3GABA

C-terminal domain of bacillus subtilis mutl crystal form i
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
190
structure length
183
Chain Sequence
b'RVPIMYPIGQMHGTYILAQNENGLYIIDQHAAQERIKYEYFREKVGEPEVQEMIVPLTFHYSTNEALIIEQHKQELESVGVFLESFGSNSYIVRCHPAWFPKGEEAELIEEIIQQVLDSKNIDIKKLREEAAIMMSCKNRHLRNDEIKALLDDLRSTSDPFTCPHGRPIIIHHSTYEMEKMFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA mismatch repair protein mutL
publication title Structure of the endonuclease domain of MutL: unlicensed to cut.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 53
structure length 183
sequence length 190
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08676 MutL_C MutL C terminal dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.20 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3gabA01
3.30.1370.100 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3gabA02
3GABA 1X9ZA 3KDGA 3KDKA 3NCVA 5B42A
chains in the Genus database with same CATH superfamily
1OBYA 4OAJA 4E34A 3EGHC 2L97A 2VSPA 2UUAH 1V1TA 2YQRA 2VPHA 2KV8A 1B8QA 5C0XG 2JE6I 5HFDA 1X0AA 2FCFA 1FCFA 2PKUA 4JORA 1MFLA 2CPQA 4FJSA 2CS5A 3OTPA 4GHNA 1X5RA 2OCSA 5HFBA 1I16A 3J80W 1I94H 2EHRA 2F4VH 1ODHA 1HNZH 1VBIA 1QLCA 4JI1H 2PKTA 4FJUA 2OSGA 4KFVA 3SFJA 1BE9A 1TP5A 4AIMA 4LF9H 1PDRA 5JXBA 2P3WA 4Z33A 2Q3GA 2Z9IA 3OETA 3JAMW 4LF4H 3AEVB 4DR7H 2QBWA 2JVZA 4NZRM 2YTWA 2CSSA 2UXCH 2EEGA 2KOHA 1GM1A 3DJ3A 2KAWA 2G2LA 4OD6A 4JOJA 4LFCH 1N6FA 2K20A 1VIGA 1FC7A 1WFGA 2EEHA 2BA0A 5D13A 4BA2I 3MH6A 5A2PA 2BYGA 4JI0H 1X4MA 2OS6A 3L7ZC 2JILA 3QE1A 1P1DA 1IU2A 3R69A 1QAVB 3GDUA 1FC9A 4B3RH 4JYAH 1U3BA 2JA9A 5E22A 2HGAA 4NMQA 2LUIA 5HFCA 4LIJA 2KPKA 2QT5A 4WALA 4FLNA 2A1SA 2KJPA 4BA1I 4KHPH 4NXNH 2EGKA 1J5KA 2CTFA 4R2ZA 2M8WA 1IHJA 3NCVA 1AN7A 2EJYA 1N99A 3UOEA 2LA8A 2EV8A 1X9ZA 2BL5A 1FKAH 3DIWA 1LCYA 3EGGC 3K50A 4JOPA 2DM8A 2KQFA 4NMOA 4Q2OA 2EDZA 4YY3H 1UM7A 4IFDG 5GNDA 2I04A 1MFGA 2M0TA 3BPUA 1WIFA 2AWUA 1QAUA 2KYLA 3NFLA 3OTOH 4NXMH 2L4SA 2PNTA 4NNMA 2DC2A 4GVCA 4OCHA 1WF8A 1GQ5A 4G69A 3GGEA 4JVYA 1TP3A 2D9IA 1WHDA 2VZ5A 4AM3A 1Y7NA 1V6BA 4Q2QA 5HEBA 2YUYA 3O5NA 1N33H 2IWPA 3MH7A 2KBSA 4H11A 5LMNH 2HE2A 5FB8C 4X62H 1ZZKA 3STJA 1UG8A 4JI5H 2QKUA 2M6QA 1WJLA 1X5NA 3LNXA 4UU5A 1W9OA 4JOHA 2OQSA 2HH2A 4X64H 2I1NA 3GSLA 4LMMA 2ENOA 5HEDA 1GQ4A 1V8CA 2CTEA 4N6XA 5E21A 5HFEA 1N36H 2KJKA 4P0CA 2M10A 4DV2H 3B76A 3QDOA 4JI3H 4E3BA 3CBYA 2CPMA 4GKKH 2Z17A 1X4NA 2M0UA 2O2TA 4OX9H 4X66H 3NFKA 3DJAA 3VQFA 4JOGA 3PV2A 3OSSD 4NZTM 1WI4A 3DJ1A 4DR6H 3O46A 1XZ9A 3CS0A 2DB5A 1V62A 1UEQA 2MHOA 2UU9H 5A2QW 3K82A 4JJ0A 3J81W 4PDBA 4L8NA 3ZRTA 2KL1A 4EC5A 4B3MH 4GKJH 3PS4A 1N7TA 3FY5A 2KRGA 1WE8A 1NF3C 1WVNA 4QMFB 2FE5A 4NMTA 1X45A 4Q6SA 4X65H 1Q7XA 1R6JA 2CSJA 1OBZA 3KZDA 2YT7A 4DV4H 2PZDA 2LF0A 2H2BA 