3GABA

C-terminal domain of bacillus subtilis mutl crystal form i
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
190
structure length
183
Chain Sequence
RVPIMYPIGQMHGTYILAQNENGLYIIDQHAAQERIKYEYFREKVGEPEVQEMIVPLTFHYSTNEALIIEQHKQELESVGVFLESFGSNSYIVRCHPAWFPKGEEAELIEEIIQQVLDSKNIDIKKLREEAAIMMSCKNRHLRNDEIKALLDDLRSTSDPFTCPHGRPIIIHHSTYEMEKMFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA mismatch repair protein mutL
publication title Structure of the endonuclease domain of MutL: unlicensed to cut.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 53
structure length 183
sequence length 190
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08676 MutL_C MutL C terminal dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.20 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3gabA01
3.30.1370.100 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3gabA02
3KDKA 5B42A 3KDGA 3NCVA 1X9ZA 3GABA
chains in the Genus database with same CATH superfamily
4DR4H 2OGPA 4JOKA 3CBZA 5FHTA 4NMPA 1WTJA 3OTOH 2PA1A 5LL6b 4WALA 1DTJA 3O5NA 1V6BA 2UZCA 1XRHA 4FLNA 2EEHA 2FPHX 2PKUA 1J4WA 4AM3A 4Q6HA 3U1KA 1XZ9A 1VIHA 4DUZH 3T1HH 1ZZIA 1IBMH 4DV7H 4L8NA 4OAJA 1RY4A 4FJSA 1FJGH 4K76A 4Z8JA 4H11A 1U39A 3R0HA 4NZRM 5E1YA 1WHDA 2FE5A 4DR6H 4E3BA 1QAVA 4EC5A 2O4CA 2YQRA 2D90A 2DMZA 3SHUA 4K72A 4KHPH 2PDZA 1RZXA 1Y7NA 1N6DA 2LRRA 4DV0H 3I1EA 3GCNA 2JZXA 3QD7X 4Z33A 1B8QA 3DJ3A 4GKKH 2H2BA 2V90A 2ZQEA 1BE9A 5A2QW 1N36H 5E21A 4DV1H 1YBOA 1UM1A 5HFFA 2I1NA 3DJAA 2K1HA 4AMHA 1WF8A 4JI6H 2EGOA 2QG1A 4GVCA 4DR2H 4LMMA 2EAQA 1PQXA 2E5LH 4B3SH 2JINA 1N99A 2KV8A 4NNLA 3CYYA 5IL9A 5LMUH 2G8YA 2EGKA 3RLEA 1S03G 3ID2A 4JI2H 3QE1A 3OETA 2UXDH 3JAMW 4LF8H 2JXOA 1AN7A 2EHRA 4X64H 4QMFB 2DLUA 2VSPA 1X4NA 1D5GA 5G1EA 3HVQC 4X66H 1W9QA 2DM8A 2X7ZA 1VB7A 3HPKA 5F3XA 2EJYA 5HDYA 3WKLA 2L97A 4JJ3A 4JYAH 4B3TH 4NMOA 5K36G 4DV4H 4KFWA 2G5MB 4NMQA 3J81W 4B8TA 4OEOA 4LIJA 2MJHA 1WFGA 1OZIA 5DTHA 1KWAA 3CH8A 2UUAH 1IBKH 4JI1H 3GJ9A 1UFXA 1P1EA 2KJKA 3CC0A 2OS6A 2BYGA 4BA1I 4OEPA 2JE6I 3EGGC 2PT7G 1WG6A 2RCZA 4LF6H 4LFAH 5EYZA 1FKAH 2F5YA 1MFGA 2YT7A 3STJA 1EC6A 3SFJA 2QKTA 2UXCH 1N32H 4GHNA 2OPVA 4F8KA 1I6UA 2JWEA 4IC6A 2CTFA 2JA9A 3GR5A 2L4TA 2R4HA 4IFDG 1R6JA 1SEIA 1HR0H 4RI0A 2DGRA 1BFEA 2EEJA 2D8IA 4JOJA 1KEFA 2HE4A 4NXMH 3UOEA 4XHVA 3NFKA 2PY9A 3OU0A 1UM7A 1UEPA 3TSVA 2E7KA 4UU5A 1VA8A 2YUBA 3L7ZC 4JI3H 4JOPA 1N6FA 4JL7A 4DUYH 4UU6A 1X5NA 1NTEA 5LMNH 4JJ0A 2Y3MA 1FC9A 3R69A 2M0TA 1HNZH 3KZEA 3KDGA 1ZTGA 5HFDA 2UUCH 5E11A 5HFCA 4X62H 5HFEA 4FGMA 2MHOA 2OCSA 4O06A 2G2LA 1MC7A 5E6PB 4B3RH 2JVZA 1J5KA 1GQ4A 2EDPA 3QJMA 3TSZA 3ID4A 3KDKA 2D9IA 3I0PA 2P2RA 3CBXA 1VIGA 1WE8A 4K0KH 2QT5A 2CTEA 1S20A 2HGAA 3NCVA 1ZZKA 2REYA 4YYXA 2OMJA 2LC6A 1RGRA 5B42A 2K20A 4P2AB 1F0XA 1N33H 