3G9WA

Crystal structure of talin2 f2-f3 in complex with the integrin beta1d cytoplasmic tail
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
217
structure length
217
Chain Sequence
GIDPFTKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEFGGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of an integrin/talin complex reveals the basis of inside-out signal transduction
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords Talin-2
total genus 69
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3g9wA01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3g9wA02
1RRPB 3PVWA 2YRYA 3A8QA 2COFA 3KSYA 4P7IA 2K2JA 3FP5A 4TYZA 1XD4A 1V88A 2GCLA 2P0HA 3V5WA 1DDWA 2IFSA 4HDOA 3TVVA 4IOYX 4K2OA 3ZDTA 5L81A 2GS0A 1U2BA 4A6HA 1KZ7A 3GYPA 4NY0A 2Y8GA 4K17A 1ZC4B 2H7DA 4YL8A 1AWEA 4HB2B 5JLJB 2D9YA 4HB4B 5HE2A 1LW3A 3SYXA 1UPRA 4DXAB 1TJ6A 2LOXA 2P0DA 1UPQA 4F7UP 3AU4A 2J0MA 5IJMA 3D8FA 1V5UA 4XWXA 2D9ZA 3X23A 4EKUA 4NSWA 4ZRKA 3TCAA 2RUKB 2J59M 3A8PA 4HAUB 1XODA 2DYQA 2CODA 1WI1A 5JP4A 1FB8A 4KHAA 3TW1A 2UVMA 3U7DA 2D2QA 1X1FA 1FHWA 1BAKA 2VSZA 3KRWA 4K2PA 3FLVA 2M38A 5LOPB 2MKRA 1J0WA 2OQBA 1OMWA 1AQCA 3QIJA 3IVFA 1U5DA 4IFSA 4GMXB 2LG1A 2YVCA 1UNQA 1XCGA 1FHXA 1U27A 4A6FB 3SNHA 4GXBA 2RLOA 1KI1B 2CY5A 4MT7A 2CY4A 2ZPYA 1UEFA 1P6SA 1PMSA 5D3WA 2DX5A 5CLQB 2I5FA 4CHJA 2DN6A 1B55A 1WJ1A 2Y8FA 5C5BB 1QC6A 2EC1A 2RSGA 2HE7A 3HQCA 3FEHA 2D9XA 2D9WA 1K5DB 2QKLA 2J0JA 5HE0A 2EJ8A 2ROVA 2KGXB 1W1HA 4EMOA 1X05A 4YONA 1V5PA 2MWNB 4WSFA 5FI1A 5DIFB 1NI2A 3HK0A 1ST7A 2RQ1A 2X18A 2AL6A 2VRWB 1H10A 2LBBA 1M7EA 1V61A 3KZ1A 4HHVA 5DI9B 3AU5A 3ODXA 4A6FA 3A98B 2Q13A 2DHJA 1V89A 2W2WA 3PSCA 3M1IB 2V76A 2YT1A 2LYDA 4DX8A 2AEHA 2I1JA 4A5KA 4BBKA 3O96A 4KHOA 1X11A 3ML4A 1MPHA 2MFQA 5DHAB 3DXDA 1ISNA 4MY6A 3FM8C 2FJ9A 4HAZB 1J19A 5KQ1A 1ZSQA 1GC6A 5KCVA 3N7CA 5C79A 3TFMA 5JHGA 5JHHA 3ODWA 2I1KA 2D11A 2KCJA 3EPYA 1SGHA 1U5FA 5GOWB 2DFKA 4WVFB 3ODOA 2MDXA 2YS1A 1LB1A 3HW2B 3ULBA 2D10A 2CB8A 3RCPA 1PFJA 2ELAA 1SHCA 2ROZB 3CIKA 2HRJA 3G9WA 3D8DA 1WGUA 2JP2A 1XR0B 1X86A 3P7ZA 3FSSA 2D4QA 1MIXA 2R0DA 1PLSA 1FGZA 2BCJA 1MAIA 5DH9B 1M7RA 1NTYA 1WJMA 4EJNA 4Z2NA 1FOEA 2LKOA 2QKMA 2K2UA 3PP2A 1DDVA 1DDMA 1EF1A 1TXDA 2RGNB 2RVBB 4Z2MB 3P6AA 4L6EA 3PZDA 1EAZA 5D3XA 1Q67A 5C16A 2I5CA 1DBHA 1OY2A 2DTCA 2XQNM 2FDQA 5D27A 3MDBC 2H7EA 1UNPA 3PG7A 3SUZA 1I7AA 1RJ2A 1U5GA 2J0KA 1MKEA 2L2IA 2W2XC 2YSZA 1DYNA 4B6HA 2P8VA 4CYEA 2HTHB 2WH5A 5J3QA 4HAWB 4TKNA 1W1DA 4CHMA 2P0FA 3VOQA 1MK9B 3LJUX 3PEGA 2K00A 2UZSA 2OTXA 1H4RA 3QBVB 1FGYA 2NZ8B 1I2HA 3ZVRA 2YS5A 1WG7A 5D3VA 4KHBB 2L1CA 4C0AA 2DHIA 1BTNA 1N3HA 2YS3A 1U29A 3PVUA 5CLLB 3QWMA 1FHOA 2DHKA 3SV1A 1KZGA 1DROA 2EMTA 3UZTA 4GMVA 5D3YA 4PNKA 4HAYB 1Y5OA 1ZM0A 5DHFB 1HBKA 2VKIA 4DBBA 5EFXA 1NTIA 3NSUA 1NU2A 5HE1A 3F5RA 3WA0A 1XKEA 3GYOA 2COAA 2FJLA 3T06A 1HB6A 4WJ7A 1WVHA 1WGQA 2EMSA 2Z0QA 3SO6A 4H8SA 5J3YA 4DX90 2CAYA 1NVLA 2NMBA 1OQNA 3DXEA 4F7GA 2LULA 1BTKA 2E2XA 2GCJA 2N23A 4F7HA 4ZRJA 3F0WA 4D0NB 5J3TA 3CXBB 4KAXB 2YF0A 2DA0A 4GPTB 1W1GA 4HATB 1P5TA 5KQ4A 1U5EA 1MIZB 2CQUA 3BJIA 2DYNA 1BWNA 1E5WA 2UZRA 4KVGB 1GC7A 4ZRIA 1ZVRA 5FI0A 3KRXA 1XX0A 2Y7BA 2W2XD 3KY9A 2DKPA 2CRFA 2KUPA 4Y94A 2Z0OA 2COPA 1TQZA 4K81A 2LOZA 2IYBA 4A6KA 2DKQA 1Z87A 2R09A 1UNRA 1X1GA 4PQ0A 3BINA 1MK7B 2PZ1A 3VIAA 4HB0B 1GG3A 2RNRB 5C6RA 2COCA 1EGXA 2N0YA 1ACAA 4GN1A 4HAXB 5LONB 2ADZA 5HE3A 2ELBA 2GJYA 1NTVA 1P3RA 2M14A 3U8ZA 1EVHA 3DXCA 4HDQA 2ABDA 3TO1A 1V5MA 1ZC3B 4IAPA 5C5BA 2Z0PA 2G35A 3WYFB 2YT0A 3OANA 4HAVB 1QQGA 3ULCA 3MPXA 3AJ4A 1K5GB 1IRSA 2DX1A 4MK0A 3D8EA 1HB8A 1FAOA 4GZUA 4HB3B 2DLWA 3PVLA 2D9VA 1Y19B
