3G9TA

Crystal structure of este5, was soaked by p-nitrophenyl butyrate for 5sec
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
296
structure length
294
Chain Sequence
AGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPMPGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biological characterization of EstE5
rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
molecule keywords Esterase/lipase
total genus 104
structure length 294
sequence length 296
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3g9tA00
4G1FA 1MAHA 3WWOA 2HIHA 1H2YA 4X93A 5DYYA 4QA9A 4YK7A 2OAGA 3S8YA 3H04A 1MX1A 5IH7A 3HI4A 1YA8A 1CRLA 4J7AA 2Y6UA 4DNPA 1E3QA 2WKWA 3NOXA 1O6FA 2ROQA 4B84A 1EINA 4BE9A 4WFIA 5K3CA 5KBYA 1QZ3A 4UBNA 5CH3A 4Y2UA 3DDUA 5LZ2A 1YB7A 4YX9A 1A8UA 1RP1A 5FRDA 3QVMA 3H19A 5BV7A 4KE9A 3PI6A 2XMCA 4MYDA 5CW2A 1EDBA 4UBLA 1THGA 3PFCA 3DD5A 4XX1A 5K5EA 5T4FA 1WB5A 4DYHA 4J0KA 5CT8A 2VT6A 5F4ZA 1XZDA 1CUJA 3W9UA 3STXA 1BRTA 2C0PA 2WG1A 5ALOA 1QOZA 3WQHA 3UUEA 5ISMA 2R11A 5C8ZA 4C4ZA 5DWDA 3OC0A 4AXBA 4Y2TA 4CG1A 1NU8A 4K2AA 2WG2A 3O9VA 2PU5A 3WMRA 3C6BA 1W1IA 2VF2A 4WJLA 4B82A 3M81A 2QJWA 4AX4A 1XRPA 3BWXA 2WHRA 5HF6A 3WI7A 2FX5A 2AXEA 1EHYA 4I19A 5BWBA 4LXGA 4FWBA 1GKKA 1SOMA 3EBLA 5AM5A 1EX9A 5ALSA 1CQZA 2J3QA 1ZJ4A 2PUJA 5K3DA 5AM1A 2GBGA 1UOPA 3OTQA 5IVDA 4TGLA 2WIGA 2ZSIA 3ZLTA 3AZPA 1QIEA 4BATA 4LIPD 2VQ6A 2AJLI 3CXUA 1B6GA 5ALNA 3AINA 1A8QA 3LIPA 1LPNA 4C4YA 3V9AA 3QITA 4GWLA 4H35A 3WKAA 1J06A 5LZ4A 1TCBA 5LZ5A 5T4BA 1QTIA 2V97A 2XUPA 3AIKA 4A16A 4GBGA 3DOIA 3HZOA 4N5HX 4B0OA 1DX6A 4AMZA 1XRLA 3I1YA 3ESDA 3DKRA 1UT6A 2VEOA 1KEZA 1XZLA 2WHPA 2PL5A 2X8BA 3O95A 4G4GA 5DYTA 3HXKA 4LKOA 3F67A 2HHAA 1FFEA 1CUVA 5CT5A 2OXEA 2YYSA 1ETHA 3PUIA 4EUSA 2PSEA 2QTBA 1JU3A 1UOOA 3JW8A 4W1PA 4AN1A 3QPCA 1QIIA 1DWQA 2WG0A 5AM2A 4W63A 3WYNA 4HXFB 3R3ZA 2YH2A 3ESBA 3KWFA 1H2XA 5EI5A 1HPLA 2AJCA 4V2IA 4BCCA 1P0MA 4XIIA 4IQ4A 1XZMA 3RK4A 1A88A 4EY5A 4L9AA 5AIBA 4Q3KA 1OCEA 2WFLB 3DL4A 4CFSA 4ARAA 2OCKA 5I8PA 3IB3A 5CT6A 4BDSA 1UK9A 1U2EA 3G9ZA 3HSSA 4Q34A 3IA2A 4AZ0A 3I2JA 1T2NA 2XUKA 2D0DA 5JIBA 1QIHA 3WA6A 3V1MA 4A5SA 2WIKA 1XZIA 2ZSHA 4QEKA 4P92A 3CCCA 2DHCA 3H0CA 4WDRA 3S2ZA 5AI6A 2ECFA 1YR2A 4OYLA 2GBIA 2QOEA 4FNGA 4BC1A 1OILA 1VJ5A 2CB9A 5E4TA 1XZAA 1XZBA 4PO3X 2W6CX 2H7XA 5HK8A 1UOQA 4BCBA 3VVLA 4QDTA 3TEJA 4OU5A 1HLGA 1RWQA 1JU4A 2XUGA 2VJBA 5JADA 1EDDA 1CUFA 4Y2RA 5JAUA 4FLMA 2OCLA 1W75A 3AIOA 1UK7A 2BKLA 3WK8A 3QMMA 2Z8ZA 2HU8A 1JKMA 1VA4A 2BGRA 2PX6A 4ZV7A 2GYVA 3GFFA 3CN7A 4K6KA 4UUQA 4HVTA 2JBWA 4MWSA 2ZJ6A 1UK8A 2FJPA 4H7KA 3I28A 2JGKA 1EA5A 1LGYA 3EQ8A 2QXUA 5AKHA 1LZLA 2RONA 4DGQA 1JI3A 3RARA 5CT9A 3N2ZB 1CR6A 1Q0ZA 4N8EA 1IUOA 4EB0A 1FSSA 4QE3A 1LPBB 5CH5A 1ACLA 2WFZA 5EHQA 3O0DA 3ESCA 5DNWA 4BBZA 2GBCA 3Q8WA 1ZGBA 2QMQA 5A7FA 4X94A 1UK6A 1DQYA 4DIUA 3RM3A 5JAOA 3V1NA 1E66A 3QM1A 4B9AA 4NZZA 4BVLA 2HRQA 1HKHA 3X3HA 1AURA 2ACKA 3PDCA 2RHTA 4G4IA 5EHXA 5J3JA 3L1HA 4P9NA 1MX9A 4BYMA 4H7JA 5ALPA 1KU6A 2XB6A 3HRHA 1LBSA 4KRXA 3YASA 3D4LA 5ALHA 1CUYA 2XUJA 2DQZA 1R9MA 4LYEA 4Y2SA 3WYDA 3JYHA 3G0GA 1XQYA 3IULA 4K6GA 1ODCA 1ZOIA 3WL7A 1GZ7A 3BF7A 3QYJA 1ZD5A 2Q0XA 4XJVA 1U8EA 1YAHA 1N1MA 2BGNA 3LP5A 4JEIA 1R3DA 1TCAA 1Q84A 2EDAA 5D6OA 5HKBA 4OUKX 3LIIA 3PE6A 5HK9A 2WFLA 1UWCA 3ESAA 4FMPA 5AKGA 4UHHA 4OYYA 1LPOA 4FBMA 3RKSA 4H7EA 3H2IA 1U65A 4MQLA 4YPVA 3BIWA 1CUDA 4BRSA 3M82A 4AQDA 2GZSA 4KRYA 5ALMA 2Y1KA 1K8QA 2XUIA 4X92A 5FV4A 2ZYIA 5AKJA 3STYA 1L7AA 3ZLUA 4CIBA 4QZVA 1UZAA 4AMYA 4JH0A 2GBFA 5AKXA 3CN9A 5JAHA 5AK4A 2GZRA 3W9BA 5D3ZA 5AKEA 2JEYA 4X6YA 1XZFA 3BXPA 1JT2A 2OAEA 4CIAA 2JGEA 2XQGA 4W1SA 4U2FA 1N8SA 5SYNA 3AZOA 4PNZA 5ALYA 4QWMA 1HQDA 2QM0A 4DSZA 5DJ5A 2ACEA 2BFNA 1AX9A 3FVTA 2XMBA 2DQYA 3WA7A 4BVJA 3H2KA 4ROTA 4ZV9A 1SCKA 4GDMA 5HF8A 1E8NA 1ZI9A 1BEZA 1TIBA 1ZIXA 3HC7A 1J2EA 1P0IA 3WL6A 3DL7A 3FLBA 1QLWA 4CCYB 5AKLA 3DOHA 3E1GA 3R3VA 1JMKC 3I2GA 1TAHA 3I6MA 3FSGA 4X3CA 5AI8A 4H7HA 2HADA 4HXEB 1CQWA 4X85A 2QS9A 4E46A 5LP1A 2IITA 4BTVA 3IUJA 4FOLA 3PF8A 2JGFA 3FYUA 1YB6A 4WY5A 4Q05A 3A2NA 3I2HA 2FJ0A 1XZJA 1DX4A 1LPSA 4RNCA 5JARA 1PFQA 4HS9A 3EQ9A 4J0CA 3K9BA 4UFNA 4U2EA 1EB9A 4H7DA 3R3YA 4WFKA 1R1DA 3C70A 4OCZA 5AICA 5DYWA 5ALEA 3VJMA 4NVRA 5A2GA 2H7YA 1IVYA 4HXGA 3WIOA 5K3AA 4X71A 3NWOA 5FPPA 3DCNA 2Y2VA 4I3FA 3C8HA 5CRIA 3I6YA 2WUEA 3DEAA 2JGJA 4RE5A 1N5MA 1EH5A 2HU7A 1WPXA 2XUFA 3ZV7A 4B81A 3H2HA 3HACA 4B80A 1AC5A 4K6HA 2X76A 5AI5A 3ED1A 1PV1A 5LKAA 3PFBA 2WTMA 2XQFA 2XQJA 3B12A 1K6EA 1MAAA 1PJAA 4GECA 2G63A 1NX9A 3O4GA 4F5ZA 1SCQA 1XZKA 4EHBA 4Q1VA 2QVBA 3N0TA 2I78A 1XZEA 3UMJA 3C87A 3M83A 5H3HA 4J3JA 1MX5A 3I2KA 4UHDA 2VJDA 2I3DA 4KAAA 3E0XA 3FLAA 2QJRA 1FFBA 5D3KA 4QLOA 3ANTA 1DTEA 4G9GA 1P0PA 2ZYSA 5T4HA 2JIDA 4FLFA 4JNCA 4Y9SA 1WCYA 3O4IA 1GXSA 3WK7A 2Y2UA 5C81A 1UKBA 5HKAA 2OQVA 3WWEA 3R40A 5SYMA 2QT9A 4L72A 2LIPA 2ZYHA 4BP8A 3FVRA 5I9IA 2PPLA 4ARBA 4UPDA 1CV2A 1ORWA 5AP9A 1CEXA 4XWGA 5FP0A 2OPHA 3TRDA 3AUKA 1DWPA 4ITVA 1YS1X 5HF5A 3W04A 3V1KA 2XUDA 2HA5A 1Y37A 4G8CA 3M3DA 1QONA 4W1RA 3H1AA 3NUZA 1CUUA 3FYTA 