5HEBA 4AQYH 2CTKA 2W7RA 1KY9A 2F0AA 2CWHA 5GNDA 1HNWH 4GKJH 4HOPB 1XNRH 2IWPA 2EEGA 4NMSA 1XNQH 1X5RA 2VRFA 3K82A 2KJDA 4KFVA 2RRMA 1NF3C 2KOHA 4JOGA 3KZDA 2F4VH 3GABA 1ZOKA 1Z2IA 2ZPMA 5F67A 5I7ZA 2VQFH 3GDUA 2VWRA 2I0IA 3GDVA 3DIWA 4NMRA 2V1WA 3CBYA 1K1GA 1UEQA 2JILA 5HF4A 3RL7A 1NXUA 1QLCA 2DB5A 1VBIA 3WKMA 2Q3GA 5A2PA 3SOEA 1IHJA 3SHWA 2KRGA 1J5EH 2QKUA 2AWXA 4OX9H 2ZPLA 2LOBA 3K1RA 1V1TA 4NXPA 1WHRA 2I04A 1X4MA 2ANRA 2M0VA 4JORA 2KQFA 1WH1A 2AXYA 4JI0H 5BR8H 2JEAI 4DR5H 3QDOA 4WYTA 3JXTA 2DC2A 4Q6SA 5IT9W 4Q2QA 4PQWA 3OSSD 4YHHH 1W9EA 1Y8TA 2FCFA 2PKTA 5HEYA 4AIMA 2HE2A 3QJNA 3AEVB 4K75A 4JI4H 2KA9A 1X0AA 4OCHA 1WF7A 1M5ZA 2W4FA 1V9NA 1TUAA 5ILBA 3VKEA 1VCWA 2EGNA 4R2ZA 2KJPA 1UEWA 2EEIA 2KOMA 2QKVA 3J80W 3BPUA 3PV5A 1TQ3A 1G9OA 4JOHA 2M6QA 1I92A 4GVDA 2YUYA 3HPMA 1W9OA 4P0CA 3FY5A 5HF1A 4NMVA 4LF5H 2UU9H 2LUIA 4HOPA 1HNXH 2I6VA 2CTLA 2FFMA 3K50A 4X65H 4JVYA 3V69A 2CS5A 2QNDA 1UITA 5E22A 3TMHA 1XMQH 2KOJA 4NZTM 4H8AA 2O2TA 2ANNA 2CWFA 2FMRA 4EDJA 1TP3A 2I4SA 3ID3A 5DT9A 4G08A 2IWOA 1ODHA 1UHPA 4REYA 2VPHA 1OBZA 1Z87A 2VZ5A 1P1DA 2CSJA 2Z17A 5EZ0A 1L6OA 2L4SA 2VQEH 2R3YA 4JVHA 4OO1G 1X9ZA 3QGLA 2HH2A 3R68A 5B6LA 3MH6A 2FNEA 2Z9IA 4NNMA 1WI4A 5JXBA 3GGEA 2CPMA 3AXAA 2CTJA 4E35A 3E17A 2PNTA 1I16A 5HJ1A 2E3UA 4Q2OA 1RGWA 2YTWA 1IBLH 1WI2A 4LFCH 4Q2NA 1MSZA 4PDBA 1OBYA 1FC6A 1X45A 2ENOA 3QIKA 1GM1A 2HHHH 1VJ6A 2BL5A 4DV5H 2CPQA 1N7FA 3PS4A 2LTLA 3EGHC 3KHFA 3SUZA 2PZDA 1PDRA 3PDZA 5FB8C 2LC7A 2UUBH 3SB1A 2KYLA 1UJVA 2NN6G 4B8CD 4DR7H 4NXQA 2M10A 4DV2H 1N34H 1U37A 2KG2A 2VSVA 2H2CA 4BA2I 3RL8A 1GQ5A 1N7EA 4N6XA 2GEFA 4MPAA 5G1DA 3ZRTA 2KBSA 3GSLA 1IU0A 2CTMA 4LF9H 4DR3H 1XMOH 1T2MA 3I4WA 5HEDA 4LFBH 4E9JA 2EXGA 4JI8H 2OZFA 2H3MA 2BA0A 4LF7H 1UJDA 3TSWA 5IWAH 2AWWA 2OPGA 1K32A 1LCYA 2WL7A 2DJTA 4JV5H 2AWUA 2FN5A 2D92A 2CSSA 2I0LA 2GZVA 3GCOA 1Q7XA 5HETA 1X5QA 3LNYA 5GLJA 3QO6A 2IWQA 2JSNA 5FLXW 2DKRA 3LNXA 1SOTA 5HFBA 3RF2A 1Q3PA 2UXBH 4K78A 2H3LA 3NGHA 5D13A 2VKCA 3EZJA 1QAUA 4NBQA 1ZZJA 1N6EA 1I94H 1TP5A 2OSGA 3L4FD 2LF0A 2M8WA 4B3MH 1X8SA 2DAZA 3ID1A 2PQUA 3B76A 1UG8A 2QBWA 3MH4A 4NXNH 1N7TA 2M0ZA 1X6DA 4JOEA 4YDPA 4K6YA 4JI7H 4Q3HA 5H3JA 1IU2A 2M3MA 4DV3H 4NMTA 2KAWA 3J7AK 3GKUA 1WIFA 4WYUA 1WJLA 1WHAA 1FCFA 2EV8A 2EDVA 4E34A 1UEZA 1UF1A 2LA8A 4OD6A 1QAVB 1SOZA 4Q2PA 3DORA 3T1YH 1VAEA 4JI5H 3CS0A 1Z86A 2HH3A 3VQGA 2EDZA 2JOAA 2P3WA 2KPLA 2JIKA 1ZUBA 2YT8A 3OTPA 4LF4H 2OPUA 3DJ1A 2IWNA 2MX6A 3FAUA 3VQFA 2X06A 3I18A 4WANA 2KPKA 2A1SA 3PDVA 1V5QA 3MH7A 2AINA 1WVNA 2KL1A 2JEBI 1TE0A 3GDSA 5JEAG 1U3BA 1V62A 3PV2A 4YY3H 2K1ZA 1DT4A 4NXRA 1V8CA 1V5LA 4DR1H 4JOFA 1WFVA 4FJUA 1OBXA 1Q3OA 2LTMA 2M0UA 5C0XG 3O46A 1U38A 2Z0SA 4G69A 2ZM6H 4DV6H 1UJUA 1MFLA 1FC7A 2OQSA 3PV4A 2JREA 1KHMA 3NFLA 2DLSA 2Q9VA
chains in the Genus database with same CATH topology
