3GABA

C-terminal domain of bacillus subtilis mutl crystal form i
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
190
structure length
183
Chain Sequence
RVPIMYPIGQMHGTYILAQNENGLYIIDQHAAQERIKYEYFREKVGEPEVQEMIVPLTFHYSTNEALIIEQHKQELESVGVFLESFGSNSYIVRCHPAWFPKGEEAELIEEIIQQVLDSKNIDIKKLREEAAIMMSCKNRHLRNDEIKALLDDLRSTSDPFTCPHGRPIIIHHSTYEMEKMFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the endonuclease domain of MutL: unlicensed to cut.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords DNA mismatch repair protein mutL
total genus 53
structure length 183
sequence length 190
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08676 MutL_C MutL C terminal dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.20 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3gabA01
3.30.1370.100 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3gabA02
3KDKA 3KDGA 1X9ZA 3NCVA 3GABA 5B42A
chains in the Genus database with same CATH superfamily
3R68A 2AINA 4DR2H 4NXRA 2EJYA 2UXDH 2VWRA 2KPKA 2HHHH 2M3MA 1W9QA 3DIWA 2VKCA 4GKKH 2G8YA 1KHMA 2VSPA 3DORA 2DB5A 3WKLA 2P2RA 3UOEA 2IWOA 4NMVA 1B8QA 2JZXA 5FHTA 4B3SH 1NXUA 4H8AA 2YUYA 2AWWA 2CTKA 4REYA 2ZM6H 4JOJA 2ENOA 2M0UA 2M6QA 4K76A 1TP5A 2QG1A 2CSSA 3T1YH 1XMOH 2CTEA 3AEVB 1AN7A 5HEDA 4AM3A 4OO1G 2JILA 3I4WA 1UEWA 1Q7XA 1OZIA 4FGMA 3OTPA 4NMTA 5HEBA 1WIFA 1V8CA 2LTLA 2LTMA 5EYZA 4B3RH 2KOHA 1UJUA 2UUCH 1OBXA 5HJ1A 3MH7A 4BA2I 2IWPA 3DJAA 2G2LA 1RGRA 5JEAG 1UITA 4OEOA 2O2TA 1V5QA 2M0ZA 5I7ZA 5EZ0A 4OEPA 2FFMA 5F67A 2YTWA 3GR5A 2K1ZA 4IFDG 4NZTM 2OPUA 3RLEA 2EDZA 2HH2A 4NXNH 1RY4A 3O46A 3LNXA 3NFLA 1BFEA 1YBOA 2I6VA 3QGLA 4MPAA 2VQFH 1EC6A 4L8NA 3GKUA 2YT7A 3MH4A 5LL6b 1NF3C 3DJ3A 2EGNA 2JINA 1UHPA 2I0IA 1MFGA 2EEGA 3SOEA 1QAVB 3KZDA 1VBIA 2FPHX 2F0AA 4DV0H 2CWFA 2JA9A 4BA1I 1ZTGA 1HR0H 1FC6A 5LMUH 5DT9A 4DV7H 3V69A 1LCYA 1WF8A 3CC0A 3GABA 5IWAH 3OTOH 1VIHA 4JOPA 4K6YA 1XNRH 4NXPA 1VCWA 