3G9WA

Crystal structure of talin2 f2-f3 in complex with the integrin beta1d cytoplasmic tail
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
217
structure length
217
Chain Sequence
GIDPFTKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEFGGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of an integrin/talin complex reveals the basis of inside-out signal transduction
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords Talin-2
total genus 69
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3g9wA01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3g9wA02
1DROA 4F7GA 2RVBB 5KQ4A 1SHCA 2Z0QA 1V88A 2Q13A 3KRWA 4GZUA 3CXBB 5J3YA 1H4RA 2J0JA 1UPRA 2WH5A 2I5FA 2DKPA 1M7RA 3TO1A 1GC7A 1FHWA 1J19A 3X23A 2K2UA 1BAKA 2RNRB 5DIFB 4CYEA 2DX5A 1FGYA 2DHJA 3AU4A 4K17A 1MIXA 1RRPB 1MKEA 5DHFB 2RUKB 3DXCA 2RLOA 1BTKA 3PVLA 3OANA 2KCJA 4NY0A 1W1GA 4HAYB 5C79A 5C6RA 3PEGA 2ABDA 4KAXB 1HB8A 4GN1A 4EMOA 3FLVA 2MKRA 1UEFA 1SGHA 1K5DB 4NSWA 3U7DA 1KI1B 3P6AA 2CY5A 3SYXA 1PMSA 1WJ1A 3G9WA 3F0WA 2KGXB 4WVFB 2AEHA 1Y19B 1FGZA 2D9ZA 4GMXB 4K2OA 2LYDA 4HB2B 1WVHA 5J3TA 1H10A 1U5DA 4HB4B 4HDQA 2YS3A 2KUPA 2CODA 2DKQA 2RSGA 2IFSA 5JHHA 1I7AA 2EMSA 2K00A 3TW1A 2DYQA 3BINA 1X05A 1LB1A 4H8SA 1NTIA 2COFA 5FI1A 2D2QA 3F5RA 2OTXA 3O96A 4C0AA 4HAVB 2J0MA 3NSUA 4CHMA 1W1DA 1GG3A 4PNKA 1DBHA 2R09A 1X1FA 2IYBA 4L6EA 5D3XA 4ZRJA 3ODWA 3P7ZA 4YONA 1OQNA 2JP2A 1ZM0A 4B6HA 5C16A 1U29A 2GCLA 3T06A 5KCVA 1AQCA 3GYPA 2W2XC 5JP4A 1U5EA 3KZ1A 2FJ9A 3ZDTA 2ROZB 2Z0PA 1U27A 4K2PA 3PSCA 4F7UP 2VSZA 4MY6A 2COPA 3TVVA 3BJIA 2Y8FA 4MT7A 2LOXA 2Y8GA 5HE2A 2NMBA 4IOYX 3QBVB 1AWEA 5LOPB 2RGNB 4HDOA 3QIJA 3WYFB 2PZ1A 3VIAA 2CRFA 1KZGA 2W2WA 2ZPYA 3U8ZA 2P0FA 3IVFA 1UNQA 1E5WA 5DI9B 5C5BB 3ODOA 3SO6A 2DHIA 3HK0A 4D0NB 3PP2A 3SUZA 1I2HA 1FB8A 1KZ7A 2ELAA 2D11A 4TYZA 2YVCA 3DXEA 4IAPA 5J3QA 1ST7A 1EVHA 2P0DA 1ISNA 2HE7A 2D9WA 2D9VA 3GYOA 3MPXA 1EGXA 3FP5A 1WGUA 2YS5A 5D27A 4BBKA 1FAOA 2YF0A 3D8FA 3PVWA 4PQ0A 1RJ2A 2LBBA 1WI1A 2YT0A 1FHOA 2DFKA 3UZTA 2CB8A 3PZDA 2YSZA 5L81A 1V5MA 2P8VA 2K2JA 1EF1A 1TJ6A 5C5BA 3TFMA 1ZSQA 1V61A 1DDMA 1NTYA 2E2XA 2L1CA 4KVGB 1N3HA 4YL8A 4A5KA 2H7DA 2HTHB 2J59M 2D10A 3ULBA 1Q67A 1WGQA 5FI0A 4HAXB 4ZRKA 2DLWA 2EC1A 1W1HA 3ML4A 1XD4A 2YT1A 1HBKA 2I1KA 3TCAA 4A6FA 1P5TA 2EJ8A 2L2IA 1DDVA 3D8DA 1ZVRA 2W2XD 4Z2MB 4DBBA 1FHXA 1MPHA 1Y5OA 2LG1A 1X1GA 2DTCA 4TKNA 2X18A 1PFJA 1K5GB 1OMWA 5EFXA 1IRSA 1TXDA 3CIKA 4HB0B 1PLSA 3KSYA 4A6KA 1UPQA 3RCPA 2XQNM 4XWXA 1ZC4B 1XCGA 3ZVRA 4IFSA 2MDXA 2M38A 3KRXA 1MK7B 3FEHA 4A6FB 2J0KA 4HB3B 1ACAA 1M7EA 2COCA 1XR0B 4EKUA 1XX0A 4HATB 1EAZA 4EJNA 5HE1A 3KY9A 5D3VA 2CY4A 2OQBA 4HHVA 5DHAB 2R0DA 3FSSA 4HAWB 3A98B 2VKIA 2ELBA 4F7HA 1NU2A 1HB6A 2MWNB 3HQCA 2G35A 1OY2A 1P3RA 3V5WA 2V76A 2CQUA 2DYNA 2DHKA 2AL6A 1V89A 5LONB 1NI2A 4Y94A 2LKOA 5JLJB 3ODXA 2GCJA 2NZ8B 3DXDA 1DYNA 5CLLB 1Z87A 1U5GA 1BWNA 4CHJA 4K81A 3QWMA 3LJUX 3N7CA 1NVLA 4HAUB 2Z0OA 2I1JA 3AU5A 4DX90 3SV1A 2DN6A 3PVUA 3A8QA 2UZRA 2FDQA 2ADZA 3FM8C 1QC6A 5GOWB 2ROVA 3M1IB 4A6HA 1J0WA 1UNRA 1DDWA 2GJYA 2M14A 2QKMA 2COAA 1GC6A 2EMTA 4GXBA 1NTVA 1V5PA 5HE0A 3EPYA 3A8PA 2N0YA 5DH9B 3WA0A 1UNPA 5IJMA 2DA0A 4HAZB 3HW2B 5D3WA 1MAIA 2N23A 2BCJA 2GS0A 2I5CA 2QKLA 1BTNA 3AJ4A 1V5UA 1X86A 1ZC3B 4GPTB 5D3YA 4DX8A 2YS1A 1XODA 4WSFA 1WG7A 2D9XA 2CAYA 5KQ1A 4P7IA 4WJ7A 1P6SA 2UVMA 3PG7A 2FJLA 4KHAA 5HE3A 1MK9B 1XKEA 5JHGA 2DX1A 2UZSA 1WJMA 2LULA 3VOQA 1B55A 2YRYA 2VRWB 1TQZA 2Y7BA 2D9YA 2D4QA 1U2BA 2RQ1A 4ZRIA 2H7EA 3D8EA 3ULCA 4MK0A 4GMVA 5CLQB 3SNHA 1MIZB 1QQGA 1LW3A 3MDBC 1U5FA 2HRJA 1FOEA 2LOZA 2P0HA 4DXAB 1X11A 4KHBB 4KHOA 2MFQA 4Z2NA