5CMLA 2JF0A 1UFOA 3A2MA 2AJBA 4MEAA 2O2IA 2H9YA 1QGED 4QLAA 5DTJA 4QDXA 4EA6A 1ZD2P 4BAZA 4UHEA 4GEGA 3W05A 1L7QA 5A6VA 2IIVA 4KAJA 5HFAA 4Y2VA 3FOBA 4CCWA 1QTRA 2O2GA 4N8SA 5DLPA 1ZGCA 1E89A 1WB4A 4NS4A 1VZ3A 3BDIA 5ALDA 3G0CA 3WWPA 4UFOA 1LNSA 1ZIYA 4K5QA 5LLSA 5FOQA 3FNBA 4X6UA 4GHWA 1KU0A 5AK5A 2WM2A 5ALKA 2XE4A 4E11A 2D5LA 3SX4A 1LBTA 3WK9A 3KWJA 1EB8A 3IUQA 3A2LA 1QO9A 2WTNA 3OM8A 4BDTA 2WIJA 4PV7A 2CUTA 1MU0A 3OPMA 1JMYA 5ALGA 1G5FA 3I6ZA 3QH4A 3FCXA 3CCBA 2BJHA 4C6HA 1CUAA 5A7GA 5JD5A 3G0BA 3ICWA 3T52A 1DU4A 2PVSA 4O08A 4LXIA 4BAGA 3FCYA 3WZMA 4WFJA 1XLWA 4UBJA 5ALXA 2HA0A 4C87A 4WDQA 3ILSA 5LYYA 3WK4A 2XUOA 3IIIA 1G4HA 4ZI5A 5YASA 4D9JA 3D2AA 2W22A 3LCRA 2QR5A 1QIFA 4U2CA 5JATA 4Q82A 4OD0A 3ZLVA 3F96A 1JJFA 4W9RA 1THTA 2OG1A 5AKYA 2ES4A 4MYSA 2WJ6A 4UBIA 3IURA 4IO0A 4H18A 1F8UA 4LHEA 2XQIA 5EHNA 4FFWA 1FFCA 1DWOA 1LPAB 4X7BA 1WOMA 1O6GA 3G9UA 3WWCA 1MTZA 1YA4A 1IUNA 1H22A 5ALJA 1CPYA 5T4EA 3QPDA 5CTAA 2XUHA 4UHBA 5CXXA 1AZWA 1BCRA 1BROA 1CFJA 4DSAA 2CKMA 4DLNA 4IH4A 3R3XA 3WWDA 5ALIA 4H77A 4M0FA 1BCSA 2C4HA 1T4MA 5JAPA 1D07A 4B0PA 3DNMA 1B41A 2C0QA 3KXPA 4L3WA 3I2IA 3MUNA 1ZD3A 4HZGA 5AM0A 4OB6A 3PUHA 3O9MA 3DYVA 1SC9A 3STUA 3HJUA 4UHCA 2CJPA 1P0QA 2QRUA 3RLIA 3GA7A 4BZWA 3B5EA 5AH0A 5A62A 1EDEA 4G8BA 3QZUA 3KDAA 5AOBA 4JUIA 1CLEA 2C58A 2DCMA 4PSUA 3F97A 2H1IA 4BP9A 3HLKA 3IVMA 3UUFA 3ANSA 5LKRA 2OCGA 2I03A 3U1TA 5KREA 5ESRA 2RIPA 2ZJ7A 3VXKA 3B3QA 2HFKA 2PSFA 5ALVA 4I4CA 4MQMA 1ODSA 3W06A 5E2IA 1USWA 2BUCA 1BN7A 3C8DA 3G9TA 1QE3A 4AO6A 3W2TA 3C5VA 4X97A 4FFVA 3K6KA 5FUMA 2HRRA 4DM7A 1VZ2A 2QUAA 1XKLA 4DNOA 1C7JA 1ACJA 1TK3A 1F0NA 5AI9A 3EIOA 1VLQA 4C01A 5FKJA 1NU6A 1H2ZA 1HBJA 5ALQA 4J0JA 4G4JA 4HTAA 2WLSA 3ICVA 3EQ7A 3L1JA 5K3FB 1AMNA 4NMWA 2WU3A 1VA5A 4FKBA 3GROA 4F21A 4ETWA 3WIBA 3SC2A 1ZICA 4AB1A 1I6WA 1LLFA 4RE6A 4EY6A 1UXOA 1UKCA 1WHTA 1TKRA 5K3EA 3AILA 1XQVA 1BN6A 4DMHA 4DMCA 2WSLA 3L1IA 3H2JA 2PKYX 4DTCA 1LZKA 2Z8XA 4OSEA 2YASA 3KSRA 4MXDA 4EBBA 4UBOA 1FFAA 4Y2PA 2AJ8A 5EIHA 2RI6A 3D7RA 3WKDA 5HQ3A 4KACA 5HCUA 5EIEA 1Y7HA 2BCEA 3VJLA 1UKAA 2WFMA 2C5GA 3ZI7A 1FFDA 4P08A 5HQ3B 4BVKA 4M0MA 3VKFA 2WUFA 4E14A 2BUAA 2XUQA 4G5XA 4KR0A 3A6ZA 5DNUA 5JASA 1X2EA 1R9NA 3C5WP 4DMFA 1MNQA 2DSNA 4DMKA 5FDFA 2PUHA 2QXTA 3IBTA 4TPKA 2WUGA 3IUMA 3HEAA 3C6ZA 2Z3WA 3STVA 1XLUA 2RGUA 4UBMA 1H2WA 2Y6VA 4BZZA 2XDWA 5IKXA 4PW0A 1ORVA 1ODTC 5AKKA 4QDUA 2Z5GA 4KEAA 3EF3A 2B20A 4PQEA 3K2IA 5CXUA 2WJ4A 5CT4A 5E4YA 1XZCA 2OGTA 3WK5A 2C7BA 3FWHA 4FLEA 4IH1A 5EFZA 1EVEA 3WJ2A 1C4XA 4G9EA 5A71A 4Y2QA 5ALTA 3QPAA 2AJDA 1ISPA 4AN0A 1DT3A 3E3AA 3T4UA 4W1QA 3SK0A 1J07A 1BEEA 1YCDA 2BUBA 4C88A 4UFPA 2PM8A 1IZ8A 1ZI8A 1ZD4A 5C8VA 2VT7A 4BB0A 1XRQA 3AZQA 1GGVA 3WL5A 4X90A 2XQKA 5CH8A 4YASA 3DKKA 4DNFA 4RPCA 1JFRA 5AHXA 2VATA 3DQZA 1HDEA 1TRHA 2XLCA 2WHQA 1S8OA 3U0VA 5IVIA 3JWEA 1MJ5A 3FYUC 5AI0A 3WKEA 2OCIA 2PBLA 3GZJA 1CUXA 5ALUA 2WILA 3I1IA 3OURA 4JYMA 2G5TA 2FUKA 5JD4A 1CUWA 5IVKA 4MWTA 1CVLA 2XMDA 1CIJA 3QMWA 1VE6A 3P2MA 5LZ7A 5ALRA 5A7HA 1DQZA 1IUPA 1W76A 4Y7DA 1ZJ5A 3ZWQA 4FBLA 4AZ3A 2XMGA 2EDCA 1BU8A 1RYYA 1VXRA 4PSCA 2PSHA 3WZLA 1TQHA 5FPQA 4F0JA 4FDMA 1XKTA 5AJHA 5JYCA 4QDZA 4Z49A 3DJYA 2XMRA 4J0DA 4HAIA 4CG3A 1VOTA 3BJMA 5I7UA 4MEBA 4S0XA 2QZPA 1R88A 1XRRA 5CURA 2CBGA 2C5FA 1SFRA 1VKHA 2WJ3A 3C6YA 2JGMA 4KYVA 4N5IX 1X2BA 4Y2XA 1F0PA 1K5PA 1Y7IA 1QJ4A 4AO8A 2B4KA 4ZREA 4FTWA 3BF8A 1CUZA 2V96A 4EY8A 3WK6A 5AK6A 1X70A 5BOVA 5KWIA 5ALWA 4BE4A 5HFNA 1QFSA 3H1BA 4FNMA 4F60A 4WCVA 2NW6A 4FHZA 5EHZA 3BDVA 1BS9A 4B7ZA 4G8DA 5C7YA 5KWJA 5AM3A 4X6XA 1GPKA 4XVCA 3KOOA 2B9VA 2P8SA 2VAVA 1HL7A 1C7IA 2I3ZA 4X95A 4OB8A 2VJAA 5DNVA 2HM7A 2UZ0A 1WPRA 5AOAA 1XLVA 2HA6A 3F8SA 4BRZA 3WL8A 2VAXA 1CUHA 2HA7A 4MJ3A 2DR0A 3TJMA 5JZ9A 5AI4A 4LYDA 1E8MA 3C45A 3WJ1A 4B9EA 1WM1A 3G0DA 3HYSA 4P93A 3HABA 3VISA 4GW3A 4GXNA 5JD6A 1YASA 4X00A 2R8BA 1R50A 4H7IA 4EZIA 4BAUA 2VA9A 1XRNA 2Z3ZA 1MO2A 3GELA 1DT5A 4Q3OA 5LZ9A 1E8DA 5AK3A 1LPMA 4M0EA 1W4LA 1DINA 4E15A 5HZGA 1ZI6A 5K3FA 3OG9A 4OU4A 2OQIA 1G66A 3R3UA 2WQZA 2GYWA 3E4DA 4N8DA 2QUBA 5ALLA 5BWCA 4UHFA 2ORYA 1GPNA 2VTVA 3QMVA 2G4LA 3WKCA 4KAFA 5EIAA 3R41A 2HU5A 3G02A 2O7RA 3TGLA 1N5RA 2J3DA 2XI4A 5FLKA 3FAKA 1CUCA 4BTLA 2JGLA 2HL6A 2XMZA 3FYUB 3G9XA 5JALA 1EVQA 3NGMA 2OLEA 3G0IA 3G7NA 3MVEA 3MUOA 3PF9A 3STTA 1VE7A 4CI9A 1Q0RA 3ZPXA 2WU4A 1GQRA 5JZSA 1QIKA 4RGYA 3MGAA 4J0IA 1AQLA 3F98A 2E3JA 4BC0A 1AUOA 3VVMA 4B83A 4H0CA 3R0VA 1CUGA 1M33A 2WIFA 1XQWA 4HRXA 2JGIA 2XMQA 2ZJFA 1AGYA 3BJRA 2BAGA 3I2FA 3LS2A 3AJAA 1CUEA 4EY7A 2JEZA 4U2BA 4L0CA 3GBSA 2X5XA 4IHAA 3FSGD 3AIMA 4B85A 1GT6A 1XROA 2RHWA 2RAUA 3IDAA 5AKIA 2OGSA 4GLBA 3KD2A 2B61A 4X91A 1Q83A 3D2BA 1QFMA 4OPMA 4QNNA 1L7RA 1BE0A 3AFIA 2DHEA 4KE8A 1MT3A 4J0HA 3WLAA 1WHSA 1JJBA 1EK1A 3D0KA 3V1LA 2XUAA 5EGNA 1QO7A 4TVKA 1W6RA 3O4JA 1E5TA 4ZGBA 3D59A 2CMFA 2DHDA 2VSQA 2WHPB 2IX9A 1XFDA 1FJ2A 4J0GA 2V98A 1A8SA 3C6XA 5AKZA 2XLBA 1GPLA 3D2CA 4U2GA 4C4XA 2O7VA 7YASA 3STWA 1CUSA 1JJIA 1W52X 2XMSA 4U2DA 3D5EA 2HA4A 4Y2JA 1R4ZA 1G42A 4PF1A 3O4HA 4JYPA 5AOCA 5ALFA 3G8YA 4Y2YA 5JANA 