4DR4H 2OGPA 4JOKA 3CBZA 5FHTA 4NMPA 3OTOH 2PA1A 5LL6b 3O5NA 1V6BA 2UZCA 4FLNA 2EEHA 2FPHX 2PKUA 4Q6HA 4DUZH 1XZ9A 3T1HH 1IBMH 4DV7H 4L8NA 4OAJA 1RY4A 1FJGH 4K76A 4Z8JA 4H11A 1U39A 3R0HA 4NZRM 5E1YA 1WHDA 2FE5A 4DR6H 4E3BA 1QAVA 4EC5A 2O4CA 2D90A 2DMZA 3SHUA 4K72A 4KHPH 2PDZA 1RZXA 1Y7NA 1N6DA 4DV0H 3I1EA 3GCNA 3QD7X 4Z33A 1B8QA 3DJ3A 4GKKH 2H2BA 2V90A 2ZQEA 1BE9A 5A2QW 1N36H 5E21A 4DV1H 1YBOA 1UM1A 5HFFA 2I1NA 3DJAA 4AMHA 1WF8A 4JI6H 2EGOA 2QG1A 4GVCA 4DR2H 4LMMA 2EAQA 2E5LH 4B3SH 2JINA 1N99A 2KV8A 4NNLA 3CYYA 5IL9A 5LMUH 2EGKA 3RLEA 1S03G 3ID2A 4JI2H 3QE1A 3OETA 2UXDH 3JAMW 4LF8H 2JXOA 1AN7A 2EHRA 4X64H 2DLUA 2VSPA 1D5GA 5G1EA 3HVQC 4X66H 1W9QA 2DM8A 2X7ZA 1VB7A 3HPKA 5F3XA 2EJYA 5HDYA 3WKLA 2L97A 4JJ3A 4JYAH 4B3TH 4NMOA 4DV4H 4KFWA 2G5MB 4NMQA 3J81W 4OEOA 1WFGA 1OZIA 5DTHA 1KWAA 3CH8A 2UUAH 1IBKH 4JI1H 3GJ9A 1UFXA 1P1EA 2KJKA 3CC0A 2OS6A 2BYGA 4OEPA 4LF6H 3EGGC 2PT7G 1WG6A 2RCZA 4LFAH 5EYZA 1FKAH 2F5YA 1MFGA 2YT7A 3STJA 3SFJA 2QKTA 2UXCH 1N32H 4GHNA 4F8KA 1I6UA 2JWEA 4IC6A 3GR5A 2L4TA 2R4HA 1R6JA 1SEIA 1HR0H 4RI0A 1BFEA 2EEJA 2D8IA 4JOJA 1KEFA 2HE4A 4NXMH 4XHVA 3NFKA 3OU0A 1UM7A 1UEPA 3TSVA 2E7KA 4UU5A 1VA8A 2YUBA 4JI3H 4JOPA 1N6FA 4JL7A 4DUYH 4UU6A 1X5NA 1NTEA 5LMNH 4JJ0A 2Y3MA 1FC9A 3R69A 2M0TA 1HNZH 3KZEA 3KDGA 5HFDA 2UUCH 5E11A 5HFCA 4X62H 5HFEA 4FGMA 2MHOA 2OCSA 4O06A 2G2LA 1MC7A 5E6PB 4B3RH 1GQ4A 2EDPA 3QJMA 3TSZA 3ID4A 3KDKA 2D9IA 3CBXA 4K0KH 2QT5A 2HGAA 3NCVA 2REYA 4YYXA 2OMJA 2LC6A 1RGRA 5B42A 2K20A 4P2AB 1F0XA 1N33H 5HEBA 4AQYH 2W7RA 1KY9A 2F0AA 5GNDA 1HNWH 4GKJH 4HOPB 1XNRH 2IWPA 2EEGA 4NMSA 1XNQH 1X5RA 2VRFA 3K82A 2KJDA 4KFVA 2RRMA 1NF3C 2KOHA 4JOGA 3KZDA 2F4VH 3GABA 1ZOKA 2ZPMA 5F67A 5I7ZA 2VQFH 3GDUA 2VWRA 2I0IA 3GDVA 3DIWA 4NMRA 2V1WA 3CBYA 1UEQA 2JILA 5HF4A 3RL7A 1QLCA 2DB5A 3WKMA 2Q3GA 5A2PA 3SOEA 1IHJA 3SHWA 2KRGA 1J5EH 2QKUA 2AWXA 4OX9H 2ZPLA 2LOBA 3K1RA 1V1TA 4NXPA 2I04A 2M0VA 4JORA 2KQFA 1WH1A 4JI0H 5BR8H 4DR5H 3QDOA 4WYTA 3JXTA 2DC2A 4Q6SA 5IT9W 4Q2QA 4PQWA 3OSSD 4YHHH 1W9EA 1Y8TA 2FCFA 2PKTA 5HEYA 2HE2A 3QJNA 4K75A 4JI4H 2KA9A 4OCHA 1WF7A 1M5ZA 2W4FA 5ILBA 1VCWA 2EGNA 4R2ZA 2KJPA 1UEWA 2EEIA 2KOMA 2QKVA 3J80W 3BPUA 3PV5A 1TQ3A 1G9OA 4JOHA 1I92A 4GVDA 2YUYA 3HPMA 1W9OA 4P0CA 3FY5A 5HF1A 4NMVA 4LF5H 2UU9H 2LUIA 4HOPA 1HNXH 2I6VA 3K50A 4X65H 2CS5A 1UITA 5E22A 3TMHA 1XMQH 2KOJA 4NZTM 2O2TA 4EDJA 1TP3A 2I4SA 3ID3A 5DT9A 4G08A 2IWOA 1ODHA 1UHPA 4REYA 2VPHA 1OBZA 1Z87A 2VZ5A 1P1DA 2CSJA 2Z17A 5EZ0A 1L6OA 2L4SA 2VQEH 2R3YA 1X9ZA 3QGLA 3R68A 5B6LA 3MH6A 2FNEA 2Z9IA 4NNMA 1WI4A 5JXBA 3GGEA 3AXAA 4E35A 3E17A 2PNTA 1I16A 5HJ1A 4Q2OA 1RGWA 2YTWA 1IBLH 1WI2A 4LFCH 4Q2NA 4PDBA 1OBYA 1FC6A 1X45A 2ENOA 3QIKA 1GM1A 2HHHH 1VJ6A 4DV5H 1N7FA 3PS4A 3EGHC 3KHFA 3SUZA 2PZDA 1PDRA 3PDZA 5FB8C 2LC7A 2UUBH 3SB1A 2KYLA 1UJVA 