chains in the Genus database with same CATH superfamily
1DROA 4F7GA 2RVBB 5KQ4A 1SHCA 2Z0QA 1V88A 2Q13A 3KRWA 4GZUA 3CXBB 5J3YA 1H4RA 2J0JA 1UPRA 2WH5A 2I5FA 2DKPA 1M7RA 3TO1A 1GC7A 1FHWA 1J19A 3X23A 2K2UA 1BAKA 2RNRB 5DIFB 4CYEA 2DX5A 1FGYA 2DHJA 3AU4A 4K17A 1MIXA 1RRPB 1MKEA 5DHFB 2RUKB 1KBLA 3DXCA 2RLOA 1BTKA 3PVLA 3OANA 2KCJA 4NY0A 1W1GA 4HAYB 5C79A 1T77A 3NWAA 3PEGA 2ABDA 3FVCA 5C6RA 4KAXB 1HB8A 4GN1A 4EMOA 3FLVA 2MKRA 1UEFA 2K8EA 1SGHA 1K5DB 4NSWA 3U7DA 1KI1B 3P6AA 2CY5A 3SYXA 1PMSA 1WJ1A 2NBVA 3G9WA 3F0WA 3ENBA 2KGXB 4WVFB 2AEHA 1Y19B 1FGZA 2D9ZA 4GMXB 4K2OA 2LYDA 4HB2B 1WVHA 5J3TA 1H10A 1U5DA 3NW8A 4HB4B 4HDQA 2YS3A 2K49A 3HSAA 2KUPA 2CODA 2DKQA 2RSGA 2IFSA 5JHHA 1I7AA 2EMSA 2K00A 3TW1A 2DYQA 3BINA 1X05A 1LB1A 4H8SA 3E66A 1NTIA 2COFA 5FI1A 2D2QA 2Z4DA 3F5RA 2OTXA 3O96A 4C0AA 4HAVB 2J0MA 2X0SA 3NSUA 4CHMA 4JKDA 1W1DA 1GG3A 4PNKA 2Z14A 1DBHA 2R09A 1X1FA 2DIKA 2IYBA 2RRFA 4L6EA 5D3XA 4ZRJA 3ODWA 3P7ZA 4YONA 4QJ4B 1OQNA 2JP2A 1ZM0A 4B6HA 5C16A 1U29A 2GCLA 3T06A 5KCVA 1AQCA 3GYPA 2W2XC 5JP4A 5IRSA 5JVLA 3SBTA 1U5EA 4ILHA 3KZ1A 2FJ9A 3ZDTA 2ROZB 5I2MA 5LG4B 2Z0PA 3B77A 3HIEA 1U27A 1KC7A 4CSQA 4K2PA 3PSCA 4F7UP 2VSZA 4MY6A 2COPA 3TVVA 3BJIA 2Y8FA 4MT7A 2LOXA 2Y8GA 5HE2A 2NMBA 4IOYX 4QJ3B 3QBVB 1AWEA 5LOPB 2RGNB 2Z59A 4HDOA 3QIJA 3SBGA 3WYFB 2PZ1A 3VIAA 4OT1A 2CRFA 1KZGA 2W2WA 2ZPYA 3U8ZA 2P0FA 3IVFA 1UNQA 1E5WA 5DI9B 5C5BB 3ODOA 3SO6A 2DHIA 3HK0A 3NWFA 3E9LA 4D0NB 3PP2A 3SUZA 1I2HA 1FB8A 1KZ7A 2ELAA 2D11A 3A58A 4TYZA 2YVCA 3DXEA 4IAPA 5J3QA 1ST7A 1EVHA 2P0DA 1ISNA 2HE7A 2YT2A 3U12A 2D9WA 2D9VA 3GYOA 3MPXA 1EGXA 3FP5A 1WGUA 2YS5A 4ILJA 5D27A 5M4YB 4BBKA 1FAOA 2YF0A 3D8FA 3PVWA 4PQ0A 1RJ2A 2LBBA 1WI1A 2YT0A 1FHOA 2DFKA 3UZTA 2CB8A 3PZDA 1VBGA 4JKCA 2YSZA 5L81A 1V5MA 2P8VA 2K2JA 1EF1A 1TJ6A 5C5BA 3TFMA 1ZSQA 1V61A 1DDMA 1NTYA 2E2XA 2L1CA 4KVGB 1N3HA 4YL8A 4A5KA 2KIGA 2R82A 2H7DA 2HTHB 2J59M 2D10A 3ULBA 1Q67A 1WGQA 5FI0A 4HAXB 4ZRKA 2DLWA 2EC1A 1W1HA 3ML4A 1XD4A 2YT1A 1HBKA 2ZKMX 2I1KA 3DCXA 2GUMA 3TCAA 4JKBA 4JKGB 4A6FA 1P5TA 2EJ8A 3OHMB 2L2IA 1DDVA 3D8DA 1ZVRA 2W2XD 4Z2MB 4DBBA 1FHXA 4QJ5B 1MPHA 1Y5OA 2LG1A 1X1GA 4TKNA 2DTCA 3E9OA 2X18A 1PFJA 1K5GB 1OMWA 2KUQA 5EFXA 1IRSA 1TXDA 3CIKA 4HB0B 1PLSA 3KSYA 4A6KA 2KR0A 1UPQA 4JK9A 3RCPA 2XQNM 4XWXA 4DIXA 1ZC4B 1XCGA 3ZVRA 4JKEA 4JK8A 5I2SA 4IFSA 2MDXA 2M38A 3KRXA 1MK7B 3FEHA 4A6FB 2J0KA 4HB3B 1ACAA 4ILGB 4GOUA 1ZYIA 1M7EA 2COCA 1XR0B 4EKUA 1MI1A 1XX0A 4HATB 1EAZA 4EJNA 1DIKA 5HE1A 4JKHA 3KY9A 5D3VA 2CY4A 2OQBA 4HHVA 5DHAB 2R0DA 3FSSA 4HSIA 4HAWB 3A98B 2VKIA 4L1RA 2ELBA 1VBHA 4F7HA 1NU2A 1HB6A 2MWNB 3HQCA 2G35A 1OY2A 1P3RA 3V5WA 2V76A 2CQUA 2DYNA 2DHKA 2AL6A 1V89A 5LONB 1NI2A 4Y94A 2LKOA 5JLJB 2Z13A 3ODXA 2GCJA 