC4 A;  4N30 A;  4PUA A;  3FY7 A;  1ERV A;  1IYI A;  4G2E A;  2ZUP A;  2DJ2 A;  2VM1 A;  4GXZ A;  5KEJ A;  4K1F A;  2RM5 A;  1VF2 A;  2J9H A;  2GLR A;  3KP9 A;  3UMA A;  2ON7 A;  2NPB A;  1THO A;  4ECC A;  5H5R A;  2MBT A;  2E7P A;  1SJI A;  4BPY A;  3ZZX A;  5HFK A;  2C0D A;  2P5Q A;  5DAK A;  1V58 A;  3DRN A;  4MMM A;  2PBJ A;  4L8E A;  1PGT A;  3I69 A;  3TJK A;  1ZYE A;  3MNG A;  1A24 A;  1XWA A;  2IPA A;  4K0N A;  2H1D A;  4ZBA A;  2OE3 A;  4HQS A;  1VF3 A;  2HZE B;  2C8U A;  1XOB A;  1T00 A;  2AV4 A;  1AQX A;  3LXT A;  3CSJ A;  5F0G A;  4WXT A;  1XIY A;  2WFC A;  1XXU A;  2V32 A;  3EU4 A;  1H4O A;  5ECK B;  2NBS A;  3GRX A;  1LJR A;  1JZW A;  2V1M A;  5G31 A;  3LXZ A;  3EMP A;  1AAZ A;  1WP0 A;  1XZO A;  3FZ9 A;  4J56 E;  2X64 A;  1O8W A;  1TK5 B;  4BWS A;  1VGL A;  4ZB9 A;  4POL A;  2P31 A;  4IS0 A;  2C80 A;  4EUY A;  2YCD A;  4WET A;  1SU9 A;  3APS A;  1YY7 A;  3PIN A;  2VIM A;  2OAC A;  2VCV A;  4O7H A;  3W6G A;  4D73 B;  4H86 A;  5G5F A;  2H1G A;  3IAS 2;  3ZFB A;  5GST A;  2CAI A;  3WT2 A;  3HZ8 A;  2CZ3 A;  1SKW B;  4HI7 A;  3RDW A;  2DJ1 A;  3US3 A;  2XPE A;  2B1K A;  4GF0 A;  5ECN B;  4HUA A;  4ZIL A;  5ECH B;  1ZGN A;  1QMV A;  4TR1 A;  2CX4 A;  3CBU A;  5DBQ A;  4I6X A;  2LST A;  3C71 A;  3CSH A;  5DJM A;  2MMN A;  1NHY A;  5DCG A;  1PQN A;  2WS2 A;  3IBH A;  1JHB A;  3D21 A;  2GDR A;  4KH7 A;  2KUC A;  5AN1 A;  2IJY A;  5B8A A;  5ECL B;  2KHP A;  2JSZ A;  3L78 A;  3GSS A;  1OKD A;  3NOF A;  3H79 A;  5L71 A;  3KCM A;  2L4C A;  1SKR B;  4DSS B;  2IWT A;  4CHS A;  3F3Q A;  4IN0 A;  1PRX A;  2JAC A;  4OCF A;  3BD2 A;  2TRX A;  1DE1 A;  6GST A;  4MDC A;  3DML A;  2QC7 A;  5IPH A;  4F0B A;  2LS5 A;  2CZ2 A;  3GN3 A;  3P2A A;  3P90 A;  1FVK A;  2R6K A;  2A2S A;  3BJ5 A;  2KP1 A;  5LCZ A;  1O7U A;  1EGO A;  5AIV A;  3F9U A;  3UOM A;  4X43 A;  3RPP A;  4TVE A;  3IOS A;  3C1R A;  3M9J A;  3ZIV A;  5ABR A;  4DEJ A;  3IK9 A;  4KDX A;  1JZO A;  1WE0 A;  5D9T A;  1FW1 A;  2IIY A;  3UL3 A;  2YZH A;  2YZU A;  4EE0 A;  3IPZ A;  1TKD B;  3ERG A;  2AHE A;  2GTU A;  1BYE A;  2V6O A;  2H6Z A;  3ED3 A;  1TK0 B;  4XRD A;  3QAG A;  1Z6N A;  3Q18 A;  4QL7 A;  3IR4 A;  4ZBB A;  2H0I A;  2X8H A;  3KTL A;  4JRR A;  3FZ4 A;  3VWV A;  4MH2 A;  1S3C A;  4MF5 A;  3Q19 A;  2WRT A;  3TOT A;  4KCE A;  3TGZ A;  4OFT A;  3EYT A;  2R37 A;  4Q5N A;  2FY6 A;  2LNT A;  2WUL A;  3WGD A;  3IAM 2;  4X0X A;  1SJ6 A;  3FYG A;  2YOI A;  4NV5 A;  4IVF A;  4I97 A;  3DIE A;  1XWG A;  2FHE A;  4XIH A;  1PKZ A;  1J9B A;  2GSS A;  1M9A A;  3ISO A;  1KNG A;  2BMX A;  3HY2 A;  3D6I A;  4FO5 A;  1TI3 A;  4KW6 A;  1TJD A;  3D22 A;  2CAQ A;  2VM2 A;  1F37 A;  4EVM A;  4MK3 A;  3SBC A;  5IM9 A;  1JLV A;  1TK8 B;  1YKA A;  4RQX A;  1M0U A;  1PA3 A;  1R5P A;  3GH9 A;  4KSM A;  2XBI A;  1EGR A;  2Z9S A;  3I9V 2;  3N5O A;  4MJA A;  2VCX A;  2MZC A;  3EU3 A;  10GS A;  4IP1 A;  1XWB A;  3PGT A;  2AJQ B;  3HHV A;  1SK1 A;  2C0E A;  4BVX A;  2HZF A;  2R3X A;  1S3D A;  4AJ8 A;  2JZR A;  1PL2 A;  3GHA A;  4EDY A;  3TKQ A;  1X5D A;  4AF2 A;  2GZY A;  1FAA A;  4L0W A;  3Q6O A;  1WPI A;  2KP2 A;  1OC9 A;  4Q5R A;  4FYC A;  4G10 A;  5ID2 A;  3D4M A;  5J5N A;  2L5L A;  2R2J A;  2H19 A;  1TOF A;  4NAX A;  2ES7 A;  4AJ6 A;  3GTU A;  6GSW A;  4KGI A;  1NM3 A;  1U6T A;  1WIK A;  4LLR A;  4OMV A;  2FGX A;  4PX1 A;  2CVD A;  5LNK e;  4Q5F A;  3IK7 A;  2JL4 A;  2DJK A;  2LUS A;  4IKH A;  4OFN A;  4JBB A;  4V2N A;  2VOC A;  4F82 A;  3CXG A;  5ENU A;  3GL5 A;  1X5E A;  3VLN A;  3L0H A;  3DKS A;  5G30 A;  1RQM A;  4FYU A;  2B5Y A;  2DLX A;  4MJB A;  2ZNM A;  1Z6M A;  3M9K A;  1YKC A;  1KEB A;  4JE1 A;  4ZL9 A;  2VL2 C;  3M8N A;  3WGE A;  3UBL A;  2AAW A;  4K2D A;  5D8I A;  3KH9 A;  1F3A A;  3MDK A;  3IDV A;  3PH9 A;  3GFK A;  4F03 A;  1K0D A;  5GAN D;  3QOU A;  3JCM L;  1T4Z A;  2YN1 A;  1LU4 A;  4EC0 A;  2GQM A;  3I43 A;  3O3T A;  1Y25 A;  2CQ9 A;  1A2M A;  1SD9 A;  3ME8 A;  1YJ6 A;  1DSB A;  4OO4 A;  5ECI B;  2FLS A;  3F4T A;  3QPM A;  3VK9 A;  4RI7 A;  2XC2 A;  1UC7 A;  3LJR A;  2JAD A;  4JR4 A;  2E0Q A;  2VCW A;  2FCH A;  4OD7 A;  3EMX A;  3VFI A;  3M0F A;  2L6C A;  3DYR A;  2MMO A;  4WKW A;  4F2I A;  4JED A;  3QFB C;  2FD3 A;  2YNX A;  1ACV A;  2PVO C;  4EKZ A;  1XW6 A;  1GTI A;  2AUV A;  2WZ9 A;  4WBR D;  1K3Y A;  1X0R A;  1TDI A;  2NTO A;  3K8N A;  2H1B A;  1KTE A;  2WDU A;  3A2W A;  4L0U A;  4XRA A;  3HJO A;  2YP6 A;  3VPT A;  3F6F A;  2K8V A;  4WR5 A;  1MDI A;  2JSY A;  5GSS A;  1V2A A;  3QD9 A;  4ECJ A;  2OJL A;  4NWY A;  2H70 