4CCYA 2J4FA 3FBWA 3BIXA 3A70A 1GKLA 3QBJA 1K63A 5FXMA 2CEKA 3SWWA 4INZA 3V48A 5C8XA 2K2QB 3BL8A 4H7FA 1LPPA 4QDOA 4ZWNA 3D3NA 2QKYA 2EEPA 5LZ8A 5ALZA 2HFJA 2ONCA 3GUUA 4EY4A 6YASA 1Z68A 5AM4A 3F9CA 5K3BA 3PICA 4J03A 2YXPX 1YAJA 2H7CA 1AKNA 1XZHA 3FLEA 4A23A 3H17A 1IMJA 1YS2X 2HA2A 4KJXA 3VJKA 4KE7A 3DLTA 1MN6A 1K4YA 2ZYRA 4IH9A 3VDXA 4PSDA 5AO9A 1QIDA 2ZVDA 1CUBA 5JZBA 2XT0A 1EI9A 3C43A 5DTIA 2PSDA 1XQXA 2HDWA 1SCIA 4C89A 4HRYA 3DYIA 4QWWA 4OB7A 2V9ZA 2OGZA 1F6WA 2DFPA 4ZXFA 1VXOA 3BE8A 4B6GA 2O2HA 4WY8A 1GQSA 2WIDA 5D7BA 1YSCA 5HF9A 3LLCA 3IUNA 1U4NA 3R3WA 1A7UA 5LIPA 3WKBA 2PU7A 3H2GA 4LXHA 2G5PA 2WUDA 1CUIA 4UBKA 2CZQA 1EK2A 3H18A 4KE6A 5AIAA 4AO7A 1EXWA 2J4CA 2PSJA 1MNAA 5IVHA 2VJCA 3OOSA 1QIMA 4DNQA 2GYUA 1H23A 5E4JA 5CBKA 3DS8A 1MPXA 3Q0TA 1IZ7A 1J1IA 1QIGA 1OXMA 1WB6A 1QIJA 1XRMA 4GI1A 4Q3LA 2HA3A 1XZGA 4ZRDA 4BCDA 1TCCA 4CG2A
chains in the Genus database with same CATH superfamily
4G1FA 5ICCA 1Z2PX 1X1QA 3HU5A 4U7TB 4WJZA 5GGYA 1CWUA 1KSJA 5DRYA 1LJUA 2CFIA 2QRVA 3FTPA 3HP4A 3QKTA 2O2DA 5DYYA 4TTTS 4IZHA 2ZJ4A 2RGRA 3DZDA 2A58A 2OAGA 3S8YA 3H04A 2WZBA 1Z0JA 3H11B 2VS1A 3NTOA 3TTUA 5IH7A 2XT6A 4NEHB 1MVLA 5IBQA 4IEEA 1HOXA 1O94C 2C96A 3H5LA 3EFHA 2POQX 2D3WA 4DNPA 1E3QA 4OMCA 2ASVA 2WKWA 3NOXA 1UM9B 4Q02A 4P1ZA 4ZP1A 3DTNA 3TX6A 2GETA 3PITA 4B84A 3Q9SA 2PRYA 2O1XA 2VDPB 4HDRA 5BQ5A 2VXYA 2IVFA 3GEBA 1ZUWA 3PTLA 4YJFA 3SJAA 2ZTUA 4UBNA 3PHBE 4Y2UA 5HOEA 3DDUA 3LYUA 4KV9A 4YQZA 3GAMA 3S7ZA 5ER6A 1QOQB 5ENZA 3T41A 2AX3A 2YX1A 3BE4A 5TNXA 2CHFA 4DKJA 4JI1B 3HBAA 4R05A 4GPZA 3K2BA 1PLJA 1NLUA 5FO1A 5SYAA 4CFYA 4M7WA 4DMRA 5DKFA 1FFSA 1UXJA 2XDYA 2QL5A 4TWIA 3RHFA 4KE9A 3PI6A 2XMCA 1T4CB 4OMFG 3WBKA 1ZCJA 3FBGA 4MYDA 5CW2A 4KDFA 4INOA 1EDBA 2FMKA 2ZBDA 4ENWA 1FX0A 1PG2A 4NU8X 4S3MA 5DGTA 2G1JA 4UBLA 5KPDA 5KTOA 1AO0A 1KQOA 1ODJA 2VHCA 1DS6A 4BMPB 1DKMA 4ETNA 3RSGA 3FDIA 2BFFA 4LYHA 1U6IA 4B75A 2JFFA 4XX1A 2HF7A 1Y9ZA 4ZMBA 3RG8A 1NATA 1WEKA 4JJ7A 4QOFA 4DA9A 3WO1A 1XTVA 4IDAA 1DKPA 2HLNA 5U4XA 1A9SA 2WVJA 3DUFB 3ZE8A 4C0KA 1CUJA 3LT2A 5BSMA 4YREA 4E33A 5C7OO 4U02A 1QAQA 4G5HA 5TGZA 5F7OA 1XVUA 5F7JA 2OFFA 4KR7A 1T2VA 1J2JA 5D84A 1L4FA 3T5TA 1P29A 1V39A 4JAVC 2WG1A 5ALOA 3U1VA 5K0GA 4M36A 1YF3A 3DE1X 1R4AA 2JIQA 1RCFA 1PFYA 1X14A 2Z8YA 4ZVOA 3EPHA 3DOFA 4HQOA 4BRUA 2Q6VA 2R11A 4JDPA 1QR6A 3HFSA 1QRSA 1P8JA 1NQAO 3OA0A 4IUDS 4F8JA 2OE2A 1P1CA 3C1TA 2LR0A 4I1YA 3PP8A 5DWDA 3W78A 1X1BA 1XEAA 2G07A 4AXBA 5AW5A 4Y2TA 2R8EA 3OQHA 4BZPA 2VJPA 4PNEA 3M9XA 1VIYA 2Z5LA 3ONNA 2H9AA 3CNEA 3O9VA 3I62A 4N7MA 1C14A 2O3JA 2XUZA 4FC6A 3O1HB 1YJCA 3ASUA 5IK2D 1FMJA 2J32A 4TS9A 3EQ6A 4WJLA 4B82A 1W36D 3VZQA 3GEMA 1TJ4A 5L3QB 1KK1A 3M81A 3PNOA 4ZAGA 2A5JA 2QJWA 2VXCA 4KHZA 4XFJA 1D9XA 4DW8A 1B1CA 1CY6A 1N5LA 4JLOA 1E0SA 2GCPA 3BWXA 4IJUA 4PZUA 2PH7A 2NVWA 5HF6A 1O95A 3ETLA 4PLGA 2FX5A 3ZEIA 5J47A 2AT1A 3R8CA 2IRWA 2Z3VA 4KI7A 1XDDA 5DXFA 3WRVA 1OB2A 1V35A 2CJYA 2XD4A 2YY5A 4GE3A 1NVUQ 1GSOA 4I19A 1K1EA 5BWBA 1X7WA 2AOUA 1BH2A 3I3OA 3VU1A 1CS0A 1UINA 4WNCA 3QKIA 5C35A 1NE7A 4QUBA 1WNTA 1GAJA 1Q21A 3E1KA 2BR3A 3BA6A 1P7YA 2OD9A 2WB4A 2B99A 2OUIA 2D8AA 3A8TA 3BA1A 3CBQA 3DO8A 3GJZA 4UASA 4XARA 5ALSA 3WLKX 4DNXA 2CNWA 3LPAA 2PUJA 2CFCA 3LW7A 3RUCA 4BMXA 1N8KA 5TGDA 2NTJA 5KB3A 1ST2A 4XFKA 1E79D 1Y8QB 1ZN8A 2HWYA 2XYQA 3ADOA 3AR9A 2H57A 4L2IA 4YAUA 5I3ZA 4NESA 1M2WA 2GBGA 3EVBA 1G21A 3EOAI 5KJCA 2HSWA 2PLWA 2QMHA 3CM0A 3OTQA 1M1YB 3KBOA 4L16A 4KPFC 4PU0A 3SN6A 2BPOA 2WIGA 4JHLA 4W99A 2XWJI 3BERA 1HV8A 4GKAA 5D2CA 5EJ4A 2E5LB 3QNUA 1DDOA 4B48A 2V7WA 4A26A 1CDDA 5DNYB 3N2GB 3SM9A 4NI5A 1QIEA 2FZVA 3AOEC 3HDGA 4LIPD 4UW9A 2RDMA 4P3KA 2GK4A 4RVFA 1WA5A 4QPPA 2QAGB 4MP6A 4C0HA 2P2CA 3QNWA 3GVIA 3AW9A 3D6AA 3SXPA 3K0CA 4P80A 4QATA 4GBJA 3UN1A 3F7TA 1EWRA 1NV8A 1OZ0A 3MMNA 4ENUA 4WLFA 1JG7A 4ITUA 5U4QA 3QITA 2IW1A 4S24A 3FNGA 2BMAA 3NH6A 1Z63A 3S1AA 3FHTA 1WDKA 5F4BA 5TLSA 1WNFA 1N0HA 2YW2A 4I2VA 1WD7A 3D1JA 1J06A 4RZSA 5LZ5A 3RYFB 3FUCA 3PX3A 1JG6A 1L5WA 1GXSB 5DGCA 2CV1A 2FEAA 2ONZA 3G23A 4I50A 2FZGA 4DEVA 1OROA 3AV0B 1NNSA 2XECA 5CEJA 4BGIA 3TSOA 3FOEC 4RXUA 3D31A 3I1YA 1P9OA 2FUG1 3E70C 3ESDA 3GDFA 3VPGA 5EXXA 1BD4A 1NHGA 3L5KA 4MYHA 4PWYA 4OK3A 3WWZA 4EYSA 5DTEA 5BVGA 3GF4A 3Q3HA 3HPQA 3WL3A 5BNTA 4KQ1A 1NMXA 3DLBA 2WHPA 1EZZA 2REXB 1E2FA 3IEIA 3ABQB 2NXWA 2PL5A 2ZI3A 2X8BA 1R4MA 4Q03A 1AUPA 4D2IA 5C8YB 5BUQA 1OSNA 4Z4EA 4HQFA 4G4GA 4L4RA 4YRAA 3HXKA 3MLEA 5K6RA 3UPTA 4KIJA 5G0VA 3K0HA 4H15A 2HHAA 1FFEA 5B1SA 2JI8A 3P0FA 2OXEA 4M1ZA 3SDSA 3J80A 1EUYA 2FFAA 2W2PA 3PUIA 1R8YA 1PR5A 1W85B 2PSEA 1H2HA 3QVLA 4TLLB 1S3FA 3T34A 1GCGA 3V5NA 1R00A 3HN7A 2Z57A 1E69A 5C5DA 2Z08A 3O8QB 5JNRA 2WOJA 4GR9A 3AHCA 4JS0A 2JB9A 1UBTS 2Y1GA 1MTOA 1PJBA 3DMNA 1I32A 3JQAB 1JG3A 4KSYA 4QYWA 4EO9A 3IKMB 4LJ8A 4WRRA 3ZV5A 3JW8A 2Q0SA 5KZMB 2JD2A 3TZHA 3HDQA 1Y5IA 3OLYA 3QPCA 4E12A 1DB3A 3SQWA 4F96A 2Y1FA 2OFXA 4C06A 4EARA 3FY4A 5IT0A 3IB6A 3IAS1 3GZNA 3EXIB 2N42A 1OW3B 1E0KA 1YMQA 2R86A 4GM4A 3T54A 2YXEA 4WA7A 3K0EA 4A0HA 2GJSA 3ESBA 3JSXA 5JRDS 1IWBB 5IZCA 2ZI7A 1RZUA 3KWFA 3DCIA 