2NZ8B 3DXDA 2KIEA 1DYNA 5CLLB 1Z87A 4JK7A 1JDEA 1BWNA 1U5GA 4CHJA 4K81A 3QWMA 3LJUX 3N7CA 1NVLA 4HAUB 2Z0OA 2I1JA 3AU5A 4DX90 3SV1A 2DN6A 3PVUA 3A8QA 3E9PA 2UZRA 2FDQA 2ADZA 3FM8C 1QC6A 5GOWB 2ROVA 3M1IB 4A6HA 1J0WA 1UNRA 1DDWA 2GJYA 2M14A 2QKMA 2COAA 4JKFA 1GC6A 2EMTA 4JKAA 4GXBA 3NWDA 1NTVA 1V5PA 5HE0A 2R2YA 3EPYA 3A8PA 2N0YA 5DH9B 3WA0A 1UNPA 5IJMA 2DA0A 4HAZB 3HW2B 5D3WA 1MAIA 2N23A 2BCJA 2GS0A 2I5CA 2QKLA 1BTNA 3AJ4A 1V5UA 1X86A 1ZC3B 4GPTB 4QXAB 5D3YA 4DX8A 2YS1A 1XODA 4OSNA 4WSFA 1WG7A 2D9XA 2CAYA 5KQ1A 4JKGA 4P7IA 4WJ7A 1P6SA 4KHBA 2UVMA 3PG7A 2FJLA 4KHAA 5HE3A 1MK9B 1XKEA 5JHGA 2DX1A 2UZSA 1WJMA 2LULA 3VOQA 1B55A 2YRYA 2VRWB 4D6WA 1TQZA 2Y7BA 2D9YA 2D4QA 1U2BA 2RQ1A 4ZRIA 2H7EA 3D8EA 3ULCA 4MK0A 4GMVA 4GNKB 5CLQB 1GGOA 3SNHA 1MIZB 1QQGA 1LW3A 2FJUB 3MDBC 1U5FA 2HRJA 1FOEA 2LOZA 2P0HA 4DXAB 1X11A 4KHBB 4KHOA 2MFQA 4Z2NA
chains in the Genus database with same CATH topology
1DROA 4F7GA 2RVBB 5KQ4A 1SHCA 2Z0QA 1V88A 2Q13A 3KRWA 4GZUA 3CXBB 5J3YA 1H4RA 2J0JA 1UPRA 2WH5A 2I5FA 2DKPA 1M7RA 3TO1A 1GC7A 1FHWA 1J19A 3X23A 2K2UA 1BAKA 2RNRB 5DIFB 4CYEA 2DX5A 1FGYA 2DHJA 3AU4A 4K17A 1MIXA 1RRPB 1MKEA 5DHFB 2RUKB 1KBLA 3DXCA 2RLOA 1BTKA 3PVLA 3OANA 2KCJA 4NY0A 1W1GA 4HAYB 5C79A 5C6RA 3PEGA 2ABDA 4KAXB 1HB8A 4GN1A 4EMOA 3FLVA 2MKRA 1UEFA 1SGHA 1K5DB 4NSWA 3U7DA 1KI1B 3P6AA 2CY5A 3SYXA 1PMSA 1WJ1A 3G9WA 3F0WA 3ENBA 2KGXB 4WVFB 2AEHA 1Y19B 1FGZA 2D9ZA 4GMXB 4K2OA 2LYDA 4HB2B 1WVHA 5J3TA 1H10A 1U5DA 4HB4B 4HDQA 2YS3A 2KUPA 2CODA 2DKQA 2RSGA 2IFSA 5JHHA 1I7AA 2EMSA 2K00A 3TW1A 2DYQA 3BINA 1X05A 1LB1A 4H8SA 3E66A 1NTIA 2COFA 5FI1A 2D2QA 3F5RA 2OTXA 3O96A 4C0AA 4HAVB 2J0MA 2X0SA 3NSUA 4CHMA 4JKDA 1W1DA 1GG3A 4PNKA 1DBHA 2R09A 1X1FA 2DIKA 2IYBA 4L6EA 5D3XA 4ZRJA 3ODWA 3P7ZA 4YONA 1OQNA 2JP2A 1ZM0A 4B6HA 5C16A 1U29A 2GCLA 3T06A 5KCVA 1AQCA 3GYPA 2W2XC 5JP4A 5JVLA 3SBTA 1U5EA 4ILHA 3KZ1A 2FJ9A 3ZDTA 2ROZB 2Z0PA 1U27A 1KC7A 4K2PA 3PSCA 4F7UP 2VSZA 4MY6A 2COPA 3TVVA 3BJIA 2Y8FA 4MT7A 2LOXA 2Y8GA 5HE2A 2NMBA 4IOYX 3QBVB 1AWEA 5LOPB 2RGNB 4HDOA 3QIJA 3SBGA 3WYFB 2PZ1A 3VIAA 2CRFA 1KZGA 2W2WA 2ZPYA 3U8ZA 2P0FA 3IVFA 1UNQA 1E5WA 5DI9B 5C5BB 3ODOA 3SO6A 2DHIA 3HK0A 3E9LA 4D0NB 3PP2A 3SUZA 1I2HA 1FB8A 1KZ7A 2ELAA 2D11A 4TYZA 2YVCA 3DXEA 4IAPA 5J3QA 1ST7A 1EVHA 2P0DA 1ISNA 2HE7A 2D9WA 2D9VA 3GYOA 3MPXA 1EGXA 3FP5A 1WGUA 2YS5A 4ILJA 5D27A 4BBKA 1FAOA 2YF0A 3D8FA 3PVWA 4PQ0A 1RJ2A 2LBBA 1WI1A 2YT0A 1FHOA 2DFKA 3UZTA 2CB8A 3PZDA 1VBGA 4JKCA 2YSZA 5L81A 1V5MA 2P8VA 2K2JA 1EF1A 1TJ6A 5C5BA 3TFMA 1ZSQA 1V61A 1DDMA 1NTYA 2E2XA 2L1CA 4KVGB 1N3HA 4YL8A 4A5KA 2R82A 2H7DA 2HTHB 2J59M 2D10A 3ULBA 1Q67A 1WGQA 5FI0A 4HAXB 4ZRKA 2DLWA 2EC1A 1W1HA 3ML4A 1XD4A 2YT1A 1HBKA 2I1KA 3TCAA 4JKBA 4JKGB 4A6FA 1P5TA 2EJ8A 2L2IA 1DDVA 3D8DA 1ZVRA 2W2XD 4Z2MB 4DBBA 1FHXA 1MPHA 1Y5OA 2LG1A 1X1GA 4TKNA 2DTCA 3E9OA 2X18A 1PFJA 1K5GB 1OMWA 5EFXA 1IRSA 1TXDA 3CIKA 4HB0B 1PLSA 3KSYA 4A6KA 1UPQA 4JK9A 3RCPA 2XQNM 4XWXA 1ZC4B 1XCGA 3ZVRA 4JKEA 4JK8A 4IFSA 2MDXA 2M38A 3KRXA 1MK7B 3FEHA 4A6FB 2J0KA 4HB3B 1ACAA 4ILGB 1M7EA 2COCA 1XR0B 4EKUA 1XX0A 4HATB 1EAZA 4EJNA 1DIKA 5HE1A 4JKHA 3KY9A 5D3VA 2CY4A 2OQBA 4HHVA 5DHAB 2R0DA 3FSSA 4HAWB 