1WG6A 3TSVA 2H3MA 2IWQA 2Z17A 4FJUA 2DC2A 3CS0A 2FCFA 2A1SA 3O5NA 2EAQA 3QIKA 1TQ3A 3L7ZC 2OMJA 3EGGC 1WVNA 5HFFA 3NGHA 2HE4A 2CTFA 2AWXA 3I18A 3GDUA 4JJ3A 2EDPA 4AQYH 3QE1A 2D9IA 2D8IA 1U37A 4JI0H 4K75A 4Q3HA 4JOEA 4DUZH 1ZZKA 2ANRA 4X62H 2G5MB 2DMZA 1WF7A 4GVDA 2I04A 4NNLA 3QO6A 1DT4A 2Q3GA 2DKRA 4JOFA 3OU0A 3TSZA 2OCSA 2V90A 3GJ9A 4RI0A 1K1GA 1XRHA 4QMFB 4G69A 3QDOA 4LF4H 4H11A 1F0XA 4K78A 2IWNA 2KJPA 4YDPA 1I92A 5G1EA 3RL8A 2JOAA 1ZZIA 2UXBH 2MHOA 3HVQC 1OBYA 2M10A 2JEAI 1IHJA 4DV3H 1IBKH 3GGEA 2FE5A 5E6PB 2CPMA 1X6DA 4XHVA 2Y3MA 2D90A 2PQUA 5HETA 4JJ0A 1FC9A 1K32A 2PKTA 4JVYA 1FCFA 4LF7H 2PKUA 3RF2A 2M8WA 4Q2NA 4B3TH 2R3YA 1W9EA 2QKTA 3GCNA 2P3WA 4GKJH 4YY3H 4LFCH 1ZOKA 4K0KH 2PY9A 3OETA 2JREA 3GCOA 4O06A 2MX6A 2UZCA 1X9ZA 5A2QW 1GM1A 1X0AA 4DV5H 3LNYA 2I4SA 1DTJA 1IBLH 2QNDA 3CBXA 2FN5A 4K72A 3SFJA 2UXCH 2ZPLA 4DR6H 1FC7A 4LIJA 4E9JA 5D13A 1Z2IA 2WL7A 3T1HH 3NFKA 4KFVA 1I94H 1SOZA 1N7EA 3ID1A 4WYUA 2KBSA 2FMRA 2OGPA 3GDSA 1V62A 1IU0A 2L4SA 3DJ1A 2RCZA 3KZEA 2UUBH 1WHAA 2E5LH 2CSJA 4LMMA 1MSZA 2KL1A 5IL9A 5HFDA 2KPLA 2CTMA 1TP3A 1U38A 3I1EA 1IBMH 2MJHA 2VRFA 2VQEH 4OD6A 4DR3H 3E17A 1HNZH 1WH1A 4DR4H 4JI3H 1GQ4A 1RZXA 4DV4H 1QAUA 2RRMA 2VPHA 2EHRA 1V1TA 4Q6SA 1RGWA 2M0VA 1WHDA 2K20A 4NMPA 2O4CA 2V1WA 1J4WA 4GHNA 1WTJA 4NXMH 1QLCA 1X4MA 5G1DA 3B76A 1WI2A 1I6UA 4JVHA 2H2BA 1WE8A 2K1HA 2I1NA 1N33H 1UEPA 1V5LA 5HFCA 1XMQH 2W4FA 1UG8A 1KWAA 1X45A 1V9NA 1P1EA 2JVZA 5FLXW 2VSVA 2KRGA 2JXOA 4OAJA 2EXGA 3PDVA 2DM8A 3K82A 1Y8TA 3CBZA 2KJKA 4B3MH 2JWEA 4NBQA 5FB8C 4JI4H 2KYLA 3PS4A 2M0TA 1WHRA 3PV5A 1P1DA 2EGKA 2OPGA 1Q3PA 1FKAH 4LF9H 4JOKA 2OZFA 5GNDA 2HE2A 5B42A 2KOJA 1N7FA 5E21A 3NCVA 2EV8A 3JAMW 4P0CA 2ZPMA 5K36G 1Z86A 3GSLA 1U3BA 2H2CA 3EGHC 4NMRA 5HFEA 2KV8A 4JI5H 3VKEA 4NMOA 5HEYA 1ZUBA 2LUIA 1UM7A 1Y7NA 1N7TA 1VAEA 2X7ZA 4JL7A 3PV4A 3RL7A 4F8KA 4DV6H 5A2PA 2F5YA 4X64H 4YYXA 1X5QA 3KDKA 2QKVA 3BPUA 1R6JA 2LRRA 3JXTA 1WI4A 1N99A 1TE0A 4Z33A 