3G9WA

Crystal structure of talin2 f2-f3 in complex with the integrin beta1d cytoplasmic tail
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
217
structure length
217
Chain Sequence
GIDPFTKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEFGGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Talin-2
publication title The structure of an integrin/talin complex reveals the basis of inside-out signal transduction
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 69
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3g9wA01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3g9wA02
1OQNA 3DXEA 3PVUA 4IAPA 2H7DA 2YS3A 3QIJA 3NSUA 5C16A 2P8VA 4HAZB 1MAIA 5J3QA 2YT1A 1SGHA 4A6KA 4KAXB 5HE1A 1OMWA 1V5MA 4K17A 3AU4A 4TYZA 2Y7BA 2P0HA 3T06A 4IFSA 3KSYA 1Q67A 1TJ6A 5C6RA 1AQCA 1V88A 2LOXA 2GCLA 2YS1A 5EFXA 4HAVB 1TQZA 1MIXA 2W2XD 3ODWA 4HATB 2J0KA 1NTVA 4NSWA 2N23A 2Z0PA 5DIFB 1TXDA 3EPYA 2AEHA 5DHFB 4YONA 1N3HA 3P6AA 3KRXA 1WVHA 3SNHA 2R0DA 1X1GA 4NY0A 2RNRB 2DX1A 4Z2NA 4GN1A 1WI1A 3CIKA 3OANA 3N7CA 2CAYA 1FHXA 4GXBA 4HB0B 4WVFB 4EJNA 1NTYA 2L2IA 1EF1A 1NVLA 2RQ1A 1FB8A 2RVBB 1M7EA 2Z0OA 4PNKA 5DHAB 2CY5A 5L81A 1FAOA 3KY9A 1WJMA 4Z2MB 1P5TA 4MY6A 4HAYB 1NI2A 3TVVA 2N0YA 1MK9B 3D8FA 2CY4A 2AL6A 1BTNA 1DYNA 1DDMA 2K2UA 1BTKA 2LYDA 2DHJA 2D10A 3VOQA 1U5FA 2D9WA 3F0WA 2D9XA 1XCGA 3DXDA 2UZSA 3A8PA 3ULBA 2DA0A 3TW1A 2RSGA 1HB8A 2Y8FA 3PVLA 5JP4A 1U5GA 1IRSA 4WSFA 1DROA 4ZRKA 4A6FA 3FP5A 2J0JA 2DHIA 5JHGA 3GYPA 1I2HA 2CRFA 1UPRA 2P0DA 4F7HA 2D11A 1QQGA 4MK0A 5C5BB 5HE2A 4ZRJA 1BAKA 1UNPA 2L1CA 4P7IA 2FJLA 3ODXA 1XODA 5HE3A 1DBHA 2VKIA 5DH9B 1EGXA 2I1JA 1PLSA 2CQUA 2W2XC 3ODOA 3ZVRA 4IOYX 5KCVA 4EMOA 1GC6A 2ZPYA 1V89A 3U7DA 2YVCA 2W2WA 2D9ZA 2LG1A 3P7ZA 1AWEA 4KHBB 1U5EA 2EJ8A 3ML4A 5D3WA 3PVWA 2YS5A 3TCAA 3VIAA 2PZ1A 2DLWA 2KCJA 3GYOA 2VSZA 2FDQA 2QKLA 3CXBB 3D8EA 4CYEA 2YF0A 2DKQA 3FM8C 4GMVA 1WJ1A 1LW3A 2DYNA 5FI1A 2K00A 1I7AA 4DBBA 1X11A 5LOPB 2JP2A 2XQNM 2ADZA 1WGQA 4TKNA 2QKMA 2OTXA 1P6SA 3HW2B 2MFQA 3HQCA 1U29A 3PSCA 3LJUX 2D9VA 2LULA 5LONB 1MK7B 4XWXA 2VRWB 1GG3A 2FJ9A 1X86A 3TO1A 4BBKA 1DDWA 5JLJB 3A98B 2YSZA 4GZUA 5IJMA 5KQ4A 3MPXA 4HDOA 1ISNA 1KZGA 1UEFA 3SO6A 4Y94A 3AJ4A 4CHJA 1PFJA 1SHCA 1V61A 1FHOA 1DDVA 4ZRIA 1OY2A 2KGXB 2M14A 4CHMA 5JHHA 1EVHA 2CB8A 1B55A 5CLLB 2HTHB 2HE7A 1U27A 5CLQB 2KUPA 2YRYA 1W1GA 2LKOA 4DX8A 3PP2A 3PG7A 4HDQA 1WGUA 3HK0A 1X1FA 2LBBA 2ROZB 4H8SA 4C0AA 1ST7A 1RJ2A 4KVGB 2DTCA 3FEHA 2YT0A 4KHOA 3BINA 1E5WA 2OQBA 3FSSA 2Z0QA 2COFA 2Y8GA 3ZDTA 2COPA 2DN6A 3FLVA 1ZC4B 2RGNB 2GCJA 2GS0A 2M38A 2DX5A 3WYFB 1XX0A 2ELBA 3F5RA 3QWMA 2J0MA 3TFMA 4K81A 4HAXB 2H7EA 1H10A 4YL8A 1NTIA 4GMXB 3UZTA 2I5CA 2EMSA 3D8DA 4HB4B 2DFKA 2MKRA 1XR0B 4DXAB 2I5FA 1K5DB 1FOEA 2EMTA 1BWNA 2MDXA 3RCPA 4B6HA 3DXCA 2ABDA 1FGYA 1ZM0A 1Y5OA 2DHKA 4MT7A 4HHVA 2K2JA 1ZSQA 5C5BA 1X05A 2GJYA 2COCA 3ULCA 1MKEA 3X23A 1J0WA 1HBKA 2COAA 1MIZB 4KHAA 3PZDA 1KI1B 2CODA 2IFSA 4PQ0A 2DYQA 2RUKB 1UNQA 1ACAA 1ZC3B 3SV1A 1Y19B 4A6FB 1UNRA 3SYXA 3BJIA 1V5PA 3U8ZA 2D4QA 2E2XA 5KQ1A 2V76A 2X18A 1GC7A 5D3XA 2D9YA 1QC6A 2R09A 2RLOA 3V5WA 4HB2B 1KZ7A 1XKEA 3G9WA 2NMBA 4F7UP 3A8QA 5J3YA 1FGZA 1WG7A 1U2BA 4A5KA 1NU2A 4HB3B 5D3VA 1LB1A 5D3YA 2Q13A 4EKUA 1P3RA 5GOWB 5FI0A 2I1KA 4L6EA 3O96A 2UZRA 3PEGA 1U5DA 1V5UA 2ROVA 4HAUB 3M1IB 1PMSA 1UPQA 5J3TA 1Z87A 5D27A 2EC1A 3KZ1A 2IYBA 2UVMA 2D2QA 2MWNB 4F7GA 5HE0A 2NZ8B 1EAZA 5DI9B 2DKPA 3QBVB 3IVFA 4A6HA 2LOZA 4K2OA 2G35A 4K2PA 5C79A 1RRPB 4WJ7A 2J59M 2P0FA 1J19A 4HAWB 1FHWA 1K5GB 3WA0A 3MDBC 4GPTB 3AU5A 1W1DA 1ZVRA 1H4RA 2WH5A 3KRWA 4DX90 1XD4A 1W1HA 2HRJA 2BCJA 1MPHA 1HB6A 3SUZA 2ELAA 1M7RA 4D0NB