4B8CD 4DR7H 4NXQA 2M10A 4DV2H 1N34H 1U37A 2KG2A 2VSVA 2H2CA 3RL8A 1GQ5A 1N7EA 4N6XA 2GEFA 4MPAA 5G1DA 3ZRTA 2KBSA 3GSLA 1IU0A 4LF9H 4DR3H 1XMOH 1T2MA 3I4WA 5HEDA 4LFBH 4E9JA 2EXGA 4JI8H 2OZFA 2H3MA 4LF7H 1UJDA 3TSWA 5IWAH 2AWWA 2OPGA 1K32A 1LCYA 2WL7A 2DJTA 4JV5H 2AWUA 2FN5A 2D92A 2CSSA 2I0LA 2GZVA 3GCOA 1Q7XA 5HETA 1X5QA 3LNYA 5GLJA 3QO6A 2IWQA 2JSNA 5FLXW 2DKRA 3LNXA 1SOTA 5HFBA 3RF2A 1Q3PA 2UXBH 4K78A 2H3LA 3NGHA 5D13A 2VKCA 3EZJA 1QAUA 1N6EA 1I94H 1TP5A 2OSGA 3L4FD 2LF0A 4B3MH 1X8SA 2DAZA 3ID1A 3B76A 2QBWA 3MH4A 4NXNH 1N7TA 2M0ZA 1X6DA 4JOEA 4YDPA 4K6YA 4JI7H 4Q3HA 5H3JA 1IU2A 2M3MA 4DV3H 4NMTA 2KAWA 3J7AK 1WIFA 4WYUA 1WJLA 1WHAA 1FCFA 2EV8A 2EDVA 4E34A 1UEZA 1UF1A 2LA8A 4OD6A 1QAVB 1SOZA 4Q2PA 3DORA 3T1YH 1VAEA 4JI5H 3CS0A 1Z86A 3VQGA 2EDZA 2JOAA 2P3WA 2KPLA 2JIKA 1ZUBA 2YT8A 3OTPA 4LF4H 3DJ1A 2IWNA 2MX6A 3FAUA 3VQFA 3I18A 2KPKA 3PDVA 1V5QA 3MH7A 2AINA 2KL1A 1TE0A 3GDSA 1U3BA 1V62A 3PV2A 4YY3H 2K1ZA 4NXRA 1V5LA 4DR1H 4JOFA 1WFVA 1OBXA 1Q3OA 2M0UA 3O46A 1U38A 4G69A 2ZM6H 4DV6H 1UJUA 1MFLA 1FC7A 2OQSA 3PV4A 2JREA 3NFLA 2DLSA 2Q9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KDK A;  5B42 A;  3KDG A;  3NCV A;  1X9Z A;  3GAB A; 
#chains in the Genus database with same CATH topology
 4DR4 H;  2OGP A;  4JOK A;  3CBZ A;  5FHT A;  4NMP A;  1WTJ A;  3OTO H;  2PA1 A;  5LL6 b;  4WAL A;  1DTJ A;  3O5N A;  1V6B A;  2UZC A;  1XRH A;  4FLN A;  2EEH A;  2FPH X;  2PKU A;  1J4W A;  4AM3 A;  4Q6H A;  3U1K A;  1XZ9 A;  1VIH A;  4DUZ H;  3T1H H;  1ZZI A;  1IBM H;  4DV7 H;  4L8N A;  4OAJ A;  1RY4 A;  4FJS A;  1FJG H;  4K76 A;  4Z8J A;  4H11 A;  1U39 A;  3R0H A;  4NZR M;  5E1Y A;  1WHD A;  2FE5 A;  4DR6 H;  4E3B A;  1QAV A;  4EC5 A;  2O4C A;  2YQR A;  2D90 A;  2DMZ A;  3SHU A;  4K72 A;  4KHP H;  2PDZ A;  1RZX A;  1Y7N A;  1N6D A;  2LRR A;  4DV0 H;  3I1E A;  3GCN A;  2JZX A;  3QD7 X;  4Z33 A;  1B8Q A;  3DJ3 A;  4GKK H;  2H2B A;  2V90 A;  2ZQE A;  1BE9 A;  5A2Q W;  1N36 H;  5E21 A;  4DV1 H;  1YBO A;  1UM1 A;  5HFF A;  2I1N A;  3DJA A;  2K1H A;  4AMH A;  1WF8 A;  4JI6 H;  2EGO A;  2QG1 A;  4GVC A;  4DR2 H;  4LMM A;  2EAQ A;  1PQX A;  2E5L H;  4B3S H;  2JIN A;  1N99 A;  2KV8 A;  4NNL A;  3CYY A;  5IL9 A;  5LMU H;  2G8Y A;  2EGK A;  3RLE A;  1S03 G;  3ID2 A;  4JI2 H;  3QE1 A;  3OET A;  2UXD H;  3JAM W;  4LF8 H;  2JXO A;  1AN7 A;  2EHR A;  4X64 H;  4QMF B;  2DLU A;  2VSP A;  1X4N A;  1D5G A;  5G1E A;  3HVQ C;  4X66 H;  1W9Q A;  2DM8 A;  2X7Z A;  1VB7 A;  3HPK A;  5F3X A;  2EJY A;  5HDY A;  3WKL A;  2L97 A;  4JJ3 A;  4JYA H;  4B3T H;  4NMO A;  5K36 G;  4DV4 H;  4KFW A;  2G5M B;  4NMQ A;  3J81 W;  4B8T A;  4OEO A;  4LIJ A;  2MJH A;  1WFG A;  1OZI A;  5DTH A;  1KWA A;  3CH8 A;  2UUA H;  1IBK H;  4JI1 H;  3GJ9 A;  1UFX A;  1P1E A;  2KJK A;  3CC0 A;  2OS6 A;  