3A98B 2VKIA 2ELBA 1VBHA 4F7HA 1NU2A 1HB6A 2MWNB 3HQCA 2G35A 1OY2A 1P3RA 3V5WA 2V76A 2CQUA 2DYNA 2DHKA 2AL6A 1V89A 5LONB 1NI2A 4Y94A 2LKOA 5JLJB 3ODXA 2GCJA 2NZ8B 3DXDA 1DYNA 5CLLB 1Z87A 4JK7A 1JDEA 1BWNA 1U5GA 4CHJA 4K81A 3QWMA 3LJUX 3N7CA 1NVLA 4HAUB 2Z0OA 2I1JA 3AU5A 4DX90 3SV1A 2DN6A 3PVUA 3A8QA 3E9PA 2UZRA 2FDQA 2ADZA 3FM8C 1QC6A 5GOWB 2ROVA 3M1IB 4A6HA 1J0WA 1UNRA 1DDWA 2GJYA 2M14A 2QKMA 2COAA 4JKFA 1GC6A 2EMTA 4JKAA 4GXBA 1NTVA 1V5PA 5HE0A 3EPYA 3A8PA 2N0YA 5DH9B 3WA0A 1UNPA 5IJMA 2DA0A 4HAZB 3HW2B 5D3WA 1MAIA 2N23A 2BCJA 2GS0A 2I5CA 2QKLA 1BTNA 3AJ4A 1V5UA 1X86A 1ZC3B 4GPTB 5D3YA 4DX8A 2YS1A 1XODA 4WSFA 1WG7A 2D9XA 2CAYA 5KQ1A 4JKGA 4P7IA 4WJ7A 1P6SA 2UVMA 3PG7A 2FJLA 4KHAA 5HE3A 1MK9B 1XKEA 5JHGA 2DX1A 2UZSA 1WJMA 2LULA 3VOQA 1B55A 2YRYA 2VRWB 1TQZA 2Y7BA 2D9YA 2D4QA 1U2BA 2RQ1A 4ZRIA 2H7EA 3D8EA 3ULCA 4MK0A 4GMVA 5CLQB 1GGOA 3SNHA 1MIZB 1QQGA 1LW3A 3MDBC 1U5FA 2HRJA 1FOEA 2LOZA 2P0HA 4DXAB 1X11A 4KHBB 4KHOA 2MFQA 4Z2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DRO A;  4F7G A;  2RVB B;  5KQ4 A;  1SHC A;  2Z0Q A;  1V88 A;  2Q13 A;  3KRW A;  4GZU A;  3CXB B;  5J3Y A;  1H4R A;  2J0J A;  1UPR A;  2WH5 A;  2I5F A;  2DKP A;  1M7R A;  3TO1 A;  1GC7 A;  1FHW A;  1J19 A;  3X23 A;  2K2U A;  1BAK A;  2RNR B;  5DIF B;  4CYE A;  2DX5 A;  1FGY A;  2DHJ A;  3AU4 A;  4K17 A;  1MIX A;  1RRP B;  1MKE A;  5DHF B;  2RUK B;  3DXC A;  2RLO A;  1BTK A;  3PVL A;  3OAN A;  2KCJ A;  4NY0 A;  1W1G A;  4HAY B;  5C79 A;  5C6R A;  3PEG A;  2ABD A;  4KAX B;  1HB8 A;  4GN1 A;  4EMO A;  3FLV A;  2MKR A;  1UEF A;  1SGH A;  1K5D B;  4NSW A;  3U7D A;  1KI1 B;  3P6A A;  2CY5 A;  3SYX A;  1PMS A;  1WJ1 A;  3G9W A;  3F0W A;  2KGX B;  4WVF B;  2AEH A;  1Y19 B;  1FGZ A;  2D9Z A;  4GMX B;  4K2O A;  2LYD A;  4HB2 B;  1WVH A;  5J3T A;  1H10 A;  1U5D A;  4HB4 B;  4HDQ A;  2YS3 A;  2KUP A;  2COD A;  2DKQ A;  2RSG A;  2IFS A;  5JHH A;  1I7A A;  2EMS A;  2K00 A;  3TW1 A;  2DYQ A;  3BIN A;  1X05 A;  1LB1 A;  4H8S A;  1NTI A;  2COF A;  5FI1 A;  2D2Q A;  3F5R A;  2OTX A;  3O96 A;  4C0A A;  4HAV B;  2J0M A;  3NSU A;  4CHM A;  1W1D A;  1GG3 A;  4PNK A;  1DBH A;  2R09 A;  1X1F A;  2IYB A;  4L6E A;  5D3X A;  4ZRJ A;  3ODW A;  3P7Z A;  4YON A;  1OQN A;  2JP2 A;  1ZM0 A;  4B6H A;  5C16 A;  1U29 A;  2GCL A;  3T06 A;  5KCV A;  1AQC A;  3GYP A;  2W2X C;  5JP4 A;  1U5E A;  3KZ1 A;  2FJ9 A;  3ZDT A;  2ROZ B;  2Z0P A;  1U27 A;  4K2P A;  3PSC A;  4F7U P;  2VSZ A;  4MY6 A;  2COP A;  3TVV A;  3BJI A;  2Y8F A;  4MT7 A;  2LOX A;  2Y8G A;  5HE2 A;  2NMB A;  4IOY X;  3QBV B;  1AWE A;  5LOP B;  2RGN B;  4HDO A;  3QIJ A;  3WYF B;  2PZ1 A;  3VIA A;  2CRF A;  1KZG A;  2W2W A;  2ZPY A;  3U8Z A;  2P0F A;  3IVF A;  1UNQ A;  1E5W A;  5DI9 B;  5C5B B;  3ODO A;  3SO6 A;  2DHI A;  3HK0 A;  4D0N B;  3PP2 A;  3SUZ A;  1I2H A;  1FB8 A;  1KZ7 A;  2ELA A;  2D11 A;  4TYZ A;  2YVC A;  3DXE A;  4IAP A;  5J3Q A;  1ST7 A;  1EVH A;  2P0D A;  1ISN A;  2HE7 A;  2D9W A;  2D9V A;  3GYO A;  3MPX A;  1EGX A;  3FP5 A;  1WGU A;  2YS5 A;  5D27 A;  4BBK A;  1FAO A;  2YF0 A;  3D8F A;  3PVW A;  4PQ0 A;  1RJ2 A;  2LBB A;  1WI1 A;  2YT0 A;  1FHO A;  2DFK A;  3UZT A;  