1F0XA 2E3UA 1UEPA 1UFXA 2RCZA 3KDKA 5G1EA 1SOTA 2LTLA 5IT9W 4DV3H 2HHHH 2DLSA 4MPAA 5I7ZA 3TMHA 2JREA 5F3XA 1ZUBA 3CC0A 1X8SA 2VSVA 3I1EA 4DV1H 3KDGA 3WKLA 2EDVA 1U39A 5IWAH 1U38A 2IWQA 3PV5A 4B8TA 1M5ZA 2QKTA 1HR0H 1UITA 2EXGA 2FMRA 3EZJA 1ZZJA 3I18A 2OPUA 2LC7A 2F0AA 2OGPA 2ZPLA 2DLUA 1TUAA 4JJ3A 3MH4A 1NTEA 3V69A 2H3LA 5B6LA 4DR1H 1UEZA 2D8IA 4PQWA 1Z2IA 4JI2H 2EDPA 3SUZA 2QNDA 1DT4A 4E9JA 5HEYA 4DR5H 4JI4H 4Q2NA 4JOEA 2M0ZA 2LOBA 1X6DA 3DORA 2VRFA 4HOPB 5EYZA 1W9EA 4DUZH 3OU0A 3VKEA 3RL8A 1FJGH 2D92A 1K1GA 4WANA 2PA1A 1UJVA 1P1EA 1ZOKA 3QJMA 3K1RA 2UZCA 1WFVA 2VKCA 2HH3A 4NXRA 4OO1G 4DR2H 3WKMA 1KEFA 2QKVA 3LNYA 1S20A 2DGRA 2Z0SA 2EGOA 4OEOA 1XNQH 1VB7A 3RF2A 1XMOH 4B8CD 2DAZA 2PQUA 2KPLA 4HOPA 1XMQH 2IWNA 1HNXH 2PDZA 3E17A 1RZXA 4WYUA 4EDJA 4WYTA 2JEAI 3I0PA 5FHTA 2RRMA 2O4CA 1N34H 1IBMH 4NMRA 2AWXA 4Q6HA 3QO6A 2JINA 4REYA 1WHAA 3AXAA 3QJNA 4JVHA 5DTHA 1V9NA 1VIHA 3GCNA 4RI0A 2DKRA 2ZQEA 2NN6G 1FC6A 2X7ZA 4DV6H 3QGLA 3CBZA 2DMZA 1J5EH 4Q3HA 2QG1A 1EC6A 1TQ3A 4YDPA 2E7KA 4Q2PA 2G8YA 2Y3MA 2UUBH 5E1YA 2JEBI 4KFWA 1IU0A 4DV7H 4K72A 5E6PB 1DTJA 4XHVA 3T1HH 3GDVA 1KHMA 2EEJA 2AINA 3JXTA 1N7FA 1J4WA 1Q3OA 3GJ9A 4NMSA 5HFFA 1OZIA 4LF7H 1HNWH 1D5GA 5FLXW 4AMHA 4B3SH 1BFEA 4F8KA 1Z86A 4JL7A 4OEPA 2K1HA 1TE0A 5H3JA 2VWRA 3CYYA 2H3MA 1WH1A 1N6EA 2EEIA 3GR5A 1ZZIA 4P2AB 1I6UA 2JIKA 3PV4A 2FNEA 1WHRA 2PY9A 2KOMA 2JOAA 1G9OA 5ILBA 4JI6H 1K32A 5B42A 1MC7A 4YYXA 4K0KH 3I4WA 1MSZA 2DJTA 1IBKH 2OPGA 4DR4H 2I4SA 2ZPMA 2PT7G 2ANRA 2V90A 1SEIA 3SHUA 2OMJA 1N7EA 2FFMA 3L4FD 1SOZA 2OPVA 1N32H 2EGNA 2H2CA 3TSZA 3SOEA 3HVQC 4DR3H 2UXBH 2MX6A 2LC6A 3QIKA 3PDZA 3HPMA 4JI8H 2WL7A 1VAEA 4YHHH 1UEWA 1ZTGA 2FN5A 2ZM6H 1VJ6A 1I92A 2E5LH 2HE4A 5GLJA 4K6YA 2V1WA 1Q3PA 3VQGA 5LL6b 1VCWA 2JZXA 2M0VA 1N6DA 1U37A 2UXDH 4JOFA 3TSWA 5HDYA 1NXUA 2I0IA 3KZEA 1RY4A 4DUYH 3ID3A 4DV5H 2G5MB 2VQFH 5JEAG 1UHPA 2GZVA 2CWFA 2X06A 1UM1A 1V5QA 5IL9A 2CTKA 3SB1A 2VQEH 3RLEA 1V5LA 2YT8A 1S03G 1RGWA 5G1DA 3SHWA 4LF6H 5HF4A 3FAUA 1WI2A 2JXOA 2W4FA 2LTMA 3HPKA 3ID4A 4B3TH 1UJUA 2R4HA 3GCOA 3TSVA 1WTJA 3CH8A 2ANNA 3CBXA 4NMPA 2I6VA 4LF8H 3PDVA 4K75A 2M3MA 3GABA 5LMUH 2AXYA 1UJDA 1L6OA 1Z87A 2D90A 2KA9A 2FPHX 2K1ZA 3J7AK 1QAVA 2CTMA 3ID1A 4JI7H 2MJHA 2I0LA 3R0HA 4LFBH 2YUBA 4JOKA 1KWAA 4LF5H 3NGHA 4NMVA 4E35A 1OBXA 1VA8A 3GDSA 2GEFA 5HETA 1RGRA 2AWWA 1Y8TA 3GKUA 5K36G 5EZ0A 4NNLA 2CWHA 3QD7X 1WF7A 2OZFA 1XNRH 4GVDA 3U1KA 4JV5H 4LFAH 1KY9A 4NXQA 2JWEA 2REYA 4G08A 1UF1A 2CTLA 2F5YA 1X5QA 4NXPA 4FGMA 5HF1A 2CTJA 2P2RA 2KJDA 4H8AA 1XRHA 4IC6A 1WG6A 1YBOA 1T2MA 3R68A 1IBLH 4K78A 5BR8H 1W9QA 3ID2A 3KHFA 4NBQA 2IWOA 2KOJA 3RL7A 4DV0H 2LRRA 5E11A 2KG2A 4UU6A 2EAQA 2Q9VA 4Z8JA 2JSNA 2L4TA 5F67A 5HJ1A 1PQXA 2W7RA 2R3YA 2UUCH 3T1YH 4K76A 4AQYH 5DT9A 4O06A
chains in the Genus database with same CATH topology