chains in the Genus database with same CATH superfamily
1OQNA 3DXEA 3PVUA 4IAPA 2H7DA 2YS3A 3QIJA 3NSUA 5C16A 2P8VA 4HAZB 4OT1A 1MAIA 5J3QA 2YT1A 1SGHA 4A6KA 4ILHA 4KAXB 5HE1A 4JK9A 1OMWA 1V5MA 4K17A 3AU4A 2KIGA 4TYZA 2Y7BA 2P0HA 3HIEA 3T06A 4IFSA 3KSYA 1Q67A 1TJ6A 5C6RA 1AQCA 1V88A 2LOXA 2GCLA 2YS1A 5EFXA 4HAVB 1TQZA 1MIXA 2Z13A 2W2XD 3ODWA 4HATB 2J0KA 1VBHA 1NTVA 4NSWA 2N23A 2Z0PA 5DIFB 1TXDA 3EPYA 1MI1A 2AEHA 5DHFB 4YONA 1N3HA 1KBLA 3P6AA 3KRXA 1WVHA 4JK7A 3SNHA 2R0DA 1X1GA 4NY0A 2RNRB 2DX1A 4Z2NA 4GN1A 1WI1A 3CIKA 3OANA 3N7CA 2CAYA 3E66A 1FHXA 4GXBA 4HB0B 4WVFB 4EJNA 1NTYA 2L2IA 1EF1A 1NVLA 2RQ1A 4CSQA 1FB8A 2RVBB 3NWFA 1M7EA 2Z0OA 4PNKA 5DHAB 2CY5A 5L81A 1FAOA 3KY9A 1WJMA 4Z2MB 1P5TA 4MY6A 4HAYB 1NI2A 3TVVA 2N0YA 3SBTA 1MK9B 3D8FA 2CY4A 2AL6A 1BTNA 1DYNA 1DDMA 4JKCA 2K2UA 1BTKA 2LYDA 2DHJA 2D10A 3VOQA 2GUMA 2D9WA 1U5FA 3F0WA 2D9XA 1XCGA 3DXDA 2UZSA 3A8PA 3ULBA 4JKGB 2DA0A 3TW1A 2RSGA 1HB8A 2Y8FA 3PVLA 5JP4A 1U5GA 4QXAB 1IRSA 4WSFA 1DROA 3E9PA 4ZRKA 4A6FA 3FP5A 3NW8A 4JK8A 4JKEA 2J0JA 2DHIA 5JHGA 3GYPA 1I2HA 2CRFA 1UPRA 2P0DA 4F7HA 2D11A 1QQGA 2YT2A 4MK0A 5C5BB 5HE2A 4ZRJA 1BAKA 1UNPA 2L1CA 4P7IA 2FJLA 3ODXA 1XODA 5HE3A 2R2YA 1DBHA 2VKIA 5DH9B 1EGXA 2I1JA 1PLSA 3E9OA 2CQUA 2W2XC 3ODOA 3ZVRA 4IOYX 5KCVA 4EMOA 1GC6A 2ZPYA 1V89A 3U7DA 2YVCA 2W2WA 2D9ZA 2LG1A 3P7ZA 5LG4B 1AWEA 4KHBB 1U5EA 2EJ8A 3ML4A 5D3WA 3PVWA 2YS5A 3NWDA 3TCAA 3VIAA 3FVCA 2PZ1A 2K8EA 2DLWA 2KCJA 3GYOA 5IRSA 2VSZA 2FDQA 2QKLA 3NWAA 3CXBB 3D8EA 4CYEA 2YF0A 2DKQA 3FM8C 4GMVA 4GOUA 1WJ1A 1LW3A 2DYNA 5FI1A 2K00A 1I7AA 4DBBA 3OHMB 1X11A 2R82A 5LOPB 2JP2A 2XQNM 2ADZA 4QJ4B 1WGQA 4QJ5B 4TKNA 2QKMA 2OTXA 1P6SA 3HW2B 2MFQA 3HQCA 1U29A 4GNKB 2NBVA 3PSCA 3LJUX 2D9VA 2LULA 5LONB 1MK7B 4XWXA 2RRFA 2VRWB 1GG3A 2FJ9A 1X86A 3TO1A 4BBKA 1JDEA 1DDWA 5JLJB 4DIXA 3A98B 2YSZA 4GZUA 5IJMA 5KQ4A 3MPXA 2Z14A 4D6WA 4HDOA 1ISNA 1KZGA 1UEFA 1T77A 3SO6A 4Y94A 3AJ4A 4CHJA 1PFJA 1DIKA 1SHCA 1V61A 3DCXA 1FHOA 1DDVA 4ZRIA 1OY2A 2KGXB 2M14A 2K49A 4CHMA 2ZKMX 5JHHA 1EVHA 2CB8A 1B55A 5CLLB 2HTHB 2HE7A 1U27A 5CLQB 2KUPA 2YRYA 1W1GA 2LKOA 4DX8A 3PP2A 3PG7A 4HDQA 1WGUA 3HK0A 4QJ3B 1X1FA 2LBBA 2ROZB 4H8SA 4C0AA 1ST7A 1RJ2A 4KVGB 2KUQA 2DTCA 3FEHA 2YT0A 4KHOA 3BINA 1E5WA 2OQBA 3FSSA 2Z0QA 2COFA 4OSNA 2Y8GA 4L1RA 1GGOA 3ZDTA 2COPA 2DN6A 3FLVA 1ZC4B 2RGNB 1VBGA 2GCJA 2GS0A 2M38A 2DX5A 3WYFB 1XX0A 2ELBA 3F5RA 3QWMA 3ENBA 2J0MA 3TFMA 4ILJA 3HSAA 4K81A 4HAXB 2H7EA 2X0SA 1H10A 4YL8A 1NTIA 4GMXB 3UZTA 2I5CA 2EMSA 4JKGA 3D8DA 4HB4B 2DFKA 2MKRA 1XR0B 4JKHA 4DXAB 2I5FA 1K5DB 1FOEA 2EMTA 1BWNA 2MDXA 3RCPA 4B6HA 3SBGA 3A58A 3DXCA 2ABDA 1FGYA 1ZM0A 5I2SA 1Y5OA 2KIEA 2DHKA 4MT7A 4HHVA 2K2JA 1ZSQA 5C5BA 1X05A 2GJYA 2COCA 3ULCA 