1M7BA 2OUKA 4WI1A 1HNZB 1FQWA 2PRSA 5EI5A 5D3QA 3F6BX 3PD7A 2AJCA 4QQ8A 3INRA 3OQOA 5SY4A 3LX5A 1LWNA 2FPGB 4LF4B 1GZ3A 2C1EA 2IGBA 3FCSB 3KT0A 2P9EA 3AHHA 4HWTA 4IQ4A 1JEAA 4K7JA 5KVSA 1A88A 2NUTB 5D8DA 1KDRA 3GDWA 2J0UB 1CNFA 4ZTBA 5B64A 2DUWA 1S2LA 3OU7A 5AIBA 1ZJYA 3X2EA 4TGLA 2JIZD 1TXGA 4MLDA 3BREA 1ZONA 2X5KO 4MYTA 2COKA 4MV5A 3ONWA 3MERA 3PZRA 2ZREA 2I4OA 4Q4DA 5G4KA 2PT6A 4M9XA 1QVWA 1A9YA 1ZMRA 1GNRA 5TT1A 1U2EA 1R2QA 1L1FA 1ADJA 3P7MA 3HKEA 1Q6ZA 1JI0A 3PC6A 5E7MA 3ULKA 2VDOB 4YRNA 3RADC 2PUAA 4PSVA 5AXDA 1NULA 1I01A 4MVXA 2X0FA 4KQHA 3AU8A 4E5VA 1S4QA 4GR4A 4Q3EA 2F3PA 4MX8A 2GI4A 5HP4A 5H83A 5E95A 2AFIE 3AR4A 4JD5A 3TUIC 4E1VA 5KSOA 1I7QB 4MULA 1T5LA 1R5BA 3WRXA 1T2NA 4L8GA 4XGQA 1GAQA 2WF6A 2RGNC 4FC7A 3QSGA 5JIBA 2X2OA 2I99A 1Z7GA 1YHZA 3OLZA 1N7IA 4A5SA 5EJ5A 1XZIA 2YC2C 5DI3A 5AHOA 5INTA 3CCCA 2NUBA 1NL3A 3VBCA 5KDOA 2BEUA 3ASZA 2Z09A 2JGRA 3BSFA 3E7DA 3LXMA 4HO1X 3S2ZA 3ZW7A 1EFLA 3IHKA 1G6OA 2I6XA 3ND9A 1XL1A 3C0KA 1A5AB 5E2BA 1EG2A 2R96A 3I9LA 5KYKA 1NNI1 2ECFA 4LC9A 4D8WA 2O48X 2Z04A 5E8JA 2NSHA 3HL0A 2VCEA 4N0QA 4AY5A 4LNAA 1U28C 3W4IA 3ZE9A 2JLVA 2UVDA 2IHUA 4UDYX 1YS7A 1NJ2A 2VL7A 4BPRA 4EI2A 1VJ5A 3AWDA 3MB8A 3NDRA 4H1HA 4WY2A 1WAMA 3EH1A 5L3VA 1KJNA 4TKMA 1KOGA 1LSSA 4REMA 5JCOC 4QM7A 4G5RA 4B3JA 3G1TA 1OXXK 3DGEC 1EDOA 2Y1DA 1AIPA 2R1TB 2O8VA 4FX5A 5HK8A 4ALJA 2COUA 3H8VA 4RVSA 6ADHA 2NUAA 2F8MA 4MO9A 3AX6A 4D7AA 5I5GA 2XX3A 4OU5A 3G9QA 4M83A 1KDVA 4EP1A 2TECE 5KINB 2XUGA 4FUTA 3RYFA 4EIWA 3GCWA 2ZYVX 3TZQA 1K75A 5K0SA 5JADA 5JAUA 1CUFA 4C76A 3RQSA 4XQEA 5GV7A 2JFWA 2JK0A 2BFDA 2GERA 3BRQA 3ITKA 4G5OA 3ZR4B 3FFAA 2NV0A 4G97A 5KQGA 5AVKA 1POXA 1HE5A 2P5SA 1JFLA 3G0HA 1G7CA 4L6CA 4EYQA 1H9CA 4BQNA 1ZOPA 5I48A 5B30A 5I7HA 1KJZA 3S2IA 1YXMA 2YC4C 3A0UA 1QZTA 3KYJB 2XZTA 3ML1A 3DA8A 2P2GA 3MCAA 1VA4A 2BGRA 3RJMA 2P9QA 3DMTA 5CJ2A 3GFFA 3LUCA 1NXPA 4U00A 4ZYUA 3AERA 2EBFX 2QQ5A 3PFWO 3CN7A 4CKEB 1DFGA 4RH3A 4F3YA 3P9CA 3UAGA 2EYQA 1RCUA 3HDVA 4KSCA 4BJHB 3M4NA 1VFNA 4HVTA 3OQIA 5F77A 4A0QA 2FZWA 3U16A 3EUEA 4KLNA 5JS2A 3ITDA 1YR9A 2IDKA 1UJBA 5CFQA 4EFLA 2IIBA 4JBYA 4AQDA 2QXUA 5AKHA 1LZLA 2RONA 3F6YA 3AF6A 3ND6A 2D2XA 1D8TA 2J1LA 1QFXA 3N2ZB 1U8AA 2I80A 2W4IA 5KVVA 4N5LA 4Y18A 5BNZA 5KTSA 1G2QA 1X87A 3RTCA 2ZBVA 1LPBB 2A84A 3JALA 5CH5A 5JH7B 2GJAA 4O2LA 5EKXA 2SKEA 5ICSA 3VYUB 5I9NA 5EHQA 2CNLA 4TKUB 3MAJA 1E3WA 2VPIA 3LRXA 2OZLB 2FG7C 3DHWC 3TSWA 2QMQA 4BKPA 3RRJA 4F45A 4IM7A 3F49S 2ZU6A 1AK2A 3MINB 4FZ5A 2QD4A 4F4FA 4Z3OA 3VH4A 4HSEA 3WWYA 2PLAA 2WYHA 4B6JA 1ESMA 2OHIA 3KJQA 4MRVA 1BG6A 1SVWA 3F1KA 1E66A 4FYIA 4BQFA 2DEUA 1CG6A 1ZO8A 2PFKA 2J45A 2ZIXA 3TTYA 3MPOA 3RBAA 4HQKA 1WKVA 1DLJA 1FDIA 2GLXA 1HKHA 1QQ7A 2YV4A 4WOPA 1RC8A 1KP3A 3KUCA 3AW8A 1GNPA 2GPJA 3VYVA 1QRUA 2IV3A 5EHXA 1EUCA 1VMKA 4C3UA 3L1HA 5DEOA 1KSHA 1I7NA 2AR7A 4IZOA 5B1IA 2RD2A 3F74A 1MX9A 2OWDA 2M6LA 4QTXA 1MBZA 1LSOA 4XKJA 1KY2A 2HJRA 4H7JA 3P8ZA 3PJGA 5ALPA 1ACMA 4UOEA 1SWWA 2KI5A 3KE9A 3C6QA 4KLAA 2XB6A 3COPA 4PQGA 5M3BA 3RIGA 2WM8A 1V96A 1IDOA 1QJCA 2B4TO 4QFDA 3CUYA 1PRYA 3OX3A 3D4LA 3NATA 5E7QA 3REQA 4NECA 1NM5C 3RROA 4GI2A 1XAGA 2ZLBA 3ZGXA 4ATNA 3COJA 1R9MA 3DHYA 2O4UX 1E6KA 3MWDB 3U5ZB 2ATIA 1Y8RA 2JHAA 2UVQA 4N0PA 4OH7A 1NE2A 4BFXA 3VU0A 4R9SA 3O4FA 3PR3A 1TZMA 1QO0A 2P6NA 3G0GA 3QWIA 4J7UA 2N0SA 5BT9A 3G13A 3IR6A 3RS3A 1KH3A 1U5AA 3L8CA 1EUZA 2A5YB 3BXEA 1ZUNA 4J94A 2XGMA 4BV9A 2AOVA 2V3VA 3BF7A 5K0NA 4RD4A 3JPYA 1YBMA 4XJVA 4G0PA 1P1IA 5K1ZA 2HH9A 3ZWPA 2UZ4A 4OJNA 5FHRA 4ZTZB 3LYHA 1KI4A 4LE1A 1N9ZA 4L8YA 1SUFA 1I5RA 1A69A 5DYGA 1RPAA 2YW9A 3FHJA 4WCDA 4QYXA 4JEIA 4EJMA 5A3RA 2GD6A 1KH2A 1NW5A 3GEIA 2FLVA 1IFXA 1Q84A 2EDAA 1QC5A 2EFDB 3HO8A 4WN9A 4XTRA 3VRHA 4ONEA 3HJFA 4I9HA 3C2QA 3LIIA 1QPZA 4ZD6A 4CXMA 4NJOA 2IY7A 2NAPA 4YJ3A 3O90A 1D6NA 5J1SB 3U4MA 2X0KA 3KQQA 3RW9A 1FDWA 4CQJA 1U0NA 3CG0A 4CBVA 3ESAA 1WW8A 4JJ8A 4UHHA 2V3WA 4TL6A 1UUFA 3FA2A 1F6BA 1EVZA 4U6SA 3V7NA 5FAXA 1G8SA 1L4NA 1LFAA 2ZKLA 2BM1A 1STOA 1BMDA 2Y71A 3L7CA 1ZX1A 2ZRFA 1L3IA 5CLQA 4DJ5X 4IRMA 3OE1A 1T91A 1IXRC 3EN0A 3TRKA 3IL2A 1B1AA 1LRLA 1TT7A 5I7SA 4QBGB 3L4BA 4BRSA 4DR7B 1KYTA 5ICGA 3IKJA 3ABRB 1ADGA 2B6HA 3GQBB 3MMPA 5JHGB 4PPFA 4XLZA 3RV4A 3U39A 4EQ6A 1KZ6A 5IARA 3ZWXA 2Q3LA 2XUIA 3K8YA 4ZCIA 5IUJC 3OC6A 3N5CA 3LT5A 4HDMA 4XYMA 5CBPB 4WV3A 1WQ3A 4RJIA 3R5JA 5FV4A 2HK8A 1TE2A 2B0JA 1L7AA 3DTTA 3M6AA 1F1BA 4RK7A 5G1NA 2AWNA 4ARSA 2O8EA 4F3TA 1E1QD 1XMQB 3IFSA 4AMYA 3WR5A 3KEGA 1NP7A 1YRQA 4DZZA 4KPYA 4QPCA 4CMBA 2VIIA 5AKXA 3CN9A 4KO8A 5IJZA 3RE1A 3BK2A 2WYVA 3W9BA 5D3ZA 4CKEA 1I4EB 3OZIA 1SK9A 5CAEA 1Z33A 1PG5A 1WLSA 1WSDA 3EWIA 1OZFA 1K66A 3HL4A 3K4QA 4B87A 5A0TA 1FB5A 2OXTA 3KAKA 4B74A 3IKTA 1IAVA 4DRYA 4FB5A 4JYCA 2OAEA 3S99A 3FBTA 1A8IA 3EUWA 2PZFA 1TVMA 2XQGA 3KR1A 1TOAA 4CR6A 5KNCA 3KQHA 3KZKA 3ROGA 4EABA 1N8SA 3BXGA 3D3EA 3GT7A 2HJ9A 2NVOA 5SYNA 2PL1A 1R4MB 1KSFX 2Q29A 3K94A 2PCLA 1E64A 4KXQA 4BO2A 2AZ4A 7REQA 3PSAA 3PQCA 3S70A 1YQDA 2CXTA 4KMSA 4NABA 4QWMA 2I9PA 2VNIA 4J4BA 4X61A 2FF7A 4A36A 4M1OA 4MUFA 4QC2A 4NICA 1W59A 2UZ1B 3DPIA 4JA0A 