4NZRM 3QJNA 1X4NA 2BA0A 1OBZA 2REYA 2EGOA 2JSNA 2BL5A 4DR7H 2DGRA 1UM1A 2PNTA 4E35A 1PDRA 2QKUA 2PZDA 4LF8H 1VJ6A 1L6OA 1UJVA 4E34A 4HOPB 2KG2A 2X06A 1N36H 2CS5A 2JEBI 4JI1H 2LOBA 2CTJA 4EDJA 1I16A 4OX9H 5HF1A 4P2AB 1SEIA 3MH6A 3EZJA 3R0HA 2AWUA 1V6BA 5E22A 2LC7A 4Q2QA 2LF0A 4KHPH 4JORA 1NTEA 1N6DA 3SUZA 3SHWA 3FY5A 4NMQA 1GQ5A 2L97A 4HOPA 2LC6A 2R4HA 2YQRA 3SB1A 3J81W 4JV5H 4LFAH 4X65H 2EEIA 1UEQA 3I0PA 1UJDA 1FJGH 2KJDA 3ZRTA 2CWHA 2D92A 4WANA 1U39A 1X5RA 2GZVA 3CYYA 1KEFA 3PV2A 4NNMA 1WJLA 2VZ5A 4DV2H 4Q2OA 2CPQA 3GDVA 5DTHA 5H3JA 3CBYA 5HF4A 4AIMA 1T2MA 4WYTA 2UU9H 3VQGA 5HFBA 2QBWA 2YUBA 2GEFA 5B6LA 2EEJA 3QJMA 3U1KA 4Z8JA 2DJTA 1XNQH 1VB7A 2BYGA 4JOGA 5HDYA 2HGAA 1M5ZA 1MFLA 3K1RA 1J5EH 2KQFA 4NXQA 4JYAH 4JOHA 2Q9VA 2QT5A 4DR1H 1KY9A 2DLUA 2AXYA 2KA9A 1S20A 2DLSA 1HNXH 5E1YA 2PDZA 4IC6A 1D5GA 1UFXA 2ZQEA 4FLNA 4DV1H 1BE9A 3FAUA 2EDVA 3KHFA 3HPKA 4Q2PA 1S03G 4B8TA 3J7AK 2UUAH 1X8SA 1X5NA 3SHUA 4Q6HA 2ANNA 1N32H 3HPMA 2E3UA 3STJA 4JI7H 1VIGA 2EEHA 1UEZA 2E7KA 1N6EA 1N6FA 1J5KA 2DAZA 4PDBA 1W9OA 5ILBA 5GLJA 1N34H 3AXAA 1QAVA 4UU6A 3VQFA 4N6XA 1UF1A 1WFVA 2HH3A 2OQSA 4PQWA 1PQXA 2OS6A 2L4TA 2JIKA 4AMHA 1G9OA 1SOTA 5E11A 5BR8H 4JI6H 2JE6I 4DUYH 2PA1A 3ID2A 3CH8A 4GVCA 3TSWA 3KDGA 3K50A 2I0LA 4NMSA 5C0XG 3L4FD 4LF6H 2W7RA 5F3XA 4G08A 1VA8A 4X66H 4DR5H 5IT9W 4JI8H 4KFWA 3J80W 3R69A 2KOMA 2YT8A 4R2ZA 2Z9IA 2OPVA 4EC5A 4B8CD 3ID4A 4WALA 2KAWA 1ODHA 4JI2H 2LA8A 3WKMA 1ZZJA 1WFGA 2CTLA 2H3LA 4LFBH 3TMHA 1Q3OA 4LF5H 3ID3A 2FNEA 1XZ9A 1Z87A 3QD7X 1MC7A 1IU2A 2PT7G 4UU5A 4OCHA 4YHHH 4E3BA 3PDZA 1HNWH 2F4VH 5JXBA 1TUAA 2NN6G 3OSSD 5LMNH 2OSGA 4FJSA 2Z0SA
chains in the Genus database with same CATH topology