1MKEA 3X23A 4JKBA 1J0WA 1HBKA 2COAA 1MIZB 4KHAA 3PZDA 3B77A 1KI1B 2CODA 2IFSA 4PQ0A 2DYQA 2RUKB 3U12A 1UNQA 1ACAA 1ZC3B 3SV1A 1Y19B 4A6FB 1UNRA 3SYXA 3BJIA 1V5PA 3U8ZA 2D4QA 2E2XA 4HSIA 5KQ1A 2V76A 2X18A 1GC7A 5D3XA 2D9YA 1QC6A 2R09A 2RLOA 3V5WA 4HB2B 1KZ7A 1XKEA 3G9WA 4KHBA 2NMBA 4F7UP 3A8QA 5J3YA 1FGZA 1WG7A 1U2BA 4A5KA 1NU2A 4HB3B 5D3VA 1LB1A 2Z4DA 2Z59A 5D3YA 2Q13A 4EKUA 1P3RA 5GOWB 5FI0A 2I1KA 4L6EA 3O96A 2UZRA 3PEGA 1U5DA 2DIKA 1V5UA 2ROVA 4JKDA 3E9LA 4HAUB 3M1IB 1PMSA 1UPQA 5J3TA 1Z87A 5D27A 2EC1A 3KZ1A 4ILGB 2IYBA 2UVMA 2D2QA 2FJUB 4F7GA 2MWNB 5HE0A 5JVLA 2NZ8B 1EAZA 5DI9B 5M4YB 2DKPA 2KR0A 3IVFA 3QBVB 4A6HA 2LOZA 4K2OA 2G35A 4K2PA 5C79A 1RRPB 1KC7A 4WJ7A 1ZYIA 2J59M 2P0FA 1J19A 4HAWB 1FHWA 1K5GB 3WA0A 3MDBC 4JKFA 3AU5A 1W1DA 4GPTB 1ZVRA 1H4RA 2WH5A 3KRWA 4DX90 1XD4A 1W1HA 2HRJA 2BCJA 1MPHA 1HB6A 4JKAA 3SUZA 5I2MA 2ELAA 1M7RA 4D0NB
chains in the Genus database with same CATH topology
1OQNA 3DXEA 3PVUA 4IAPA 2H7DA 2YS3A 3QIJA 3NSUA 5C16A 2P8VA 4HAZB 1MAIA 5J3QA 2YT1A 1SGHA 4A6KA 4ILHA 4KAXB 5HE1A 4JK9A 1OMWA 1V5MA 4K17A 3AU4A 4TYZA 2Y7BA 2P0HA 3T06A 4IFSA 3KSYA 1Q67A 1TJ6A 5C6RA 1AQCA 1V88A 2LOXA 2GCLA 2YS1A 5EFXA 4HAVB 1TQZA 1MIXA 2W2XD 3ODWA 4HATB 2J0KA 1VBHA 1NTVA 4NSWA 2N23A 2Z0PA 5DIFB 1TXDA 3EPYA 2AEHA 5DHFB 4YONA 1N3HA 1KBLA 3P6AA 3KRXA 1WVHA 4JK7A 3SNHA 2R0DA 1X1GA 4NY0A 2RNRB 2DX1A 4Z2NA 4GN1A 1WI1A 3CIKA 3OANA 3N7CA 2CAYA 3E66A 1FHXA 4GXBA 4HB0B 4WVFB 4EJNA 1NTYA 2L2IA 1EF1A 1NVLA 2RQ1A 1FB8A 2RVBB 1M7EA 2Z0OA 4PNKA 5DHAB 2CY5A 5L81A 1FAOA 3KY9A 1WJMA 4Z2MB 1P5TA 4MY6A 4HAYB 1NI2A 3TVVA 2N0YA 3SBTA 1MK9B 3D8FA 2CY4A 2AL6A 1BTNA 1DYNA 1DDMA 4JKCA 2K2UA 1BTKA 2LYDA 2DHJA 2D10A 3VOQA 1U5FA 2D9WA 3F0WA 2D9XA 1XCGA 3DXDA 2UZSA 3A8PA 3ULBA 4JKGB 2DA0A 3TW1A 2RSGA 1HB8A 2Y8FA 3PVLA 5JP4A 1U5GA 1IRSA 4WSFA 1DROA 3E9PA 4ZRKA 4A6FA 3FP5A 4JK8A 4JKEA 2J0JA 2DHIA 5JHGA 3GYPA 1I2HA 2CRFA 1UPRA 2P0DA 4F7HA 2D11A 1QQGA 4MK0A 5C5BB 5HE2A 4ZRJA 1BAKA 1UNPA 2L1CA 4P7IA 2FJLA 3ODXA 1XODA 5HE3A 1DBHA 2VKIA 5DH9B 1EGXA 2I1JA 1PLSA 3E9OA 2CQUA 2W2XC 3ODOA 3ZVRA 4IOYX 5KCVA 4EMOA 1GC6A 2ZPYA 1V89A 3U7DA 2YVCA 2W2WA 2D9ZA 2LG1A 3P7ZA 1AWEA 4KHBB 1U5EA 2EJ8A 3ML4A 5D3WA 3PVWA 2YS5A 3TCAA 3VIAA 2PZ1A 2DLWA 2KCJA 3GYOA 2VSZA 2FDQA 2QKLA 3CXBB 3D8EA 4CYEA 2YF0A 2DKQA 3FM8C 4GMVA 1WJ1A 1LW3A 2DYNA 5FI1A 2K00A 1I7AA 4DBBA 1X11A 2R82A 5LOPB 2JP2A 2XQNM 2ADZA 1WGQA 4TKNA 2QKMA 2OTXA 1P6SA 3HW2B 2MFQA 3HQCA 1U29A 3PSCA 3LJUX 2D9VA 2LULA 5LONB 1MK7B 4XWXA 2VRWB 1GG3A 2FJ9A 1X86A 3TO1A 4BBKA 1JDEA 1DDWA 5JLJB 3A98B 2YSZA 4GZUA 5IJMA 5KQ4A 3MPXA 4HDOA 1ISNA 1KZGA 1UEFA 3SO6A 4Y94A 3AJ4A 4CHJA 1PFJA 1DIKA 1SHCA 1V61A 1FHOA 1DDVA 4ZRIA 1OY2A 2KGXB 2M14A 4CHMA 5JHHA 1EVHA 2CB8A 1B55A 5CLLB 2HTHB 2HE7A 1U27A 5CLQB 2KUPA 2YRYA 1W1GA 2LKOA 4DX8A 3PP2A 3PG7A 4HDQA 1WGUA 3HK0A 1X1FA 2LBBA 2ROZB 4H8SA 4C0AA 1ST7A 1RJ2A 4KVGB 2DTCA 3FEHA 2YT0A 4KHOA 3BINA 1E5WA 2OQBA 3FSSA 2Z0QA 2COFA 2Y8GA 1GGOA 3ZDTA 2COPA 2DN6A 3FLVA 1ZC4B 2RGNB 1VBGA 2GCJA 2GS0A 2M38A 2DX5A 3WYFB 1XX0A 2ELBA 3F5RA 3QWMA 3ENBA 2J0MA 3TFMA 4ILJA 4K81A 4HAXB 2H7EA 2X0SA 1H10A 4YL8A 1NTIA 4GMXB 3UZTA 2I5CA 2EMSA 4JKGA 3D8DA 4HB4B 2DFKA 2MKRA 