2CB8 A;  3PZD A;  2YSZ A;  5L81 A;  1V5M A;  2P8V A;  2K2J A;  1EF1 A;  1TJ6 A;  5C5B A;  3TFM A;  1ZSQ A;  1V61 A;  1DDM A;  1NTY A;  2E2X A;  2L1C A;  4KVG B;  1N3H A;  4YL8 A;  4A5K A;  2H7D A;  2HTH B;  2J59 M;  2D10 A;  3ULB A;  1Q67 A;  1WGQ A;  5FI0 A;  4HAX B;  4ZRK A;  2DLW A;  2EC1 A;  1W1H A;  3ML4 A;  1XD4 A;  2YT1 A;  1HBK A;  2I1K A;  3TCA A;  4A6F A;  1P5T A;  2EJ8 A;  2L2I A;  1DDV A;  3D8D A;  1ZVR A;  2W2X D;  4Z2M B;  4DBB A;  1FHX A;  1MPH A;  1Y5O A;  2LG1 A;  1X1G A;  2DTC A;  4TKN A;  2X18 A;  1PFJ A;  1K5G B;  1OMW A;  5EFX A;  1IRS A;  1TXD A;  3CIK A;  4HB0 B;  1PLS A;  3KSY A;  4A6K A;  1UPQ A;  3RCP A;  2XQN M;  4XWX A;  1ZC4 B;  1XCG A;  3ZVR A;  4IFS A;  2MDX A;  2M38 A;  3KRX A;  1MK7 B;  3FEH A;  4A6F B;  2J0K A;  4HB3 B;  1ACA A;  1M7E A;  2COC A;  1XR0 B;  4EKU A;  1XX0 A;  4HAT B;  1EAZ A;  4EJN A;  5HE1 A;  3KY9 A;  5D3V A;  2CY4 A;  2OQB A;  4HHV A;  5DHA B;  2R0D A;  3FSS A;  4HAW B;  3A98 B;  2VKI A;  2ELB A;  4F7H A;  1NU2 A;  1HB6 A;  2MWN B;  3HQC A;  2G35 A;  1OY2 A;  1P3R A;  3V5W A;  2V76 A;  2CQU A;  2DYN A;  2DHK A;  2AL6 A;  1V89 A;  5LON B;  1NI2 A;  4Y94 A;  2LKO A;  5JLJ B;  3ODX A;  2GCJ A;  2NZ8 B;  3DXD A;  1DYN A;  5CLL B;  1Z87 A;  1U5G A;  1BWN A;  4CHJ A;  4K81 A;  3QWM A;  3LJU X;  3N7C A;  1NVL A;  4HAU B;  2Z0O A;  2I1J A;  3AU5 A;  4DX9 0;  3SV1 A;  2DN6 A;  3PVU A;  3A8Q A;  2UZR A;  2FDQ A;  2ADZ A;  3FM8 C;  1QC6 A;  5GOW B;  2ROV A;  3M1I B;  4A6H A;  1J0W A;  1UNR A;  1DDW A;  2GJY A;  2M14 A;  2QKM A;  2COA A;  1GC6 A;  2EMT A;  4GXB A;  1NTV A;  1V5P A;  5HE0 A;  3EPY A;  3A8P A;  2N0Y A;  5DH9 B;  3WA0 A;  1UNP A;  5IJM A;  2DA0 A;  4HAZ B;  3HW2 B;  5D3W A;  1MAI A;  2N23 A;  2BCJ A;  2GS0 A;  2I5C A;  2QKL A;  1BTN A;  3AJ4 A;  1V5U A;  1X86 A;  1ZC3 B;  4GPT B;  5D3Y A;  4DX8 A;  2YS1 A;  1XOD A;  4WSF A;  1WG7 A;  2D9X A;  2CAY A;  5KQ1 A;  4P7I A;  4WJ7 A;  1P6S A;  2UVM A;  3PG7 A;  2FJL A;  4KHA A;  5HE3 A;  1MK9 B;  1XKE A;  5JHG A;  2DX1 A;  2UZS A;  1WJM A;  2LUL A;  3VOQ A;  1B55 A;  2YRY A;  2VRW B;  1TQZ A;  2Y7B A;  2D9Y A;  2D4Q A;  1U2B A;  2RQ1 A;  4ZRI A;  2H7E A;  3D8E A;  3ULC A;  4MK0 A;  4GMV A;  5CLQ B;  3SNH A;  1MIZ B;  1QQG A;  1LW3 A;  3MDB C;  1U5F A;  2HRJ A;  1FOE A;  2LOZ A;  2P0H A;  4DXA B;  1X11 A;  4KHB B;  4KHO A;  2MFQ A;  4Z2N A; 
#chains in the Genus database with same CATH topology
 1DRO A;  4F7G A;  2RVB B;  5KQ4 A;  1SHC A;  2Z0Q A;  1V88 A;  2Q13 A;  3KRW A;  4GZU A;  3CXB B;  5J3Y A;  1H4R A;  2J0J A;  1UPR A;  2WH5 A;  2I5F A;  2DKP A;  1M7R A;  3TO1 A;  1GC7 A;  1FHW A;  1J19 A;  3X23 A;  2K2U A;  1BAK A;  2RNR B;  5DIF B;  4CYE A;  2DX5 A;  1FGY A;  2DHJ A;  3AU4 A;  4K17 A;  1MIX A;  1RRP B;  1MKE A;  5DHF B;  2RUK B;  1KBL A;  3DXC A;  2RLO A;  1BTK A;  3PVL A;  3OAN A;  2KCJ A;  4NY0 A;  1W1G A;  4HAY B;  5C79 A;  1T77 A;  3NWA A;  3PEG A;  2ABD A;  3FVC A;  5C6R A;  4KAX B;  1HB8 A;  4GN1 A;  4EMO A;  3FLV A;  2MKR A;  1UEF A;  2K8E A;  1SGH A;  1K5D B;  4NSW A;  3U7D A;  1KI1 B;  3P6A A;  2CY5 A;  3SYX A;  1PMS A;  1WJ1 A;  2NBV A;  3G9W A;  3F0W A;  3ENB A;  