3CZCA 3INYA 3UAVA 2BFNA 3HN2A 1U5BA 2V74B 3LBIA 3ZBTA 1Y8ZA 3FVTA 2W6QA 3OKPA 3QW4B 1B6SA 4JLBA 1P44A 4F12A 1WPQA 5BWNA 4ZV9A 1YGPA 2GDZA 1E1CA 4JYAB 5F2EA 5DM4A 4M89A 1RBYA 3V34A 4KQFA 2PR7A 1RYHA 5D1NA 4C7JA 2CZGA 4ZKEA 3IMGA 1MO3A 2XCTB 4HDNA 4QXQA 1ZIXA 1OA0A 3M4YA 5HKOA 1JW9B 5MGNA 3FGPA 4BQRA 3HC7A 2ZROA 3ISTA 4TRMA 3DL7A 3FLBA 1QLWA 3WYEA 1UDBA 4O33A 3SZMA 5AKLA 3E1GA 3L0ZA 3R3VA 4KQ9A 2ERXA 4DCCA 3C5EA 3EGWA 1I3MA 1W88B 1HL3A 3I2GA 4FDTA 3K3PA 3JAWB 2D6FA 3B1XA 3T5GA 5FJJA 2UUCB 4DOMA 2QN7A 1RWPA 1R37A 2EBWA 3I6MA 3FSGA 3A3OA 1A7AA 4LSWA 3IX7A 1GR0A 1RWWA 2VYQA 2YXBA 1RJDA 1PNOA 1BHSA 4CHTA 3P20A 1A1VA 5GVRA 4N7JA 2HRZA 2J0UA 2OXFA 4ND5A 4Q4HB 2MOKA 3ZHBA 3IALA 1W4ZA 3DHVA 4E2YA 5C53B 3PLAE 2IZ6A 3IO5A 3KPUA 3VFDA 3INTA 4Q1AA 3ZWNA 3MFQA 3S7TA 1NC3A 3TL6A 2SHKA 3E0QA 4FZJA 4V0ME 2G82A 3AEKB 4DQUA 5LP1A 3RANA 1XZPA 1GM5A 4D3XA 3BDAA 3VNSA 2HPHA 2ZJBA 2OD2A 4YACA 1KAOA 4A0GA 2F17A 3EAFA 3WE7A 4YI3A 1AN9A 3H9QA 1HH4A 4ZYZA 3H2BA 4FOLA 1F17A 4Z0HO 1ZQ9A 3DWIA 2VDWB 3CZQA 4BL5A 1C0LA 5A3QA 3FNHA 3HP7A 3ZJUA 4U7FA 2P5YA 3OJLA 5FOUA 1GNQA 1VG1A 1YQGA 3U7GA 4RAOA 1Z28A 3I2HA 2FJ0A 3NEYA 1XZJA 4AJIA 1CZRA 2G6BA 2MINB 3EPJA 1YC2A 2AOXA 4XXHA 3BRSA 3FVWA 4C4PA 3VPHA 2FXVA 1FTSA 1E7MA 1PS0A 1X38A 3EQ9A 4J0CA 4YVFA 4FYXA 1IM2A 2WOOA 1E2KA 4UTNA 1BDBA 4EHKA 1S02A 3OJ0A 1XU9A 4ZVLA 4F2PA 1NF3A 4RPIA 4WFKA 1OU4A 3R3YA 5DEIA 3MSXA 2NU9A 1CERA 1ZXLA 4AUMA 3KQYA 2QMOA 3W1VA 3RVBA 4OCZA 2B35A 5KWEA 4C07A 4YPFA 1Z5WA 5BYKA 1JEEA 3RVJA 3CB2A 1E2HA 4Q3CA 4Q4LA 2G83A 5A05A 1C9DB 3V55A 5ALEA 2AZDA 2PRKA 3C1OA 4RKQA 3ERCA 3HCFA 4DMMA 1JV2B 3A9UA 4MHSA 2CHVA 4E94A 2R6JA 2RGEA 4QREA 4DV7B 3HRIA 5EWMB 5KNCD 1Z5ZA 2Z4TA 3IQZA 1DG9A 1PZNA 3B6JA 5EMHA 3UV6A 3DCNA 2W8ZA 4GZMA 2YZKA 5L95A 3GCGA 3HUEA 4Q3DA 1XTJA 5HFJA 2RE8A 2NU8B 1VSVA 4YCNA 1PQ4A 1B7GO 4CMIA 1EJ6A 3BRCA 1ULAA 3EVFA 3K73O 5DF1A 3WYFA 3AL3A 3C8HA 4DRZA 5KYYB 4DR4B 4ACAA 1XEWX 3MK31 4F5DA 3RI3A 3A31A 5JXWA 2BGIA 1RWOA 4TXJA 2JRLA 2VDLB 4HQ0A 5JDCA 4RE5A 2N75A 2B21A 2JL1A 1ZYUA 2DLNA 3KJIA 1EH5A 3KT3A 3N2NA 1L7BA 4GMDA 4C03A 4IUBS 1SB8A 2HU7A 1QZUA 2JK1A 1H9AA 1L8XA 1SU8A 3LP6A 4JXXA 3GLHB 3VJRA 3F4BA 3HACA 3WIUA 1YR6A 3SFTA 1NBMD 3JYOA 3M49A 1VJ0A 4YJHB 1WZUA 4D0GA 4TV8B 2W6JD 4I9NA 2PS0A 3EBPA 4C2AA 4V02A 2ZWMA 1PVVA 4BVEA 4QYSA 3ED1A 3OE4A 3PJRA 2XKBA 3QF7A 1U3GA 2HXSA 2I4NA 2GSDA 2WTMA 2ZAOA 3PFBA 3RS2A 5JCJD 2D7DA 3AEQA 4TRJA 1ARZA 4QYIB 1IPEA 4DDKA 1LF0A 2AMYA 2F9FA 1HE2A 3FFWA 4WZ6A 2WP8J 1E2JA 2H5IA 3L8GA 4PTZA 1AF4A 2J0SA 2FP4A 4ZZ1A 3H11A 2XXAB 4F5ZA 2ZUBA 4BEBA 1XDSA 2EFYA 4FFBA 1O9HA 4I08A 4C6SA 2NAFA 1NQ5A 2OV8A 2X77A 5DHRA 2VYVD 4PBSA 1OI7A 3GRRA 2JD1A 1EXNA 3PPWA 1J0AA 3N0TA 3ZXSA 2I78A 2WQ6A 1C7ZA 3NCTA 4BBPA 2PANA 2WYUA 1RTKA 3OD1A 5J4YA 1KF0A 4IW3B 3OZGA 3M83A 4JL5A 4E31A 2AFIB 2I4IA 4QXAA 2WICA 1ZLXA 1Z25A 2QTRA 2GHTA 1Z5GA 4OG2A 1DBIA 1UAGA 2A0UA 1J8VA 3EZYA 2H1CA 2BRUC 2ZAIA 3O2NA 4S35A 3RVPA 6AT1A 1OBHA 2ECOA 3E0XA 3H2YA 3IXMA 4LRWA 4D99A 3CYFA 4EMTA 4JLVA 1AXRA 1GAWA 5HM6A 1I9CA 4CDGA 3JAMA 1FFBA 2Z58A 4FT4A 5DV9A 3BG5A 4EMUA 3ANTA 2FRVA 4RTPA 1I94B 3JWHA 1DG3A 2W2NA 4B45A 4PHFA 4BO0A 1OH5A 2QYHA 4BP3A 3D4BA 4WLOA 3FWNA 3PEEA 2L42A 4XEHA 2YHSA 4BLTA 2FEOA 4OYRA 1J8DA 1O96B 1P80A 4BO8A 4F6RA 4JNCA 1OLUA 3IMKA 1SJ9A 1WCYA 3PQDA 3WVNA 3LPNA 5IN4A 4CKXA 1HORA 1J4AA 4KQCA 1UKBA 5LL6P 2HW8A 2WWIA 4PG4A 5HKAA 4LDJA 1JBQA 3R40A 4TXMA 1NXWA 1SB9A 1GRNA 1MIOB 3L7DA 4L72A 5SYMA 2XCRB 1N9GB 2HZ7A 3RASA 2DYKA 1I3LA 1FVFA 3DOOA 1V3UA 3FVRA 3ZX4A 5C1PA 3PT9A 3U4GA 1TO6A 4ARBA 2VSXA 1KZ7B 5I7EA 3KSMA 4PLTA 3V4OA 2Y0CA 3CV3A 3NGLA 2WAYA 5EVJA 4J1SA 1UMDA 1MIOA 2NM0A 3QUBA 4HGQA 4DC1A 1NONA 3RIMA 1ORWA 4W4TA 2O5EA 3LSTA 1M2VB 2ZQYA 5LWHA 5AJVB 3CGWA 2ZIGA 1Y3IA 2Q2QA 4CIVA 2VHYA 4JB8A 5E1BA 5K0JA 3LL4A 1PR9A 4I6GA 5K9ZA 1M66A 4ZOLF 1BX0A 1JEYB 1C3VA 2D2FA 1H2FA 4Z5XA 3HNRA 3UMRA 1EWKA 1V8BA 1II0A 1EZ1A 1GPJA 3BFKA 3I4LA 3I8XA 1U2QA 4L8FA 1C7RA 1AB6A 1YS1X 5J9FA 5CB8A 4URXR 1P91A 2P3SA 1SCNE 3EFOB 3PFIA 1T1SA 2HLDD 4LDAA 1R4NB 1TECE 2FWRA 1FUIA 2ZT7A 4X45A 3F3YA 2CD7A 3NZEA 3EW7A 3B9PA 4R5MA 2PRZA 1E9DA 1D0IA 2H0AA 2PRIA 2Q46A 4G1CA 2JJ8A 3BCHA 2AJBA 3QUCA 4E09A 1KMHB 3KBBA 1N32B 2CDCA 2XR1A 3HCWA 1K3UB 2H9YA 4RF3A 5FTJA 1P2BA 4JWKA 1NA5A 3TSZA 1DI0A 1EUDA 3DW3X 3VC7A 1A9TA 3WRYC 4FN5A 4BAZA 4G8JA 3H97A 1K6MA 2WVGA 2ZJ3A 1UJMA 3I76A 3OZSA 3PDIB 4UHEA 3ZTYA 1I7DA 4ZJPA 1ZNQO 4HB0A 2J0QA 1QKIA 3FOBA 1QNFA 1BFUA 2AI3A 3V4LA 5EESA 4AG5A 1QP4A 2FFQA 1U3UA 3KZCA 4TKZA 4TOIA 2OKCA 3R9IA 2XWSA 4QG7A 4Y2HA 4A8JA 1AUQA 1S3GA 4MB0A 2DFTA 2XDQB 3GN1A 3RVSA 1OXSC 4A8JC 4AJ4A 1BXZA 5DXJA 2IHNA 3SJUA 1WB4A 4Z4FA 1VZ3A 1S89A 3DP9A 5FPHA 5ALDA 2FW9A 4RF4A 3RBVA 4YMLA 1B73A 1AT1A 3GJQA 3HR4A 3KJXA 4WUVA 2A2ZA 5G0UA 2HO4A 2H31A 1PLKA 1Z8NA 1U98A 2RCYA 3FWKA 3OBIA 1PQYA 4X6UA 4EGQA 4GHWA 2CE7A 2IEYA 4TKLA 3TEMA 5AK5A 4RIEA 2GOYA 2II6A 3V8PA 4D8YA 5E0KB 3AR8A 3BWBA 4LPKA 3LOUA 1N6KA 3OEEA 3PNMA 3R3JA 3TVDA 5DASA 2XF8A 3TWOA 3DMPA 4B76A 4HDMB 4OA8A 2XE4A 2V55B 4WNIA 1FDTA 2WMNB 5GJWC 3PJEA 3D7LA 3SX4A 3WK9A 