1OBYA 4OAJA 4E34A 3EGHC 2L97A 2VSPA 2UUAH 1V1TA 2VPHA 2KV8A 1B8QA 5HFDA 2FCFA 1FCFA 2PKUA 4JORA 1MFLA 2CS5A 3OTPA 4GHNA 1X5RA 2OCSA 5HFBA 1I16A 3J80W 1I94H 2EHRA 2F4VH 1ODHA 1HNZH 1QLCA 4JI1H 2PKTA 2OSGA 4KFVA 3SFJA 1BE9A 1TP5A 4LF9H 1PDRA 5JXBA 2P3WA 4Z33A 2Q3GA 2Z9IA 3OETA 3JAMW 4LF4H 4DR7H 2QBWA 4NZRM 2YTWA 2CSSA 2UXCH 2EEGA 2KOHA 1GM1A 3DJ3A 2KAWA 2G2LA 4OD6A 4JOJA 4LFCH 1N6FA 2K20A 1FC7A 1WFGA 2EEHA 5D13A 3MH6A 5A2PA 2BYGA 4JI0H 2OS6A 2JILA 3QE1A 1P1DA 1IU2A 3R69A 1QAVB 3GDUA 1FC9A 4B3RH 4JYAH 1U3BA 5E22A 2HGAA 4NMQA 2LUIA 5HFCA 2KPKA 2QT5A 4FLNA 2KJPA 4KHPH 4NXNH 2EGKA 4R2ZA 1IHJA 3NCVA 1AN7A 2EJYA 1N99A 2LA8A 2EV8A 1X9ZA 1FKAH 3DIWA 1LCYA 3EGGC 3K50A 4JOPA 2DM8A 2KQFA 4NMOA 4Q2OA 2EDZA 4YY3H 1UM7A 5GNDA 2I04A 1MFGA 2M0TA 3BPUA 1WIFA 2AWUA 1QAUA 2KYLA 3NFLA 3OTOH 4NXMH 2L4SA 2PNTA 4NNMA 2DC2A 4GVCA 4OCHA 1WF8A 1GQ5A 4G69A 3GGEA 1TP3A 2D9IA 1WHDA 2VZ5A 1Y7NA 1V6BA 4Q2QA 5HEBA 2YUYA 3O5NA 1N33H 2IWPA 3MH7A 2KBSA 4H11A 5LMNH 2HE2A 5FB8C 4X62H 3STJA 4JI5H 2QKUA 1WJLA 1X5NA 3LNXA 4UU5A 1W9OA 4JOHA 2OQSA 4X64H 2I1NA 3GSLA 4LMMA 2ENOA 5HEDA 1GQ4A 4N6XA 5E21A 5HFEA 1N36H 2KJKA 4P0CA 2M10A 4DV2H 3B76A 3QDOA 4JI3H 4E3BA 3CBYA 4GKKH 2Z17A 2M0UA 2O2TA 4OX9H 4X66H 3NFKA 3DJAA 3VQFA 4JOGA 3PV2A 3OSSD 4NZTM 1WI4A 3DJ1A 4DR6H 3O46A 1XZ9A 3CS0A 2DB5A 1V62A 1UEQA 2MHOA 2UU9H 5A2QW 3K82A 4JJ0A 3J81W 4PDBA 4L8NA 3ZRTA 2KL1A 4EC5A 4B3MH 4GKJH 3PS4A 1N7TA 3FY5A 2KRGA 1NF3C 2FE5A 4NMTA 1X45A 4Q6SA 4X65H 1Q7XA 1R6JA 2CSJA 1OBZA 3KZDA 2YT7A 4DV4H 2PZDA 2LF0A 2H2BA 1F0XA 1UEPA 1UFXA 2RCZA 3KDKA 5G1EA 1SOTA 5IT9W 4DV3H 2HHHH 2DLSA 4MPAA 5I7ZA 3TMHA 2JREA 5F3XA 1ZUBA 3CC0A 1X8SA 2VSVA 3I1EA 4DV1H 3KDGA 3WKLA 2EDVA 1U39A 5IWAH 1U38A 2IWQA 3PV5A 1M5ZA 2QKTA 1HR0H 1UITA 2EXGA 3EZJA 3I18A 2LC7A 2F0AA 2OGPA 2ZPLA 2DLUA 4JJ3A 3MH4A 1NTEA 2H3LA 5B6LA 4DR1H 1UEZA 2D8IA 4PQWA 4JI2H 2EDPA 3SUZA 4E9JA 5HEYA 4DR5H 4JI4H 4Q2NA 4JOEA 2M0ZA 2LOBA 1X6DA 3DORA 2VRFA 4HOPB 5EYZA 1W9EA 4DUZH 3OU0A 3RL8A 1FJGH 2D92A 2PA1A 1UJVA 1P1EA 1ZOKA 3QJMA 3K1RA 2UZCA 1WFVA 2VKCA 4NXRA 4DR2H 3WKMA 1KEFA 2QKVA 3LNYA 1XNQH 2EGOA 4OEOA 1VB7A 3RF2A 1XMOH 4B8CD 2DAZA 2KPLA 4HOPA 1XMQH 2IWNA 1HNXH 2PDZA 3E17A 1RZXA 4WYUA 4EDJA 4WYTA 5FHTA 2RRMA 2O4CA 1N34H 1IBMH 4NMRA 2AWXA 4Q6HA 3QO6A 2JINA 4REYA 1WHAA 3AXAA 3QJNA 5DTHA 3GCNA 4RI0A 2DKRA 2ZQEA 1FC6A 2X7ZA 4DV6H 3QGLA 3CBZA 2DMZA 1J5EH 4Q3HA 2QG1A 1TQ3A 4YDPA 2E7KA 4Q2PA 2Y3MA 2UUBH 5E1YA 4KFWA 1IU0A 4DV7H 4K72A 5E6PB 4XHVA 3T1HH 3GDVA 2EEJA 2AINA 3JXTA 1N7FA 1Q3OA 3GJ9A 4NMSA 5HFFA 1OZIA 4LF7H 1HNWH 1D5GA 5FLXW 4AMHA 4B3SH 1BFEA 4F8KA 1Z86A 4JL7A 4OEPA 1TE0A 5H3JA 2VWRA 3CYYA 2H3MA 1WH1A 1N6EA 2EEIA 3GR5A 4P2AB 1I6UA 2JIKA 3PV4A 2FNEA 2KOMA 2JOAA 1G9OA 5ILBA 4JI6H 1K32A 5B42A 1MC7A 4YYXA 4K0KH 3I4WA 2DJTA 1IBKH 2OPGA 4DR4H 2I4SA 