1XR0B 4JKHA 4DXAB 2I5FA 1K5DB 1FOEA 2EMTA 1BWNA 2MDXA 3RCPA 4B6HA 3SBGA 3DXCA 2ABDA 1FGYA 1ZM0A 1Y5OA 2DHKA 4MT7A 4HHVA 2K2JA 1ZSQA 5C5BA 1X05A 2GJYA 2COCA 3ULCA 1MKEA 3X23A 4JKBA 1J0WA 1HBKA 2COAA 1MIZB 4KHAA 3PZDA 1KI1B 2CODA 2IFSA 4PQ0A 2DYQA 2RUKB 1UNQA 1ACAA 1ZC3B 3SV1A 1Y19B 4A6FB 1UNRA 3SYXA 3BJIA 1V5PA 3U8ZA 2D4QA 2E2XA 5KQ1A 2V76A 2X18A 1GC7A 5D3XA 2D9YA 1QC6A 2R09A 2RLOA 3V5WA 4HB2B 1KZ7A 1XKEA 3G9WA 2NMBA 4F7UP 3A8QA 5J3YA 1FGZA 1WG7A 1U2BA 4A5KA 1NU2A 4HB3B 5D3VA 1LB1A 5D3YA 2Q13A 4EKUA 1P3RA 5GOWB 5FI0A 2I1KA 4L6EA 3O96A 2UZRA 3PEGA 1U5DA 2DIKA 1V5UA 2ROVA 4JKDA 3E9LA 4HAUB 3M1IB 1PMSA 1UPQA 5J3TA 1Z87A 5D27A 2EC1A 3KZ1A 4ILGB 2IYBA 2UVMA 2D2QA 2MWNB 4F7GA 5HE0A 5JVLA 2NZ8B 1EAZA 5DI9B 2DKPA 3QBVB 3IVFA 4A6HA 2LOZA 4K2OA 2G35A 4K2PA 5C79A 1RRPB 1KC7A 4WJ7A 2J59M 2P0FA 1J19A 4HAWB 1FHWA 1K5GB 3WA0A 3MDBC 4JKFA 3AU5A 1W1DA 4GPTB 1ZVRA 1H4RA 2WH5A 3KRWA 4DX90 1XD4A 1W1HA 2HRJA 2BCJA 1MPHA 1HB6A 4JKAA 3SUZA 2ELAA 1M7RA 4D0NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OQN A;  3DXE A;  3PVU A;  4IAP A;  2H7D A;  2YS3 A;  3QIJ A;  3NSU A;  5C16 A;  2P8V A;  4HAZ B;  1MAI A;  5J3Q A;  2YT1 A;  1SGH A;  4A6K A;  4KAX B;  5HE1 A;  1OMW A;  1V5M A;  4K17 A;  3AU4 A;  4TYZ A;  2Y7B A;  2P0H A;  3T06 A;  4IFS A;  3KSY A;  1Q67 A;  1TJ6 A;  5C6R A;  1AQC A;  1V88 A;  2LOX A;  2GCL A;  2YS1 A;  5EFX A;  4HAV B;  1TQZ A;  1MIX A;  2W2X D;  3ODW A;  4HAT B;  2J0K A;  1NTV A;  4NSW A;  2N23 A;  2Z0P A;  5DIF B;  1TXD A;  3EPY A;  2AEH A;  5DHF B;  4YON A;  1N3H A;  3P6A A;  3KRX A;  1WVH A;  3SNH A;  2R0D A;  1X1G A;  4NY0 A;  2RNR B;  2DX1 A;  4Z2N A;  4GN1 A;  1WI1 A;  3CIK A;  3OAN A;  3N7C A;  2CAY A;  1FHX A;  4GXB A;  4HB0 B;  4WVF B;  4EJN A;  1NTY A;  2L2I A;  1EF1 A;  1NVL A;  2RQ1 A;  1FB8 A;  2RVB B;  1M7E A;  2Z0O A;  4PNK A;  5DHA B;  2CY5 A;  5L81 A;  1FAO A;  3KY9 A;  1WJM A;  4Z2M B;  1P5T A;  4MY6 A;  4HAY B;  1NI2 A;  3TVV A;  2N0Y A;  1MK9 B;  3D8F A;  2CY4 A;  2AL6 A;  1BTN A;  1DYN A;  1DDM A;  2K2U A;  1BTK A;  2LYD A;  2DHJ A;  2D10 A;  3VOQ A;  1U5F A;  2D9W A;  3F0W A;  2D9X A;  1XCG A;  3DXD A;  2UZS A;  3A8P A;  3ULB A;  2DA0 A;  3TW1 A;  2RSG A;  1HB8 A;  2Y8F A;  3PVL A;  5JP4 A;  1U5G A;  1IRS A;  4WSF A;  1DRO A;  4ZRK A;  4A6F A;  3FP5 A;  2J0J A;  2DHI A;  5JHG A;  3GYP A;  1I2H A;  2CRF A;  1UPR A;  2P0D A;  4F7H A;  2D11 A;  1QQG A;  4MK0 A;  5C5B B;  5HE2 A;  4ZRJ A;  1BAK A;  1UNP A;  2L1C A;  4P7I A;  2FJL A;  3ODX A;  1XOD A;  5HE3 A;  1DBH A;  2VKI A;  5DH9 B;  1EGX A;  2I1J A;  1PLS A;  2CQU A;  2W2X C;  3ODO A;  3ZVR A;  4IOY X;  5KCV A;  4EMO A;  1GC6 A;  2ZPY A;  1V89 A;  3U7D A;  2YVC A;  2W2W A;  2D9Z A;  2LG1 A;  3P7Z A;  1AWE A;  4KHB B;  1U5E A;  2EJ8 A;  3ML4 A;  5D3W A;  3PVW A;  2YS5 A;  3TCA A;  3VIA A;  2PZ1 A;  2DLW A;  2KCJ A;  3GYO A;  2VSZ A;  2FDQ A;  2QKL A;  3CXB B;  3D8E A;  4CYE A;  2YF0 A;  2DKQ A;  3FM8 C;  4GMV A;  1WJ1 A;  1LW3 A;  2DYN A;  5FI1 A;  2K00 A;  1I7A A;  4DBB A;  1X11 A;  5LOP B;  2JP2 A;  2XQN M;  2ADZ A;  1WGQ A;  4TKN A;  2QKM A;  2OTX A;  1P6S A;  3HW2 B;  2MFQ A;  3HQC A;  1U29 A;  3PSC A;  