chains in the Genus database with same CATH superfamily
1RRPB 3PVWA 2YRYA 3A8QA 2COFA 4JKCA 3KSYA 4P7IA 4QJ3B 2K2JA 3FP5A 4TYZA 1XD4A 1V88A 2GCLA 1DIKA 2P0HA 3V5WA 1DDWA 4DIXA 2IFSA 4HDOA 3TVVA 4IOYX 1VBHA 1ZYIA 4K2OA 3ZDTA 5L81A 2GS0A 1U2BA 4A6HA 1KZ7A 3GYPA 2DIKA 4NY0A 2Y8GA 4K17A 1ZC4B 2H7DA 4YL8A 1AWEA 4HB2B 5JLJB 2D9YA 4HB4B 4JKDA 5HE2A 1LW3A 3SYXA 1UPRA 4DXAB 1TJ6A 2LOXA 2P0DA 1UPQA 4F7UP 3AU4A 2J0MA 5IJMA 2RRFA 3D8FA 1V5UA 4XWXA 2D9ZA 4OT1A 3A58A 3X23A 4EKUA 4JKGA 4ZRKA 4NSWA 3TCAA 2RUKB 2J59M 3A8PA 4HAUB 1XODA 2DYQA 2CODA 1WI1A 5JP4A 1FB8A 4KHAA 3TW1A 2UVMA 4L1RA 3U7DA 2D2QA 1X1FA 1FHWA 1BAKA 2VSZA 3KRWA 3NW8A 4K2PA 2Z59A 3FLVA 2M38A 5LOPB 2MKRA 1J0WA 2OQBA 4JK8A 1OMWA 2KR0A 1AQCA 3QIJA 4QJ4B 3IVFA 1U5DA 4IFSA 4GMXB 2LG1A 2YVCA 4GNKB 1UNQA 1XCGA 1FHXA 1U27A 4A6FB 3SNHA 4GXBA 2RLOA 1KI1B 3FVCA 2CY5A 4MT7A 2CY4A 2ZPYA 1UEFA 1P6SA 2Z13A 1PMSA 5D3WA 2DX5A 5CLQB 2I5FA 4CHJA 2DN6A 1B55A 1WJ1A 2Y8FA 5C5BB 1QC6A 2EC1A 2RSGA 2HE7A 3HQCA 3FEHA 2D9XA 2D9WA 3HIEA 1K5DB 2QKLA 2J0JA 5HE0A 2EJ8A 2ROVA 2KGXB 1W1HA 4EMOA 2R82A 1X05A 4YONA 3DCXA 1V5PA 2MWNB 4WSFA 5FI1A 5DIFB 1NI2A 3HK0A 1ST7A 2RQ1A 2X18A 2AL6A 2VRWB 1H10A 2LBBA 1M7EA 1V61A 3KZ1A 4HHVA 5DI9B 3AU5A 3ODXA 4A6FA 3A98B 4ILJA 2Q13A 2DHJA 1V89A 2W2WA 3PSCA 1GGOA 2V76A 3M1IB 2YT1A 2LYDA 4DX8A 2AEHA 2I1JA 4GOUA 4A5KA 4BBKA 3O96A 4KHOA 4JKEA 1X11A 4D6WA 3ML4A 1MPHA 2MFQA 5DHAB 3DXDA 1ISNA 4MY6A 3FM8C 2FJ9A 4HAZB 1J19A 5KQ1A 1ZSQA 1GC6A 2Z4DA 5KCVA 3E66A 3N7CA 5C79A 3TFMA 5JHGA 5JHHA 3ODWA 2I1KA 1JDEA 2D11A 2KCJA 3EPYA 3NWAA 1SGHA 1U5FA 2YT2A 5GOWB 2DFKA 4WVFB 3E9LA 3ODOA 2MDXA 2YS1A 1LB1A 3HW2B 3B77A 3ULBA 2D10A 2CB8A 3RCPA 2X0SA 1PFJA 2ELAA 1SHCA 2ROZB 3CIKA 2HRJA 3G9WA 3D8DA 3HSAA 1WGUA 2JP2A 3NWDA 1XR0B 1X86A 3P7ZA 3FSSA 2D4QA 2K49A 5LG4B 1MIXA 5IRSA 2R0DA 1PLSA 1FGZA 2BCJA 1MAIA 5DH9B 2KIEA 1M7RA 1NTYA 1WJMA 4JKHA 4EJNA 3NWFA 4Z2NA 1FOEA 2LKOA 1VBGA 2QKMA 4HSIA 2K2UA 3PP2A 1DDVA 1DDMA 1EF1A 1TXDA 2RGNB 2RVBB 4Z2MB 3P6AA 4L6EA 3PZDA 2GUMA 1EAZA 5D3XA 1Q67A 5C16A 2I5CA 1DBHA 1OY2A 2DTCA 2XQNM 2FDQA 5D27A 3MDBC 2H7EA 1UNPA 3PG7A 3SUZA 1I7AA 1RJ2A 1U5GA 2J0KA 1MKEA 2L2IA 2W2XC 2YSZA 1DYNA 4B6HA 2P8VA 4CYEA 2HTHB 2WH5A 5J3QA 4JKAA 4TKNA 4HAWB 1W1DA 4CHMA 2P0FA 3VOQA 4CSQA 1MK9B 4KHBA 3LJUX 3PEGA 2UZSA 2K00A 1KBLA 2OTXA 1H4RA 3QBVB 4JKGB 2ZKMX 1FGYA 2NZ8B 1I2HA 3ZVRA 2YS5A 1WG7A 5D3VA 4KHBB 2L1CA 4C0AA 1T77A 2DHIA 1BTNA 1N3HA 2YS3A 1U29A 3PVUA 2R2YA 4JKBA 5CLLB 1KC7A 3QWMA 1FHOA 2DHKA 3SV1A 1KZGA 1DROA 2EMTA 3UZTA 4GMVA 5D3YA 4QJ5B 4PNKA 3ENBA 4HAYB 1Y5OA 1ZM0A 5DHFB 1HBKA 2VKIA 4DBBA 5EFXA 1NTIA 3NSUA 1NU2A 5HE1A 3F5RA 3WA0A 1XKEA 3GYOA 3SBGA 2COAA 2FJLA 3T06A 1HB6A 2K8EA 1WVHA 1WGQA 4WJ7A 2EMSA 2Z0QA 2FJUB 