2ZPMA 2PT7G 2V90A 1SEIA 3SHUA 2OMJA 1N7EA 3L4FD 1SOZA 1N32H 2EGNA 2H2CA 3TSZA 3SOEA 3HVQC 4DR3H 2UXBH 2MX6A 2LC6A 3QIKA 3PDZA 3HPMA 4JI8H 2WL7A 1VAEA 4YHHH 1UEWA 2FN5A 2ZM6H 1VJ6A 1I92A 2E5LH 2HE4A 5GLJA 4K6YA 2V1WA 1Q3PA 3VQGA 5LL6b 1VCWA 2M0VA 1N6DA 1U37A 2UXDH 4JOFA 3TSWA 5HDYA 2I0IA 3KZEA 1RY4A 4DUYH 3ID3A 4DV5H 2G5MB 2VQFH 1UHPA 2GZVA 1UM1A 1V5QA 5IL9A 3SB1A 2VQEH 3RLEA 1V5LA 2YT8A 1S03G 1RGWA 5G1DA 3SHWA 4LF6H 5HF4A 3FAUA 1WI2A 2JXOA 2W4FA 3HPKA 3ID4A 4B3TH 1UJUA 2R4HA 3GCOA 3TSVA 3CH8A 3CBXA 4NMPA 2I6VA 4LF8H 3PDVA 4K75A 2M3MA 3GABA 5LMUH 1UJDA 1L6OA 1Z87A 2D90A 2KA9A 2FPHX 2K1ZA 3J7AK 1QAVA 3ID1A 4JI7H 2I0LA 3R0HA 4LFBH 2YUBA 4JOKA 1KWAA 4LF5H 3NGHA 4NMVA 4E35A 1OBXA 1VA8A 3GDSA 2GEFA 5HETA 1RGRA 2AWWA 1Y8TA 5EZ0A 4NNLA 3QD7X 1WF7A 2OZFA 1XNRH 4GVDA 4JV5H 4LFAH 1KY9A 4NXQA 2JWEA 2REYA 4G08A 1UF1A 2F5YA 1X5QA 4NXPA 4FGMA 5HF1A 2KJDA 4IC6A 1WG6A 1YBOA 1T2MA 3R68A 1IBLH 4K78A 5BR8H 1W9QA 3ID2A 3KHFA 2IWOA 2KOJA 3RL7A 4DV0H 5E11A 2KG2A 4UU6A 2EAQA 2Q9VA 4Z8JA 2JSNA 2L4TA 5F67A 5HJ1A 2W7RA 2R3YA 2UUCH 3T1YH 4K76A 4AQYH 5DT9A 4O06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GAB A;  1X9Z A;  3KDG A;  3KDK A;  3NCV A;  5B42 A; 
#chains in the Genus database with same CATH topology
 1OBY A;  4OAJ A;  4E34 A;  3EGH C;  2L97 A;  2VSP A;  2UUA H;  1V1T A;  2YQR A;  2VPH A;  2KV8 A;  1B8Q A;  5C0X G;  2JE6 I;  5HFD A;  1X0A A;  2FCF A;  1FCF A;  2PKU A;  4JOR A;  1MFL A;  2CPQ A;  4FJS A;  2CS5 A;  3OTP A;  4GHN A;  1X5R A;  2OCS A;  5HFB A;  1I16 A;  3J80 W;  1I94 H;  2EHR A;  2F4V H;  1ODH A;  1HNZ H;  1VBI A;  1QLC A;  4JI1 H;  2PKT A;  4FJU A;  2OSG A;  4KFV A;  3SFJ A;  1BE9 A;  1TP5 A;  4AIM A;  4LF9 H;  1PDR A;  5JXB A;  2P3W A;  4Z33 A;  2Q3G A;  2Z9I A;  3OET A;  3JAM W;  4LF4 H;  3AEV B;  4DR7 H;  2QBW A;  2JVZ A;  4NZR M;  2YTW A;  2CSS A;  2UXC H;  2EEG A;  2KOH A;  1GM1 A;  3DJ3 A;  2KAW A;  2G2L A;  4OD6 A;  4JOJ A;  4LFC H;  1N6F A;  2K20 A;  1VIG A;  1FC7 A;  1WFG A;  2EEH A;  2BA0 A;  5D13 A;  4BA2 I;  3MH6 A;  5A2P A;  2BYG A;  4JI0 H;  1X4M A;  2OS6 A;  3L7Z C;  2JIL A;  3QE1 A;  1P1D A;  1IU2 A;  3R69 A;  1QAV B;  3GDU A;  1FC9 A;  4B3R H;  4JYA H;  1U3B A;  2JA9 A;  5E22 A;  2HGA A;  4NMQ A;  2LUI A;  5HFC A;  4LIJ A;  2KPK A;  2QT5 A;  4WAL A;  4FLN A;  2A1S A;  2KJP A;  4BA1 I;  4KHP H;  4NXN H;  2EGK A;  1J5K A;  2CTF A;  4R2Z A;  2M8W A;  1IHJ A;  3NCV A;  1AN7 A;  2EJY A;  1N99 A;  3UOE A;  2LA8 A;  2EV8 A;  1X9Z A;  2BL5 A;  1FKA H;  3DIW A;  1LCY A;  3EGG C;  3K50 A;  4JOP A;  2DM8 A;  2KQF A;  4NMO A;  4Q2O A;  2EDZ A;  4YY3 H;  1UM7 A;  4IFD G;  5GND A;  2I04 A;  1MFG A;  2M0T A;  3BPU A;  1WIF A;  2AWU A;  1QAU A;  2KYL A;  3NFL A;  3OTO H;  4NXM H;  2L4S A;  2PNT A;  4NNM A;  2DC2 A;  4GVC A;  4OCH A;  