2BYG A;  4BA1 I;  4OEP A;  2JE6 I;  3EGG C;  2PT7 G;  1WG6 A;  2RCZ A;  4LF6 H;  4LFA H;  5EYZ A;  1FKA H;  2F5Y A;  1MFG A;  2YT7 A;  3STJ A;  1EC6 A;  3SFJ A;  2QKT A;  2UXC H;  1N32 H;  4GHN A;  2OPV A;  4F8K A;  1I6U A;  2JWE A;  4IC6 A;  2CTF A;  2JA9 A;  3GR5 A;  2L4T A;  2R4H A;  4IFD G;  1R6J A;  1SEI A;  1HR0 H;  4RI0 A;  2DGR A;  1BFE A;  2EEJ A;  2D8I A;  4JOJ A;  1KEF A;  2HE4 A;  4NXM H;  3UOE A;  4XHV A;  3NFK A;  2PY9 A;  3OU0 A;  1UM7 A;  1UEP A;  3TSV A;  2E7K A;  4UU5 A;  1VA8 A;  2YUB A;  3L7Z C;  4JI3 H;  4JOP A;  1N6F A;  4JL7 A;  4DUY H;  4UU6 A;  1X5N A;  1NTE A;  5LMN H;  4JJ0 A;  2Y3M A;  1FC9 A;  3R69 A;  2M0T A;  1HNZ H;  3KZE A;  3KDG A;  1ZTG A;  5HFD A;  2UUC H;  5E11 A;  5HFC A;  4X62 H;  5HFE A;  4FGM A;  2MHO A;  2OCS A;  4O06 A;  2G2L A;  1MC7 A;  5E6P B;  4B3R H;  2JVZ A;  1J5K A;  1GQ4 A;  2EDP A;  3QJM A;  3TSZ A;  3ID4 A;  3KDK A;  2D9I A;  3I0P A;  2P2R A;  3CBX A;  1VIG A;  1WE8 A;  4K0K H;  2QT5 A;  2CTE A;  1S20 A;  2HGA A;  3NCV A;  1ZZK A;  2REY A;  4YYX A;  2OMJ A;  2LC6 A;  1RGR A;  5B42 A;  2K20 A;  4P2A B;  1F0X A;  1N33 H;  5HEB A;  4AQY H;  2CTK A;  2W7R A;  1KY9 A;  2F0A A;  2CWH A;  5GND A;  1HNW H;  4GKJ H;  4HOP B;  1XNR H;  2IWP A;  2EEG A;  4NMS A;  1XNQ H;  1X5R A;  2VRF A;  3K82 A;  2KJD A;  4KFV A;  2RRM A;  1NF3 C;  2KOH A;  4JOG A;  3KZD A;  2F4V H;  3GAB A;  1ZOK A;  1Z2I A;  2ZPM A;  5F67 A;  5I7Z A;  2VQF H;  3GDU A;  2VWR A;  2I0I A;  3GDV A;  3DIW A;  4NMR A;  2V1W A;  3CBY A;  1K1G A;  1UEQ A;  2JIL A;  5HF4 A;  3RL7 A;  1NXU A;  1QLC A;  2DB5 A;  1VBI A;  3WKM A;  2Q3G A;  5A2P A;  3SOE A;  1IHJ A;  3SHW A;  2KRG A;  1J5E H;  2QKU A;  2AWX A;  4OX9 H;  2ZPL A;  2LOB A;  3K1R A;  1V1T A;  4NXP A;  1WHR A;  2I04 A;  1X4M A;  2ANR A;  2M0V A;  4JOR A;  2KQF A;  1WH1 A;  2AXY A;  4JI0 H;  5BR8 H;  2JEA I;  4DR5 H;  3QDO A;  4WYT A;  3JXT A;  2DC2 A;  4Q6S A;  5IT9 W;  4Q2Q A;  4PQW A;  3OSS D;  4YHH H;  1W9E A;  1Y8T A;  2FCF A;  2PKT A;  5HEY A;  4AIM A;  2HE2 A;  3QJN A;  3AEV B;  4K75 A;  4JI4 H;  2KA9 A;  1X0A A;  4OCH A;  1WF7 A;  1M5Z A;  2W4F A;  1V9N A;  1TUA A;  5ILB A;  3VKE A;  1VCW A;  2EGN A;  4R2Z A;  2KJP A;  1UEW A;  2EEI A;  2KOM A;  2QKV A;  3J80 W;  3BPU A;  3PV5 A;  1TQ3 A;  1G9O A;  4JOH A;  2M6Q A;  1I92 A;  4GVD A;  2YUY A;  3HPM A;  1W9O A;  4P0C A;  3FY5 A;  5HF1 A;  4NMV A;  4LF5 H;  2UU9 H;  2LUI A;  4HOP A;  1HNX H;  2I6V A;  2CTL A;  2FFM A;  3K50 A;  4X65 H;  4JVY A;  3V69 A;  2CS5 A;  2QND A;  1UIT A;  5E22 A;  3TMH A;  1XMQ H;  2KOJ A;  4NZT M;  4H8A A;  2O2T A;  2ANN A;  2CWF A;  2FMR A;  4EDJ A;  1TP3 A;  2I4S A;  3ID3 A;  5DT9 A;  4G08 A;  2IWO A;  1ODH A;  1UHP A;  4REY A;  2VPH A;  1OBZ A;  1Z87 A;  2VZ5 A;  1P1D A;  2CSJ A;  2Z17 A;  5EZ0 