A;  4HEA 2;  1VRS D;  1GLP A;  4BA7 A;  2CX3 A;  5JWO B;  3ZL5 A;  2H8L A;  1A23 A;  3UIW A;  1K0N A;  3OR5 A;  3FRC A;  3TKP A;  1M7T A;  4MPF A;  3F4S A;  2NVL A;  4WF4 A;  3KZQ A;  4G19 A;  2HT9 A;  3VUR A;  4K8M A;  2HI7 A;  3GX0 A;  2OA7 A;  1EEM A;  4TR3 A;  2WB9 A;  4WBJ A;  4LMV A;  1WWJ A;  3ZFL A;  4TRX A;  4NHZ A;  2MBS A;  1FB0 A;  5DAK B;  2H01 A;  1TI1 A;  4IJI A;  4TOP A;  2B7K A;  19GS A;  1YF0 A;  1K0B A;  4TXO A;  3H4K A;  8GSS A;  3UAP A;  3TJG A;  1A0R P;  5IO2 A;  4XS1 A;  2VLU A;  1GRX A;  2EIO A;  4RQR A;  2C1Y A;  2V2G A;  1XW5 A;  1M2D A;  4IQ1 A;  2CVB A;  4TR4 A;  1N8J A;  2L4Q A;  1TU8 A;  4GCI A;  1T4Y A;  3KGK A;  2HNL A;  11GS A;  1Q4J A;  2GT6 A;  3DEX A;  2CV4 A;  2EIR A;  4EL1 A;  2YWO A;  5HQP A;  5DDL A;  2B7J A;  1EZK A;  5IMZ A;  1SK0 A;  5DAL A;  2HLS A;  2VD1 A;  3KEB A;  3TKS E;  3CMI A;  5KN0 A;  1X9S B;  3L9S A;  4KDY A;  3DWV A;  4QL9 A;  2IFQ A;  3C7M A;  2R4V A;  3GV1 A;  2FWF A;  3DVW A;  5IPG A;  3QR6 A;  4JU5 A;  4ACS A;  1U88 A;  5F8B A;  5DVB A;  4ECI A;  2LJK A;  2ZCT A;  5AGY A;  4KE3 A;  5A4W A;  3IHQ A;  5D9X A;  1DE2 A;  2GZZ A;  1X9W B;  6GSX A;  3H93 A;  3FR9 A;  3WT1 A;  5D73 A;  1KBN A;  3P7X A;  1WJK A;  4KCA A;  1XW9 A;  3L4N A;  3QAV A;  3CYN A;  5IO0 A;  2OAD A;  4TR1 B;  1OYJ A;  4HQZ A;  5A4V A;  12GS A;  5G1K A;  2LQO A;  1TP9 A;  4POM A;  3U6V A;  2CT6 A;  2K18 A;  3IE3 A;  1FVJ A;  14GS A;  1TRS A;  1XWK A;  3KH7 A;  18GS A;  3H8Q A;  2OBI A;  3L9V A;  2YJH A;  4ML1 A;  2PMT A;  2NDO A;  3LYP A;  2RII A;  2A2R A;  3CSI A;  4XS4 A;  5CRW A;  4DSR A;  4BWQ A;  3CRU A;  2OBK A;  2B5E A;  1I9D A;  2RLI A;  3LYK A;  5ECS A;  1BG5 A;  1H75 A;  4J57 E;  2PER A;  1GSD A;  2LRT A;  3EWL A;  2F51 A;  3LSZ A;  1AIU A;  4HJ2 A;  1G6W A;  3GKK A;  4ML6 A;  3ZMK A;  2YWM A;  4IW9 A;  5G5E A;  1OVN A;  3M1G A;  1PMT A;  2QKE A;  1F2E A;  3EIN A;  5IMA A;  1K0C A;  1MD4 A;  1ZCP A;  2F8A A;  1R5A A;  2K6V A;  4QQ7 A;  2H76 A;  5CRD A;  1Y6E A;  4F9Z A;  1NW2 A;  1BED A;  2HYX A;  3F4R A; 
#chains in the Genus database with same CATH topology
 3GUR A;  1J0F A;  2FWG A;  2HXK A;  4HU9 A;  5HR0 A;  1FO5 A;  3GNJ A;  5D9W A;  1HQO A;  2LRC A;  1T8E B;  2B5X A;  3E0U A;  1TTZ A;  2IMD A;  2GVP A;  4KND A;  2O89 A;  4IQA A;  4L5O A;  3HDC A;  3KIJ A;  13GS A;  4POK A;  4PNG A;  3SWL A;  2LKU A;  4GRF A;  2IMI A;  3LFL A;  1F9M A;  1OE8 A;  1THX A;  4FIW A;  1QQ2 A;  1X5C A;  2XPD A;  2V41 A;  5J3R A;  1SL0 B;  5DCH A;  1B9X C;  1XWC A;  2PN8 A;  3HZ4 A;  1GTB A;  1M2B A;  3LQ7 A;  1QK8 A;  2I3Y A;  3UAR A;  2TIR A;  3ERF A;  3DVX A;  1BJX A;  4Z2T A;  2H74 A;  1AC1 A;  5HR1 A;  5J4U A;  2QGV A;  2H73 A;  4V2L A;  2PPT A;  1GL8 A;  5IMD A;  5CNW A;  2JZS A;  4KX4 A;  3TDG A;  17GS A;  5IIZ A;  1G0T A;  1QUW A;  5CYY A;  4WEY A;  5DQS A;  4MZC A;  1EWX A;  3P8W A;  4G0K A;  3TCO A;  3TRP A;  1YQ1 A;  4N0V A;  2HSH A;  1W4V A;  1LBK A;  1OC8 A;  4KAE A;  1ON4 A;  1B4Q A;  2MMZ A;  3W8S A;  4ZB8 A;  5DQY A;  3D0Z A;  2H72 A;  5H5S A;  2F3M A;  3BCK A;  1M2A A;  1UVZ A;  5CRG A;  4CY8 A;  4BVX B;  4LL1 B;  1PD2 1;  2JZT A;  1SD8 A;  1ZOF A;  1K3O A;  3N9J A;  1XVW A;  3TJF A;  2LEG A;  1N2A A;  4ZL8 A;  3GH6 A;  1E2Y A;  4MNN A;  3WGX A;  2VAF A;  1OC9 B;  1V40 A;  3FHK A;  3HXS A;  5HR2 A;  5ID2 B;  1XVQ A;  4PXO A;  2JU5 A;  2RM6 A;  3BCI A;  1HYU A;  5F06 A;  3M3M A;  3HCZ A;  3GTU B;  1SYX A;  2G0F A;  1O73 A;  3RPN A;  3KTB A;  1MDK A;  4YH2 A;  4DSQ A;  1A8L A;  2QA1 A;  3RAZ A;  2C3N A;  5A5K A;  3J7Y k;  1Z5Y E;  2WGR A;  2P0G A;  3BOA A;  1EEJ A;  1TXX A;  1ILO A;  2H6X A;  1GSY A;  3QDN A;  4Q5Q A;  2RUF A;  2HSY A;  4YAP A;  1I5G A;  5FT3 A;  3UVT A;  2IMF A;  3ZVJ D;  4HZ2 A;  3KD0 A;  2GT5 A;  4TW5 A;  4YKG A;  1G7O A;  2QSI A;  2DBC A;  4GWR A;  1TU7 A;  4KB3 A;  2H71 A;  5INY A;  2BTO T;  2OE1 A;  5CRE A;  5D9V A;  2GZP A;  4GSS A;  3F3R A;  5LD0 A;  3O6T A;  3NIV A;  3H1N A;  3W8J A;  3VPQ A;  2VL9 A;  3HKR A;  1QGV A;  2LV3 A;  4PTS A;  4GQC A;  2KOK A;  1PKW A;  3DD3 A;  1K0A A;  1ZYQ B;  4YQV A;  1GUK A;  2L6D A;  4CW9 A;  5C04 A;  1XPV A;  1T3B A;  2I1U A;  1GSF A;  1HNB A;  1AQW A;  1U3A A;  1XOA A;  5KN1 A;  3RHB A;  4K6X A;  4AJ7 A;  4BL7 A;  1GTA A;  4K2X A;  2PVQ A;  2YV7 A;  3HD5 A;  2HFD A;  1VF4 A;  2DIY A;  2FNO A;  2O85 A;  3GKX A;  3QAW A;  3IHG A;  3CRT A;  4ZB6 A;  3LOR A;  6GSY A;  4N0Z A;  3KMO A;  3TKS A;  1AW9 A;  1RW1 A;  3O76 A;  3ZML A;  3S9F A;  1UN2 A;  3C8E A;  2PU9 C;  1T7P B;  4NMU A;  