1WF8 A;  1GQ5 A;  4G69 A;  3GGE A;  4JVY A;  1TP3 A;  2D9I A;  1WHD A;  2VZ5 A;  4AM3 A;  1Y7N A;  1V6B A;  4Q2Q A;  5HEB A;  2YUY A;  3O5N A;  1N33 H;  2IWP A;  3MH7 A;  2KBS A;  4H11 A;  5LMN H;  2HE2 A;  5FB8 C;  4X62 H;  1ZZK A;  3STJ A;  1UG8 A;  4JI5 H;  2QKU A;  2M6Q A;  1WJL A;  1X5N A;  3LNX A;  4UU5 A;  1W9O A;  4JOH A;  2OQS A;  2HH2 A;  4X64 H;  2I1N A;  3GSL A;  4LMM A;  2ENO A;  5HED A;  1GQ4 A;  1V8C A;  2CTE A;  4N6X A;  5E21 A;  5HFE A;  1N36 H;  2KJK A;  4P0C A;  2M10 A;  4DV2 H;  3B76 A;  3QDO A;  4JI3 H;  4E3B A;  3CBY A;  2CPM A;  4GKK H;  2Z17 A;  1X4N A;  2M0U A;  2O2T A;  4OX9 H;  4X66 H;  3NFK A;  3DJA A;  3VQF A;  4JOG A;  3PV2 A;  3OSS D;  4NZT M;  1WI4 A;  3DJ1 A;  4DR6 H;  3O46 A;  1XZ9 A;  3CS0 A;  2DB5 A;  1V62 A;  1UEQ A;  2MHO A;  2UU9 H;  5A2Q W;  3K82 A;  4JJ0 A;  3J81 W;  4PDB A;  4L8N A;  3ZRT A;  2KL1 A;  4EC5 A;  4B3M H;  4GKJ H;  3PS4 A;  1N7T A;  3FY5 A;  2KRG A;  1WE8 A;  1NF3 C;  1WVN A;  4QMF B;  2FE5 A;  4NMT A;  1X45 A;  4Q6S A;  4X65 H;  1Q7X A;  1R6J A;  2CSJ A;  1OBZ A;  3KZD A;  2YT7 A;  4DV4 H;  2PZD A;  2LF0 A;  2H2B A;  1F0X A;  2E3U A;  1UEP A;  1UFX A;  2RCZ A;  3KDK A;  5G1E A;  1SOT A;  2LTL A;  5IT9 W;  4DV3 H;  2HHH H;  2DLS A;  4MPA A;  5I7Z A;  3TMH A;  2JRE A;  5F3X A;  1ZUB A;  3CC0 A;  1X8S A;  2VSV A;  3I1E A;  4DV1 H;  3KDG A;  3WKL A;  2EDV A;  1U39 A;  5IWA H;  1U38 A;  2IWQ A;  3PV5 A;  4B8T A;  1M5Z A;  2QKT A;  1HR0 H;  1UIT A;  2EXG A;  2FMR A;  3EZJ A;  1ZZJ A;  3I18 A;  2OPU A;  2LC7 A;  2F0A A;  2OGP A;  2ZPL A;  2DLU A;  1TUA A;  4JJ3 A;  3MH4 A;  1NTE A;  3V69 A;  2H3L A;  5B6L A;  4DR1 H;  1UEZ A;  2D8I A;  4PQW A;  1Z2I A;  4JI2 H;  2EDP A;  3SUZ A;  2QND A;  1DT4 A;  4E9J A;  5HEY A;  4DR5 H;  4JI4 H;  4Q2N A;  4JOE A;  2M0Z A;  2LOB A;  1X6D A;  3DOR A;  2VRF A;  4HOP B;  5EYZ A;  1W9E A;  4DUZ H;  3OU0 A;  3VKE A;  3RL8 A;  1FJG H;  2D92 A;  1K1G A;  4WAN A;  2PA1 A;  1UJV A;  1P1E A;  1ZOK A;  3QJM A;  3K1R A;  2UZC A;  1WFV A;  2VKC A;  2HH3 A;  4NXR A;  4OO1 G;  4DR2 H;  3WKM A;  1KEF A;  2QKV A;  3LNY A;  1S20 A;  2DGR A;  2Z0S A;  2EGO A;  4OEO A;  1XNQ H;  1VB7 A;  3RF2 A;  1XMO H;  4B8C D;  2DAZ A;  2PQU A;  2KPL A;  4HOP A;  1XMQ H;  2IWN A;  1HNX H;  2PDZ A;  3E17 A;  1RZX A;  4WYU A;  4EDJ A;  4WYT A;  2JEA I;  3I0P A;  5FHT A;  2RRM A;  2O4C A;  1N34 H;  1IBM H;  4NMR A;  2AWX A;  4Q6H A;  3QO6 A;  2JIN A;  4REY A;  1WHA A;  3AXA A;  3QJN A;  4JVH A;  5DTH A;  1V9N A;  1VIH A;  3GCN A;  4RI0 A;  2DKR A;  2ZQE A;  2NN6 G;  1FC6 A;  2X7Z A;  4DV6 H;  3QGL A;  3CBZ A;  2DMZ A;  1J5E H;  4Q3H A;  2QG1 A;  1EC6 A;  1TQ3 A;  4YDP A;  2E7K A;  4Q2P A;  2G8Y A;  2Y3M A;  2UUB H;  5E1Y A;  2JEB I;  4KFW A;  1IU0 A;  4DV7 H;  4K72 A;  5E6P B;  1DTJ A;  