3R68A 2AINA 4DR2H 4NXRA 2EJYA 2UXDH 2VWRA 2KPKA 2HHHH 2M3MA 1W9QA 3DIWA 2VKCA 4GKKH 2VSPA 3DORA 2DB5A 3WKLA 2IWOA 4NMVA 1B8QA 5FHTA 4B3SH 2YUYA 2AWWA 2ZM6H 4REYA 4JOJA 2ENOA 2M0UA 4K76A 1TP5A 2QG1A 2CSSA 3T1YH 1XMOH 1AN7A 5HEDA 2JILA 3I4WA 1UEWA 1Q7XA 1OZIA 4FGMA 3OTPA 4NMTA 5HEBA 1WIFA 5EYZA 4B3RH 2KOHA 1UJUA 2UUCH 1OBXA 5HJ1A 3MH7A 2IWPA 3DJAA 2G2LA 1RGRA 1UITA 4OEOA 2O2TA 1V5QA 2M0ZA 5I7ZA 5EZ0A 4OEPA 5F67A 2YTWA 3GR5A 2K1ZA 4NZTM 3RLEA 2EDZA 4NXNH 1RY4A 3O46A 3LNXA 3NFLA 1BFEA 1YBOA 2I6VA 3QGLA 4MPAA 2VQFH 4L8NA 2YT7A 3MH4A 5LL6b 1NF3C 3DJ3A 2EGNA 2JINA 1UHPA 2I0IA 1MFGA 2EEGA 3SOEA 1QAVB 3KZDA 2FPHX 2F0AA 4DV0H 1HR0H 1FC6A 5LMUH 5DT9A 4DV7H 1LCYA 1WF8A 3CC0A 3GABA 5IWAH 3OTOH 4JOPA 4K6YA 1XNRH 4NXPA 1VCWA 1WG6A 3TSVA 2H3MA 2IWQA 2Z17A 2DC2A 3CS0A 2FCFA 3O5NA 2EAQA 3QIKA 1TQ3A 2OMJA 3EGGC 5HFFA 3NGHA 2HE4A 2AWXA 3I18A 3GDUA 4JJ3A 2EDPA 4AQYH 3QE1A 2D9IA 2D8IA 1U37A 4JI0H 4K75A 4Q3HA 4JOEA 4DUZH 4X62H 2G5MB 2DMZA 1WF7A 4GVDA 2I04A 4NNLA 3QO6A 2Q3GA 2DKRA 4JOFA 3OU0A 3TSZA 2OCSA 2V90A 3GJ9A 4RI0A 4G69A 3QDOA 4LF4H 4H11A 1F0XA 4K78A 2IWNA 2KJPA 4YDPA 1I92A 5G1EA 3RL8A 2JOAA 2UXBH 2MHOA 3HVQC 1OBYA 2M10A 1IHJA 4DV3H 1IBKH 3GGEA 2FE5A 5E6PB 1X6DA 4XHVA 2Y3MA 2D90A 5HETA 4JJ0A 1FC9A 1K32A 2PKTA 1FCFA 4LF7H 2PKUA 3RF2A 4B3TH 4Q2NA 2R3YA 1W9EA 2QKTA 3GCNA 2P3WA 4GKJH 4YY3H 4LFCH 1ZOKA 4K0KH 3OETA 2JREA 3GCOA 4O06A 2MX6A 2UZCA 1X9ZA 5A2QW 1GM1A 4DV5H 3LNYA 2I4SA 1IBLH 3CBXA 2FN5A 4K72A 3SFJA 2UXCH 2ZPLA 4DR6H 1FC7A 4E9JA 5D13A 2WL7A 3T1HH 3NFKA 4KFVA 1I94H 1SOZA 1N7EA 3ID1A 4WYUA 2KBSA 2OGPA 3GDSA 1V62A 1IU0A 2L4SA 3DJ1A 2RCZA 3KZEA 2UUBH 1WHAA 2E5LH 2CSJA 4LMMA 2KL1A 5IL9A 5HFDA 2KPLA 1TP3A 1U38A 3I1EA 1IBMH 2VRFA 2VQEH 4OD6A 4DR3H 3E17A 1HNZH 1WH1A 4DR4H 4JI3H 1GQ4A 1RZXA 4DV4H 1QAUA 2RRMA 2VPHA 2EHRA 1V1TA 4Q6SA 1RGWA 2M0VA 1WHDA 2K20A 4NMPA 2O4CA 2V1WA 4GHNA 4NXMH 1QLCA 5G1DA 3B76A 1WI2A 1I6UA 2H2BA 2I1NA 1N33H 1UEPA 1V5LA 5HFCA 1XMQH 2W4FA 1KWAA 1X45A 1P1EA 5FLXW 2VSVA 2KRGA 2JXOA 4OAJA 2EXGA 3PDVA 2DM8A 3K82A 1Y8TA 3CBZA 2KJKA 4B3MH 2JWEA 5FB8C 4JI4H 2KYLA 3PS4A 2M0TA 3PV5A 1P1DA 2EGKA 2OPGA 1Q3PA 1FKAH 4LF9H 4JOKA 2OZFA 5GNDA 2HE2A 5B42A 2KOJA 1N7FA 5E21A 3NCVA 2EV8A 3JAMW 