3LJU X;  2D9V A;  2LUL A;  5LON B;  1MK7 B;  4XWX A;  2VRW B;  1GG3 A;  2FJ9 A;  1X86 A;  3TO1 A;  4BBK A;  1DDW A;  5JLJ B;  3A98 B;  2YSZ A;  4GZU A;  5IJM A;  5KQ4 A;  3MPX A;  4HDO A;  1ISN A;  1KZG A;  1UEF A;  3SO6 A;  4Y94 A;  3AJ4 A;  4CHJ A;  1PFJ A;  1SHC A;  1V61 A;  1FHO A;  1DDV A;  4ZRI A;  1OY2 A;  2KGX B;  2M14 A;  4CHM A;  5JHH A;  1EVH A;  2CB8 A;  1B55 A;  5CLL B;  2HTH B;  2HE7 A;  1U27 A;  5CLQ B;  2KUP A;  2YRY A;  1W1G A;  2LKO A;  4DX8 A;  3PP2 A;  3PG7 A;  4HDQ A;  1WGU A;  3HK0 A;  1X1F A;  2LBB A;  2ROZ B;  4H8S A;  4C0A A;  1ST7 A;  1RJ2 A;  4KVG B;  2DTC A;  3FEH A;  2YT0 A;  4KHO A;  3BIN A;  1E5W A;  2OQB A;  3FSS A;  2Z0Q A;  2COF A;  2Y8G A;  3ZDT A;  2COP A;  2DN6 A;  3FLV A;  1ZC4 B;  2RGN B;  2GCJ A;  2GS0 A;  2M38 A;  2DX5 A;  3WYF B;  1XX0 A;  2ELB A;  3F5R A;  3QWM A;  2J0M A;  3TFM A;  4K81 A;  4HAX B;  2H7E A;  1H10 A;  4YL8 A;  1NTI A;  4GMX B;  3UZT A;  2I5C A;  2EMS A;  3D8D A;  4HB4 B;  2DFK A;  2MKR A;  1XR0 B;  4DXA B;  2I5F A;  1K5D B;  1FOE A;  2EMT A;  1BWN A;  2MDX A;  3RCP A;  4B6H A;  3DXC A;  2ABD A;  1FGY A;  1ZM0 A;  1Y5O A;  2DHK A;  4MT7 A;  4HHV A;  2K2J A;  1ZSQ A;  5C5B A;  1X05 A;  2GJY A;  2COC A;  3ULC A;  1MKE A;  3X23 A;  1J0W A;  1HBK A;  2COA A;  1MIZ B;  4KHA A;  3PZD A;  1KI1 B;  2COD A;  2IFS A;  4PQ0 A;  2DYQ A;  2RUK B;  1UNQ A;  1ACA A;  1ZC3 B;  3SV1 A;  1Y19 B;  4A6F B;  1UNR A;  3SYX A;  3BJI A;  1V5P A;  3U8Z A;  2D4Q A;  2E2X A;  5KQ1 A;  2V76 A;  2X18 A;  1GC7 A;  5D3X A;  2D9Y A;  1QC6 A;  2R09 A;  2RLO A;  3V5W A;  4HB2 B;  1KZ7 A;  1XKE A;  3G9W A;  2NMB A;  4F7U P;  3A8Q A;  5J3Y A;  1FGZ A;  1WG7 A;  1U2B A;  4A5K A;  1NU2 A;  4HB3 B;  5D3V A;  1LB1 A;  5D3Y A;  2Q13 A;  4EKU A;  1P3R A;  5GOW B;  5FI0 A;  2I1K A;  4L6E A;  3O96 A;  2UZR A;  3PEG A;  1U5D A;  1V5U A;  2ROV A;  4HAU B;  3M1I B;  1PMS A;  1UPQ A;  5J3T A;  1Z87 A;  5D27 A;  2EC1 A;  3KZ1 A;  2IYB A;  2UVM A;  2D2Q A;  2MWN B;  4F7G A;  5HE0 A;  2NZ8 B;  1EAZ A;  5DI9 B;  2DKP A;  3QBV B;  3IVF A;  4A6H A;  2LOZ A;  4K2O A;  2G35 A;  4K2P A;  5C79 A;  1RRP B;  4WJ7 A;  2J59 M;  2P0F A;  1J19 A;  4HAW B;  1FHW A;  1K5G B;  3WA0 A;  3MDB C;  4GPT B;  3AU5 A;  1W1D A;  1ZVR A;  1H4R A;  2WH5 A;  3KRW A;  4DX9 0;  1XD4 A;  1W1H A;  2HRJ A;  2BCJ A;  1MPH A;  1HB6 A;  3SUZ A;  2ELA A;  1M7R A;  4D0N B; 
#chains in the Genus database with same CATH topology
 1OQN A;  3DXE A;  3PVU A;  4IAP A;  2H7D A;  2YS3 A;  3QIJ A;  3NSU A;  5C16 A;  2P8V A;  4HAZ B;  4OT1 A;  1MAI A;  5J3Q A;  2YT1 A;  1SGH A;  4A6K A;  4ILH A;  4KAX B;  5HE1 A;  4JK9 A;  1OMW A;  1V5M A;  4K17 A;  3AU4 A;  2KIG A;  4TYZ A;  2Y7B A;  2P0H A;  3HIE A;  3T06 A;  4IFS A;  3KSY A;  1Q67 A;  1TJ6 A;  5C6R A;  1AQC A;  1V88 A;  2LOX A;  2GCL A;  2YS1 A;  5EFX A;  4HAV B;  1TQZ A;  1MIX A;  2Z13 A;  2W2X D;  3ODW A;  4HAT B;  2J0K A;  1VBH A;  1NTV A;  4NSW A;  2N23 A;  2Z0P A;  5DIF B;  1TXD A;  3EPY A;  1MI1 A;  2AEH A;  5DHF B;  4YON A;  1N3H A;  1KBL A;  3P6A A;  3KRX A;  1WVH A;  4JK7 A;  3SNH A;  2R0D A;  1X1G A;  4NY0 A;  2RNR B;  2DX1 A;  4Z2N A;  4GN1 A;  1WI1 A;  