3SO6A 5I2MA 4H8SA 5J3YA 4DX90 2CAYA 1NVLA 2NMBA 1OQNA 3DXEA 5I2SA 4F7GA 2LULA 1BTKA 2E2XA 2GCJA 2N23A 4F7HA 4ZRJA 3F0WA 4D0NB 4QXAB 5J3TA 3CXBB 4KAXB 2YF0A 2DA0A 2KIGA 4GPTB 1W1GA 1MI1A 4HATB 1P5TA 5KQ4A 4JK7A 1U5EA 1MIZB 2CQUA 3BJIA 2DYNA 3E9OA 1E5WA 1BWNA 2UZRA 4KVGB 1GC7A 4JK9A 4ZRIA 1ZVRA 5FI0A 4ILGB 3KRXA 1XX0A 2Y7BA 2W2XD 4JKFA 3KY9A 2DKPA 2CRFA 4ILHA 2KUPA 4Y94A 2Z0OA 2COPA 1TQZA 3OHMB 4K81A 2LOZA 2IYBA 4A6KA 2DKQA 1Z87A 2R09A 1UNRA 1X1GA 4PQ0A 2Z14A 3BINA 1MK7B 2PZ1A 3VIAA 2NBVA 4HB0B 5JVLA 1GG3A 2RNRB 5C6RA 2COCA 1EGXA 2N0YA 1ACAA 4GN1A 4HAXB 3SBTA 5LONB 2ADZA 5HE3A 2ELBA 2GJYA 1NTVA 1P3RA 2M14A 3U8ZA 1EVHA 3DXCA 4HDQA 2ABDA 3TO1A 1V5MA 1ZC3B 4IAPA 5C5BA 2Z0PA 3E9PA 2G35A 3WYFB 2YT0A 3OANA 4HAVB 1QQGA 3ULCA 3MPXA 3AJ4A 5M4YB 1K5GB 1IRSA 2DX1A 4MK0A 3U12A 3D8EA 4OSNA 1HB8A 1FAOA 4GZUA 2KUQA 4HB3B 2DLWA 3PVLA 2D9VA 1Y19B
chains in the Genus database with same CATH topology
1RRPB 3PVWA 2YRYA 3A8QA 2COFA 4JKCA 3KSYA 4P7IA 2K2JA 3FP5A 4TYZA 1XD4A 1V88A 2GCLA 1DIKA 2P0HA 3V5WA 1DDWA 2IFSA 4HDOA 3TVVA 4IOYX 1VBHA 4K2OA 3ZDTA 5L81A 2GS0A 1U2BA 4A6HA 1KZ7A 3GYPA 2DIKA 4NY0A 2Y8GA 4K17A 1ZC4B 2H7DA 4YL8A 1AWEA 4HB2B 5JLJB 2D9YA 4HB4B 4JKDA 5HE2A 1LW3A 3SYXA 1UPRA 4DXAB 1TJ6A 2LOXA 2P0DA 1UPQA 4F7UP 3AU4A 2J0MA 5IJMA 3D8FA 1V5UA 4XWXA 2D9ZA 3X23A 4EKUA 4JKGA 4ZRKA 4NSWA 3TCAA 2RUKB 2J59M 3A8PA 4HAUB 1XODA 2DYQA 2CODA 1WI1A 5JP4A 1FB8A 4KHAA 3TW1A 2UVMA 3U7DA 2D2QA 1X1FA 1FHWA 1BAKA 2VSZA 3KRWA 4K2PA 3FLVA 2M38A 5LOPB 2MKRA 1J0WA 2OQBA 4JK8A 1OMWA 1AQCA 3QIJA 3IVFA 1U5DA 4IFSA 4GMXB 2LG1A 2YVCA 1UNQA 1XCGA 1FHXA 1U27A 4A6FB 3SNHA 4GXBA 2RLOA 1KI1B 2CY5A 4MT7A 2CY4A 2ZPYA 1UEFA 1P6SA 1PMSA 5D3WA 2DX5A 5CLQB 2I5FA 4CHJA 2DN6A 1B55A 1WJ1A 2Y8FA 5C5BB 1QC6A 2EC1A 2RSGA 2HE7A 3HQCA 3FEHA 2D9XA 2D9WA 1K5DB 2QKLA 2J0JA 5HE0A 2EJ8A 2ROVA 2KGXB 1W1HA 4EMOA 2R82A 1X05A 4YONA 1V5PA 2MWNB 4WSFA 5FI1A 5DIFB 1NI2A 3HK0A 1ST7A 2RQ1A 2X18A 2AL6A 2VRWB 1H10A 2LBBA 1M7EA 1V61A 3KZ1A 4HHVA 5DI9B 3AU5A 3ODXA 4A6FA 3A98B 4ILJA 2Q13A 2DHJA 1V89A 2W2WA 3PSCA 1GGOA 2V76A 3M1IB 2YT1A 2LYDA 4DX8A 2AEHA 2I1JA 4A5KA 4BBKA 3O96A 4KHOA 4JKEA 1X11A 3ML4A 1MPHA 2MFQA 5DHAB 3DXDA 1ISNA 4MY6A 3FM8C 2FJ9A 4HAZB 1J19A 5KQ1A 1ZSQA 1GC6A 5KCVA 3E66A 3N7CA 5C79A 3TFMA 5JHGA 5JHHA 3ODWA 2I1KA 1JDEA 2D11A 2KCJA 3EPYA 1SGHA 1U5FA 5GOWB 2DFKA 4WVFB 3E9LA 3ODOA 2MDXA 2YS1A 1LB1A 3HW2B 3ULBA 2D10A 2CB8A 3RCPA 2X0SA 1PFJA 2ELAA 1SHCA 2ROZB 3CIKA 2HRJA 3G9WA 3D8DA 1WGUA 2JP2A 1XR0B 1X86A 3P7ZA 3FSSA 2D4QA 1MIXA 2R0DA 1PLSA 1FGZA 2BCJA 1MAIA 5DH9B 1M7RA 1NTYA 1WJMA 4JKHA 4EJNA 4Z2NA 1FOEA 2LKOA 1VBGA 2QKMA 2K2UA 3PP2A 1DDVA 1DDMA 1EF1A 1TXDA 2RGNB 2RVBB 4Z2MB 3P6AA 4L6EA 3PZDA 1EAZA 5D3XA 1Q67A 5C16A 2I5CA 1DBHA 1OY2A 2DTCA 2XQNM 2FDQA 5D27A 3MDBC 2H7EA 1UNPA 3PG7A 3SUZA 1I7AA 1RJ2A 1U5GA 2J0KA 1MKEA 2L2IA 2W2XC 2YSZA 1DYNA 4B6HA 2P8VA 4CYEA 2HTHB 2WH5A 5J3QA 4JKAA 4TKNA 4HAWB 1W1DA 4CHMA 2P0FA 3VOQA 1MK9B 3LJUX 3PEGA 2UZSA 2K00A 1KBLA 2OTXA 1H4RA 3QBVB 4JKGB 1FGYA 2NZ8B 1I2HA 3ZVRA 2YS5A 1WG7A 5D3VA 4KHBB 2L1CA 4C0AA 2DHIA 1BTNA 1N3HA 2YS3A 1U29A 3PVUA 4JKBA 5CLLB 1KC7A 3QWMA 1FHOA 2DHKA 3SV1A 1KZGA 1DROA 2EMTA 3UZTA 4GMVA 