A;  1L6O A;  2L4S A;  2VQE H;  2R3Y A;  4JVH A;  4OO1 G;  1X9Z A;  3QGL A;  2HH2 A;  3R68 A;  5B6L A;  3MH6 A;  2FNE A;  2Z9I A;  4NNM A;  1WI4 A;  5JXB A;  3GGE A;  2CPM A;  3AXA A;  2CTJ A;  4E35 A;  3E17 A;  2PNT A;  1I16 A;  5HJ1 A;  2E3U A;  4Q2O A;  1RGW A;  2YTW A;  1IBL H;  1WI2 A;  4LFC H;  4Q2N A;  1MSZ A;  4PDB A;  1OBY A;  1FC6 A;  1X45 A;  2ENO A;  3QIK A;  1GM1 A;  2HHH H;  1VJ6 A;  2BL5 A;  4DV5 H;  2CPQ A;  1N7F A;  3PS4 A;  2LTL A;  3EGH C;  3KHF A;  3SUZ A;  2PZD A;  1PDR A;  3PDZ A;  5FB8 C;  2LC7 A;  2UUB H;  3SB1 A;  2KYL A;  1UJV A;  2NN6 G;  4B8C D;  4DR7 H;  4NXQ A;  2M10 A;  4DV2 H;  1N34 H;  1U37 A;  2KG2 A;  2VSV A;  2H2C A;  4BA2 I;  3RL8 A;  1GQ5 A;  1N7E A;  4N6X A;  2GEF A;  4MPA A;  5G1D A;  3ZRT A;  2KBS A;  3GSL A;  1IU0 A;  2CTM A;  4LF9 H;  4DR3 H;  1XMO H;  1T2M A;  3I4W A;  5HED A;  4LFB H;  4E9J A;  2EXG A;  4JI8 H;  2OZF A;  2H3M A;  2BA0 A;  4LF7 H;  1UJD A;  3TSW A;  5IWA H;  2AWW A;  2OPG A;  1K32 A;  1LCY A;  2WL7 A;  2DJT A;  4JV5 H;  2AWU A;  2FN5 A;  2D92 A;  2CSS A;  2I0L A;  2GZV A;  3GCO A;  1Q7X A;  5HET A;  1X5Q A;  3LNY A;  5GLJ A;  3QO6 A;  2IWQ A;  2JSN A;  5FLX W;  2DKR A;  3LNX A;  1SOT A;  5HFB A;  3RF2 A;  1Q3P A;  2UXB H;  4K78 A;  2H3L A;  3NGH A;  5D13 A;  2VKC A;  3EZJ A;  1QAU A;  4NBQ A;  1ZZJ A;  1N6E A;  1I94 H;  1TP5 A;  2OSG A;  3L4F D;  2LF0 A;  2M8W A;  4B3M H;  1X8S A;  2DAZ A;  3ID1 A;  2PQU A;  3B76 A;  1UG8 A;  2QBW A;  3MH4 A;  4NXN H;  1N7T A;  2M0Z A;  1X6D A;  4JOE A;  4YDP A;  4K6Y A;  4JI7 H;  4Q3H A;  5H3J A;  1IU2 A;  2M3M A;  4DV3 H;  4NMT A;  2KAW A;  3J7A K;  3GKU A;  1WIF A;  4WYU A;  1WJL A;  1WHA A;  1FCF A;  2EV8 A;  2EDV A;  4E34 A;  1UEZ A;  1UF1 A;  2LA8 A;  4OD6 A;  1QAV B;  1SOZ A;  4Q2P A;  3DOR A;  3T1Y H;  1VAE A;  4JI5 H;  3CS0 A;  1Z86 A;  2HH3 A;  3VQG A;  2EDZ A;  2JOA A;  2P3W A;  2KPL A;  2JIK A;  1ZUB A;  2YT8 A;  3OTP A;  4LF4 H;  2OPU A;  3DJ1 A;  2IWN A;  2MX6 A;  3FAU A;  3VQF A;  2X06 A;  3I18 A;  4WAN A;  2KPK A;  2A1S A;  3PDV A;  1V5Q A;  3MH7 A;  2AIN A;  1WVN A;  2KL1 A;  2JEB I;  1TE0 A;  3GDS A;  5JEA G;  1U3B A;  1V62 A;  3PV2 A;  4YY3 H;  2K1Z A;  1DT4 A;  4NXR A;  1V8C A;  1V5L A;  4DR1 H;  4JOF A;  1WFV A;  4FJU A;  1OBX A;  1Q3O A;  2LTM A;  2M0U A;  5C0X G;  3O46 A;  1U38 A;  2Z0S A;  4G69 A;  2ZM6 H;  4DV6 H;  1UJU A;  1MFL A;  1FC7 A;  2OQS A;  3PV4 A;  2JRE A;  1KHM A;  3NFL A;  2DLS A;  2Q9V A; 
#chains in the Genus database with same CATH homology