4BMVA 3IHTA 1NUHA 4N5DA 3S81A 5JTUA 3UA4A 2H1VA 3KZ1E 3SM3A 1E9CA 3A2LA 1QO9A 3NVDA 4HGZA 3OM8A 4UCFA 3PGMA 4N54A 1E1MA 4Q4CA 4CIWA 1A2QA 2CUTA 4MKGA 4MVJF 4DXHA 3CX8A 4LTDA 1L7EA 1MU0A 1USIA 2N9UA 2WVHA 4JYBA 3MYYA 5IAEA 1EE1A 3KQWA 4CV0A 3NMUF 4FKZA 2QTAA 2CF6A 5ALGA 5A4IS 3A6DA 2Q8QA 1OBVA 2OHOA 1Z29A 4XYBA 4RENA 3AFMA 3QA9A 1VL6A 1YJBA 3UVEA 4EDHA 4E1AA 4UM9D 1KZYC 3C15C 5JD5A 1QGZA 3I23A 3RYTC 3ELBA 5T3UA 5EYPA 2ZPTX 1DU4A 4O08A 3EXG1 2F2TA 4LXIA 3EIXA 1BFKA 3ROZA 1SUIA 4PIVA 4WFJA 4AZ0B 2HIAA 2WJGA 3VZCA 2RAVA 3VDNB 2GESA 3I9FA 3U4HA 2VNHA 1Z6GA 4R2HA 4TS3A 4E5PA 3CQ9A 3T1TA 3LF2A 3OIYA 1W7AA 4DA4A 2WHYA 2C7VA 2QLFA 4WDQA 1DQRA 1DO8A 5L3RA 1YU9A 1O9GA 3EWSA 1WU8A 1JVNA 4N7RA 2HLPA 1IE3A 2OHGA 5CDGA 5I9LA 3DSRA 1RRMA 5ICMA 2VUHB 3T7AA 3D2AA 4LHXA 2W83A 1WTAA 5AFSA 5FLEX 5KNDD 2CLSA 1J7KA 1T9GS 1K08A 2VLBA 4II7A 3LCRA 1OXVA 5ES4B 1QH1B 2PZ8A 1AKMA 2AKYA 2DVMA 1M8JA 3NU1A 4J1QA 2IXDA 1ESCA 5JATA 1OWLA 2I6UA 3FRJA 4AS1A 4B3RB 1R0ZA 2QUZA 3AXTA 2RK3A 3QLEA 4MPRA 4Y6LA 1DTSA 3CVXA 1QU2A 3PQ7A 3E5RA 2N1BA 1YK1A 3PPVA 3EVZA 5K03A 3FOFC 5DDIP 4I55F 5BSUA 4X1KA 3NP9A 1R6TA 3R7AA 3ZLVA 4D4KA 4ZYXA 1U2SA 2Q3FA 3MMSA 3F96A 1SOVA 4GOLD 4N41A 2R9VA 2X9GA 4BEJA 2QBYB 5SICE 1U3DA 1V5EA 1JDVA 3B85A 3TQOA 2UUAB 3RUPA 2FN8A 4MVCA 4KQ6A 1M74A 2O2EA 4LHEA 2XQIA 1XTKA 3VQTA 1HYHA 4FFWA 4LHYA 2B6NA 1L7PA 5KDDA 2F64A 3INNA 4LCJA 2POCA 2FDRA 2QHXA 5B7NA 4I8IA 4B2LA 2G28A 2EG9A 1L7NA 4QNMA 4B47A 5KYXA 1P19A 1YA4A 1GPAA 3K2QA 2B9EA 3BCUA 5ALJA 1PGQA 4P22A 3W6NA 1N3LA 4D45A 5LQRA 3M3HA 3ICEA 1PV4A 1SBYA 5BYBA 1J9EA 2F3TA 4MVYA 4XSGA 5CXXA 4M60A 3S2GA 4H3VA 4K8OA 1F2VA 1TC2A 2HSDA 3IR7A 4DR3B 4C2TA 3O2JA 3OCJA 1C3XA 3B6ZA 1CFJA 2HWXA 3BTVA 1WCV1 4RV5A 1M5UA 4ZO4A 3PXEA 1RM0A 1LTQA 4BKRA 4R2XA 4W5OA 1E5VA 1P17A 1RLTA 1BCSA 1N2SA 1VCMA 2PSSA 3IP8A 1H2BA 3E8XA 3K70C 2MTBA 3ECAA 2ONJA 3MT8A 1H4TA 1WEHA 4KL8S 3HCCA 2A78A 5GINE 1RAGA 5JMPA 4EB6B 4L3WA 3I2IA 3MCVA 5FA5A 4ZI7A 3L1UA 3ZBQA 4DJTA 1OB5A 5FTNA 1RPJA 4QLBA 1UBGA 3ZHUA 2O19A 4IPTA 1NJ1A 2WD8A 1KVSA 4R2IA 2A8YA 4IV5A 1MGOA 2G4CA 3FIJA 5KOJB 1B8OA 1B2RA 1SC9A 2O23A 2GXAA 4GO1A 3PXDA 4X20A 2A5DA 4IIYA 3R74A 1C9YA 1WZCA 5EPUA 4K1LA 1G6HA 1XNHA 3CUWA 4YC7A 2SECE 3IAEA 4ES6A 1PR0A 4JJ6A 4PZEA 1MO4A 2X9NA 4WBNA 3E6AA 4KVGA 4MP3A 4L51A 4RVGA 4NONA 1RE1A 4MSUA 1CRWG 1Y3DE 3LD9A 3GH1A 4GC9A 1I0ZA 1MC4A 4U3JB 1P0QA 1AKTA 2OENG 3L7NA 3GRYA 3LKZA 2VZ8A 4MRMB 5LBIA 4U7GA 4DWJA 1NRJB 3OE7D 2G0AA 2Y1EA 4MUKA 3SIRA 3VI4B 4F6LA 5AH0A 2Q5HA 4IIJB 3ZQJA 1AGNA 1UQTA 3JYNA 5HKKA 3W8NA 5LQKA 3GNLA 1KEEB 1SBHA 4MNTA 1YH3A 2O8NA 2C58A 2P9HA 4PSUA 3CEJA 1Z0SA 2PMDA 1ID1A 3HCDA 3HLKA 5HEKA 5B37A 2WMDA 4D9HA 5IAOA 4PN7A 4V0OA 3OCYA 3IHLA 2WJZB 4NDAA 5LMUB 2AYZA 3IVMA 3UUFA 3ANSA 2H85A 4MI1A 5CG2A 1SC3A 2H17A 2WD7A 4WFQA 4BTVA 5ESRA 5CBPA 2RIPA 4RMHA 4F71A 1VJ1A 1WXWA 2JH9A 10MHA 2QLLA 3UF0A 3B3QA 2QTWB 4UMVA 3VI3B 2XW6A 4UE2A 5ALVA 3H83A 1MA3A 2W2VA 3GAFA 3W06A 4C4OA 3IIEA 3RYIB 3KU1A 1GSIA 5EJ9A 3OOWA 1YWGO 3R6GA 3BAFA 1OXBB 4BMYA 3GEPA 3TECE 3K9NA 3QX3A 1P72A 5DM1A 2ZBRA 2QVZX 3NKVA 3W2TA 3C5VA 2Z95A 4R0VA 4R7GA 1GV0A 2WSSA 1CQJA 2RAPA 4ZHQF 5KOHB 2R47A 5FUMA 4MPDA 4DM7A 3HCPA 1BHJA 3H3FA 1Y48E 2A88A 5BSWA 1AD2A 1X9GA 4OI1A 4RZXA 4AURA 4FQ5A 4L22A 3R7FA 3UXHA 1IM8A 1N57A 2GCGA 4QYIA 3AUFA 2I7DA 3DE6X 3RT9A 1BXRA 2WSBA 4IGFA 5AI9A 3AB8A 3QIAA 1KAGA 4YP5A 4MKZA 4ZCSA 2WJYA 2HDHA 4DY4A 1N2BA 3PHJA 4NCBA 1FP4A 1YBVA 2G88A 2V6JA 4HTAA 4UHKA 1ZM2A 3ICVA 4XB1A 3WV5A 4HV4A 1I24A 5KC9A 1PVOA 2HYIC 4B7XA 3IQDB 4NMWA 4CF3A 3FX2A 2G0NA 3QHPA 3SF8A 4NARA 4ETWA 4ZC1A 3E5NA 1TAGA 3WIBA 3FZYA 1Q50A 2D1QA 3EZNA 2IIQA 4G1MB 3HKDA 1Z16A 5K6TA 4U9HS 3VH2A 1GZVA 3OZVA 1IRIA 4XM0A 2ORWA 2QMYA 3CPEA 1UBMS 3NNSA 4RE6A 3AFGA 2Q7DA 1CZLA 1E6UA 5LQDA 2CXHA 2IOYA 1TEVA 3ETGA 1ULSA 1UKZA 4JVNA 4LV6A 1GN9A 2C4TA 2IWRA 4HEHA 2ZS9A 2KSQA 3BHNA 2XE6A 3GJRA 3TLXA 4BX9A 1TKRA 3K1ZA 4V0KA 5LUBA 1MA0A 3D6FA 5A5FA 3DUFA 2DGDA 1ECPA 3HKCB 4RADA 4XPZA 2NVUB 1CF2O 5DCUA 3GLKA 4DMHA 2HIMA 3ET4A 4DIKA 1IN1A 4KXXA 1J0DA 4OJQA 4YP9A 4MAAA 3VC3A 1YL6A 1HURA 1WO8A 1EFVA 4EJ2A 5JVDF 1ZVVA 4DR6B 1YKGA 1ZRNA 4URFA 4OSEA 1CC1S 3S0JA 2YIVX 3V9PA 3KSRA 4MXDA 5CB4A 1CJSA 2IS4A 4FILA 4D1YA 4UBOA 2J08A 4AJPA 1H42A 3JYLA 5D3MB 4Y2PA 1WXHA 1UMDB 1I2BA 3EJWA 1VMDA 2XGGA 1Z6YA 1GUAA 3D7RA 3KJEA 4JKYA 1KEPA 2IDMA 1BX1A 4MITA 1MJNA 2H11A 4KACA 4MICA 5HCUA 2WTXA 3EXHA 1SXQA 1T4CA 2R4QA 4IF6A 4C6RA 4I1OA 3HWSA 4MHTA 1QBGA 3QEMB 3M6XA 1SCAA 4J3FA 4EEZA 1Z7YA 4K2HA 4B1FA 4NBWA 4V03A 1U2GA 3LLSA 5CIWA 2NXNA 4M0PA 3ZI7A 2WT8A 4DCMA 4QU0A 2CDBA 1XJCA 3H8WA 1TUGA 2PXCA 2QPLA 2UZIR 3RYHA 2LRHA 4MS4A 3JX9A 4DBZA 1NI3A 1MVNA 2WABA 3DT6A 1N8TA 4NF2A 2D00A 4A1FA 5EUBA 4PLPA 3CRQA 5C8YA 2KWIA 4B7UA 4CQLA 2SKCA 1KI9A 5FNVF 3AH8A 2V7VA 2YIDA 1GO2A 2QZ4A 4YAGA 4BJ1A 1Y82A 1JTEA 2ETXA 2J9FB 3EIFA 1E3LA 1IHXA 1PG0A 3NC0C 3U62A 3NV7A 3WYAA 1NG9A 4BJ5A 1TDJA 5JASA 3BS4A 3RFVA 3CE9A 1X2EA 2YIMA 2O7SA 2RG1A 1HE8B 4WKOA 4GL2A 1G7SA 4BY9E 4BGVA 2RGGA 3IJPA 1OI2A 4DMFA 1U7HA 2DSNA 4M1TA 1EP1B 1T3LA 2IV2X 1TVKA 