4XHV A;  3T1H H;  3GDV A;  1KHM A;  2EEJ A;  2AIN A;  3JXT A;  1N7F A;  1J4W A;  1Q3O A;  3GJ9 A;  4NMS A;  5HFF A;  1OZI A;  4LF7 H;  1HNW H;  1D5G A;  5FLX W;  4AMH A;  4B3S H;  1BFE A;  4F8K A;  1Z86 A;  4JL7 A;  4OEP A;  2K1H A;  1TE0 A;  5H3J A;  2VWR A;  3CYY A;  2H3M A;  1WH1 A;  1N6E A;  2EEI A;  3GR5 A;  1ZZI A;  4P2A B;  1I6U A;  2JIK A;  3PV4 A;  2FNE A;  1WHR A;  2PY9 A;  2KOM A;  2JOA A;  1G9O A;  5ILB A;  4JI6 H;  1K32 A;  5B42 A;  1MC7 A;  4YYX A;  4K0K H;  3I4W A;  1MSZ A;  2DJT A;  1IBK H;  2OPG A;  4DR4 H;  2I4S A;  2ZPM A;  2PT7 G;  2ANR A;  2V90 A;  1SEI A;  3SHU A;  2OMJ A;  1N7E A;  2FFM A;  3L4F D;  1SOZ A;  2OPV A;  1N32 H;  2EGN A;  2H2C A;  3TSZ A;  3SOE A;  3HVQ C;  4DR3 H;  2UXB H;  2MX6 A;  2LC6 A;  3QIK A;  3PDZ A;  3HPM A;  4JI8 H;  2WL7 A;  1VAE A;  4YHH H;  1UEW A;  1ZTG A;  2FN5 A;  2ZM6 H;  1VJ6 A;  1I92 A;  2E5L H;  2HE4 A;  5GLJ A;  4K6Y A;  2V1W A;  1Q3P A;  3VQG A;  5LL6 b;  1VCW A;  2JZX A;  2M0V A;  1N6D A;  1U37 A;  2UXD H;  4JOF A;  3TSW A;  5HDY A;  1NXU A;  2I0I A;  3KZE A;  1RY4 A;  4DUY H;  3ID3 A;  4DV5 H;  2G5M B;  2VQF H;  5JEA G;  1UHP A;  2GZV A;  2CWF A;  2X06 A;  1UM1 A;  1V5Q A;  5IL9 A;  2CTK A;  3SB1 A;  2VQE H;  3RLE A;  1V5L A;  2YT8 A;  1S03 G;  1RGW A;  5G1D A;  3SHW A;  4LF6 H;  5HF4 A;  3FAU A;  1WI2 A;  2JXO A;  2W4F A;  2LTM A;  3HPK A;  3ID4 A;  4B3T H;  1UJU A;  2R4H A;  3GCO A;  3TSV A;  1WTJ A;  3CH8 A;  2ANN A;  3CBX A;  4NMP A;  2I6V A;  4LF8 H;  3PDV A;  4K75 A;  2M3M A;  3GAB A;  5LMU H;  2AXY A;  1UJD A;  1L6O A;  1Z87 A;  2D90 A;  2KA9 A;  2FPH X;  2K1Z A;  3J7A K;  1QAV A;  2CTM A;  3ID1 A;  4JI7 H;  2MJH A;  2I0L A;  3R0H A;  4LFB H;  2YUB A;  4JOK A;  1KWA A;  4LF5 H;  3NGH A;  4NMV A;  4E35 A;  1OBX A;  1VA8 A;  3GDS A;  2GEF A;  5HET A;  1RGR A;  2AWW A;  1Y8T A;  3GKU A;  5K36 G;  5EZ0 A;  4NNL A;  2CWH A;  3QD7 X;  1WF7 A;  2OZF A;  1XNR H;  4GVD A;  3U1K A;  4JV5 H;  4LFA H;  1KY9 A;  4NXQ A;  2JWE A;  2REY A;  4G08 A;  1UF1 A;  2CTL A;  2F5Y A;  1X5Q A;  4NXP A;  4FGM A;  5HF1 A;  2CTJ A;  2P2R A;  2KJD A;  4H8A A;  1XRH A;  4IC6 A;  1WG6 A;  1YBO A;  1T2M A;  3R68 A;  1IBL H;  4K78 A;  5BR8 H;  1W9Q A;  3ID2 A;  3KHF A;  4NBQ A;  2IWO A;  2KOJ A;  3RL7 A;  4DV0 H;  2LRR A;  5E11 A;  2KG2 A;  4UU6 A;  2EAQ A;  2Q9V A;  4Z8J A;  2JSN A;  2L4T A;  5F67 A;  5HJ1 A;  1PQX A;  2W7R A;  2R3Y A;  2UUC H;  3T1Y H;  4K76 A;  4AQY H;  5DT9 A;  4O06 A; 
#chains in the Genus database with same CATH homology