4P0CA 2ZPMA 1Z86A 3GSLA 1U3BA 2H2CA 3EGHC 4NMRA 5HFEA 2KV8A 4JI5H 4NMOA 5HEYA 1ZUBA 2LUIA 1UM7A 1Y7NA 1N7TA 1VAEA 2X7ZA 4JL7A 3PV4A 3RL7A 4F8KA 4DV6H 5A2PA 2F5YA 4X64H 4YYXA 1X5QA 3KDKA 2QKVA 3BPUA 1R6JA 3JXTA 1WI4A 1N99A 1TE0A 4Z33A 4NZRM 3QJNA 1OBZA 2REYA 2EGOA 2JSNA 4DR7H 1UM1A 2PNTA 4E35A 1PDRA 2QKUA 2PZDA 4LF8H 1VJ6A 1L6OA 1UJVA 4E34A 4HOPB 2KG2A 1N36H 2CS5A 4JI1H 2LOBA 4EDJA 1I16A 4OX9H 5HF1A 4P2AB 1SEIA 3MH6A 3EZJA 3R0HA 2AWUA 1V6BA 5E22A 2LC7A 4Q2QA 2LF0A 4KHPH 4JORA 1NTEA 1N6DA 3SUZA 3SHWA 3FY5A 4NMQA 1GQ5A 2L97A 4HOPA 2LC6A 2R4HA 3SB1A 3J81W 4JV5H 4LFAH 4X65H 2EEIA 1UEQA 1UJDA 1FJGH 2KJDA 3ZRTA 2D92A 1U39A 1X5RA 2GZVA 3CYYA 1KEFA 3PV2A 4NNMA 1WJLA 2VZ5A 4DV2H 4Q2OA 3GDVA 5DTHA 5H3JA 3CBYA 5HF4A 1T2MA 4WYTA 2UU9H 3VQGA 5HFBA 2QBWA 2YUBA 2GEFA 5B6LA 2EEJA 3QJMA 4Z8JA 2DJTA 1XNQH 1VB7A 2BYGA 4JOGA 5HDYA 2HGAA 1M5ZA 1MFLA 3K1RA 1J5EH 2KQFA 4NXQA 4JYAH 4JOHA 2Q9VA 2QT5A 4DR1H 1KY9A 2DLUA 2KA9A 2DLSA 1HNXH 5E1YA 2PDZA 4IC6A 1D5GA 1UFXA 2ZQEA 4FLNA 4DV1H 1BE9A 3FAUA 2EDVA 3KHFA 3HPKA 4Q2PA 1S03G 3J7AK 2UUAH 1X8SA 1X5NA 3SHUA 4Q6HA 1N32H 3HPMA 3STJA 4JI7H 2EEHA 1UEZA 2E7KA 1N6EA 1N6FA 2DAZA 4PDBA 1W9OA 5ILBA 5GLJA 1N34H 3AXAA 1QAVA 4UU6A 3VQFA 4N6XA 1UF1A 1WFVA 2OQSA 4PQWA 2OS6A 2L4TA 2JIKA 4AMHA 1G9OA 1SOTA 5E11A 5BR8H 4JI6H 4DUYH 2PA1A 3ID2A 3CH8A 4GVCA 3TSWA 3KDGA 3K50A 2I0LA 4NMSA 4LF6H 3L4FD 2W7RA 5F3XA 4G08A 1VA8A 4X66H 4DR5H 5IT9W 4JI8H 4KFWA 3J80W 3R69A 2KOMA 2YT8A 4R2ZA 2Z9IA 4EC5A 4B8CD 3ID4A 2KAWA 1ODHA 4JI2H 2LA8A 3WKMA 1WFGA 2H3LA 4LFBH 3TMHA 1Q3OA 4LF5H 3ID3A 2FNEA 1XZ9A 1Z87A 3QD7X 1MC7A 1IU2A 2PT7G 4UU5A 4OCHA 4YHHH 4E3BA 3PDZA 1HNWH 2F4VH 5JXBA 3OSSD 5LMNH 2OSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KDK A;  3KDG A;  1X9Z A;  3NCV A;  3GAB A;  5B42 A; 
#chains in the Genus database with same CATH topology