1SJZ A;  4N10 A;  2N5A A;  2GGT A;  2DJJ A;  1ST9 A;  2O8V B;  1JZR A;  3IC4 A;  5ELG A;  5KN3 A;  1V9W A;  1ML6 A;  2C0F A;  5J9C A;  1VF1 A;  3ZYW A;  5G1L A;  1USB A;  3EVI A;  5A4U A;  4PGT A;  3TRX A;  2O7K A;  1GUH A;  4POB A;  2VCZ A;  5B8B A;  2KLX A;  1EP8 A;  3TJJ A;  3TJB A;  3MAK A;  2WCI A;  1PX7 A;  1ZL9 A;  4K0G A;  3HJP A;  4EXJ A;  3FEU A;  1M99 A;  2YPM A;  4ICY A;  4JZQ A;  3ZIT A;  2A4H A;  1O8X A;  5IMF A;  3ZLP A;  3C73 A;  4E8E A;  4G9H A;  1X9M B;  1FHE A;  2BJX A;  4HJM A;  3MWH A;  4PQI A;  5H5Q A;  5ECQ B;  2RUE A;  3I6A A;  16GS A;  5ELA A;  2PWJ A;  4ISD A;  4LA1 A;  2ON5 A;  2LQQ A;  5GAP D;  5KOW A;  1YF1 A;  2P5R A;  4OWY A;  1K3L A;  2WJU A;  1CQH A;  2DKI A;  1W89 A;  3MSZ A;  5B7C A;  1Z3E A;  1M3I A;  1MTC A;  4TXO B;  1URM A;  3IXR A;  2FA4 A;  3PPU A;  2MMA A;  4IJ3 A;  4Z7X A;  3MIX A;  2DIZ A;  20GS A;  1GLQ A;  5J9B A;  1B48 A;  1B8X A;  3TUE A;  1O85 A;  2ALB A;  3ERW A;  1SEN A;  4MA9 A;  1O6J A;  4DVC A;  1HD2 A;  3ZVJ A;  2IMK A;  4MLY A;  2REM A;  4OO5 A;  2I4A A;  3L9U A;  2X8G A;  1PX6 A;  4ZBD A;  2C4J A;  1R4W A;  2R5G A;  3FR3 A;  2H1A A;  1GP1 A;  4MAB A;  4EF0 A;  2YJ7 A;  1DBY A;  2D2Z A;  3F6D A;  3LEF A;  3U5R E;  4GTU A;  4CY6 A;  4IBP A;  2LJR A;  1OE7 A;  2DJ0 A;  5DAL B;  3G7J A;  2F8F A;  3CTF A;  4YQM A;  3TKR A;  1BQ7 A;  2HZE A;  1ZMA A;  4ECB A;  3KXO A;  2VCQ A;  1A2J A;  1BAY A;  1SL2 B;  5CO3 A;  3KJY A;  2YV9 A;  2IFQ B;  5JCG A;  1SKS B;  2K8S A;  3HVS A;  2VL2 A;  5COH A;  3UEM A;  1YEP A;  3LGC A;  3F8U A;  1A8Y A;  1MDJ A;  1ERW A;  2E2G A;  5HFG A;  2M72 A;  5CP1 A;  2VL3 A;  4XTS A;  2N5F A;  1MD3 A;  5JWQ B;  1F3B A;  4K7O A;  3HVX A;  3GIX A;  3QFA C;  2X99 A;  4PUF C;  2DMM A;  2MYG A;  3UJ1 A;  4I8B A;  5FWG A;  3FW2 A;  1TRW A;  4O5R A;  2LJA A;  2J23 A;  1AUC A;  3ME7 A;  1O81 A;  1SYR A;  2GQK A;  4D73 A;  3BBY A;  4IHU A;  1DUG A;  2V6K A;  3CTG A;  2FUG 2;  4TR0 A;  2R0C A;  3D5J A;  4HOJ A;  4LMW A;  4Z2U A;  1C72 A;  3FZA A;  3D4T A;  3GMF A;  2B3S A;  3DGQ A;  3R2Q A;  2TRC P;  2PGT A;  1GSU A;  5C00 A;  5CAX A;  3IRA A;  2I81 A;  4KDU A;  4XS4 B;  4FH8 A;  5GZZ B;  4O92 A;  2EIQ A;  2YWI A;  4ILF A;  3RHC A;  1GSS A;  5ECP B;  5D93 A;  4IP6 A;  4CDO A;  1M9B A;  1CQG A;  3G7I A;  1SK2 A;  2A4V A;  3IV4 A;  2M46 A;  3FR6 A;  4IEL A;  4ZXG A;  1NHO A;  2L5O A;  4GLT A;  2K9F A;  4K7N A;  3UBK A;  4MJE A;  2YAN A;  1XBS A;  4DSS A;  3FKF A;  1PSQ A;  2GS3 A;  1EOG A;  1S3A A;  1Z9H A;  4Z2R A;  2L57 A;  7GSS A;  4MZB A;  2HRF A;  1QFN A;  1JZD A;  2FWH A;  3E3E A;  1K0M A;  2DML A;  4IGJ A;  2GSQ A;  3EUR A;  3TB2 A;  1GWC A;  5F05 A;  2H75 A;  3GX8 A;  1EP7 A;  3HYP A;  1V98 A;  1XFL A;  4XHM A;  5D96 A;  2DJ3 A;  4N11 A;  1HNC A;  4K7I A;  4X1U A;  4EIP A;  1GTU A;  1GSE A;  4V2M A;  1GUL A;  1U3I A;  2FWE A;  1RK4 A;  3G9B A;  1HNA A;  2VD0 A;  1GSQ A;  1UA5 A;  5B6M A;  2LRN A;  1YDK A;  1IYH A;  2VO4 A;  2X4A A;  3IC8 A;  1E6B A;  4L5L A;  1ABA A;  5F07 A;  5IQY A;  4AGS A;  4WR4 A;  4EDZ A;  2XBQ A;  4RUV A;  5E59 A;  3TRQ A;  1FOV A;  2DC5 A;  1XCC A;  3VI7 A;  4PQ1 A;  3GA4 A;  1TW9 A;  5JWR B;  3F0I A;  3DXB A;  4XS6 A;  4HZ4 A;  3GYK A;  1SL1 B;  3QCP A;  2UZ8 A;  2YWN A;  5JCU A;  3TKS C;  1R7H A;  3APO A;  2IL3 A;  1T1V A;  4I2T A;  4GQF A;  3VWU A;  3LWA A;  1JLW A;  3J7Y b;  6GSV A;  2GSR A;  5AIS A;  2O87 A;  1AXD A;  2HRN A;  4BVY A;  1EV4 A;  2OKA A;  4HU7 A;  2M80 A;  1NSW A;  5DJL A;  3FK8 A;  3RBT A;  1FG4 A;  1AQV A;  1A0F A;  1YEX A;  2CVK A;  3E9J B;  2VLT A;  3NZN A;  2XHF A;  3AY8 A;  2B1L A;  5IOX A;  3IA1 A;  4HSC X;  1A2L A;  3VI5 A;  3KP8 A;  3HVV A;  3GKN A;  4MPG A;  4I5Q A;  4KUN A;  3FZ5 A;  4GST A;  1Z7P A;  5HR3 A;  2C3T A;  2IN3 A;  2F9S A;  3UVH A;  4MF6 A;  3CQF A;  2CA8 A;  1GUM A;  3KM6 A;  5KN2 A;  5JCW A;  3V1W A;  1EV9 A;  1FB6 A;  4V1A p;  4YQU A;  2DSA A;  4EO3 A;  4K5S A;  4ZL7 A;  3A5W A;  3QMX A;  3GL3 A;  3ZTL A;  2VCT A;  3C1S A;  4MJC A;  4ULX A;  5IOW A;  3A2X A;  4TN8 A;  3F63 A;  4P3Y B;  3ZRD A;  2N5B A;  2LTK A;  4XCS A;  5B6N A;  2LNS A;  4HDE A;  4OFM A;  3VWW A;  1GH2 A;  5ECR B;  4YAV A;  1G7E A;  5FHI A;  4RI6 A;  4FYB A;  2PUK C;  5ECM B;  4GSN A;  2E2M A;  3ZRE A;  1G6Y A;  2HE3 A;  1J08 A;  2L59 A;  4E8H A;  1OKT A;  1OAZ A;  5EVO A;  3HJM A;  1WRY A;  2B6M A;  3R3E A;  2H30 A;  4PNF A;  3APQ A;  1R26 A;  22GS A;  4I2U A;  4MP4 A;  4ZIJ A;  1GNE A;  1ERT A;  4F0C A;  3Q74 A;  2GQL A;  4MZW A;  1WMJ A;  3GUS A;  3EC3 A;  4X4J