3JVDA 4TPKA 2FVYA 3M1AA 5GTDA 2WUGA 1Z4IA 2XMPA 2PUCA 5J43A 4V0MA 4E51A 1AOXA 1VB3A 3BMCA 3DLCA 4PQFA 2VH2A 5E6UA 1JUDA 3DCYA 3JWJA 3RJTA 5LYJA 2I1QA 1ST3A 2FUCA 1C5KA 1P2TA 3FB1A 3KLBA 4AMBA 2E5FA 2RKBA 1ZVKA 3D6VA 5DLDA 3DEZA 2B7BA 4OP2A 4AM8A 3H4IA 1ZIOA 4I36A 1ZN9A 4XD7A 4B6OA 4I6EA 2FSHA 1P18A 4OKNA 3AR3A 3C7DB 4H9GA 2XDWA 2FB9A 2R8YA 2VJQA 1GKUB 3JQAD 4EYEA 1JQEA 2ZZMA 2WKPA 4MV8A 3AEXA 5I4IA 3AVPA 2EZTA 1NLZA 2IPAB 3AR7A 2C99A 3SJCA 3TLEA 2QSUA 5DTRA 1XCJA 4QDUA 3WB0A 1L1RA 2R68A 4HBZA 3SZOA 4AMVA 1M2OB 1SQ0A 1OGIA 1ND5A 1NY5A 4FHGA 2YHIB 5H9WA 3G5AA 3STHA 3SNKA 3EIHA 5CT4A 3TBFA 4Q7QA 2ZT8A 5AYVA 4CF5A 2QSZA 4W7SA 1GT91 3MTQA 5E9QA 4YMWA 4B6EA 4G84A 5ADWA 2F4NA 1H3NA 4G2TA 1OASA 5BSGA 1Z0AA 3WJ2A 2J67A 5TR9A 1N6RA 3DD1A 3H3JA 3K0FB 3K32A 1N75A 2FZCA 4ZEOA 3T0FA 2X4IA 2GJKA 4J90A 4RFVA 2HWUA 1XTZA 2OO5C 3W4JA 1U3CA 5FLXA 1QB8A 3NKLA 2BELA 3KXDA 4V1CB 2E7ZA 2H4WA 4CQMD 5JBIA 4MVJG 2BISA 2W6NA 1YU6A 3P0IA 4RCVA 2DSTA 3A1FA 5BSVA 1FRFS 1Y7PA 1VHQA 4OK6A 4AWXA 1KC3A 1Q1BA 3L9WA 1NUTA 4F1JA 5FR1A 2GJ9A 2IYOA 3IAS6 1DCFA 2H51A 4GEKA 4AN0A 8LDHA 4DDVA 1R12A 4NYJQ 4ZPJA 4ABYA 2ORED 3ZCVA 1XBTA 5BURA 4QGBA 4ERNA 3GO4A 4C4RA 3SIPA 4YUYA 1JSXA 3RUHA 4LWOA 1PJ3A 5DRTA 3G5TA 2IDJA 3HPRA 2NUPB 4RS4A 4PX5A 1K4MA 2HB6A 1NVMB 2V6MA 3EYAA 2BDTA 1T10A 2VP5A 1DAOA 1KYYA 2D13A 1BMTA 4MQEB 4DSNA 3HGMA 2OV1A 3OM9A 1GL9B 1UFVA 2YWHA 3ZCPA 3I9OA 1KJWA 5L7TA 1DQSA 3P0HA 1MRNA 4TT3D 1KL7A 5CP8A 1VIVA 1XP5A 3ILYA 5CXSA 3K05A 3WL5A 5BQXA 3UB3A 5BMVA 2JNWA 5LWQA 1YULA 3ECCA 2BHRA 4OIFA 3F73A 5F9FA 1X7DA 3BMOB 1Y4ZA 5CCBA 4B3DA 1ONOA 3OTGA 2N3ZA 1TEZA 1T0UA 2NZYA 4NCNA 5EEGA 2CYBA 4W5WA 3MB5A 4M9QA 1PIWA 3DQZA 3REGA 4XWKA 1A4RA 2XSZA 4HLUA 1FVHA 3A04A 1HYQA 3K9QO 3QV2A 2WHQA 1V48A 4MGEA 5HS6A 1M5TA 3WQSB 1A72A 3DBIA 3JWEA 4NV1A 3ROEA 5CW1A 3FYUC 3DFUA 5A4FS 5AUQA 1YQWA 3EHEA 2R1UA 9GPBA 5F1YA 5MHTA 1ZP6A 5H68A 1DC3A 4UEQA 2PBLA 5WRFA 3SYTA 1CUXA 5BT8A 3HCAA 2ZRIA 2WILA 4D4IA 2QYTA 1NVKA 3GLVA 4MWBA 2CE2X 3OURA 2BD0A 2P30A 2G5TA 1H94A 2FPSA 3NYRA 1ISRA 4NNJA 2VDWA 2FZKA 5JD4A 2VBCA 3R7BA 2YV1A 3AJEA 3AM1A 1DUVG 4LXXA 1MH9A 2CYAA 4CEHB 3KM0A 3DZJA 4OQYA 2FEWB 1R6VA 1QDEA 5BW8A 1VE5A 5TT0A 3COWA 3P2MA 3THYA 1R5OA 4G1UC 3OIUA 2XGOA 2JVKA 1W34A 3DDNA 3EG5A 1K3FA 5H0IA 5LZ7A 3O0TA 3FH0A 1TT5A 4J43A 3AVUA 3FR7A 3HBNA 1H4QA 3TFWA 4H1WA 3HLYA 1T2EA 4YT4A 3NEPX 1XTBA 4NOKA 4LFAB 3KS9A 4RDCA 2XMGA 2EDCA 1DEOA 3CF4A 3DW1X 4YP0A 3MGCA 1RYYA 4Y9RA 1WSWA 3Q2IA 1N4AA 3PTZA 5AJTA 5CA0F 1Z34A 2WE8A 3LUBA 1KOFA 1AZTA 2ZB8A 7AT1A 3U19A 4RW0A 4F0JA 1FLNA 2RCNA 2GXUA 3UMFA 5C9ZA 4UNPA 4JUBA 3ADBA 3BGSA 4QDZA 1IIBA 3VDRA 4ICIA 2W2QA 2ZT5A 5JWHA 4Z49A 3HA2A 2EQBA 4AJEA 2J3EA 4RKWA 5K51A 2IUUA 1H93A 1SR8A 1V3VA 1VQ1A 1VKNA 3HB9A 3BJMA 2A0YA 1G17A 2A0XA 4S0XA 3IEMA 4HH1A 4WZAA 4BMSA 3HBMA 1R15A 2QTZA 4CNQA 3KKEA 1NF9A 1KVRA 1U1FA 3E84A 3GDGA 4PAWA 3DAHA 4BLRA 1WZEA 2JGMA 4YMIA 4BNWA 3SZRA 3BCRA 3TLZA 1LK7A 4UEKA 4XSHA 2GMWA 4ZHSA 5L53A 5L4NA 5SY6A 3B8HA 3LLMA 4JVOA 1NJGA 3I39X 2JARA 2INGX 4WCFA 4O63O 1JIQA 1DV1A 1LVHA 1YIOA 4TLMB 4HB2A 2YHIA 2AG6A 2P11A 3A11A 4EY8A 5KQRA 4YXFA 2P41A 3GWGA 1C30B 3ROTA 1W44A 3TR0A 4AD8A 4P2GA 5BXQC 2P1DA 2Y68A 3PK0A 1X7XA 3RJ9A 1G291 5FUBA 3D8BA 4IHJB 4KH0A 5HFNA 1L5SA 2XHEA 3OUZA 5A3SA 4ARZA 2VN8A 1TMOA 2AFHA 3QYPA 3TFOA 1FW6A 1RLOA 4M9CA 1MVOA 4KYIB 2FI1A 2Y0BA 3OF2A 2NW6A 3NTUA 4MV7A 1B4DA 5CD1A 3SHWA 3A32A 3ICCA 4Y0AA 3ZKAA 1PE0A 2JFUA 1M1ZA 4KWCA 1NMYA 1O94A 2PT9A 3PTAA 4TVOA 3UQZA 4COKA 2EHDA 2R6GA 2ZRDA 3GEHA 4G8DA 1XCMA 1OTHA 4R6WA 1USKA 1WQ1R 2AG0A 1GPKA 3WNZA 4DSUA 5CVCA 5FWYA 3AM5A 4FFOA 5IM5A 5B3JA 2DQKA 4FR2A 1TNDA 1QG4A 2LPMA 3LQKA 3OLQA 5JQGF 1YRBA 5AOVA 1HL7A 3JRXA 3FKSD 4BLSA 2OA0A 4B43A 3C3JA 2YQZA 4CKCB 1QHFA 4FFDA 4H60A 1V25A 2QL6A 1MRZA 2VZEA 1UC8A 4OB8A 4UU7A 5EZYF 4V0RA 4IFBA 3ZQ6A 1Z6QA 3IEVA 1R18A 4LNUA 3HUUA 1QHIA 1VHLA 1Z4KA 2X9QA 3TQCA 1GPH1 3E3NA 2YOFA 2BFCB 3HUTA 3D7KA 4FD2A 4M1MA 1T2AA 1UMCB 5D5PA 4S1PA 2Q21A 2VAXA 4K6MA 1CUHA 5IG2A 3AUSA 2NYVA 2AQHA 2DR0A 2QGZA 1PVDA 3Q2OA 2B2CA 3TJMA 5BR1A 1D2MA 4FE3A 1G5QA 3OZXA 4H59A 1Y8QA 3LU1A 4O8ZA 3SDBA 3TRJA 1AKRA 3PQ8A 1ZN7A 3DBLB 4RSGA 5DYNA 3WJ1A 5LQAA 5HPYB 4WXRA 2PUEA 1OGYA 1WM1A 1JXMA 3G0DA 3BYZA 1V7ZA 4ZPXA 2UYYA 4KIWA 3OOYA 2GVDC 4JBXA 2OP1A 3IPAA 1PTJA 3OAAD 5B12A 4GW3A 2Q28A 5JD6A 1A96A 1E1KA 2R8BA 2VJOA 2A6PA 2QTVB 4H7IA 4P98A 4IINA 1FYVA 1OZHA 3NP7A 4I4TA 4FXPA 2I66A 3TRIA 2X8JB 2Y92A 2X4GA 1E5QA 1RXYA 4Q1FA 5LP6A 1XRNA 3ACDA 1NMZA 3VU9B 4CLOA 3DEJA 3GD5A 4LYYA 3FYDA 3SLKA 4C2BA 2C1ZA 1OQAA 5EJGA 1HDZA 1E8DA 1X0VA 2EWMA 5F35A 2QTCA 3ZWDA 3KEOA 4BVBA 5LP6B 1W4LA 1DINA 1HQCA 3OJEA 4Z86A 3B7PA 3QPVA 5J2UB 3ZHZA 4E15A 2I71A 4KXWA 3UJDA 2GN2A 2IQIA 3VYTB 2RHBA 4ZOCA 4YWJA 2BFBB 2DLDA 3IQIX 5CVTA 4KFUA 4IO1A 4ZCRA 5JMWA 1OJLA 5KX5B 1YHYA 3VHLB 1L7MA 3R3UA 4D3ZA 4LN1A 7ABPA 4RHEA 3RHTA 4D25A 3E4DA 1NN3A 1A2BA 1WXEA 1ZU4A 2A3RA 5ALLA 2MDTA 4GYYA 2Q3CA 2ORYA 1LV8A 3NBZC 4M87A 3HADA 4QFBA 3IEXA 1YTLA 4KNVA 3CF2A 5IM4A 5SV2A 1Z75A 2OO3A 4FDVA 1JG2A 1KWKA 3O2SB 3CONA 2CNBA 5F2KA 