 3R68 A;  2AIN A;  4DR2 H;  4NXR A;  2EJY A;  2UXD H;  2VWR A;  2KPK A;  2HHH H;  2M3M A;  1W9Q A;  3DIW A;  2VKC A;  4GKK H;  2G8Y A;  1KHM A;  2VSP A;  3DOR A;  2DB5 A;  3WKL A;  2P2R A;  3UOE A;  2IWO A;  4NMV A;  1B8Q A;  2JZX A;  5FHT A;  4B3S H;  1NXU A;  4H8A A;  2YUY A;  2AWW A;  2CTK A;  4REY A;  2ZM6 H;  4JOJ A;  2ENO A;  2M0U A;  2M6Q A;  4K76 A;  1TP5 A;  2QG1 A;  2CSS A;  3T1Y H;  1XMO H;  2CTE A;  3AEV B;  1AN7 A;  5HED A;  4AM3 A;  4OO1 G;  2JIL A;  3I4W A;  1UEW A;  1Q7X A;  1OZI A;  4FGM A;  3OTP A;  4NMT A;  5HEB A;  1WIF A;  1V8C A;  2LTL A;  2LTM A;  5EYZ A;  4B3R H;  2KOH A;  1UJU A;  2UUC H;  1OBX A;  5HJ1 A;  3MH7 A;  4BA2 I;  2IWP A;  3DJA A;  2G2L A;  1RGR A;  5JEA G;  1UIT A;  4OEO A;  2O2T A;  1V5Q A;  2M0Z A;  5I7Z A;  5EZ0 A;  4OEP A;  2FFM A;  5F67 A;  2YTW A;  3GR5 A;  2K1Z A;  4IFD G;  4NZT M;  2OPU A;  3RLE A;  2EDZ A;  2HH2 A;  4NXN H;  1RY4 A;  3O46 A;  3LNX A;  3NFL A;  1BFE A;  1YBO A;  2I6V A;  3QGL A;  4MPA A;  2VQF H;  1EC6 A;  4L8N A;  3GKU A;  2YT7 A;  3MH4 A;  5LL6 b;  1NF3 C;  3DJ3 A;  2EGN A;  2JIN A;  1UHP A;  2I0I A;  1MFG A;  2EEG A;  3SOE A;  1QAV B;  3KZD A;  1VBI A;  2FPH X;  2F0A A;  4DV0 H;  2CWF A;  2JA9 A;  4BA1 I;  1ZTG A;  1HR0 H;  1FC6 A;  5LMU H;  5DT9 A;  4DV7 H;  3V69 A;  1LCY A;  1WF8 A;  3CC0 A;  3GAB A;  5IWA H;  3OTO H;  1VIH A;  4JOP A;  4K6Y A;  1XNR H;  4NXP A;  1VCW A;  1WG6 A;  3TSV A;  2H3M A;  2IWQ A;  2Z17 A;  4FJU A;  2DC2 A;  3CS0 A;  2FCF A;  2A1S A;  3O5N A;  2EAQ A;  3QIK A;  1TQ3 A;  3L7Z C;  2OMJ A;  3EGG C;  1WVN A;  5HFF A;  3NGH A;  2HE4 A;  2CTF A;  2AWX A;  3I18 A;  3GDU A;  4JJ3 A;  2EDP A;  4AQY H;  3QE1 A;  2D9I A;  2D8I A;  1U37 A;  4JI0 H;  4K75 A;  4Q3H A;  4JOE A;  4DUZ H;  1ZZK A;  2ANR A;  4X62 H;  2G5M B;  2DMZ A;  1WF7 A;  4GVD A;  2I04 A;  4NNL A;  3QO6 A;  1DT4 A;  2Q3G A;  2DKR A;  4JOF A;  3OU0 A;  3TSZ A;  2OCS A;  2V90 A;  3GJ9 A;  4RI0 A;  1K1G A;  1XRH A;  4QMF B;  4G69 A;  3QDO A;  4LF4 H;  4H11 A;  1F0X A;  4K78 A;  2IWN A;  2KJP A;  4YDP