2KGX B;  4WVF B;  2AEH A;  1Y19 B;  1FGZ A;  2D9Z A;  4GMX B;  4K2O A;  2LYD A;  4HB2 B;  1WVH A;  5J3T A;  1H10 A;  1U5D A;  3NW8 A;  4HB4 B;  4HDQ A;  2YS3 A;  2K49 A;  3HSA A;  2KUP A;  2COD A;  2DKQ A;  2RSG A;  2IFS A;  5JHH A;  1I7A A;  2EMS A;  2K00 A;  3TW1 A;  2DYQ A;  3BIN A;  1X05 A;  1LB1 A;  4H8S A;  3E66 A;  1NTI A;  2COF A;  5FI1 A;  2D2Q A;  2Z4D A;  3F5R A;  2OTX A;  3O96 A;  4C0A A;  4HAV B;  2J0M A;  2X0S A;  3NSU A;  4CHM A;  4JKD A;  1W1D A;  1GG3 A;  4PNK A;  2Z14 A;  1DBH A;  2R09 A;  1X1F A;  2DIK A;  2IYB A;  2RRF A;  4L6E A;  5D3X A;  4ZRJ A;  3ODW A;  3P7Z A;  4YON A;  4QJ4 B;  1OQN A;  2JP2 A;  1ZM0 A;  4B6H A;  5C16 A;  1U29 A;  2GCL A;  3T06 A;  5KCV A;  1AQC A;  3GYP A;  2W2X C;  5JP4 A;  5IRS A;  5JVL A;  3SBT A;  1U5E A;  4ILH A;  3KZ1 A;  2FJ9 A;  3ZDT A;  2ROZ B;  5I2M A;  5LG4 B;  2Z0P A;  3B77 A;  3HIE A;  1U27 A;  1KC7 A;  4CSQ A;  4K2P A;  3PSC A;  4F7U P;  2VSZ A;  4MY6 A;  2COP A;  3TVV A;  3BJI A;  2Y8F A;  4MT7 A;  2LOX A;  2Y8G A;  5HE2 A;  2NMB A;  4IOY X;  4QJ3 B;  3QBV B;  1AWE A;  5LOP B;  2RGN B;  2Z59 A;  4HDO A;  3QIJ A;  3SBG A;  3WYF B;  2PZ1 A;  3VIA A;  4OT1 A;  2CRF A;  1KZG A;  2W2W A;  2ZPY A;  3U8Z A;  2P0F A;  3IVF A;  1UNQ A;  1E5W A;  5DI9 B;  5C5B B;  3ODO A;  3SO6 A;  2DHI A;  3HK0 A;  3NWF A;  3E9L A;  4D0N B;  3PP2 A;  3SUZ A;  1I2H A;  1FB8 A;  1KZ7 A;  2ELA A;  2D11 A;  3A58 A;  4TYZ A;  2YVC A;  3DXE A;  4IAP A;  5J3Q A;  1ST7 A;  1EVH A;  2P0D A;  1ISN A;  2HE7 A;  2YT2 A;  3U12 A;  2D9W A;  2D9V A;  3GYO A;  3MPX A;  1EGX A;  3FP5 A;  1WGU A;  2YS5 A;  4ILJ A;  5D27 A;  5M4Y B;  4BBK A;  1FAO A;  2YF0 A;  3D8F A;  3PVW A;  4PQ0 A;  1RJ2 A;  2LBB A;  1WI1 A;  2YT0 A;  1FHO A;  2DFK A;  3UZT A;  2CB8 A;  3PZD A;  1VBG A;  4JKC A;  2YSZ A;  5L81 A;  1V5M A;  2P8V A;  2K2J A;  1EF1 A;  1TJ6 A;  5C5B A;  3TFM A;  1ZSQ A;  1V61 A;  1DDM A;  1NTY A;  2E2X A;  2L1C A;  4KVG B;  1N3H A;  4YL8 A;  4A5K A;  2KIG A;  2R82 A;  2H7D A;  2HTH B;  2J59 M;  2D10 A;  3ULB A;  1Q67 A;  1WGQ A;  5FI0 A;  4HAX B;  4ZRK A;  2DLW A;  2EC1 A;  1W1H A;  3ML4 A;  1XD4 A;  2YT1 A;  1HBK A;  2ZKM X;  2I1K A;  3DCX A;  2GUM A;  3TCA A;  4JKB A;  4JKG B;  4A6F A;  1P5T A;  2EJ8 A;  3OHM B;  2L2I A;  1DDV A;  3D8D A;  1ZVR A;  2W2X D;  4Z2M B;  4DBB A;  1FHX A;  4QJ5 B;  1MPH A;  1Y5O A;  2LG1 A;  1X1G A;  4TKN A;  2DTC A;  3E9O A;  2X18 A;  1PFJ A;  1K5G B;  1OMW A;  2KUQ A;  5EFX A;  1IRS A;  1TXD A;  3CIK A;  4HB0 B;  1PLS A;  3KSY A;  4A6K A;  2KR0 A;  1UPQ A;  4JK9 A;  3RCP A;  2XQN M;  4XWX A;  4DIX A;  1ZC4 B;  1XCG A;  3ZVR A;  4JKE A;  4JK8 A;  5I2S A;  4IFS A;  2MDX A;  2M38 A;  3KRX A;  1MK7 B;  3FEH A;  4A6F B;  2J0K A;  4HB3 B;  1ACA A;  4ILG B;  4GOU A;  1ZYI A;  1M7E A;  2COC A;  1XR0 B;  4EKU A;  1MI1 A;  1XX0 A;  4HAT B;  1EAZ A;  4EJN A;  1DIK A;  5HE1 A;  4JKH A;  3KY9 A;  5D3V A;  2CY4 A;  2OQB A;  4HHV A;  5DHA B;  2R0D A;  3FSS A;  4HSI A;  4HAW B;  3A98 B;  2VKI A;  4L1R A;  2ELB A;  1VBH A;  4F7H A;  1NU2 A;  1HB6 A;  2MWN B;  3HQC A;  2G35 A;  1OY2 A;  1P3R A;  3V5W A;  2V76 A;  2CQU A;  2DYN A;  2DHK A;  2AL6 