5D3YA 4PNKA 3ENBA 4HAYB 1Y5OA 1ZM0A 5DHFB 1HBKA 2VKIA 4DBBA 5EFXA 1NTIA 3NSUA 1NU2A 5HE1A 3F5RA 3WA0A 1XKEA 3GYOA 3SBGA 2COAA 2FJLA 3T06A 1HB6A 4WJ7A 1WVHA 1WGQA 2EMSA 2Z0QA 3SO6A 4H8SA 5J3YA 4DX90 2CAYA 1NVLA 2NMBA 1OQNA 3DXEA 4F7GA 2LULA 1BTKA 2E2XA 2GCJA 2N23A 4F7HA 4ZRJA 3F0WA 4D0NB 5J3TA 3CXBB 4KAXB 2YF0A 2DA0A 4GPTB 1W1GA 4HATB 1P5TA 5KQ4A 4JK7A 1U5EA 1MIZB 2CQUA 3BJIA 2DYNA 3E9OA 1E5WA 1BWNA 2UZRA 4KVGB 1GC7A 4JK9A 4ZRIA 1ZVRA 5FI0A 4ILGB 3KRXA 1XX0A 2Y7BA 2W2XD 4JKFA 3KY9A 2DKPA 2CRFA 4ILHA 2KUPA 4Y94A 2Z0OA 2COPA 1TQZA 4K81A 2LOZA 2IYBA 4A6KA 2DKQA 1Z87A 2R09A 1UNRA 1X1GA 4PQ0A 3BINA 1MK7B 2PZ1A 3VIAA 4HB0B 5JVLA 1GG3A 2RNRB 5C6RA 2COCA 1EGXA 2N0YA 1ACAA 4GN1A 4HAXB 3SBTA 5LONB 2ADZA 5HE3A 2ELBA 2GJYA 1NTVA 1P3RA 2M14A 3U8ZA 1EVHA 3DXCA 4HDQA 2ABDA 3TO1A 1V5MA 1ZC3B 4IAPA 5C5BA 2Z0PA 3E9PA 2G35A 3WYFB 2YT0A 3OANA 4HAVB 1QQGA 3ULCA 3MPXA 3AJ4A 1K5GB 1IRSA 2DX1A 4MK0A 3D8EA 1HB8A 1FAOA 4GZUA 4HB3B 2DLWA 3PVLA 2D9VA 1Y19B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RRP B;  3PVW A;  2YRY A;  3A8Q A;  2COF A;  3KSY A;  4P7I A;  2K2J A;  3FP5 A;  4TYZ A;  1XD4 A;  1V88 A;  2GCL A;  2P0H A;  3V5W A;  1DDW A;  2IFS A;  4HDO A;  3TVV A;  4IOY X;  4K2O A;  3ZDT A;  5L81 A;  2GS0 A;  1U2B A;  4A6H A;  1KZ7 A;  3GYP A;  4NY0 A;  2Y8G A;  4K17 A;  1ZC4 B;  2H7D A;  4YL8 A;  1AWE A;  4HB2 B;  5JLJ B;  2D9Y A;  4HB4 B;  5HE2 A;  1LW3 A;  3SYX A;  1UPR A;  4DXA B;  1TJ6 A;  2LOX A;  2P0D A;  1UPQ A;  4F7U P;  3AU4 A;  2J0M A;  5IJM A;  3D8F A;  1V5U A;  4XWX A;  2D9Z A;  3X23 A;  4EKU A;  4NSW A;  4ZRK A;  3TCA A;  2RUK B;  2J59 M;  3A8P A;  4HAU B;  1XOD A;  2DYQ A;  2COD A;  1WI1 A;  5JP4 A;  1FB8 A;  4KHA A;  3TW1 A;  2UVM A;  3U7D A;  2D2Q A;  1X1F A;  1FHW A;  1BAK A;  2VSZ A;  3KRW A;  4K2P A;  3FLV A;  2M38 A;  5LOP B;  2MKR A;  1J0W A;  2OQB A;  1OMW A;  1AQC A;  3QIJ A;  3IVF A;  1U5D A;  4IFS A;  4GMX B;  2LG1 A;  2YVC A;  1UNQ A;  1XCG A;  1FHX A;  1U27 A;  4A6F B;  3SNH A;  4GXB A;  2RLO A;  1KI1 B;  2CY5 A;  4MT7 A;  2CY4 A;  2ZPY A;  1UEF A;  1P6S A;  1PMS A;  5D3W A;  2DX5 A;  5CLQ B;  2I5F A;  4CHJ A;  2DN6 A;  1B55 A;  1WJ1 A;  2Y8F A;  5C5B B;  1QC6 A;  2EC1 A;  2RSG A;  2HE7 A;  3HQC A;  3FEH A;  2D9X A;  2D9W A;  1K5D B;  2QKL A;  2J0J A;  5HE0 A;  2EJ8 A;  2ROV A;  2KGX B;  1W1H A;  4EMO A;  1X05 A;  4YON A;  1V5P A;  2MWN B;  4WSF A;  5FI1 A;  5DIF B;  1NI2 A;  3HK0 A;  1ST7 A;  2RQ1 A;  2X18 A;  2AL6 A;  2VRW B;  1H10 A;  2LBB A;  1M7E A;  1V61 A;  3KZ1 A;  4HHV A;  5DI9 B;  3AU5 A;  3ODX A;  4A6F A;  3A98 B;  2Q13 A;  2DHJ A;  1V89 A;  2W2W A;  3PSC A;  3M1I B;  2V76 A;  2YT1 A;  2LYD A;  4DX8 A;  2AEH A;  2I1J A;  4A5K A;  4BBK A;  3O96 A;  4KHO A;  1X11 A;  3ML4 A;  1MPH A;  2MFQ A;  5DHA B;  3DXD A;  1ISN A;  4MY6 A;  3FM8 C;  2FJ9 A;  4HAZ B;  1J19 A;  5KQ1 A;  1ZSQ A;  1GC6 A;  5KCV A;  3N7C A;  5C79 A;  3TFM A;  5JHG A;  5JHH A;  3ODW A;  2I1K A;  2D11 A;  2KCJ A;  3EPY A;  1SGH A;  1U5F A;  5GOW B;  2DFK A;  4WVF B;  3ODO A;  2MDX A;  2YS1 A;  1LB1 A;  3HW2 B;  3ULB A;  2D10 A;  2CB8 A;  3RCP A;  1PFJ A;  2ELA A;  1SHC A;  2ROZ B;  3CIK A;  2HRJ A;  