 1OBY A;  4OAJ A;  4E34 A;  3EGH C;  2L97 A;  2VSP A;  2UUA H;  1V1T A;  2VPH A;  2KV8 A;  1B8Q A;  5HFD A;  2FCF A;  1FCF A;  2PKU A;  4JOR A;  1MFL A;  2CS5 A;  3OTP A;  4GHN A;  1X5R A;  2OCS A;  5HFB A;  1I16 A;  3J80 W;  1I94 H;  2EHR A;  2F4V H;  1ODH A;  1HNZ H;  1QLC A;  4JI1 H;  2PKT A;  2OSG A;  4KFV A;  3SFJ A;  1BE9 A;  1TP5 A;  4LF9 H;  1PDR A;  5JXB A;  2P3W A;  4Z33 A;  2Q3G A;  2Z9I A;  3OET A;  3JAM W;  4LF4 H;  4DR7 H;  2QBW A;  4NZR M;  2YTW A;  2CSS A;  2UXC H;  2EEG A;  2KOH A;  1GM1 A;  3DJ3 A;  2KAW A;  2G2L A;  4OD6 A;  4JOJ A;  4LFC H;  1N6F A;  2K20 A;  1FC7 A;  1WFG A;  2EEH A;  5D13 A;  3MH6 A;  5A2P A;  2BYG A;  4JI0 H;  2OS6 A;  2JIL A;  3QE1 A;  1P1D A;  1IU2 A;  3R69 A;  1QAV B;  3GDU A;  1FC9 A;  4B3R H;  4JYA H;  1U3B A;  5E22 A;  2HGA A;  4NMQ A;  2LUI A;  5HFC A;  2KPK A;  2QT5 A;  4FLN A;  2KJP A;  4KHP H;  4NXN H;  2EGK A;  4R2Z A;  1IHJ A;  3NCV A;  1AN7 A;  2EJY A;  1N99 A;  2LA8 A;  2EV8 A;  1X9Z A;  1FKA H;  3DIW A;  1LCY A;  3EGG C;  3K50 A;  4JOP A;  2DM8 A;  2KQF A;  4NMO A;  4Q2O A;  2EDZ A;  4YY3 H;  1UM7 A;  5GND A;  2I04 A;  1MFG A;  2M0T A;  3BPU A;  1WIF A;  2AWU A;  1QAU A;  2KYL A;  3NFL A;  3OTO H;  4NXM H;  2L4S A;  2PNT A;  4NNM A;  2DC2 A;  4GVC A;  4OCH A;  1WF8 A;  1GQ5 A;  4G69 A;  3GGE A;  1TP3 A;  2D9I A;  1WHD A;  2VZ5 A;  1Y7N A;  1V6B A;  4Q2Q A;  5HEB A;  2YUY A;  3O5N A;  1N33 H;  2IWP A;  3MH7 A;  2KBS A;  4H11 A;  5LMN H;  2HE2 A;  5FB8 C;  4X62 H;  3STJ A;  4JI5 H;  2QKU A;  1WJL A;  1X5N A;  3LNX A;  4UU5 A;  1W9O A;  4JOH A;  2OQS A;  4X64 H;  2I1N A;  3GSL A;  4LMM A;  2ENO A;  5HED A;  1GQ4 A;  4N6X A;  5E21 A;  5HFE A;  1N36 H;  2KJK A;  4P0C A;  2M10 A;  4DV2 H;  3B76 A;  3QDO A;  4JI3 H;  4E3B A;  3CBY A;  4GKK H;  2Z17 A;  2M0U A;  2O2T A;  4OX9 H;  4X66 H;  3NFK A;  3DJA A;  3VQF A;  4JOG A;  3PV2 A;  3OSS D;  4NZT M;  1WI4 A;  3DJ1 A;  4DR6 H;  3O46 A;  1XZ9 A;  3CS0 A;  2DB5 A;  1V62 A;  1UEQ A;  2MHO A;  2UU9 H;  5A2Q W;  3K82 A;  4JJ0 A;  3J81 W;  4PDB A;  4L8N A;  3ZRT A;  2KL1 A;  4EC5 A;  4B3M H;  4GKJ H;  3PS4 A;  1N7T A;  3FY5 A;  2KRG A;  1NF3 C;  2FE5 A;  4NMT A;  1X45 A;  4Q6S A;  4X65 H;  1Q7X A;  1R6J A;  2CSJ A;  1OBZ A;  3KZD A;  2YT7 A;  4DV4 H;  2PZD A;  2LF0 A;  2H2B A;  1F0X A;  1UEP A;  1UFX A;  2RCZ A;  3KDK A;  5G1E A;  1SOT A;  5IT9 W;  4DV3 H;  2HHH H;  2DLS A;  4MPA A;  5I7Z A;  3TMH A;  2JRE A;  5F3X A;  1ZUB A;  3CC0 A;  1X8S A;  2VSV A;  3I1E A;  4DV1 H;  3KDG A;  3WKL A;  2EDV A;  1U39 A;  5IWA H;  1U38 A;  2IWQ A;  3PV5 A;  1M5Z A;  2QKT A;  1HR0 H;  1UIT A;  2EXG A;  3EZJ A;  3I18 A;  2LC7 A;  2F0A A;  2OGP A;  2ZPL A;  2DLU A;  4JJ3 A;  3MH4 A;  1NTE A;  2H3L A;  5B6L A;  4DR1 H;  1UEZ A;  2D8I A;  4PQW A;  4JI2 H;  2EDP A;  3SUZ A;  4E9J A;  5HEY A;  4DR5 H;  4JI4 H;  4Q2N A;  4JOE A;  2M0Z A;  2LOB A;  1X6D A;  3DOR A;  2VRF A;  4HOP B;  5EYZ A;  1W9E A;  4DUZ H;  3OU0 A;  3RL8 A;  1FJG H;  2D92 A;  2PA1 A;  1UJV A;  1P1E A;  1ZOK A;  3QJM A;  3K1R A;  2UZC A;  1WFV A;  2VKC A;  4NXR