1CY0A 4C0BA 2HF9A 4CTOA 4I46A 4RZUA 3I58A 3W8DA 3VAAA 2C9ZA 2I55A 5IC5A 3QEKA 1HFWA 3ZIAD 4C20A 1TI7A 1U8ZA 4I5DA 5H02A 4DV3B 2VQDA 3AY6A 1SHJA 1INLA 1Y6QA 2R6CA 1N92A 1PNVA 3AP1A 3B9QA 3EVNA 2WJIA 3UJ6A 3EVGA 2Q7OE 1MFPA 4MJ7A 2AN9A 5D85A 5DM2A 3U48A 1DG1G 1RI5A 3A7EA 3BEOA 2ZGVA 5DHSA 5CHYA 3UY4A 3WRXC 3DC7A 2PYIA 2EKDA 2DWQA 4HD8A 1XC7A 3DEKA 4HQLA 4M38A 2CXSA 2PWYA 1FLDA 3RRZA 5A3VA 4BX3A 1XF9A 5KQPA 1DMRA 1QANA 1VPEA 1XDWA 2PGNA 4J16C 4QJ4A 5G0TA 2HBYA 5JBQA 1QYWA 1YOVB 1NWCA 1HTWA 2ACWA 2ZRMA 3CRVA 1L8OA 3G7NA 4TZ0A 4RTRA 3MVEA 2XRMA 3MINA 1K7FB 3AM4A 1A4UA 3CTMA 3K8ZA 3LH5A 4MA4A 4KQEA 1DIOB 4RFLA 4DJEC 1BRMA 1VE7A 1R0WA 5LCXA 1LI5A 5EQJB 1Q0RA 3KLOA 3EGIA 1E7QA 3MJ4A 3SJ7A 2H06A 1JHAA 2PKXA 4RVOA 3QQPA 4OI4A 3PXUA 1U02A 1SQ6A 2WKRA 1NNUA 2RHJA 4BMZA 4RGYA 4J0IA 4D4LA 5DBEX 1IL0A 3F98A 3SZGA 4L6AA 1YDHA 4RD1A 5LDDC 1WW3A 3OCCA 1CUGA 4QO8A 1M33A 1YT5A 1TA0A 2WIFA 2WVAA 3FDJA 3QE4A 5J4LA 2QYOA 5JXIA 2ZR9A 1X7ZA 2AFHB 4HRXA 2Y1WA 1L5FA 2JGIA 3PNKA 3CT4A 1R6AA 2YWGA 3G1UA 2GEJA 2DKOA 2VEDA 2ZJFA 4HC4A 1BKDR 2BHLA 1M1YE 2BAGA 3BJRA 3I2FA 3PEVA 1PWEA 4PEVA 4YH1A 3AJAA 1G38A 2JEZA 4U2BA 4MS3A 4D74A 1CR2A 3SC3A 5IXSA 4RTMA 2NP7A 1FQOA 4GGMX 2OVFA 1BZYA 1PBTA 2ZTVA 3GBSA 1V9CA 2ZJ0A 1RDFA 3SZLA 4F7DA 1Z3IX 4GSKA 4I9GA 5DHTA 4IHAA 3FSGD 1Y80A 1U7PA 1SBTA 4LOLA 5ES3A 3SX2A 2GPAA 3HWWA 5DOVA 5IMSA 1VL0A 1FNNA 5L4LA 4JWTA 4UNQA 3MWFA 4B85A 5B3LA 3DM5A 5F9HA 4PIPA 2RHWA 5L6LB 3CVOA 5E3HA 3WGQA 1XXHA 3IDAA 4K9KA 5AKIA 3GG2A 4CKYA 1JHQA 1BDIA 3MYRA 4P6VF 4RDXA 4FM9A 3PL5A 4GLBA 3KZXA 4LE2A 2R6HA 2DKNA 4Y9DA 1C8LA 2O0HA 4US1R 5KUTA 1M0TA 1R9JA 1T6ZA 4QQRA 4YAJA 3GEEA 2YWJA 4HAOA 3M70A 2FK7A 4EPYA 4EITA 1L7RA 4TMYA 1KFJB 5BN1A 3FHOA 5NLLA 1JDPA 2CJWB 2YHAA 4KE8A 2XRZA 2VT2A 1GA4A 2GARA 1N0VC 2RIRA 4CE6A 1WRBA 3UYKA 2FPUA 3B1JA 4RIHA 2X14A 1K5GA 2JIOA 1WABA 4CZ2A 2O05A 2WSIA 3V1LA 1JB9A 3ZGLA 1JTVA 1IMOA 4RTSA 1UXIA 1H6CA 2C3MA 3H7AA 3K09C 3NS7A 1Q77A 1C4WA 2VQSA 2XTMA 4DADA 2JHCA 2X5OA 3F46A 1KWGA 2PUVA 1H6DA 4A73A 4D96A 3SQMA 1G41A 2EQAA 2NQ8A 3OOJA 4B73A 4NCHA 2G9RA 1UIRA 3J81k 3KJFA 2QX4A 4XGRA 2I65A 4B4KA 1NT2A 2HSEA 1ZU5A 3GT3A 5IBPA 1EFDN 1PR2A 2J5RA 1T1GA 3FXAA 4JBLA 3VBEA 4D9FA 5EQTA 3QE0A 4NEGA 4XUDA 5LOVF 2CMFA 4H27A 1NVEA 5EIOA 2YJ5A 5JG7A 1JQBA 1B15A 4PYQA 3RHZA 1BGWA 1NQUA 2ODAA 2ZYGA 5KSWB 1W5SA 4IGIA 3ADDA 3M4JA 3SBXA 1MEJA 5BN5A 1ISGA 1SVIA 1IY0A 1FXUA 3RT1A 1GG5A 1LTHR 1RVDA 4YAWA 4UNSA 3WIDA 3ZEAA 4B35A 5IC4A 5J2UA 2IP4A 1M2VA 4U0JA 4ZU3A 1EQUA 3VGJA 3SNHA 3KOYA 4EOGA 2V98A 3ETDA 3HHEA 2QI9C 3C6XA 3OTWA 5AKZA 3WLEA 3FTEA 3F3MA 1G3RA 3D2CA 3KKOA 4QTZA 4C4XA 1PV2A 1SOWA 1V2GA 2O7VA 4W5JA 2HNAA 5ETJA 4CMAA 3RIHA 1EWYA 1HMYA 1N6OA 4ZZ0A 5KEIA 1CUSA 2FR8A 1PHRA 3OPYA 3BSYA 1JJIA 4MHOA 3D5EA 1TD1A 3DBOB 4IHQA 1NSYA 4Q3AA 3TBHA 1CIVA 5B4UA 1GSAA 2GGSA 4UCWA 2WINI 1B23P 1RMTA 2IXFA 1GLGA 1ISMA 1D4AA 2BFFB 2GN6A 1MHTA 1NW7A 1QE0A 5ALFA 4FOSA 4MRSA 1HDIA 3BX1A 3QY9A 5CM8B 2VP4A 1E3SA 2GQ0A 3GC6A 4BP1A 1P4AA 4CJXA 4DS3A 3CNHA 1S2GA 5A9RA 2BI7A 3TVYA 3T3DA 4DQXA 1Z5UA 2QLBA 3Q12A 1GYRA 2I4MA 5NULA 3DE7X 1U31A 1AH2A 5BMOA 1DO2A 4G0YA 4AP9A 5KVAA 1KFBB 1T43A 2RFLA 2RK4A 2XV1A 2ZJAA 2OHVA 3TNJA 3TTVA 4F2GA 2Z43A 3QBJA 2YS6A 2CEKA 1FNDA 2XCIA 2QIOA 4E2WA 1S2DA 5C8XA 3AI2A 4KW7A 2O9JA 2XWPA 3LX4A 1MC1A 4R8KA 3U7QA 1LQ2A 2JCGA 2B82A 1VL5A 3MS4A 3MIZA 1SN7A 4O2BF 4ZI3A 5EN4A 1CKEA 4ZWNA 1C0EA 1QH1A 2V5VA 4JIMA 1NWHA 1PD1A 4Q4HA 2QKYA 5LMCA 1UJNA 2C4UA 3TLJA 4NOLA 4HDAA 4PLHA 1A7KA 4HDCA 1JHYA 3A1VA 4RH1A 4DEYA 2DHRA 2QTFA 1HT2E 3OZAA 1RWKA 1V5WA 3V6MA 3WYGA 2X0IA 3GUUA 5CD9A 1EP2B 4CWAA 6YASA 5I4CA 1Z0UA 2P90A 4R5HA 4UUMA 3MTGA 4LBZA 4DV2B 1E9VA 1YB2A 4EJSB 1Z12A 4NFYA 1Q15A 1MV8A 4PSKA 3WY9A 4AJLA 2I62A 4D9EA 1DRKA 4OOFA 4IV8A 1YS6A 3QP9A 3EZGA 1P4SA 4FSHA 1GWNA 1RVV1 3ZZNA 3IQGX 4Z7QB 4UQOA 1KJIA 1NSTA 1Y6ZA 3OY7A 5EG5A 1YFKA 1WCXA 1XZHA 4EEXA 4ESHA 2D3TA 3H17A 4N18A 4P34A 3I9KA 1MOZA 1S2NA 2JFYA 4PGMA 1U9JA 4L0DA 3QUAA 1TC1A 3ABIA 4NWIA 1EFRD 2ZUTA 1YS2X 3KVOA 1C30A 2TMYA 4GUAA 4JGGA 2OGWA 1A9XB 4LC0A 3UMCA 3ANXA 1MN6A 1E7WA 1K4YA 1M83A 1GPWB 1Z7WA 4MRAA 2ZYRA 4OHUA 2EFEB 4LS3A 3EZ9A 3PJDA 4E4YA 1IBMB 1W87A 4PSDA 2FW7A 2JJQA 4FS8A 4R1TA 1BXKA 2KMLA 1IOZA 3CNLA 2R6R1 2YWRA 4MRPA 3L1VA 3GFBA 2JCBA 2ZJZA 3DDSA 1XB2A 1DAHA 1VL2A 2YZ2A 4Q9AA 3RWOA 3TH5A 3L6RA 1Z22A 2EG5A 5DBFA 4EM6A 5COAA 4CLDA 4C14A 5JZBA 1CS4C 3PYLA 1ZWLA 1JBKA 3DKPA 2HCJB 5COBA 3H5AA 1J22A 3OF5A 4M76B 3KD3A 4NATA 3U5TA 1F06A 2AN3A 4NDZA 4DUGA 1D5CA 1GPBA 2ZXUA 4O4HF 2BM0A 1QHGA 2UYQA 4LYAA 3D54D 3Q7TA 2H92A 5EWJB 3SPXA 3TLGB 4AWAA 2GFQA 5JCXA 1PK9A 1XDBA 5EJAA 3DE2X 4WQMA 3MT9A 5BQOA 1MAVA 3ET5A 2E2WA 5CM2Z 4QWWA 4BNLA 4WX2B 5KKCA 5JW6A 3M6IA 1NYQA 2V9ZA 3THSA 2QAGA 3HVUA 2ZAGA 3TINA 1C7FA 1OHHA 1VXOA 1OXKB 4IJMA 4EFDA 3BE8A 2WK1A 1Q3KA 4CMEC 1KDTA 3R7SA 4EGCB 1Y5MA 2JJ1A 1YR7A 3T8YA 5L8VA 1DDGA 4RD3A 1YSCA 5FQOA 4AG3A 4YDQA 3NCHA 3B53X 4PSCA 1YI1A 1SC6A 1U8UA 2ZSAA 3R3WA 4YRBA 4QRHA 1N2OA 2JKVA 2YNMA 2C07A 2PU7A 4GP6A 1BGVA 3TTXA 1BJKA 1SWVA 2YHUA 1SXGA 4NMLA 4UARA 1JLLA