3G9W A;  3D8D A;  1WGU A;  2JP2 A;  1XR0 B;  1X86 A;  3P7Z A;  3FSS A;  2D4Q A;  1MIX A;  2R0D A;  1PLS A;  1FGZ A;  2BCJ A;  1MAI A;  5DH9 B;  1M7R A;  1NTY A;  1WJM A;  4EJN A;  4Z2N A;  1FOE A;  2LKO A;  2QKM A;  2K2U A;  3PP2 A;  1DDV A;  1DDM A;  1EF1 A;  1TXD A;  2RGN B;  2RVB B;  4Z2M B;  3P6A A;  4L6E A;  3PZD A;  1EAZ A;  5D3X A;  1Q67 A;  5C16 A;  2I5C A;  1DBH A;  1OY2 A;  2DTC A;  2XQN M;  2FDQ A;  5D27 A;  3MDB C;  2H7E A;  1UNP A;  3PG7 A;  3SUZ A;  1I7A A;  1RJ2 A;  1U5G A;  2J0K A;  1MKE A;  2L2I A;  2W2X C;  2YSZ A;  1DYN A;  4B6H A;  2P8V A;  4CYE A;  2HTH B;  2WH5 A;  5J3Q A;  4HAW B;  4TKN A;  1W1D A;  4CHM A;  2P0F A;  3VOQ A;  1MK9 B;  3LJU X;  3PEG A;  2K00 A;  2UZS A;  2OTX A;  1H4R A;  3QBV B;  1FGY A;  2NZ8 B;  1I2H A;  3ZVR A;  2YS5 A;  1WG7 A;  5D3V A;  4KHB B;  2L1C A;  4C0A A;  2DHI A;  1BTN A;  1N3H A;  2YS3 A;  1U29 A;  3PVU A;  5CLL B;  3QWM A;  1FHO A;  2DHK A;  3SV1 A;  1KZG A;  1DRO A;  2EMT A;  3UZT A;  4GMV A;  5D3Y A;  4PNK A;  4HAY B;  1Y5O A;  1ZM0 A;  5DHF B;  1HBK A;  2VKI A;  4DBB A;  5EFX A;  1NTI A;  3NSU A;  1NU2 A;  5HE1 A;  3F5R A;  3WA0 A;  1XKE A;  3GYO A;  2COA A;  2FJL A;  3T06 A;  1HB6 A;  4WJ7 A;  1WVH A;  1WGQ A;  2EMS A;  2Z0Q A;  3SO6 A;  4H8S A;  5J3Y A;  4DX9 0;  2CAY A;  1NVL A;  2NMB A;  1OQN A;  3DXE A;  4F7G A;  2LUL A;  1BTK A;  2E2X A;  2GCJ A;  2N23 A;  4F7H A;  4ZRJ A;  3F0W A;  4D0N B;  5J3T A;  3CXB B;  4KAX B;  2YF0 A;  2DA0 A;  4GPT B;  1W1G A;  4HAT B;  1P5T A;  5KQ4 A;  1U5E A;  1MIZ B;  2CQU A;  3BJI A;  2DYN A;  1BWN A;  1E5W A;  2UZR A;  4KVG B;  1GC7 A;  4ZRI A;  1ZVR A;  5FI0 A;  3KRX A;  1XX0 A;  2Y7B A;  2W2X D;  3KY9 A;  2DKP A;  2CRF A;  2KUP A;  4Y94 A;  2Z0O A;  2COP A;  1TQZ A;  4K81 A;  2LOZ A;  2IYB A;  4A6K A;  2DKQ A;  1Z87 A;  2R09 A;  1UNR A;  1X1G A;  4PQ0 A;  3BIN A;  1MK7 B;  2PZ1 A;  3VIA A;  4HB0 B;  1GG3 A;  2RNR B;  5C6R A;  2COC A;  1EGX A;  2N0Y A;  1ACA A;  4GN1 A;  4HAX B;  5LON B;  2ADZ A;  5HE3 A;  2ELB A;  2GJY A;  1NTV A;  1P3R A;  2M14 A;  3U8Z A;  1EVH A;  3DXC A;  4HDQ A;  2ABD A;  3TO1 A;  1V5M A;  1ZC3 B;  4IAP A;  5C5B A;  2Z0P A;  2G35 A;  3WYF B;  2YT0 A;  3OAN A;  4HAV B;  1QQG A;  3ULC A;  3MPX A;  3AJ4 A;  1K5G B;  1IRS A;  2DX1 A;  4MK0 A;  3D8E A;  1HB8 A;  1FAO A;  4GZU A;  4HB3 B;  2DLW A;  3PVL A;  2D9V A;  1Y19 B; 
#chains in the Genus database with same CATH topology
 1RRP B;  3PVW A;  2YRY A;  3A8Q A;  2COF A;  4JKC A;  3KSY A;  4P7I A;  4QJ3 B;  2K2J A;  3FP5 A;  4TYZ A;  1XD4 A;  1V88 A;  2GCL A;  1DIK A;  2P0H A;  3V5W A;  1DDW A;  4DIX A;  2IFS A;  4HDO A;  3TVV A;  4IOY X;  1VBH A;  1ZYI A;  4K2O A;  3ZDT A;  5L81 A;  2GS0 A;  1U2B A;  4A6H A;  1KZ7 A;  3GYP A;  2DIK A;  4NY0 A;  2Y8G A;  4K17 A;  1ZC4 B;  2H7D A;  4YL8 A;  1AWE A;  4HB2 B;  5JLJ B;  2D9Y A;  4HB4 B;  4JKD A;  5HE2 A;  1LW3 A;  3SYX A;  1UPR A;  4DXA B;  1TJ6 A;  2LOX A;  2P0D A;  1UPQ A;  4F7U P;  3AU4 A;  2J0M A;  5IJM A;  2RRF A;  3D8F A;  1V5U A;  4XWX A;  2D9Z A;  4OT1 A;  3A58 A;  3X23 A;  4EKU A;  4JKG A;  4ZRK A;  4NSW A;  3TCA A;  2RUK B;  2J59 M;  3A8P A;  4HAU B;  1XOD A;  