A;  5EPF A;  2I9H A;  4BL7 B;  1F6M C;  6GSS A;  2VLV A;  3HA9 A;  1GNW A;  5CRH A;  1PN9 A;  4MH3 A;  3FMW A;  2GST A;  3GST A;  3EE2 A;  5J41 A;  2X8C A;  3PR8 A;  4JR6 A;  4TKY A;  3G7Y A;  4NV2 A;  1V57 A;  1MEK A;  1U87 A;  1TRU A;  3GKM A;  1YZX A;  1B4P A;  1B9Y C;  2H0H A;  4NPB A;  4V1A g;  5EL8 A;  1BX9 A;  2AYT A;  5E4W A;  3VWX A;  3ZIJ A;  2DKH A;  4J2F A;  2X49 A;  3WYW A;  3WD6 A;  4O32 A;  3A2V A;  4MF7 A;  4TXV A;  3KMN A;  1PL1 A;  1OC3 A;  3LG6 A;  4KA0 A;  4HS1 A;  4PUR A;  2AB6 A;  4KSO A;  2H6Y A;  1WOU A;  2G2Q A;  4OCE A;  1QXH A;  5AIX A;  4LL4 B;  4NXI A;  2FA8 A;  5HFI A;  5IMC A;  5EY6 A;  5G2Z A;  2VUP A;  4K9Z A;  1Z7R A;  1K0O A;  4PQH A;  1TRV A;  1ERU A;  4NHW A;  2IME A;  5ECO B;  1JFU A;  1EOH A;  4YKF A;  1ZYN A;  1Q98 A;  2C3Q A;  1ZZY A;  2H0G A;  4ID0 A;  5IMV A;  6GSU A;  4MCU A;  2C0G A;  3TOU A;  4WF5 A;  9GSS A;  2H66 A;  3A3T A;  2OE0 A;  2EC4 A;  4N30 A;  4PUA A;  3FY7 A;  1ERV A;  1IYI A;  4G2E A;  2ZUP A;  2DJ2 A;  4O5Q A;  2VM1 A;  4GXZ A;  5KEJ A;  4K1F A;  2RM5 A;  1VF2 A;  2J9H A;  2GLR A;  3KP9 A;  3UMA A;  2ON7 A;  2NPB A;  1THO A;  4ECC A;  5H5R A;  2MBT A;  2E7P A;  1SJI A;  4BPY A;  3ZZX A;  5HFK A;  2C0D A;  2P5Q A;  5DAK A;  1V58 A;  3DRN A;  4MMM A;  2PBJ A;  4L8E A;  1PGT A;  3I69 A;  3TJK A;  1ZYE A;  3MNG A;  4FQU A;  1A24 A;  1XWA A;  2IPA A;  4K0N A;  2H1D A;  4ZBA A;  2OE3 A;  4HQS A;  1VF3 A;  2HZE B;  2C8U A;  1XOB A;  1T00 A;  2AV4 A;  1AQX A;  3LXT A;  3CSJ A;  5F0G A;  4WXT A;  1XIY A;  2WFC A;  3A5I A;  1XXU A;  2V32 A;  3EU4 A;  1H4O A;  5ECK B;  2NBS A;  1FOH A;  3GRX A;  1LJR A;  4K5R A;  1JZW A;  2V1M A;  5G31 A;  3LXZ A;  3EMP A;  1AAZ A;  1WP0 A;  1XZO A;  3FZ9 A;  4J56 E;  2X64 A;  1O8W A;  1TK5 B;  4BWS A;  1VGL A;  4ZB9 A;  4POL A;  2P31 A;  4IS0 A;  2C80 A;  4EUY A;  2YCD A;  4WET A;  1SU9 A;  3APS A;  1YY7 A;  3PIN A;  2VIM A;  2OAC A;  2VCV A;  4O7H A;  1PN0 A;  3W6G A;  4D73 B;  4H86 A;  5G5F A;  2H1G A;  3IAS 2;  3ZFB A;  5GST A;  2CAI A;  3WT2 A;  3HZ8 A;  2CZ3 A;  1SKW B;  4HI7 A;  3RDW A;  2DJ1 A;  3US3 A;  2XPE A;  2B1K A;  4GF0 A;  5ECN B;  4HUA A;  4ZIL A;  5ECH B;  1ZGN A;  1QMV A;  4TR1 A;  2CX4 A;  3CBU A;  2HRK A;  5DBQ A;  4I6X A;  2LST A;  3C71 A;  3CSH A;  5DJM A;  2MMN A;  1NHY A;  5DCG A;  1PQN A;  2WS2 A;  3IBH A;  1JHB A;  3D21 A;  2GDR A;  4KH7 A;  2KUC A;  1ZYP A;  5AN1 A;  2IJY A;  5B8A A;  5ECL B;  2KHP A;  2JSZ A;  3L78 A;  3GSS A;  1OKD A;  3NOF A;  3H79 A;  5L71 A;  3KCM A;  2L4C A;  1SKR B;  4DSS B;  2IWT A;  4CHS A;  3F3Q A;  4IN0 A;  1PRX A;  2JAC A;  4OCF A;  3BD2 A;  2TRX A;  1DE1 A;  6GST A;  1XG8 A;  4MDC A;  3DML A;  2QC7 A;  5IPH A;  4F0B A;  2LS5 A;  4BIK A;  3EPT A;  2CZ2 A;  3GN3 A;  3P2A A;  3P90 A;  1FVK A;  2R6K A;  2A2S A;  3BJ5 A;  2KP1 A;  5LCZ A;  1O7U A;  1EGO A;  5AIV A;  3F9U A;  3UOM A;  4X43 A;  3RPP A;  4TVE A;  3IOS A;  3C1R A;  3M9J A;  3ZIV A;  5ABR A;  4DEJ A;  3IK9 A;  4KDX A;  1JZO A;  1WE0 A;  5D9T A;  1FW1 A;  2IIY A;  3UL3 A;  2YZH A;  2YZU A;  4EE0 A;  3IPZ A;  1TKD B;  3ERG A;  2AHE A;  2GTU A;  1BYE A;  2V6O A;  2H6Z A;  3ED3 A;  1TK0 B;  4XRD A;  3QAG A;  1Z6N A;  3Q18 A;  4QL7 A;  3IR4 A;  4ZBB A;  2H0I A;  2X8H A;  3KTL A;  4JRR A;  3FZ4 A;  3VWV A;  4G0I A;  4MH2 A;  1S3C A;  4MF5 A;  3Q19 A;  4O5U A;  2WRT A;  2R0G A;  3TOT A;  4KCE A;  3TGZ A;  4OFT A;  3EYT A;  1M3J A;  2R37 A;  4Q5N A;  2FY6 A;  2LNT A;  2WUL A;  3WGD A;  3IAM 2;  4X0X A;  1SJ6 A;  3FYG A;  2YOI A;  4NV5 A;  4IVF A;  4I97 A;  3DIE A;  1XWG A;  2FHE A;  4XIH A;  1PKZ A;  1J9B A;  4BVY B;  2GSS A;  1M9A A;  3ISO A;  4EIQ A;  1KNG A;  2BMX A;  3HY2 A;  3D6I A;  4FO5 A;  1TI3 A;  4KW6 A;  1TJD A;  3D22 A;  2CAQ A;  2VM2 A;  1F37 A;  4EVM A;  4MK3 A;  3SBC A;  5IM9 A;  1JLV A;  1TK8 B;  1YKA A;  4RQX A;  1M0U A;  1PA3 A;  1R5P A;  3GH9 A;  4KSM A;  2XBI A;  1EGR A;  2Z9S A;  3I9V 2;  3N5O A;  4MJA A;  2VCX A;  2MZC A;  3EU3 A;  4KF9 A;  10GS A;  4IP1 A;  1XWB A;  3PGT A;  2AJQ B;  3HHV A;  1SK1 A;  2C0E A;  4BVX A;  2HZF A;  2R3X A;  1S3D A;  4AJ8 A;  2JZR A;  1PL2 A;  3GHA A;  4A5P A;  4EDY A;  3TKQ A;  1X5D A;  4AF2 A;  2GZY A;  1FAA A;  4L0W A;  3Q6O A;  1WPI A;  2KP2 A;  1OC9 A;  4Q5R A;  4FYC A;  4G10 A;  5ID2 A;  3D4M A;  5J5N A;  2L5L A;  2R2J A;  2HSM A;  2H19 A;  1TOF A;  4NAX A;  2ES7 A;  4AJ6 A;  3GTU A;  6GSW A;  4KGI A;  1NM3 A;  1U6T A;  1WIK A;  4LLR A;  4OMV A;  2FGX A;  4PX1 A;  2CVD A;  5LNK e;  4Q5F A;  3IK7 A;  2JL4 A;  2DJK A;  2LUS A;  