A;  1V89 A;  5LON B;  1NI2 A;  4Y94 A;  2LKO A;  5JLJ B;  2Z13 A;  3ODX A;  2GCJ A;  2NZ8 B;  3DXD A;  2KIE A;  1DYN A;  5CLL B;  1Z87 A;  4JK7 A;  1JDE A;  1BWN A;  1U5G A;  4CHJ A;  4K81 A;  3QWM A;  3LJU X;  3N7C A;  1NVL A;  4HAU B;  2Z0O A;  2I1J A;  3AU5 A;  4DX9 0;  3SV1 A;  2DN6 A;  3PVU A;  3A8Q A;  3E9P A;  2UZR A;  2FDQ A;  2ADZ A;  3FM8 C;  1QC6 A;  5GOW B;  2ROV A;  3M1I B;  4A6H A;  1J0W A;  1UNR A;  1DDW A;  2GJY A;  2M14 A;  2QKM A;  2COA A;  4JKF A;  1GC6 A;  2EMT A;  4JKA A;  4GXB A;  3NWD A;  1NTV A;  1V5P A;  5HE0 A;  2R2Y A;  3EPY A;  3A8P A;  2N0Y A;  5DH9 B;  3WA0 A;  1UNP A;  5IJM A;  2DA0 A;  4HAZ B;  3HW2 B;  5D3W A;  1MAI A;  2N23 A;  2BCJ A;  2GS0 A;  2I5C A;  2QKL A;  1BTN A;  3AJ4 A;  1V5U A;  1X86 A;  1ZC3 B;  4GPT B;  4QXA B;  5D3Y A;  4DX8 A;  2YS1 A;  1XOD A;  4OSN A;  4WSF A;  1WG7 A;  2D9X A;  2CAY A;  5KQ1 A;  4JKG A;  4P7I A;  4WJ7 A;  1P6S A;  4KHB A;  2UVM A;  3PG7 A;  2FJL A;  4KHA A;  5HE3 A;  1MK9 B;  1XKE A;  5JHG A;  2DX1 A;  2UZS A;  1WJM A;  2LUL A;  3VOQ A;  1B55 A;  2YRY A;  2VRW B;  4D6W A;  1TQZ A;  2Y7B A;  2D9Y A;  2D4Q A;  1U2B A;  2RQ1 A;  4ZRI A;  2H7E A;  3D8E A;  3ULC A;  4MK0 A;  4GMV A;  4GNK B;  5CLQ B;  1GGO A;  3SNH A;  1MIZ B;  1QQG A;  1LW3 A;  2FJU B;  3MDB C;  1U5F A;  2HRJ A;  1FOE A;  2LOZ A;  2P0H A;  4DXA B;  1X11 A;  4KHB B;  4KHO A;  2MFQ A;  4Z2N A; 
#chains in the Genus database with same CATH homology
 1DRO A;  4F7G A;  2RVB B;  5KQ4 A;  1SHC A;  2Z0Q A;  1V88 A;  2Q13 A;  3KRW A;  4GZU A;  3CXB B;  5J3Y A;  1H4R A;  2J0J A;  1UPR A;  2WH5 A;  2I5F A;  2DKP A;  1M7R A;  3TO1 A;  1GC7 A;  1FHW A;  1J19 A;  3X23 A;  2K2U A;  1BAK A;  2RNR B;  5DIF B;  4CYE A;  2DX5 A;  1FGY A;  2DHJ A;  3AU4 A;  4K17 A;  1MIX A;  1RRP B;  1MKE A;  5DHF B;  2RUK B;  1KBL A;  3DXC A;  2RLO A;  1BTK A;  3PVL A;  3OAN A;  2KCJ A;  4NY0 A;  1W1G A;  4HAY B;  5C79 A;  5C6R A;  3PEG A;  2ABD A;  4KAX B;  1HB8 A;  4GN1 A;  4EMO A;  3FLV A;  2MKR A;  1UEF A;  1SGH A;  1K5D B;  4NSW A;  3U7D A;  1KI1 B;  3P6A A;  2CY5 A;  3SYX A;  1PMS A;  1WJ1 A;  3G9W A;  3F0W A;  3ENB A;  2KGX B;  4WVF B;  2AEH A;  1Y19 B;  1FGZ A;  2D9Z A;  4GMX B;  4K2O A;  2LYD A;  4HB2 B;  1WVH A;  5J3T A;  1H10 A;  1U5D A;  4HB4 B;  4HDQ A;  2YS3 A;  2KUP A;  2COD A;  2DKQ A;  2RSG A;  2IFS A;  5JHH A;  1I7A A;  2EMS A;  2K00 A;  3TW1 A;  2DYQ A;  3BIN A;  1X05 A;  1LB1 A;  4H8S A;  3E66 A;  1NTI A;  2COF A;  5FI1 A;  2D2Q A;  3F5R A;  2OTX A;  3O96 A;  4C0A A;  4HAV B;  2J0M A;  2X0S A;  3NSU A;  4CHM A;  4JKD A;  1W1D A;  1GG3 A;  4PNK A;  1DBH A;  2R09 A;  1X1F A;  2DIK A;  2IYB A;  4L6E A;  5D3X A;  4ZRJ A;  3ODW A;  3P7Z A;  4YON A;  1OQN A;  2JP2 A;  1ZM0 A;  4B6H A;  5C16 A;  1U29 A;  2GCL A;  3T06 A;  5KCV A;  1AQC A;  3GYP A;  2W2X C;  5JP4 A;  5JVL A;  3SBT A;  1U5E A;  4ILH A;  3KZ1 A;  2FJ9 A;  3ZDT A;  2ROZ B;  2Z0P A;  1U27 A;  1KC7 A;  4K2P A;  3PSC A;  4F7U P;  2VSZ A;  4MY6 A;  2COP A;  3TVV A;  3BJI A;  2Y8F A;  4MT7 A;  2LOX A;  2Y8G A;  5HE2 A;  2NMB A;  4IOY X;  3QBV B;  1AWE A;  5LOP B;  2RGN B;  4HDO A;  3QIJ A;  3SBG A;  3WYF B;  2PZ1 