3CIK A;  3OAN A;  3N7C A;  2CAY A;  3E66 A;  1FHX A;  4GXB A;  4HB0 B;  4WVF B;  4EJN A;  1NTY A;  2L2I A;  1EF1 A;  1NVL A;  2RQ1 A;  4CSQ A;  1FB8 A;  2RVB B;  3NWF A;  1M7E A;  2Z0O A;  4PNK A;  5DHA B;  2CY5 A;  5L81 A;  1FAO A;  3KY9 A;  1WJM A;  4Z2M B;  1P5T A;  4MY6 A;  4HAY B;  1NI2 A;  3TVV A;  2N0Y A;  3SBT A;  1MK9 B;  3D8F A;  2CY4 A;  2AL6 A;  1BTN A;  1DYN A;  1DDM A;  4JKC A;  2K2U A;  1BTK A;  2LYD A;  2DHJ A;  2D10 A;  3VOQ A;  2GUM A;  2D9W A;  1U5F A;  3F0W A;  2D9X A;  1XCG A;  3DXD A;  2UZS A;  3A8P A;  3ULB A;  4JKG B;  2DA0 A;  3TW1 A;  2RSG A;  1HB8 A;  2Y8F A;  3PVL A;  5JP4 A;  1U5G A;  4QXA B;  1IRS A;  4WSF A;  1DRO A;  3E9P A;  4ZRK A;  4A6F A;  3FP5 A;  3NW8 A;  4JK8 A;  4JKE A;  2J0J A;  2DHI A;  5JHG A;  3GYP A;  1I2H A;  2CRF A;  1UPR A;  2P0D A;  4F7H A;  2D11 A;  1QQG A;  2YT2 A;  4MK0 A;  5C5B B;  5HE2 A;  4ZRJ A;  1BAK A;  1UNP A;  2L1C A;  4P7I A;  2FJL A;  3ODX A;  1XOD A;  5HE3 A;  2R2Y A;  1DBH A;  2VKI A;  5DH9 B;  1EGX A;  2I1J A;  1PLS A;  3E9O A;  2CQU A;  2W2X C;  3ODO A;  3ZVR A;  4IOY X;  5KCV A;  4EMO A;  1GC6 A;  2ZPY A;  1V89 A;  3U7D A;  2YVC A;  2W2W A;  2D9Z A;  2LG1 A;  3P7Z A;  5LG4 B;  1AWE A;  4KHB B;  1U5E A;  2EJ8 A;  3ML4 A;  5D3W A;  3PVW A;  2YS5 A;  3NWD A;  3TCA A;  3VIA A;  3FVC A;  2PZ1 A;  2K8E A;  2DLW A;  2KCJ A;  3GYO A;  5IRS A;  2VSZ A;  2FDQ A;  2QKL A;  3NWA A;  3CXB B;  3D8E A;  4CYE A;  2YF0 A;  2DKQ A;  3FM8 C;  4GMV A;  4GOU A;  1WJ1 A;  1LW3 A;  2DYN A;  5FI1 A;  2K00 A;  1I7A A;  4DBB A;  3OHM B;  1X11 A;  2R82 A;  5LOP B;  2JP2 A;  2XQN M;  2ADZ A;  4QJ4 B;  1WGQ A;  4QJ5 B;  4TKN A;  2QKM A;  2OTX A;  1P6S A;  3HW2 B;  2MFQ A;  3HQC A;  1U29 A;  4GNK B;  2NBV A;  3PSC A;  3LJU X;  2D9V A;  2LUL A;  5LON B;  1MK7 B;  4XWX A;  2RRF A;  2VRW B;  1GG3 A;  2FJ9 A;  1X86 A;  3TO1 A;  4BBK A;  1JDE A;  1DDW A;  5JLJ B;  4DIX A;  3A98 B;  2YSZ A;  4GZU A;  5IJM A;  5KQ4 A;  3MPX A;  2Z14 A;  4D6W A;  4HDO A;  1ISN A;  1KZG A;  1UEF A;  1T77 A;  3SO6 A;  4Y94 A;  3AJ4 A;  4CHJ A;  1PFJ A;  1DIK A;  1SHC A;  1V61 A;  3DCX A;  1FHO A;  1DDV A;  4ZRI A;  1OY2 A;  2KGX B;  2M14 A;  2K49 A;  4CHM A;  2ZKM X;  5JHH A;  1EVH A;  2CB8 A;  1B55 A;  5CLL B;  2HTH B;  2HE7 A;  1U27 A;  5CLQ B;  2KUP A;  2YRY A;  1W1G A;  2LKO A;  4DX8 A;  3PP2 A;  3PG7 A;  4HDQ A;  1WGU A;  3HK0 A;  4QJ3 B;  1X1F A;  2LBB A;  2ROZ B;  4H8S A;  4C0A A;  1ST7 A;  1RJ2 A;  4KVG B;  2KUQ A;  2DTC A;  3FEH A;  2YT0 A;  4KHO A;  3BIN A;  1E5W A;  2OQB A;  3FSS A;  2Z0Q A;  2COF A;  4OSN A;  2Y8G A;  4L1R A;  1GGO A;  3ZDT A;  2COP A;  2DN6 A;  3FLV A;  1ZC4 B;  2RGN B;  1VBG A;  2GCJ A;  2GS0 A;  2M38 A;  2DX5 A;  3WYF B;  1XX0 A;  2ELB A;  3F5R A;  3QWM A;  3ENB A;  2J0M A;  3TFM A;  4ILJ A;  3HSA A;  4K81 A;  4HAX B;  2H7E A;  2X0S A;  1H10 A;  4YL8 A;  1NTI A;  4GMX B;  3UZT A;  2I5C A;  2EMS A;  4JKG A;  3D8D A;  4HB4 B;  2DFK A;  2MKR A;  1XR0 B;  4JKH A;  4DXA B;  2I5F A;  1K5D B;  1FOE A;  2EMT A;  1BWN A;  2MDX A;  3RCP A;  4B6H A;  3SBG A;  3A58 A;  3DXC A;  2ABD A;  1FGY A;  1ZM0 A;  5I2S A;  1Y5O A;  2KIE A;  2DHK A;  4MT7 A;  4HHV