4IKH A;  4OFN A;  4JBB A;  4V2N A;  2VOC A;  1PFO A;  4F82 A;  3CXG A;  5ENU A;  3GL5 A;  1X5E A;  3VLN A;  3L0H A;  3DKS A;  5G30 A;  1RQM A;  4FYU A;  2B5Y A;  2R0P A;  2DLX A;  3MYD A;  4MJB A;  2ZNM A;  1Z6M A;  3M9K A;  1S3R A;  1YKC A;  1KEB A;  4JE1 A;  4ZL9 A;  5BMU A;  2VL2 C;  3M8N A;  3WGE A;  3UBL A;  2AAW A;  4K2D A;  5D8I A;  3KH9 A;  1F3A A;  3MDK A;  3IDV A;  3PH9 A;  3GFK A;  4F03 A;  1K0D A;  5GAN D;  3QOU A;  3JCM L;  1T4Z A;  2YN1 A;  1LU4 A;  4EC0 A;  2GQM A;  3I43 A;  3O3T A;  1Y25 A;  2CQ9 A;  1A2M A;  1SD9 A;  3ME8 A;  1YJ6 A;  1DSB A;  4OO4 A;  5ECI B;  2FLS A;  3F4T A;  3QPM A;  3VK9 A;  4RI7 A;  2QA2 A;  2XC2 A;  1UC7 A;  3LJR A;  2JAD A;  4JR4 A;  2E0Q A;  2VCW A;  2FCH A;  4OD7 A;  3EMX A;  3VFI A;  3M0F A;  2L6C A;  3DYR A;  2MMO A;  4WKW A;  4F2I A;  4JED A;  3QFB C;  2FD3 A;  2YNX A;  1ACV A;  2PVO C;  4EKZ A;  1XW6 A;  1GTI A;  2AUV A;  2WZ9 A;  4WBR D;  1K3Y A;  1X0R A;  1TDI A;  2NTO A;  3K8N A;  2H1B A;  1KTE A;  2WDU A;  3A2W A;  4L0U A;  4XRA A;  3HJO A;  2YP6 A;  3VPT A;  3F6F A;  2K8V A;  4WR5 A;  1MDI A;  2JSY A;  5GSS A;  1V2A A;  3QD9 A;  4ECJ A;  2OJL A;  4NWY A;  2H70 A;  4HEA 2;  1VRS D;  1GLP A;  4BA7 A;  2CX3 A;  5JWO B;  3ZL5 A;  2H8L A;  1A23 A;  3UIW A;  1K0N A;  3OR5 A;  3FRC A;  3TKP A;  1M7T A;  4MPF A;  3F4S A;  2NVL A;  4WF4 A;  3KZQ A;  4G19 A;  2HT9 A;  3VUR A;  4K8M A;  2HI7 A;  3GX0 A;  2OA7 A;  1EEM A;  4TR3 A;  2WB9 A;  4WBJ A;  4LMV A;  1WWJ A;  3ZFL A;  4TRX A;  4NHZ A;  2MBS A;  1FB0 A;  5DAK B;  2H01 A;  1TI1 A;  4IJI A;  4TOP A;  2B7K A;  19GS A;  1YF0 A;  1K0B A;  4TXO A;  3H4K A;  8GSS A;  3UAP A;  3TJG A;  1A0R P;  5IO2 A;  4XS1 A;  2VLU A;  1GRX A;  2EIO A;  3HVN A;  4RQR A;  2C1Y A;  2V2G A;  1XW5 A;  1M2D A;  4IQ1 A;  2CVB A;  4TR4 A;  1N8J A;  2A2P A;  2L4Q A;  1TU8 A;  4GCI A;  1T4Y A;  3KGK A;  2HNL A;  11GS A;  1Q4J A;  2GT6 A;  3DEX A;  2CV4 A;  2EIR A;  4EL1 A;  2YWO A;  5HQP A;  5DDL A;  2B7J A;  5KOX A;  1EZK A;  5IMZ A;  1SK0 A;  5DAL A;  2HLS A;  2VD1 A;  3KEB A;  3TKS E;  3CMI A;  5KN0 A;  1X9S B;  3L9S A;  4KDY A;  3DWV A;  4QL9 A;  2IFQ A;  3C7M A;  2R4V A;  3GV1 A;  2FWF A;  3DVW A;  5IPG A;  3QR6 A;  4JU5 A;  4ACS A;  1U88 A;  2HRA A;  5F8B A;  5DVB A;  4ECI A;  2LJK A;  2ZCT A;  5AGY A;  4KE3 A;  5A4W A;  3IHQ A;  5D9X A;  1DE2 A;  2GZZ A;  1X9W B;  6GSX A;  3H93 A;  3FR9 A;  3WT1 A;  5D73 A;  5BRT A;  1KBN A;  3P7X A;  1WJK A;  4KCA A;  1XW9 A;  3L4N A;  3QAV A;  3CYN A;  5IO0 A;  2OAD A;  4TR1 B;  1OYJ A;  4HQZ A;  3LW9 A;  5A4V A;  4G0L A;  12GS A;  5G1K A;  2LQO A;  1TP9 A;  4POM A;  3U6V A;  2CT6 A;  2K18 A;  3IE3 A;  1FVJ A;  14GS A;  1TRS A;  1XWK A;  3KH7 A;  18GS A;  3H8Q A;  2OBI A;  3L9V A;  2YJH A;  4ML1 A;  2PMT A;  2NDO A;  3LYP A;  2RII A;  2A2R A;  3CSI A;  4XS4 A;  5CRW A;  4DSR A;  4BWQ A;  3CRU A;  2OBK A;  2B5E A;  1I9D A;  2RLI A;  3LYK A;  5ECS A;  1BG5 A;  1H75 A;  4J57 E;  2PER A;  1GSD A;  2LRT A;  3EWL A;  2F51 A;  3LSZ A;  1AIU A;  4HJ2 A;  1G6W A;  3GKK A;  4ML6 A;  3ZMK A;  4USS A;  2YWM A;  4IW9 A;  5G5E A;  1OVN A;  3M1G A;  1PMT A;  2QKE A;  1F2E A;  3EIN A;  5IMA A;  1K0C A;  1MD4 A;  1ZCP A;  2F8A A;  1R5A A;  2K6V A;  4QQ7 A;  2H76 A;  5CRD A;  1Y6E A;  4F9Z A;  1NW2 A;  1BED A;  2HYX A;  3F4R A; 
#chains in the Genus database with same CATH homology
 3GUR A;  1J0F A;  2FWG A;  2HXK A;  4HU9 A;  5HR0 A;  1FO5 A;  3GNJ A;  5D9W A;  1HQO A;  2LRC A;  1T8E B;  2B5X A;  3E0U A;  1TTZ A;  2IMD A;  2GVP A;  4KND A;  2O89 A;  4IQA A;  4L5O A;  3HDC A;  3KIJ A;  13GS A;  4POK A;  4PNG A;  3SWL A;  2LKU A;  4GRF A;  2IMI A;  3LFL A;  1F9M A;  1OE8 A;  1THX A;  4FIW A;  1QQ2 A;  1X5C A;  2XPD A;  2V41 A;  5J3R A;  1SL0 B;  5DCH A;  1B9X C;  1XWC A;  2PN8 A;  3HZ4 A;  1GTB A;  1M2B A;  3LQ7 A;  1QK8 A;  2I3Y A;  3UAR A;  2TIR A;  3ERF A;  3DVX A;  1BJX A;  4Z2T A;  2H74 A;  1AC1 A;  5HR1 A;  5J4U A;  2QGV A;  2H73 A;  4V2L A;  2PPT A;  1GL8 A;  5IMD A;  5CNW A;  2JZS A;  4KX4 A;  3TDG A;  17GS A;  5IIZ A;  1G0T A;  1QUW A;  5CYY A;  4WEY A;  5DQS A;  4MZC A;  1EWX A;  3P8W A;  4G0K A;  3TCO A;  3TRP A;  1YQ1 A;  4N0V A;  2HSH A;  1W4V A;  1LBK A;  1OC8 A;  4KAE A;  1ON4 A;  1B4Q A;  2MMZ A;  3W8S A;  4ZB8 A;  5DQY A;  3D0Z A;  2H72 A;  5H5S A;  2F3M A;  3BCK A;  1M2A A;  1UVZ A;  5CRG A;  4CY8 A;  4BVX B;  4LL1 B;  1PD2 1;  2JZT A;  1SD8 A;  1ZOF A;  1K3O A;  3N9J A;  1XVW A;  3TJF A;  2LEG A;  1N2A A;  4ZL8 A;  3GH6 A;  1E2Y A;  4MNN A;  3WGX A;  2VAF A;  