 4DR4 H;  2OGP A;  4JOK A;  3CBZ A;  5FHT A;  4NMP A;  3OTO H;  2PA1 A;  5LL6 b;  3O5N A;  1V6B A;  2UZC A;  4FLN A;  2EEH A;  2FPH X;  2PKU A;  4Q6H A;  4DUZ H;  1XZ9 A;  3T1H H;  1IBM H;  4DV7 H;  4L8N A;  4OAJ A;  1RY4 A;  1FJG H;  4K76 A;  4Z8J A;  4H11 A;  1U39 A;  3R0H A;  4NZR M;  5E1Y A;  1WHD A;  2FE5 A;  4DR6 H;  4E3B A;  1QAV A;  4EC5 A;  2O4C A;  2D90 A;  2DMZ A;  3SHU A;  4K72 A;  4KHP H;  2PDZ A;  1RZX A;  1Y7N A;  1N6D A;  4DV0 H;  3I1E A;  3GCN A;  3QD7 X;  4Z33 A;  1B8Q A;  3DJ3 A;  4GKK H;  2H2B A;  2V90 A;  2ZQE A;  1BE9 A;  5A2Q W;  1N36 H;  5E21 A;  4DV1 H;  1YBO A;  1UM1 A;  5HFF A;  2I1N A;  3DJA A;  4AMH A;  1WF8 A;  4JI6 H;  2EGO A;  2QG1 A;  4GVC A;  4DR2 H;  4LMM A;  2EAQ A;  2E5L H;  4B3S H;  2JIN A;  1N99 A;  2KV8 A;  4NNL A;  3CYY A;  5IL9 A;  5LMU H;  2EGK A;  3RLE A;  1S03 G;  3ID2 A;  4JI2 H;  3QE1 A;  3OET A;  2UXD H;  3JAM W;  4LF8 H;  2JXO A;  1AN7 A;  2EHR A;  4X64 H;  2DLU A;  2VSP A;  1D5G A;  5G1E A;  3HVQ C;  4X66 H;  1W9Q A;  2DM8 A;  2X7Z A;  1VB7 A;  3HPK A;  5F3X A;  2EJY A;  5HDY A;  3WKL A;  2L97 A;  4JJ3 A;  4JYA H;  4B3T H;  4NMO A;  4DV4 H;  4KFW A;  2G5M B;  4NMQ A;  3J81 W;  4OEO A;  1WFG A;  1OZI A;  5DTH A;  1KWA A;  3CH8 A;  2UUA H;  1IBK H;  4JI1 H;  3GJ9 A;  1UFX A;  1P1E A;  2KJK A;  3CC0 A;  2OS6 A;  2BYG A;  4OEP A;  4LF6 H;  3EGG C;  2PT7 G;  1WG6 A;  2RCZ A;  4LFA H;  5EYZ A;  1FKA H;  2F5Y A;  1MFG A;  2YT7 A;  3STJ A;  3SFJ A;  2QKT A;  2UXC H;  1N32 H;  4GHN A;  4F8K A;  1I6U A;  2JWE A;  4IC6 A;  3GR5 A;  2L4T A;  2R4H A;  1R6J A;  1SEI A;  1HR0 H;  4RI0 A;  1BFE A;  2EEJ A;  2D8I A;  4JOJ A;  1KEF A;  2HE4 A;  4NXM H;  4XHV A;  3NFK A;  3OU0 A;  1UM7 A;  1UEP A;  3TSV A;  2E7K A;  4UU5 A;  1VA8 A;  2YUB A;  4JI3 H;  4JOP A;  1N6F A;  4JL7 A;  4DUY H;  4UU6 A;  1X5N A;  1NTE A;  5LMN H;  4JJ0 A;  2Y3M A;  1FC9 A;  3R69 A;  2M0T A;  1HNZ H;  3KZE A;  3KDG A;  5HFD A;  2UUC H;  5E11 A;  5HFC A;  4X62 H;  5HFE A;  4FGM A;  2MHO A;  2OCS A;  4O06 A;  2G2L A;  1MC7 A;  5E6P B;  4B3R H;  1GQ4 A;  2EDP A;  3QJM A;  3TSZ A;  3ID4 A;  3KDK A;  2D9I A;  3CBX A;  4K0K H;  2QT5 A;  2HGA A;  3NCV A;  2REY A;  4YYX A;  2OMJ A;  2LC6 A;  1RGR A;  5B42 A;  2K20 A;  4P2A B;  1F0X A;  1N33 H;  5HEB A;  4AQY H;  2W7R A;  1KY9 A;  2F0A A;  5GND A;  1HNW H;  4GKJ H;  4HOP B;  1XNR H;  2IWP A;  2EEG A;  4NMS A;  1XNQ H;  1X5R A;  2VRF A;  3K82 A;  2KJD A;  4KFV A;  2RRM A;  1NF3 C;  2KOH A;  4JOG A;  3KZD A;  2F4V H;  3GAB A;  1ZOK A;  2ZPM A;  5F67 A;  5I7Z A;  2VQF H;  3GDU A;  2VWR A;  2I0I A;  3GDV A;  3DIW A;  4NMR A;  2V1W A;  3CBY A;  1UEQ A;  2JIL A;  5HF4 A;  3RL7 A;  1QLC A;  2DB5 A;  3WKM A;  2Q3G A;  5A2P A;  3SOE A;  1IHJ A;  3SHW A;  2KRG A;  1J5E H;  2QKU A;  2AWX A;  4OX9 H;  2ZPL A;  2LOB A;  3K1R A;  1V1T A;  4NXP A;  2I04 A;  2M0V A;  4JOR A;  2KQF A;  1WH1 A;  4JI0 H;  5BR8 H;  4DR5 H;  3QDO A;  4WYT A;  3JXT A;  2DC2 A;  4Q6S A;  5IT9 W;  4Q2Q A;  4PQW A;  3OSS D;  4YHH H;  1W9E A;  1Y8T A;  2FCF A;  2PKT A;  5HEY A;  2HE2 A;  3QJN