A;  2K2J A;  1ZSQ A;  5C5B A;  1X05 A;  2GJY A;  2COC A;  3ULC A;  1MKE A;  3X23 A;  4JKB A;  1J0W A;  1HBK A;  2COA A;  1MIZ B;  4KHA A;  3PZD A;  3B77 A;  1KI1 B;  2COD A;  2IFS A;  4PQ0 A;  2DYQ A;  2RUK B;  3U12 A;  1UNQ A;  1ACA A;  1ZC3 B;  3SV1 A;  1Y19 B;  4A6F B;  1UNR A;  3SYX A;  3BJI A;  1V5P A;  3U8Z A;  2D4Q A;  2E2X A;  4HSI A;  5KQ1 A;  2V76 A;  2X18 A;  1GC7 A;  5D3X A;  2D9Y A;  1QC6 A;  2R09 A;  2RLO A;  3V5W A;  4HB2 B;  1KZ7 A;  1XKE A;  3G9W A;  4KHB A;  2NMB A;  4F7U P;  3A8Q A;  5J3Y A;  1FGZ A;  1WG7 A;  1U2B A;  4A5K A;  1NU2 A;  4HB3 B;  5D3V A;  1LB1 A;  2Z4D A;  2Z59 A;  5D3Y A;  2Q13 A;  4EKU A;  1P3R A;  5GOW B;  5FI0 A;  2I1K A;  4L6E A;  3O96 A;  2UZR A;  3PEG A;  1U5D A;  2DIK A;  1V5U A;  2ROV A;  4JKD A;  3E9L A;  4HAU B;  3M1I B;  1PMS A;  1UPQ A;  5J3T A;  1Z87 A;  5D27 A;  2EC1 A;  3KZ1 A;  4ILG B;  2IYB A;  2UVM A;  2D2Q A;  2FJU B;  4F7G A;  2MWN B;  5HE0 A;  5JVL A;  2NZ8 B;  1EAZ A;  5DI9 B;  5M4Y B;  2DKP A;  2KR0 A;  3IVF A;  3QBV B;  4A6H A;  2LOZ A;  4K2O A;  2G35 A;  4K2P A;  5C79 A;  1RRP B;  1KC7 A;  4WJ7 A;  1ZYI A;  2J59 M;  2P0F A;  1J19 A;  4HAW B;  1FHW A;  1K5G B;  3WA0 A;  3MDB C;  4JKF A;  3AU5 A;  1W1D A;  4GPT B;  1ZVR A;  1H4R A;  2WH5 A;  3KRW A;  4DX9 0;  1XD4 A;  1W1H A;  2HRJ A;  2BCJ A;  1MPH A;  1HB6 A;  4JKA A;  3SUZ A;  5I2M A;  2ELA A;  1M7R A;  4D0N B; 
#chains in the Genus database with same CATH homology
 1OQN A;  3DXE A;  3PVU A;  4IAP A;  2H7D A;  2YS3 A;  3QIJ A;  3NSU A;  5C16 A;  2P8V A;  4HAZ B;  1MAI A;  5J3Q A;  2YT1 A;  1SGH A;  4A6K A;  4ILH A;  4KAX B;  5HE1 A;  4JK9 A;  1OMW A;  1V5M A;  4K17 A;  3AU4 A;  4TYZ A;  2Y7B A;  2P0H A;  3T06 A;  4IFS A;  3KSY A;  1Q67 A;  1TJ6 A;  5C6R A;  1AQC A;  1V88 A;  2LOX A;  2GCL A;  2YS1 A;  5EFX A;  4HAV B;  1TQZ A;  1MIX A;  2W2X D;  3ODW A;  4HAT B;  2J0K A;  1VBH A;  1NTV A;  4NSW A;  2N23 A;  2Z0P A;  5DIF B;  1TXD A;  3EPY A;  2AEH A;  5DHF B;  4YON A;  1N3H A;  1KBL A;  3P6A A;  3KRX A;  1WVH A;  4JK7 A;  3SNH A;  2R0D A;  1X1G A;  4NY0 A;  2RNR B;  2DX1 A;  4Z2N A;  4GN1 A;  1WI1 A;  3CIK A;  3OAN A;  3N7C A;  2CAY A;  3E66 A;  1FHX A;  4GXB A;  4HB0 B;  4WVF B;  4EJN A;  1NTY A;  2L2I A;  1EF1 A;  1NVL A;  2RQ1 A;  1FB8 A;  2RVB B;  1M7E A;  2Z0O A;  4PNK A;  5DHA B;  2CY5 A;  5L81 A;  1FAO A;  3KY9 A;  1WJM A;  4Z2M B;  1P5T A;  4MY6 A;  4HAY B;  1NI2 A;  3TVV A;  2N0Y A;  3SBT A;  1MK9 B;  3D8F A;  2CY4 A;  2AL6 A;  1BTN A;  1DYN A;  1DDM A;  4JKC A;  2K2U A;  1BTK A;  2LYD A;  2DHJ A;  2D10 A;  3VOQ A;  1U5F A;  2D9W A;  3F0W A;  2D9X A;  1XCG A;  3DXD A;  2UZS A;  3A8P A;  3ULB A;  4JKG B;  2DA0 A;  3TW1 A;  2RSG A;  1HB8 A;  2Y8F A;  3PVL A;  5JP4 A;  1U5G A;  1IRS A;  4WSF A;  1DRO A;  3E9P A;  4ZRK A;  4A6F A;  3FP5 A;  4JK8 A;  4JKE A;  2J0J A;  2DHI A;  5JHG A;  3GYP A;  1I2H A;  2CRF A;  1UPR A;  2P0D A;  4F7H A;  2D11 A;  1QQG A;  4MK0 A;  5C5B B;  5HE2 A;  4ZRJ A;  1BAK A;  1UNP A;  2L1C A;  4P7I A;  2FJL A;  3ODX A;  1XOD A;  5HE3 A;  1DBH A;  2VKI A;  5DH9 B;  1EGX A;  2I1J A;  1PLS A;  3E9O A;  2CQU A;  2W2X C;  3ODO A;  3ZVR A;  4IOY