1OC9 B;  1V40 A;  3FHK A;  3HXS A;  5HR2 A;  5ID2 B;  1XVQ A;  4PXO A;  2JU5 A;  2RM6 A;  3BCI A;  1HYU A;  5F06 A;  3M3M A;  3HCZ A;  3GTU B;  1SYX A;  2G0F A;  1O73 A;  3RPN A;  3KTB A;  1MDK A;  4YH2 A;  4DSQ A;  1A8L A;  2QA1 A;  3RAZ A;  2C3N A;  5A5K A;  3J7Y k;  1Z5Y E;  2WGR A;  2P0G A;  3BOA A;  1EEJ A;  1TXX A;  1ILO A;  2H6X A;  1GSY A;  3QDN A;  4Q5Q A;  2RUF A;  2HSY A;  4YAP A;  1I5G A;  5FT3 A;  3UVT A;  2IMF A;  3ZVJ D;  4HZ2 A;  3KD0 A;  2GT5 A;  4TW5 A;  4YKG A;  1G7O A;  2QSI A;  2DBC A;  4GWR A;  1TU7 A;  4KB3 A;  2H71 A;  5INY A;  2BTO T;  2OE1 A;  5CRE A;  5D9V A;  2GZP A;  4GSS A;  3F3R A;  5LD0 A;  3O6T A;  3NIV A;  3H1N A;  3W8J A;  3VPQ A;  2VL9 A;  3HKR A;  1QGV A;  2LV3 A;  4PTS A;  4GQC A;  2KOK A;  1PKW A;  3DD3 A;  1K0A A;  1ZYQ B;  4YQV A;  1GUK A;  2L6D A;  4CW9 A;  5C04 A;  1XPV A;  1T3B A;  2I1U A;  1GSF A;  1HNB A;  1AQW A;  1U3A A;  1XOA A;  5KN1 A;  3RHB A;  4K6X A;  4AJ7 A;  4BL7 A;  1GTA A;  4K2X A;  2PVQ A;  2YV7 A;  3HD5 A;  2HFD A;  1VF4 A;  2DIY A;  2FNO A;  2O85 A;  3GKX A;  3QAW A;  3IHG A;  3CRT A;  4ZB6 A;  3LOR A;  6GSY A;  4N0Z A;  3KMO A;  3TKS A;  1AW9 A;  1RW1 A;  3O76 A;  3ZML A;  3S9F A;  1UN2 A;  3C8E A;  2PU9 C;  1T7P B;  4NMU A;  1SJZ A;  4N10 A;  2N5A A;  2GGT A;  2DJJ A;  1ST9 A;  2O8V B;  1JZR A;  3IC4 A;  5ELG A;  5KN3 A;  1V9W A;  1ML6 A;  2C0F A;  5J9C A;  1VF1 A;  3ZYW A;  5G1L A;  1USB A;  3EVI A;  5A4U A;  4PGT A;  3TRX A;  2O7K A;  1GUH A;  4POB A;  2VCZ A;  5B8B A;  2KLX A;  1EP8 A;  3TJJ A;  3TJB A;  3MAK A;  2WCI A;  1PX7 A;  1ZL9 A;  4K0G A;  3HJP A;  4EXJ A;  3FEU A;  1M99 A;  2YPM A;  4ICY A;  4JZQ A;  3ZIT A;  2A4H A;  1O8X A;  5IMF A;  3ZLP A;  3C73 A;  4E8E A;  4G9H A;  1X9M B;  1FHE A;  2BJX A;  4HJM A;  3MWH A;  4PQI A;  5H5Q A;  5ECQ B;  2RUE A;  3I6A A;  16GS A;  5ELA A;  2PWJ A;  4ISD A;  4LA1 A;  2ON5 A;  2LQQ A;  5GAP D;  5KOW A;  1YF1 A;  2P5R A;  4OWY A;  1K3L A;  2WJU A;  1CQH A;  2DKI A;  1W89 A;  3MSZ A;  5B7C A;  1Z3E A;  1MTC A;  4TXO B;  1URM A;  3IXR A;  2FA4 A;  3PPU A;  2MMA A;  4IJ3 A;  4Z7X A;  3MIX A;  2DIZ A;  20GS A;  1GLQ A;  5J9B A;  1B48 A;  1B8X A;  3TUE A;  1O85 A;  2ALB A;  3ERW A;  1SEN A;  4MA9 A;  1O6J A;  4DVC A;  1HD2 A;  3ZVJ A;  2IMK A;  4MLY A;  2REM A;  4OO5 A;  2I4A A;  3L9U A;  2X8G A;  1PX6 A;  4ZBD A;  2C4J A;  1R4W A;  2R5G A;  3FR3 A;  2H1A A;  1GP1 A;  4MAB A;  4EF0 A;  2YJ7 A;  1DBY A;  2D2Z A;  3F6D A;  3LEF A;  3U5R E;  4GTU A;  4CY6 A;  4IBP A;  2LJR A;  1OE7 A;  2DJ0 A;  5DAL B;  3G7J A;  2F8F A;  3CTF A;  4YQM A;  3TKR A;  1BQ7 A;  2HZE A;  1ZMA A;  4ECB A;  3KXO A;  2VCQ A;  1A2J A;  1BAY A;  1SL2 B;  5CO3 A;  3KJY A;  2YV9 A;  2IFQ B;  5JCG A;  1SKS B;  2K8S A;  3HVS A;  2VL2 A;  5COH A;  3UEM A;  1YEP A;  3LGC A;  3F8U A;  1A8Y A;  1MDJ A;  1ERW A;  2E2G A;  5HFG A;  2M72 A;  5CP1 A;  2VL3 A;  4XTS A;  2N5F A;  1MD3 A;  5JWQ B;  1F3B A;  4K7O A;  3HVX A;  3GIX A;  3QFA C;  2X99 A;  4PUF C;  2DMM A;  2MYG A;  3UJ1 A;  4I8B A;  5FWG A;  3FW2 A;  1TRW A;  4O5R A;  2LJA A;  2J23 A;  1AUC A;  3ME7 A;  1O81 A;  1SYR A;  2GQK A;  4D73 A;  3BBY A;  4IHU A;  1DUG A;  2V6K A;  3CTG A;  2FUG 2;  4TR0 A;  2R0C A;  3D5J A;  4HOJ A;  4LMW A;  4Z2U A;  1C72 A;  3FZA A;  3D4T A;  3GMF A;  2B3S A;  3DGQ A;  3R2Q A;  2TRC P;  2PGT A;  1GSU A;  5C00 A;  5CAX A;  3IRA A;  2I81 A;  4KDU A;  4XS4 B;  4FH8 A;  5GZZ B;  4O92 A;  2EIQ A;  2YWI A;  4ILF A;  3RHC A;  1GSS A;  5ECP B;  5D93 A;  4IP6 A;  4CDO A;  1M9B A;  1CQG A;  3G7I A;  1SK2 A;  2A4V A;  3IV4 A;  2M46 A;  3FR6 A;  4IEL A;  4ZXG A;  1NHO A;  2L5O A;  4GLT A;  2K9F A;  4K7N A;  3UBK A;  4MJE A;  2YAN A;  1XBS A;  4DSS A;  3FKF A;  1PSQ A;  2GS3 A;  1EOG A;  1S3A A;  1Z9H A;  4Z2R A;  2L57 A;  7GSS A;  4MZB A;  2HRF A;  1QFN A;  1JZD A;  2FWH A;  3E3E A;  1K0M A;  2DML A;  4IGJ A;  2GSQ A;  3EUR A;  3TB2 A;  1GWC A;  5F05 A;  2H75 A;  3GX8 A;  1EP7 A;  3HYP A;  1V98 A;  1XFL A;  4XHM A;  5D96 A;  2DJ3 A;  4N11 A;  1HNC A;  4K7I A;  4X1U A;  4EIP A;  1GTU A;  1GSE A;  4V2M A;  1GUL A;  1U3I A;  2FWE A;  1RK4 A;  3G9B A;  1HNA A;  2VD0 A;  1GSQ A;  1UA5 A;  5B6M A;  2LRN A;  1YDK A;  1IYH A;  2VO4 A;  2X4A A;  3IC8 A;  1E6B A;  4L5L A;  1ABA A;  5F07 A;  5IQY A;  4AGS A;  4WR4 A;  4EDZ A;  2XBQ A;  4RUV A;  5E59 A;  3TRQ A;  1FOV A;  2DC5 A;  1XCC A;  3VI7 A;  4PQ1 A;  3GA4 A;  1TW9 A;  5JWR B;  3F0I A;  3DXB A;  4XS6 A;  4HZ4 A;  3GYK A;  1SL1 B;  3QCP A;  2UZ8 A;  2YWN A;  5JCU A;  3TKS C;  1R7H A;  3APO