A;  4DR2 H;  3WKM A;  1KEF A;  2QKV A;  3LNY A;  1XNQ H;  2EGO A;  4OEO A;  1VB7 A;  3RF2 A;  1XMO H;  4B8C D;  2DAZ A;  2KPL A;  4HOP A;  1XMQ H;  2IWN A;  1HNX H;  2PDZ A;  3E17 A;  1RZX A;  4WYU A;  4EDJ A;  4WYT A;  5FHT A;  2RRM A;  2O4C A;  1N34 H;  1IBM H;  4NMR A;  2AWX A;  4Q6H A;  3QO6 A;  2JIN A;  4REY A;  1WHA A;  3AXA A;  3QJN A;  5DTH A;  3GCN A;  4RI0 A;  2DKR A;  2ZQE A;  1FC6 A;  2X7Z A;  4DV6 H;  3QGL A;  3CBZ A;  2DMZ A;  1J5E H;  4Q3H A;  2QG1 A;  1TQ3 A;  4YDP A;  2E7K A;  4Q2P A;  2Y3M A;  2UUB H;  5E1Y A;  4KFW A;  1IU0 A;  4DV7 H;  4K72 A;  5E6P B;  4XHV A;  3T1H H;  3GDV A;  2EEJ A;  2AIN A;  3JXT A;  1N7F A;  1Q3O A;  3GJ9 A;  4NMS A;  5HFF A;  1OZI A;  4LF7 H;  1HNW H;  1D5G A;  5FLX W;  4AMH A;  4B3S H;  1BFE A;  4F8K A;  1Z86 A;  4JL7 A;  4OEP A;  1TE0 A;  5H3J A;  2VWR A;  3CYY A;  2H3M A;  1WH1 A;  1N6E A;  2EEI A;  3GR5 A;  4P2A B;  1I6U A;  2JIK A;  3PV4 A;  2FNE A;  2KOM A;  2JOA A;  1G9O A;  5ILB A;  4JI6 H;  1K32 A;  5B42 A;  1MC7 A;  4YYX A;  4K0K H;  3I4W A;  2DJT A;  1IBK H;  2OPG A;  4DR4 H;  2I4S A;  2ZPM A;  2PT7 G;  2V90 A;  1SEI A;  3SHU A;  2OMJ A;  1N7E A;  3L4F D;  1SOZ A;  1N32 H;  2EGN A;  2H2C A;  3TSZ A;  3SOE A;  3HVQ C;  4DR3 H;  2UXB H;  2MX6 A;  2LC6 A;  3QIK A;  3PDZ A;  3HPM A;  4JI8 H;  2WL7 A;  1VAE A;  4YHH H;  1UEW A;  2FN5 A;  2ZM6 H;  1VJ6 A;  1I92 A;  2E5L H;  2HE4 A;  5GLJ A;  4K6Y A;  2V1W A;  1Q3P A;  3VQG A;  5LL6 b;  1VCW A;  2M0V A;  1N6D A;  1U37 A;  2UXD H;  4JOF A;  3TSW A;  5HDY A;  2I0I A;  3KZE A;  1RY4 A;  4DUY H;  3ID3 A;  4DV5 H;  2G5M B;  2VQF H;  1UHP A;  2GZV A;  1UM1 A;  1V5Q A;  5IL9 A;  3SB1 A;  2VQE H;  3RLE A;  1V5L A;  2YT8 A;  1S03 G;  1RGW A;  5G1D A;  3SHW A;  4LF6 H;  5HF4 A;  3FAU A;  1WI2 A;  2JXO A;  2W4F A;  3HPK A;  3ID4 A;  4B3T H;  1UJU A;  2R4H A;  3GCO A;  3TSV A;  3CH8 A;  3CBX A;  4NMP A;  2I6V A;  4LF8 H;  3PDV A;  4K75 A;  2M3M A;  3GAB A;  5LMU H;  1UJD A;  1L6O A;  1Z87 A;  2D90 A;  2KA9 A;  2FPH X;  2K1Z A;  3J7A K;  1QAV A;  3ID1 A;  4JI7 H;  2I0L A;  3R0H A;  4LFB H;  2YUB A;  4JOK A;  1KWA A;  4LF5 H;  3NGH A;  4NMV A;  4E35 A;  1OBX A;  1VA8 A;  3GDS A;  2GEF A;  5HET A;  1RGR A;  2AWW A;  1Y8T A;  5EZ0 A;  4NNL A;  3QD7 X;  1WF7 A;  2OZF A;  1XNR H;  4GVD A;  4JV5 H;  4LFA H;  1KY9 A;  4NXQ A;  2JWE A;  2REY A;  4G08 A;  1UF1 A;  2F5Y A;  1X5Q A;  4NXP A;  4FGM A;  5HF1 A;  2KJD A;  4IC6 A;  1WG6 A;  1YBO A;  1T2M A;  3R68 A;  1IBL H;  4K78 A;  5BR8 H;  1W9Q A;  3ID2 A;  3KHF A;  2IWO A;  2KOJ A;  3RL7 A;  4DV0 H;  5E11 A;  2KG2 A;  4UU6 A;  2EAQ A;  2Q9V A;  4Z8J A;  2JSN A;  2L4T A;  5F67 A;  5HJ1 A;  2W7R A;  2R3Y A;  2UUC H;  3T1Y H;  4K76 A;  4AQY H;  5DT9 A;  4O06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...