2DYQ A;  2COD A;  1WI1 A;  5JP4 A;  1FB8 A;  4KHA A;  3TW1 A;  2UVM A;  4L1R A;  3U7D A;  2D2Q A;  1X1F A;  1FHW A;  1BAK A;  2VSZ A;  3KRW A;  3NW8 A;  4K2P A;  2Z59 A;  3FLV A;  2M38 A;  5LOP B;  2MKR A;  1J0W A;  2OQB A;  4JK8 A;  1OMW A;  2KR0 A;  1AQC A;  3QIJ A;  4QJ4 B;  3IVF A;  1U5D A;  4IFS A;  4GMX B;  2LG1 A;  2YVC A;  4GNK B;  1UNQ A;  1XCG A;  1FHX A;  1U27 A;  4A6F B;  3SNH A;  4GXB A;  2RLO A;  1KI1 B;  3FVC A;  2CY5 A;  4MT7 A;  2CY4 A;  2ZPY A;  1UEF A;  1P6S A;  2Z13 A;  1PMS A;  5D3W A;  2DX5 A;  5CLQ B;  2I5F A;  4CHJ A;  2DN6 A;  1B55 A;  1WJ1 A;  2Y8F A;  5C5B B;  1QC6 A;  2EC1 A;  2RSG A;  2HE7 A;  3HQC A;  3FEH A;  2D9X A;  2D9W A;  3HIE A;  1K5D B;  2QKL A;  2J0J A;  5HE0 A;  2EJ8 A;  2ROV A;  2KGX B;  1W1H A;  4EMO A;  2R82 A;  1X05 A;  4YON A;  3DCX A;  1V5P A;  2MWN B;  4WSF A;  5FI1 A;  5DIF B;  1NI2 A;  3HK0 A;  1ST7 A;  2RQ1 A;  2X18 A;  2AL6 A;  2VRW B;  1H10 A;  2LBB A;  1M7E A;  1V61 A;  3KZ1 A;  4HHV A;  5DI9 B;  3AU5 A;  3ODX A;  4A6F A;  3A98 B;  4ILJ A;  2Q13 A;  2DHJ A;  1V89 A;  2W2W A;  3PSC A;  1GGO A;  2V76 A;  3M1I B;  2YT1 A;  2LYD A;  4DX8 A;  2AEH A;  2I1J A;  4GOU A;  4A5K A;  4BBK A;  3O96 A;  4KHO A;  4JKE A;  1X11 A;  4D6W A;  3ML4 A;  1MPH A;  2MFQ A;  5DHA B;  3DXD A;  1ISN A;  4MY6 A;  3FM8 C;  2FJ9 A;  4HAZ B;  1J19 A;  5KQ1 A;  1ZSQ A;  1GC6 A;  2Z4D A;  5KCV A;  3E66 A;  3N7C A;  5C79 A;  3TFM A;  5JHG A;  5JHH A;  3ODW A;  2I1K A;  1JDE A;  2D11 A;  2KCJ A;  3EPY A;  3NWA A;  1SGH A;  1U5F A;  2YT2 A;  5GOW B;  2DFK A;  4WVF B;  3E9L A;  3ODO A;  2MDX A;  2YS1 A;  1LB1 A;  3HW2 B;  3B77 A;  3ULB A;  2D10 A;  2CB8 A;  3RCP A;  2X0S A;  1PFJ A;  2ELA A;  1SHC A;  2ROZ B;  3CIK A;  2HRJ A;  3G9W A;  3D8D A;  3HSA A;  1WGU A;  2JP2 A;  3NWD A;  1XR0 B;  1X86 A;  3P7Z A;  3FSS A;  2D4Q A;  2K49 A;  5LG4 B;  1MIX A;  5IRS A;  2R0D A;  1PLS A;  1FGZ A;  2BCJ A;  1MAI A;  5DH9 B;  2KIE A;  1M7R A;  1NTY A;  1WJM A;  4JKH A;  4EJN A;  3NWF A;  4Z2N A;  1FOE A;  2LKO A;  1VBG A;  2QKM A;  4HSI A;  2K2U A;  3PP2 A;  1DDV A;  1DDM A;  1EF1 A;  1TXD A;  2RGN B;  2RVB B;  4Z2M B;  3P6A A;  4L6E A;  3PZD A;  2GUM A;  1EAZ A;  5D3X A;  1Q67 A;  5C16 A;  2I5C A;  1DBH A;  1OY2 A;  2DTC A;  2XQN M;  2FDQ A;  5D27 A;  3MDB C;  2H7E A;  1UNP A;  3PG7 A;  3SUZ A;  1I7A A;  1RJ2 A;  1U5G A;  2J0K A;  1MKE A;  2L2I A;  2W2X C;  2YSZ A;  1DYN A;  4B6H A;  2P8V A;  4CYE A;  2HTH B;  2WH5 A;  5J3Q A;  4JKA A;  4TKN A;  4HAW B;  1W1D A;  4CHM A;  2P0F A;  3VOQ A;  4CSQ A;  1MK9 B;  4KHB A;  3LJU X;  3PEG A;  2UZS A;  2K00 A;  1KBL A;  2OTX A;  1H4R A;  3QBV B;  4JKG B;  2ZKM X;  1FGY A;  2NZ8 B;  1I2H A;  3ZVR A;  2YS5 A;  1WG7 A;  5D3V A;  4KHB B;  2L1C A;  4C0A A;  1T77 A;  2DHI A;  1BTN A;  1N3H A;  2YS3 A;  1U29 A;  3PVU A;  2R2Y A;  4JKB A;  5CLL B;  1KC7 A;  3QWM A;  1FHO A;  2DHK A;  3SV1 A;  1KZG A;  1DRO A;  2EMT A;  3UZT A;  4GMV A;  5D3Y A;  4QJ5 B;  4PNK A;  3ENB A;  4HAY B;  1Y5O A;  1ZM0 A;  5DHF B;  1HBK A;  2VKI A;  4DBB A;  5EFX A;  1NTI A;  3NSU A;  1NU2 A;  5HE1 A;  3F5R A;  3WA0 A;  1XKE A;  3GYO A;  3SBG A;  2COA A;  2FJL A;  