A;  2IL3 A;  1T1V A;  4I2T A;  4GQF A;  3VWU A;  3LWA A;  1JLW A;  3J7Y b;  6GSV A;  2GSR A;  5AIS A;  2O87 A;  1AXD A;  2HRN A;  4BVY A;  1EV4 A;  2OKA A;  4HU7 A;  2M80 A;  1NSW A;  5DJL A;  3FK8 A;  3RBT A;  1FG4 A;  1AQV A;  1A0F A;  1YEX A;  2CVK A;  3E9J B;  2VLT A;  3NZN A;  2XHF A;  3AY8 A;  2B1L A;  5IOX A;  3IA1 A;  1A2L A;  3VI5 A;  3KP8 A;  3HVV A;  3GKN A;  4MPG A;  4I5Q A;  4KUN A;  3FZ5 A;  4GST A;  1Z7P A;  5HR3 A;  2C3T A;  2IN3 A;  2F9S A;  3UVH A;  4MF6 A;  2CA8 A;  1GUM A;  3KM6 A;  5KN2 A;  5JCW A;  3V1W A;  1EV9 A;  1FB6 A;  4V1A p;  4YQU A;  2DSA A;  4EO3 A;  4K5S A;  4ZL7 A;  3A5W A;  3QMX A;  3GL3 A;  3ZTL A;  2VCT A;  3C1S A;  4MJC A;  4ULX A;  5IOW A;  3A2X A;  4TN8 A;  3F63 A;  4P3Y B;  3ZRD A;  2N5B A;  2LTK A;  4XCS A;  5B6N A;  2LNS A;  4HDE A;  4OFM A;  3VWW A;  1GH2 A;  5ECR B;  4YAV A;  1G7E A;  5FHI A;  4RI6 A;  4FYB A;  2PUK C;  5ECM B;  4GSN A;  2E2M A;  3ZRE A;  1G6Y A;  2HE3 A;  1J08 A;  2L59 A;  4E8H A;  1OKT A;  1OAZ A;  5EVO A;  3HJM A;  1WRY A;  2B6M A;  3R3E A;  2H30 A;  4PNF A;  3APQ A;  1R26 A;  22GS A;  4I2U A;  4MP4 A;  4ZIJ A;  1GNE A;  1ERT A;  4F0C A;  3Q74 A;  2GQL A;  4MZW A;  1WMJ A;  3GUS A;  3EC3 A;  4X4J A;  5EPF A;  2I9H A;  4BL7 B;  1F6M C;  6GSS A;  2VLV A;  3HA9 A;  1GNW A;  5CRH A;  1PN9 A;  4MH3 A;  3FMW A;  2GST A;  3GST A;  3EE2 A;  5J41 A;  2X8C A;  3PR8 A;  4JR6 A;  4TKY A;  3G7Y A;  4NV2 A;  1V57 A;  1MEK A;  1U87 A;  1TRU A;  3GKM A;  1YZX A;  1B4P A;  1B9Y C;  2H0H A;  4NPB A;  4V1A g;  5EL8 A;  1BX9 A;  2AYT A;  5E4W A;  3VWX A;  3ZIJ A;  2DKH A;  4J2F A;  2X49 A;  3WYW A;  3WD6 A;  4O32 A;  3A2V A;  4MF7 A;  4TXV A;  3KMN A;  1PL1 A;  1OC3 A;  3LG6 A;  4KA0 A;  4HS1 A;  4PUR A;  2AB6 A;  4KSO A;  2H6Y A;  1WOU A;  2G2Q A;  4OCE A;  1QXH A;  5AIX A;  4LL4 B;  4NXI A;  2FA8 A;  5HFI A;  5IMC A;  5EY6 A;  5G2Z A;  2VUP A;  4K9Z A;  1Z7R A;  1K0O A;  4PQH A;  1TRV A;  1ERU A;  4NHW A;  2IME A;  5ECO B;  1JFU A;  1EOH A;  4YKF A;  1ZYN A;  1Q98 A;  2C3Q A;  1ZZY A;  2H0G A;  4ID0 A;  5IMV A;  6GSU A;  4MCU A;  2C0G A;  3TOU A;  4WF5 A;  9GSS A;  2H66 A;  3A3T A;  2OE0 A;  2EC4 A;  4N30 A;  4PUA A;  3FY7 A;  1ERV A;  1IYI A;  4G2E A;  2ZUP A;  2DJ2 A;  4O5Q A;  2VM1 A;  4GXZ A;  5KEJ A;  4K1F A;  2RM5 A;  1VF2 A;  2J9H A;  2GLR A;  3KP9 A;  3UMA A;  2ON7 A;  2NPB A;  1THO A;  4ECC A;  5H5R A;  2MBT A;  2E7P A;  1SJI A;  4BPY A;  3ZZX A;  5HFK A;  2C0D A;  2P5Q A;  5DAK A;  1V58 A;  3DRN A;  4MMM A;  2PBJ A;  4L8E A;  1PGT A;  3I69 A;  3TJK A;  1ZYE A;  3MNG A;  4FQU A;  1A24 A;  1XWA A;  2IPA A;  4K0N A;  2H1D A;  4ZBA A;  2OE3 A;  4HQS A;  1VF3 A;  2HZE B;  2C8U A;  1XOB A;  1T00 A;  2AV4 A;  1AQX A;  3LXT A;  3CSJ A;  5F0G A;  4WXT A;  1XIY A;  2WFC A;  3A5I A;  1XXU A;  2V32 A;  3EU4 A;  1H4O A;  5ECK B;  2NBS A;  1FOH A;  3GRX A;  1LJR A;  4K5R A;  1JZW A;  2V1M A;  5G31 A;  3LXZ A;  3EMP A;  1AAZ A;  1WP0 A;  1XZO A;  3FZ9 A;  4J56 E;  2X64 A;  1O8W A;  1TK5 B;  4BWS A;  1VGL A;  4ZB9 A;  4POL A;  2P31 A;  4IS0 A;  2C80 A;  4EUY A;  2YCD A;  4WET A;  1SU9 A;  3APS A;  1YY7 A;  3PIN A;  2VIM A;  2OAC A;  2VCV A;  4O7H A;  1PN0 A;  3W6G A;  4D73 B;  4H86 A;  5G5F A;  2H1G A;  3IAS 2;  3ZFB A;  5GST A;  2CAI A;  3WT2 A;  3HZ8 A;  2CZ3 A;  1SKW B;  4HI7 A;  3RDW A;  2DJ1 A;  3US3 A;  2XPE A;  2B1K A;  4GF0 A;  5ECN B;  4HUA A;  4ZIL A;  5ECH B;  1ZGN A;  1QMV A;  4TR1 A;  2CX4 A;  3CBU A;  2HRK A;  5DBQ A;  4I6X A;  2LST A;  3C71 A;  3CSH A;  5DJM A;  2MMN A;  1NHY A;  5DCG A;  1PQN A;  2WS2 A;  3IBH A;  1JHB A;  3D21 A;  2GDR A;  4KH7 A;  2KUC A;  1ZYP A;  5AN1 A;  2IJY A;  5B8A A;  5ECL B;  2KHP A;  2JSZ A;  3L78 A;  3GSS A;  1OKD A;  3NOF A;  3H79 A;  5L71 A;  3KCM A;  2L4C A;  1SKR B;  4DSS B;  2IWT A;  4CHS A;  3F3Q A;  4IN0 A;  1PRX A;  2JAC A;  4OCF A;  3BD2 A;  2TRX A;  1DE1 A;  6GST A;  4MDC A;  3DML A;  2QC7 A;  5IPH A;  4F0B A;  2LS5 A;  3EPT A;  2CZ2 A;  3GN3 A;  3P2A A;  3P90 A;  1FVK A;  2R6K A;  2A2S A;  3BJ5 A;  2KP1 A;  5LCZ A;  1O7U A;  1EGO A;  5AIV A;  3F9U A;  3UOM A;  4X43 A;  3RPP A;  4TVE A;  3IOS A;  3C1R A;  3M9J A;  3ZIV A;  5ABR A;  4DEJ A;  3IK9 A;  4KDX A;  1JZO A;  1WE0 A;  5D9T A;  1FW1 A;  2IIY A;  3UL3 A;  2YZH A;  2YZU A;  4EE0 A;  3IPZ A;  1TKD B;  3ERG A;  2AHE A;  2GTU A;  1BYE A;  2V6O A;  2H6Z A;  3ED3 A;  1TK0 B;  4XRD A;  3QAG A;  1Z6N A;  3Q18 A;  4QL7 A;  3IR4 A;  4ZBB A;  2H0I A;  2X8H A;  3KTL A;  4JRR A;  3FZ4 A;  3VWV A;  4G0I A;  4MH2 A;  1S3C A;  4MF5 A;  