X;  5KCV A;  4EMO A;  1GC6 A;  2ZPY A;  1V89 A;  3U7D A;  2YVC A;  2W2W A;  2D9Z A;  2LG1 A;  3P7Z A;  1AWE A;  4KHB B;  1U5E A;  2EJ8 A;  3ML4 A;  5D3W A;  3PVW A;  2YS5 A;  3TCA A;  3VIA A;  2PZ1 A;  2DLW A;  2KCJ A;  3GYO A;  2VSZ A;  2FDQ A;  2QKL A;  3CXB B;  3D8E A;  4CYE A;  2YF0 A;  2DKQ A;  3FM8 C;  4GMV A;  1WJ1 A;  1LW3 A;  2DYN A;  5FI1 A;  2K00 A;  1I7A A;  4DBB A;  1X11 A;  2R82 A;  5LOP B;  2JP2 A;  2XQN M;  2ADZ A;  1WGQ A;  4TKN A;  2QKM A;  2OTX A;  1P6S A;  3HW2 B;  2MFQ A;  3HQC A;  1U29 A;  3PSC A;  3LJU X;  2D9V A;  2LUL A;  5LON B;  1MK7 B;  4XWX A;  2VRW B;  1GG3 A;  2FJ9 A;  1X86 A;  3TO1 A;  4BBK A;  1JDE A;  1DDW A;  5JLJ B;  3A98 B;  2YSZ A;  4GZU A;  5IJM A;  5KQ4 A;  3MPX A;  4HDO A;  1ISN A;  1KZG A;  1UEF A;  3SO6 A;  4Y94 A;  3AJ4 A;  4CHJ A;  1PFJ A;  1DIK A;  1SHC A;  1V61 A;  1FHO A;  1DDV A;  4ZRI A;  1OY2 A;  2KGX B;  2M14 A;  4CHM A;  5JHH A;  1EVH A;  2CB8 A;  1B55 A;  5CLL B;  2HTH B;  2HE7 A;  1U27 A;  5CLQ B;  2KUP A;  2YRY A;  1W1G A;  2LKO A;  4DX8 A;  3PP2 A;  3PG7 A;  4HDQ A;  1WGU A;  3HK0 A;  1X1F A;  2LBB A;  2ROZ B;  4H8S A;  4C0A A;  1ST7 A;  1RJ2 A;  4KVG B;  2DTC A;  3FEH A;  2YT0 A;  4KHO A;  3BIN A;  1E5W A;  2OQB A;  3FSS A;  2Z0Q A;  2COF A;  2Y8G A;  1GGO A;  3ZDT A;  2COP A;  2DN6 A;  3FLV A;  1ZC4 B;  2RGN B;  1VBG A;  2GCJ A;  2GS0 A;  2M38 A;  2DX5 A;  3WYF B;  1XX0 A;  2ELB A;  3F5R A;  3QWM A;  3ENB A;  2J0M A;  3TFM A;  4ILJ A;  4K81 A;  4HAX B;  2H7E A;  2X0S A;  1H10 A;  4YL8 A;  1NTI A;  4GMX B;  3UZT A;  2I5C A;  2EMS A;  4JKG A;  3D8D A;  4HB4 B;  2DFK A;  2MKR A;  1XR0 B;  4JKH A;  4DXA B;  2I5F A;  1K5D B;  1FOE A;  2EMT A;  1BWN A;  2MDX A;  3RCP A;  4B6H A;  3SBG A;  3DXC A;  2ABD A;  1FGY A;  1ZM0 A;  1Y5O A;  2DHK A;  4MT7 A;  4HHV A;  2K2J A;  1ZSQ A;  5C5B A;  1X05 A;  2GJY A;  2COC A;  3ULC A;  1MKE A;  3X23 A;  4JKB A;  1J0W A;  1HBK A;  2COA A;  1MIZ B;  4KHA A;  3PZD A;  1KI1 B;  2COD A;  2IFS A;  4PQ0 A;  2DYQ A;  2RUK B;  1UNQ A;  1ACA A;  1ZC3 B;  3SV1 A;  1Y19 B;  4A6F B;  1UNR A;  3SYX A;  3BJI A;  1V5P A;  3U8Z A;  2D4Q A;  2E2X A;  5KQ1 A;  2V76 A;  2X18 A;  1GC7 A;  5D3X A;  2D9Y A;  1QC6 A;  2R09 A;  2RLO A;  3V5W A;  4HB2 B;  1KZ7 A;  1XKE A;  3G9W A;  2NMB A;  4F7U P;  3A8Q A;  5J3Y A;  1FGZ A;  1WG7 A;  1U2B A;  4A5K A;  1NU2 A;  4HB3 B;  5D3V A;  1LB1 A;  5D3Y A;  2Q13 A;  4EKU A;  1P3R A;  5GOW B;  5FI0 A;  2I1K A;  4L6E A;  3O96 A;  2UZR A;  3PEG A;  1U5D A;  2DIK A;  1V5U A;  2ROV A;  4JKD A;  3E9L A;  4HAU B;  3M1I B;  1PMS A;  1UPQ A;  5J3T A;  1Z87 A;  5D27 A;  2EC1 A;  3KZ1 A;  4ILG B;  2IYB A;  2UVM A;  2D2Q A;  2MWN B;  4F7G A;  5HE0 A;  5JVL A;  2NZ8 B;  1EAZ A;  5DI9 B;  2DKP A;  3QBV B;  3IVF A;  4A6H A;  2LOZ A;  4K2O A;  2G35 A;  4K2P A;  5C79 A;  1RRP B;  1KC7 A;  4WJ7 A;  2J59 M;  2P0F A;  1J19 A;  4HAW B;  1FHW A;  1K5G B;  3WA0 A;  3MDB C;  4JKF A;  3AU5 A;  1W1D A;  4GPT B;  1ZVR A;  1H4R A;  2WH5 A;  3KRW A;  4DX9 0;  1XD4 A;  1W1H A;  2HRJ A;  2BCJ A;  1MPH A;  1HB6 A;  4JKA A;  3SUZ A;  2ELA A;  1M7R A;  4D0N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...