A;  4K75 A;  4JI4 H;  2KA9 A;  4OCH A;  1WF7 A;  1M5Z A;  2W4F A;  5ILB A;  1VCW A;  2EGN A;  4R2Z A;  2KJP A;  1UEW A;  2EEI A;  2KOM A;  2QKV A;  3J80 W;  3BPU A;  3PV5 A;  1TQ3 A;  1G9O A;  4JOH A;  1I92 A;  4GVD A;  2YUY A;  3HPM A;  1W9O A;  4P0C A;  3FY5 A;  5HF1 A;  4NMV A;  4LF5 H;  2UU9 H;  2LUI A;  4HOP A;  1HNX H;  2I6V A;  3K50 A;  4X65 H;  2CS5 A;  1UIT A;  5E22 A;  3TMH A;  1XMQ H;  2KOJ A;  4NZT M;  2O2T A;  4EDJ A;  1TP3 A;  2I4S A;  3ID3 A;  5DT9 A;  4G08 A;  2IWO A;  1ODH A;  1UHP A;  4REY A;  2VPH A;  1OBZ A;  1Z87 A;  2VZ5 A;  1P1D A;  2CSJ A;  2Z17 A;  5EZ0 A;  1L6O A;  2L4S A;  2VQE H;  2R3Y A;  1X9Z A;  3QGL A;  3R68 A;  5B6L A;  3MH6 A;  2FNE A;  2Z9I A;  4NNM A;  1WI4 A;  5JXB A;  3GGE A;  3AXA A;  4E35 A;  3E17 A;  2PNT A;  1I16 A;  5HJ1 A;  4Q2O A;  1RGW A;  2YTW A;  1IBL H;  1WI2 A;  4LFC H;  4Q2N A;  4PDB A;  1OBY A;  1FC6 A;  1X45 A;  2ENO A;  3QIK A;  1GM1 A;  2HHH H;  1VJ6 A;  4DV5 H;  1N7F A;  3PS4 A;  3EGH C;  3KHF A;  3SUZ A;  2PZD A;  1PDR A;  3PDZ A;  5FB8 C;  2LC7 A;  2UUB H;  3SB1 A;  2KYL A;  1UJV A;  4B8C D;  4DR7 H;  4NXQ A;  2M10 A;  4DV2 H;  1N34 H;  1U37 A;  2KG2 A;  2VSV A;  2H2C A;  3RL8 A;  1GQ5 A;  1N7E A;  4N6X A;  2GEF A;  4MPA A;  5G1D A;  3ZRT A;  2KBS A;  3GSL A;  1IU0 A;  4LF9 H;  4DR3 H;  1XMO H;  1T2M A;  3I4W A;  5HED A;  4LFB H;  4E9J A;  2EXG A;  4JI8 H;  2OZF A;  2H3M A;  4LF7 H;  1UJD A;  3TSW A;  5IWA H;  2AWW A;  2OPG A;  1K32 A;  1LCY A;  2WL7 A;  2DJT A;  4JV5 H;  2AWU A;  2FN5 A;  2D92 A;  2CSS A;  2I0L A;  2GZV A;  3GCO A;  1Q7X A;  5HET A;  1X5Q A;  3LNY A;  5GLJ A;  3QO6 A;  2IWQ A;  2JSN A;  5FLX W;  2DKR A;  3LNX A;  1SOT A;  5HFB A;  3RF2 A;  1Q3P A;  2UXB H;  4K78 A;  2H3L A;  3NGH A;  5D13 A;  2VKC A;  3EZJ A;  1QAU A;  1N6E A;  1I94 H;  1TP5 A;  2OSG A;  3L4F D;  2LF0 A;  4B3M H;  1X8S A;  2DAZ A;  3ID1 A;  3B76 A;  2QBW A;  3MH4 A;  4NXN H;  1N7T A;  2M0Z A;  1X6D A;  4JOE A;  4YDP A;  4K6Y A;  4JI7 H;  4Q3H A;  5H3J A;  1IU2 A;  2M3M A;  4DV3 H;  4NMT A;  2KAW A;  3J7A K;  1WIF A;  4WYU A;  1WJL A;  1WHA A;  1FCF A;  2EV8 A;  2EDV A;  4E34 A;  1UEZ A;  1UF1 A;  2LA8 A;  4OD6 A;  1QAV B;  1SOZ A;  4Q2P A;  3DOR A;  3T1Y H;  1VAE A;  4JI5 H;  3CS0 A;  1Z86 A;  3VQG A;  2EDZ A;  2JOA A;  2P3W A;  2KPL A;  2JIK A;  1ZUB A;  2YT8 A;  3OTP A;  4LF4 H;  3DJ1 A;  2IWN A;  2MX6 A;  3FAU A;  3VQF A;  3I18 A;  2KPK A;  3PDV A;  1V5Q A;  3MH7 A;  2AIN A;  2KL1 A;  1TE0 A;  3GDS A;  1U3B A;  1V62 A;  3PV2 A;  4YY3 H;  2K1Z A;  4NXR A;  1V5L A;  4DR1 H;  4JOF A;  1WFV A;  1OBX A;  1Q3O A;  2M0U A;  3O46 A;  1U38 A;  4G69 A;  2ZM6 H;  4DV6 H;  1UJU A;  1MFL A;  1FC7 A;  2OQS A;  3PV4 A;  2JRE A;  3NFL A;  2DLS A;  2Q9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...