3Q19 A;  4O5U A;  2WRT A;  2R0G A;  3TOT A;  4KCE A;  3TGZ A;  4OFT A;  3EYT A;  2R37 A;  4Q5N A;  2FY6 A;  2LNT A;  2WUL A;  3WGD A;  3IAM 2;  4X0X A;  1SJ6 A;  3FYG A;  2YOI A;  4NV5 A;  4IVF A;  4I97 A;  3DIE A;  1XWG A;  2FHE A;  4XIH A;  1PKZ A;  1J9B A;  4BVY B;  2GSS A;  1M9A A;  3ISO A;  4EIQ A;  1KNG A;  2BMX A;  3HY2 A;  3D6I A;  4FO5 A;  1TI3 A;  4KW6 A;  1TJD A;  3D22 A;  2CAQ A;  2VM2 A;  1F37 A;  4EVM A;  4MK3 A;  3SBC A;  5IM9 A;  1JLV A;  1TK8 B;  1YKA A;  4RQX A;  1M0U A;  1PA3 A;  1R5P A;  3GH9 A;  4KSM A;  2XBI A;  1EGR A;  2Z9S A;  3I9V 2;  3N5O A;  4MJA A;  2VCX A;  2MZC A;  3EU3 A;  4KF9 A;  10GS A;  4IP1 A;  1XWB A;  3PGT A;  2AJQ B;  3HHV A;  1SK1 A;  2C0E A;  4BVX A;  2HZF A;  2R3X A;  1S3D A;  4AJ8 A;  2JZR A;  1PL2 A;  3GHA A;  4A5P A;  4EDY A;  3TKQ A;  1X5D A;  4AF2 A;  2GZY A;  1FAA A;  4L0W A;  3Q6O A;  1WPI A;  2KP2 A;  1OC9 A;  4Q5R A;  4FYC A;  4G10 A;  5ID2 A;  3D4M A;  5J5N A;  2L5L A;  2R2J A;  2HSM A;  2H19 A;  1TOF A;  4NAX A;  2ES7 A;  4AJ6 A;  3GTU A;  6GSW A;  4KGI A;  1NM3 A;  1U6T A;  1WIK A;  4LLR A;  4OMV A;  2FGX A;  4PX1 A;  2CVD A;  5LNK e;  4Q5F A;  3IK7 A;  2JL4 A;  2DJK A;  2LUS A;  4IKH A;  4OFN A;  4JBB A;  4V2N A;  2VOC A;  4F82 A;  3CXG A;  5ENU A;  3GL5 A;  1X5E A;  3VLN A;  3L0H A;  3DKS A;  5G30 A;  1RQM A;  4FYU A;  2B5Y A;  2R0P A;  2DLX A;  3MYD A;  4MJB A;  2ZNM A;  1Z6M A;  3M9K A;  1YKC A;  1KEB A;  4JE1 A;  4ZL9 A;  5BMU A;  2VL2 C;  3M8N A;  3WGE A;  3UBL A;  2AAW A;  4K2D A;  5D8I A;  3KH9 A;  1F3A A;  3MDK A;  3IDV A;  3PH9 A;  3GFK A;  4F03 A;  1K0D A;  5GAN D;  3QOU A;  3JCM L;  1T4Z A;  2YN1 A;  1LU4 A;  4EC0 A;  2GQM A;  3I43 A;  3O3T A;  1Y25 A;  2CQ9 A;  1A2M A;  1SD9 A;  3ME8 A;  1YJ6 A;  1DSB A;  4OO4 A;  5ECI B;  2FLS A;  3F4T A;  3QPM A;  3VK9 A;  4RI7 A;  2QA2 A;  2XC2 A;  1UC7 A;  3LJR A;  2JAD A;  4JR4 A;  2E0Q A;  2VCW A;  2FCH A;  4OD7 A;  3EMX A;  3VFI A;  3M0F A;  2L6C A;  3DYR A;  2MMO A;  4WKW A;  4F2I A;  4JED A;  3QFB C;  2FD3 A;  2YNX A;  1ACV A;  2PVO C;  4EKZ A;  1XW6 A;  1GTI A;  2AUV A;  2WZ9 A;  4WBR D;  1K3Y A;  1X0R A;  1TDI A;  2NTO A;  3K8N A;  2H1B A;  1KTE A;  2WDU A;  3A2W A;  4L0U A;  4XRA A;  3HJO A;  2YP6 A;  3VPT A;  3F6F A;  2K8V A;  4WR5 A;  1MDI A;  2JSY A;  5GSS A;  1V2A A;  3QD9 A;  4ECJ A;  2OJL A;  4NWY A;  2H70 A;  4HEA 2;  1VRS D;  1GLP A;  4BA7 A;  2CX3 A;  5JWO B;  3ZL5 A;  2H8L A;  1A23 A;  3UIW A;  1K0N A;  3OR5 A;  3FRC A;  3TKP A;  1M7T A;  4MPF A;  3F4S A;  2NVL A;  4WF4 A;  3KZQ A;  4G19 A;  2HT9 A;  3VUR A;  4K8M A;  2HI7 A;  3GX0 A;  2OA7 A;  1EEM A;  4TR3 A;  2WB9 A;  4WBJ A;  4LMV A;  1WWJ A;  3ZFL A;  4TRX A;  4NHZ A;  2MBS A;  1FB0 A;  5DAK B;  2H01 A;  1TI1 A;  4IJI A;  4TOP A;  2B7K A;  19GS A;  1YF0 A;  1K0B A;  4TXO A;  3H4K A;  8GSS A;  3UAP A;  3TJG A;  1A0R P;  5IO2 A;  4XS1 A;  2VLU A;  1GRX A;  2EIO A;  4RQR A;  2C1Y A;  2V2G A;  1XW5 A;  1M2D A;  4IQ1 A;  2CVB A;  4TR4 A;  1N8J A;  2A2P A;  2L4Q A;  1TU8 A;  4GCI A;  1T4Y A;  3KGK A;  2HNL A;  11GS A;  1Q4J A;  2GT6 A;  3DEX A;  2CV4 A;  2EIR A;  4EL1 A;  2YWO A;  5HQP A;  5DDL A;  2B7J A;  5KOX A;  1EZK A;  5IMZ A;  1SK0 A;  5DAL A;  2HLS A;  2VD1 A;  3KEB A;  3TKS E;  3CMI A;  5KN0 A;  1X9S B;  3L9S A;  4KDY A;  3DWV A;  4QL9 A;  2IFQ A;  3C7M A;  2R4V A;  3GV1 A;  2FWF A;  3DVW A;  5IPG A;  3QR6 A;  4JU5 A;  4ACS A;  1U88 A;  2HRA A;  5F8B A;  5DVB A;  4ECI A;  2LJK A;  2ZCT A;  5AGY A;  4KE3 A;  5A4W A;  3IHQ A;  5D9X A;  1DE2 A;  2GZZ A;  1X9W B;  6GSX A;  3H93 A;  3FR9 A;  3WT1 A;  5D73 A;  5BRT A;  1KBN A;  3P7X A;  1WJK A;  4KCA A;  1XW9 A;  3L4N A;  3QAV A;  3CYN A;  5IO0 A;  2OAD A;  4TR1 B;  1OYJ A;  4HQZ A;  3LW9 A;  5A4V A;  4G0L A;  12GS A;  5G1K A;  2LQO A;  1TP9 A;  4POM A;  3U6V A;  2CT6 A;  2K18 A;  3IE3 A;  1FVJ A;  14GS A;  1TRS A;  1XWK A;  3KH7 A;  18GS A;  3H8Q A;  2OBI A;  3L9V A;  2YJH A;  4ML1 A;  2PMT A;  2NDO A;  3LYP A;  2RII A;  2A2R A;  3CSI A;  4XS4 A;  5CRW A;  4DSR A;  4BWQ A;  3CRU A;  2OBK A;  2B5E A;  1I9D A;  2RLI A;  3LYK A;  5ECS A;  1BG5 A;  1H75 A;  4J57 E;  2PER A;  1GSD A;  2LRT A;  3EWL A;  2F51 A;  3LSZ A;  1AIU A;  4HJ2 A;  1G6W A;  3GKK A;  4ML6 A;  3ZMK A;  4USS A;  2YWM A;  4IW9 A;  5G5E A;  1OVN A;  3M1G A;  1PMT A;  2QKE A;  1F2E A;  3EIN A;  5IMA A;  1K0C A;  1MD4 A;  1ZCP A;  2F8A A;  1R5A A;  2K6V A;  4QQ7 A;  2H76 A;  5CRD A;  1Y6E A;  4F9Z A;  1NW2 A;  1BED A;  2HYX A;  3F4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...