3T06 A;  1HB6 A;  2K8E A;  1WVH A;  1WGQ A;  4WJ7 A;  2EMS A;  2Z0Q A;  2FJU B;  3SO6 A;  5I2M A;  4H8S A;  5J3Y A;  4DX9 0;  2CAY A;  1NVL A;  2NMB A;  1OQN A;  3DXE A;  5I2S A;  4F7G A;  2LUL A;  1BTK A;  2E2X A;  2GCJ A;  2N23 A;  4F7H A;  4ZRJ A;  3F0W A;  4D0N B;  4QXA B;  5J3T A;  3CXB B;  4KAX B;  2YF0 A;  2DA0 A;  2KIG A;  4GPT B;  1W1G A;  1MI1 A;  4HAT B;  1P5T A;  5KQ4 A;  4JK7 A;  1U5E A;  1MIZ B;  2CQU A;  3BJI A;  2DYN A;  3E9O A;  1E5W A;  1BWN A;  2UZR A;  4KVG B;  1GC7 A;  4JK9 A;  4ZRI A;  1ZVR A;  5FI0 A;  4ILG B;  3KRX A;  1XX0 A;  2Y7B A;  2W2X D;  4JKF A;  3KY9 A;  2DKP A;  2CRF A;  4ILH A;  2KUP A;  4Y94 A;  2Z0O A;  2COP A;  1TQZ A;  3OHM B;  4K81 A;  2LOZ A;  2IYB A;  4A6K A;  2DKQ A;  1Z87 A;  2R09 A;  1UNR A;  1X1G A;  4PQ0 A;  2Z14 A;  3BIN A;  1MK7 B;  2PZ1 A;  3VIA A;  2NBV A;  4HB0 B;  5JVL A;  1GG3 A;  2RNR B;  5C6R A;  2COC A;  1EGX A;  2N0Y A;  1ACA A;  4GN1 A;  4HAX B;  3SBT A;  5LON B;  2ADZ A;  5HE3 A;  2ELB A;  2GJY A;  1NTV A;  1P3R A;  2M14 A;  3U8Z A;  1EVH A;  3DXC A;  4HDQ A;  2ABD A;  3TO1 A;  1V5M A;  1ZC3 B;  4IAP A;  5C5B A;  2Z0P A;  3E9P A;  2G35 A;  3WYF B;  2YT0 A;  3OAN A;  4HAV B;  1QQG A;  3ULC A;  3MPX A;  3AJ4 A;  5M4Y B;  1K5G B;  1IRS A;  2DX1 A;  4MK0 A;  3U12 A;  3D8E A;  4OSN A;  1HB8 A;  1FAO A;  4GZU A;  2KUQ A;  4HB3 B;  2DLW A;  3PVL A;  2D9V A;  1Y19 B; 
#chains in the Genus database with same CATH homology
 1RRP B;  3PVW A;  2YRY A;  3A8Q A;  2COF A;  4JKC A;  3KSY A;  4P7I A;  2K2J A;  3FP5 A;  4TYZ A;  1XD4 A;  1V88 A;  2GCL A;  1DIK A;  2P0H A;  3V5W A;  1DDW A;  2IFS A;  4HDO A;  3TVV A;  4IOY X;  1VBH A;  4K2O A;  3ZDT A;  5L81 A;  2GS0 A;  1U2B A;  4A6H A;  1KZ7 A;  3GYP A;  2DIK A;  4NY0 A;  2Y8G A;  4K17 A;  1ZC4 B;  2H7D A;  4YL8 A;  1AWE A;  4HB2 B;  5JLJ B;  2D9Y A;  4HB4 B;  4JKD A;  5HE2 A;  1LW3 A;  3SYX A;  1UPR A;  4DXA B;  1TJ6 A;  2LOX A;  2P0D A;  1UPQ A;  4F7U P;  3AU4 A;  2J0M A;  5IJM A;  3D8F A;  1V5U A;  4XWX A;  2D9Z A;  3X23 A;  4EKU A;  4JKG A;  4ZRK A;  4NSW A;  3TCA A;  2RUK B;  2J59 M;  3A8P A;  4HAU B;  1XOD A;  2DYQ A;  2COD A;  1WI1 A;  5JP4 A;  1FB8 A;  4KHA A;  3TW1 A;  2UVM A;  3U7D A;  2D2Q A;  1X1F A;  1FHW A;  1BAK A;  2VSZ A;  3KRW A;  4K2P A;  3FLV A;  2M38 A;  5LOP B;  2MKR A;  1J0W A;  2OQB A;  4JK8 A;  1OMW A;  1AQC A;  3QIJ A;  3IVF A;  1U5D A;  4IFS A;  4GMX B;  2LG1 A;  2YVC A;  1UNQ A;  1XCG A;  1FHX A;  1U27 A;  4A6F B;  3SNH A;  4GXB A;  2RLO A;  1KI1 B;  2CY5 A;  4MT7 A;  2CY4 A;  2ZPY A;  1UEF A;  1P6S A;  1PMS A;  5D3W A;  2DX5 A;  5CLQ B;  2I5F A;  4CHJ A;  2DN6 A;  1B55 A;  1WJ1 A;  2Y8F A;  5C5B B;  1QC6 A;  2EC1 A;  2RSG A;  2HE7 A;  3HQC A;  3FEH A;  2D9X A;  2D9W A;  1K5D B;  2QKL A;  2J0J A;  5HE0 A;  2EJ8 A;  2ROV A;  2KGX B;  1W1H A;  4EMO A;  2R82 A;  1X05 A;  4YON A;  1V5P A;  2MWN B;  4WSF A;  5FI1 A;  5DIF B;  1NI2 A;  3HK0 A;  1ST7 A;  2RQ1 A;  2X18 A;  2AL6 A;  2VRW B;  1H10 A;  2LBB A;  1M7E A;  1V61 A;  3KZ1 A;  4HHV A;  5DI9 B;  3AU5 A;  3ODX A;  4A6F A;  3A98 B;  4ILJ A;  2Q13 A;  2DHJ A;  1V89 A;  2W2W A;  3PSC A;  1GGO A;  2V76 A;  3M1I