A;  3VIA A;  2CRF A;  1KZG A;  2W2W A;  2ZPY A;  3U8Z A;  2P0F A;  3IVF A;  1UNQ A;  1E5W A;  5DI9 B;  5C5B B;  3ODO A;  3SO6 A;  2DHI A;  3HK0 A;  3E9L A;  4D0N B;  3PP2 A;  3SUZ A;  1I2H A;  1FB8 A;  1KZ7 A;  2ELA A;  2D11 A;  4TYZ A;  2YVC A;  3DXE A;  4IAP A;  5J3Q A;  1ST7 A;  1EVH A;  2P0D A;  1ISN A;  2HE7 A;  2D9W A;  2D9V A;  3GYO A;  3MPX A;  1EGX A;  3FP5 A;  1WGU A;  2YS5 A;  4ILJ A;  5D27 A;  4BBK A;  1FAO A;  2YF0 A;  3D8F A;  3PVW A;  4PQ0 A;  1RJ2 A;  2LBB A;  1WI1 A;  2YT0 A;  1FHO A;  2DFK A;  3UZT A;  2CB8 A;  3PZD A;  1VBG A;  4JKC A;  2YSZ A;  5L81 A;  1V5M A;  2P8V A;  2K2J A;  1EF1 A;  1TJ6 A;  5C5B A;  3TFM A;  1ZSQ A;  1V61 A;  1DDM A;  1NTY A;  2E2X A;  2L1C A;  4KVG B;  1N3H A;  4YL8 A;  4A5K A;  2R82 A;  2H7D A;  2HTH B;  2J59 M;  2D10 A;  3ULB A;  1Q67 A;  1WGQ A;  5FI0 A;  4HAX B;  4ZRK A;  2DLW A;  2EC1 A;  1W1H A;  3ML4 A;  1XD4 A;  2YT1 A;  1HBK A;  2I1K A;  3TCA A;  4JKB A;  4JKG B;  4A6F A;  1P5T A;  2EJ8 A;  2L2I A;  1DDV A;  3D8D A;  1ZVR A;  2W2X D;  4Z2M B;  4DBB A;  1FHX A;  1MPH A;  1Y5O A;  2LG1 A;  1X1G A;  4TKN A;  2DTC A;  3E9O A;  2X18 A;  1PFJ A;  1K5G B;  1OMW A;  5EFX A;  1IRS A;  1TXD A;  3CIK A;  4HB0 B;  1PLS A;  3KSY A;  4A6K A;  1UPQ A;  4JK9 A;  3RCP A;  2XQN M;  4XWX A;  1ZC4 B;  1XCG A;  3ZVR A;  4JKE A;  4JK8 A;  4IFS A;  2MDX A;  2M38 A;  3KRX A;  1MK7 B;  3FEH A;  4A6F B;  2J0K A;  4HB3 B;  1ACA A;  4ILG B;  1M7E A;  2COC A;  1XR0 B;  4EKU A;  1XX0 A;  4HAT B;  1EAZ A;  4EJN A;  1DIK A;  5HE1 A;  4JKH A;  3KY9 A;  5D3V A;  2CY4 A;  2OQB A;  4HHV A;  5DHA B;  2R0D A;  3FSS A;  4HAW B;  3A98 B;  2VKI A;  2ELB A;  1VBH A;  4F7H A;  1NU2 A;  1HB6 A;  2MWN B;  3HQC A;  2G35 A;  1OY2 A;  1P3R A;  3V5W A;  2V76 A;  2CQU A;  2DYN A;  2DHK A;  2AL6 A;  1V89 A;  5LON B;  1NI2 A;  4Y94 A;  2LKO A;  5JLJ B;  3ODX A;  2GCJ A;  2NZ8 B;  3DXD A;  1DYN A;  5CLL B;  1Z87 A;  4JK7 A;  1JDE A;  1BWN A;  1U5G A;  4CHJ A;  4K81 A;  3QWM A;  3LJU X;  3N7C A;  1NVL A;  4HAU B;  2Z0O A;  2I1J A;  3AU5 A;  4DX9 0;  3SV1 A;  2DN6 A;  3PVU A;  3A8Q A;  3E9P A;  2UZR A;  2FDQ A;  2ADZ A;  3FM8 C;  1QC6 A;  5GOW B;  2ROV A;  3M1I B;  4A6H A;  1J0W A;  1UNR A;  1DDW A;  2GJY A;  2M14 A;  2QKM A;  2COA A;  4JKF A;  1GC6 A;  2EMT A;  4JKA A;  4GXB A;  1NTV A;  1V5P A;  5HE0 A;  3EPY A;  3A8P A;  2N0Y A;  5DH9 B;  3WA0 A;  1UNP A;  5IJM A;  2DA0 A;  4HAZ B;  3HW2 B;  5D3W A;  1MAI A;  2N23 A;  2BCJ A;  2GS0 A;  2I5C A;  2QKL A;  1BTN A;  3AJ4 A;  1V5U A;  1X86 A;  1ZC3 B;  4GPT B;  5D3Y A;  4DX8 A;  2YS1 A;  1XOD A;  4WSF A;  1WG7 A;  2D9X A;  2CAY A;  5KQ1 A;  4JKG A;  4P7I A;  4WJ7 A;  1P6S A;  2UVM A;  3PG7 A;  2FJL A;  4KHA A;  5HE3 A;  1MK9 B;  1XKE A;  5JHG A;  2DX1 A;  2UZS A;  1WJM A;  2LUL A;  3VOQ A;  1B55 A;  2YRY A;  2VRW B;  1TQZ A;  2Y7B A;  2D9Y A;  2D4Q A;  1U2B A;  2RQ1 A;  4ZRI A;  2H7E A;  3D8E A;  3ULC A;  4MK0 A;  4GMV A;  5CLQ B;  1GGO A;  3SNH A;  1MIZ B;  1QQG A;  1LW3 A;  3MDB C;  1U5F A;  2HRJ A;  1FOE A;  2LOZ A;  2P0H A;  4DXA B;  1X11 A;  4KHB B;  4KHO A;  2MFQ A;  4Z2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...