B;  2YT1 A;  2LYD A;  4DX8 A;  2AEH A;  2I1J A;  4A5K A;  4BBK A;  3O96 A;  4KHO A;  4JKE A;  1X11 A;  3ML4 A;  1MPH A;  2MFQ A;  5DHA B;  3DXD A;  1ISN A;  4MY6 A;  3FM8 C;  2FJ9 A;  4HAZ B;  1J19 A;  5KQ1 A;  1ZSQ A;  1GC6 A;  5KCV A;  3E66 A;  3N7C A;  5C79 A;  3TFM A;  5JHG A;  5JHH A;  3ODW A;  2I1K A;  1JDE A;  2D11 A;  2KCJ A;  3EPY A;  1SGH A;  1U5F A;  5GOW B;  2DFK A;  4WVF B;  3E9L A;  3ODO A;  2MDX A;  2YS1 A;  1LB1 A;  3HW2 B;  3ULB A;  2D10 A;  2CB8 A;  3RCP A;  2X0S A;  1PFJ A;  2ELA A;  1SHC A;  2ROZ B;  3CIK A;  2HRJ A;  3G9W A;  3D8D A;  1WGU A;  2JP2 A;  1XR0 B;  1X86 A;  3P7Z A;  3FSS A;  2D4Q A;  1MIX A;  2R0D A;  1PLS A;  1FGZ A;  2BCJ A;  1MAI A;  5DH9 B;  1M7R A;  1NTY A;  1WJM A;  4JKH A;  4EJN A;  4Z2N A;  1FOE A;  2LKO A;  1VBG A;  2QKM A;  2K2U A;  3PP2 A;  1DDV A;  1DDM A;  1EF1 A;  1TXD A;  2RGN B;  2RVB B;  4Z2M B;  3P6A A;  4L6E A;  3PZD A;  1EAZ A;  5D3X A;  1Q67 A;  5C16 A;  2I5C A;  1DBH A;  1OY2 A;  2DTC A;  2XQN M;  2FDQ A;  5D27 A;  3MDB C;  2H7E A;  1UNP A;  3PG7 A;  3SUZ A;  1I7A A;  1RJ2 A;  1U5G A;  2J0K A;  1MKE A;  2L2I A;  2W2X C;  2YSZ A;  1DYN A;  4B6H A;  2P8V A;  4CYE A;  2HTH B;  2WH5 A;  5J3Q A;  4JKA A;  4TKN A;  4HAW B;  1W1D A;  4CHM A;  2P0F A;  3VOQ A;  1MK9 B;  3LJU X;  3PEG A;  2UZS A;  2K00 A;  1KBL A;  2OTX A;  1H4R A;  3QBV B;  4JKG B;  1FGY A;  2NZ8 B;  1I2H A;  3ZVR A;  2YS5 A;  1WG7 A;  5D3V A;  4KHB B;  2L1C A;  4C0A A;  2DHI A;  1BTN A;  1N3H A;  2YS3 A;  1U29 A;  3PVU A;  4JKB A;  5CLL B;  1KC7 A;  3QWM A;  1FHO A;  2DHK A;  3SV1 A;  1KZG A;  1DRO A;  2EMT A;  3UZT A;  4GMV A;  5D3Y A;  4PNK A;  3ENB A;  4HAY B;  1Y5O A;  1ZM0 A;  5DHF B;  1HBK A;  2VKI A;  4DBB A;  5EFX A;  1NTI A;  3NSU A;  1NU2 A;  5HE1 A;  3F5R A;  3WA0 A;  1XKE A;  3GYO A;  3SBG A;  2COA A;  2FJL A;  3T06 A;  1HB6 A;  4WJ7 A;  1WVH A;  1WGQ A;  2EMS A;  2Z0Q A;  3SO6 A;  4H8S A;  5J3Y A;  4DX9 0;  2CAY A;  1NVL A;  2NMB A;  1OQN A;  3DXE A;  4F7G A;  2LUL A;  1BTK A;  2E2X A;  2GCJ A;  2N23 A;  4F7H A;  4ZRJ A;  3F0W A;  4D0N B;  5J3T A;  3CXB B;  4KAX B;  2YF0 A;  2DA0 A;  4GPT B;  1W1G A;  4HAT B;  1P5T A;  5KQ4 A;  4JK7 A;  1U5E A;  1MIZ B;  2CQU A;  3BJI A;  2DYN A;  3E9O A;  1E5W A;  1BWN A;  2UZR A;  4KVG B;  1GC7 A;  4JK9 A;  4ZRI A;  1ZVR A;  5FI0 A;  4ILG B;  3KRX A;  1XX0 A;  2Y7B A;  2W2X D;  4JKF A;  3KY9 A;  2DKP A;  2CRF A;  4ILH A;  2KUP A;  4Y94 A;  2Z0O A;  2COP A;  1TQZ A;  4K81 A;  2LOZ A;  2IYB A;  4A6K A;  2DKQ A;  1Z87 A;  2R09 A;  1UNR A;  1X1G A;  4PQ0 A;  3BIN A;  1MK7 B;  2PZ1 A;  3VIA A;  4HB0 B;  5JVL A;  1GG3 A;  2RNR B;  5C6R A;  2COC A;  1EGX A;  2N0Y A;  1ACA A;  4GN1 A;  4HAX B;  3SBT A;  5LON B;  2ADZ A;  5HE3 A;  2ELB A;  2GJY A;  1NTV A;  1P3R A;  2M14 A;  3U8Z A;  1EVH A;  3DXC A;  4HDQ A;  2ABD A;  3TO1 A;  1V5M A;  1ZC3 B;  4IAP A;  5C5B A;  2Z0P A;  3E9P A;  2G35 A;  3WYF B;  2YT0 A;  3OAN A;  4HAV B;  1QQG A;  3ULC A;  3MPX A;  3AJ4 A;  1K5G B;  1IRS A;  2DX1 A;  4MK0 A;  3D8E A;  1HB8 A;  1FAO A;  4GZU A;  4HB3 B;  2DLW A;  3PVL A;  2D9V A;  1Y19 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...