A;  1I92 A;  5G1E A;  3RL8 A;  2JOA A;  1ZZI A;  2UXB H;  2MHO A;  3HVQ C;  1OBY A;  2M10 A;  2JEA I;  1IHJ A;  4DV3 H;  1IBK H;  3GGE A;  2FE5 A;  5E6P B;  2CPM A;  1X6D A;  4XHV A;  2Y3M A;  2D90 A;  2PQU A;  5HET A;  4JJ0 A;  1FC9 A;  1K32 A;  2PKT A;  4JVY A;  1FCF A;  4LF7 H;  2PKU A;  3RF2 A;  2M8W A;  4Q2N A;  4B3T H;  2R3Y A;  1W9E A;  2QKT A;  3GCN A;  2P3W A;  4GKJ H;  4YY3 H;  4LFC H;  1ZOK A;  4K0K H;  2PY9 A;  3OET A;  2JRE A;  3GCO A;  4O06 A;  2MX6 A;  2UZC A;  1X9Z A;  5A2Q W;  1GM1 A;  1X0A A;  4DV5 H;  3LNY A;  2I4S A;  1DTJ A;  1IBL H;  2QND A;  3CBX A;  2FN5 A;  4K72 A;  3SFJ A;  2UXC H;  2ZPL A;  4DR6 H;  1FC7 A;  4LIJ A;  4E9J A;  5D13 A;  1Z2I A;  2WL7 A;  3T1H H;  3NFK A;  4KFV A;  1I94 H;  1SOZ A;  1N7E A;  3ID1 A;  4WYU A;  2KBS A;  2FMR A;  2OGP A;  3GDS A;  1V62 A;  1IU0 A;  2L4S A;  3DJ1 A;  2RCZ A;  3KZE A;  2UUB H;  1WHA A;  2E5L H;  2CSJ A;  4LMM A;  1MSZ A;  2KL1 A;  5IL9 A;  5HFD A;  2KPL A;  2CTM A;  1TP3 A;  1U38 A;  3I1E A;  1IBM H;  2MJH A;  2VRF A;  2VQE H;  4OD6 A;  4DR3 H;  3E17 A;  1HNZ H;  1WH1 A;  4DR4 H;  4JI3 H;  1GQ4 A;  1RZX A;  4DV4 H;  1QAU A;  2RRM A;  2VPH A;  2EHR A;  1V1T A;  4Q6S A;  1RGW A;  2M0V A;  1WHD A;  2K20 A;  4NMP A;  2O4C A;  2V1W A;  1J4W A;  4GHN A;  1WTJ A;  4NXM H;  1QLC A;  1X4M A;  5G1D A;  3B76 A;  1WI2 A;  1I6U A;  4JVH A;  2H2B A;  1WE8 A;  2K1H A;  2I1N A;  1N33 H;  1UEP A;  1V5L A;  5HFC A;  1XMQ H;  2W4F A;  1UG8 A;  1KWA A;  1X45 A;  1V9N A;  1P1E A;  2JVZ A;  5FLX W;  2VSV A;  2KRG A;  2JXO A;  4OAJ A;  2EXG A;  3PDV A;  2DM8 A;  3K82 A;  1Y8T A;  3CBZ A;  2KJK A;  4B3M H;  2JWE A;  4NBQ A;  5FB8 C;  4JI4 H;  2KYL A;  3PS4 A;  2M0T A;  1WHR A;  3PV5 A;  1P1D A;  2EGK A;  2OPG A;  1Q3P A;  1FKA H;  4LF9 H;  4JOK A;  2OZF A;  5GND A;  2HE2 A;  5B42 A;  2KOJ A;  1N7F A;  5E21 A;  3NCV A;  2EV8 A;  3JAM W;  4P0C A;  2ZPM A;  5K36 G;  1Z86 A;  3GSL A;  1U3B A;  2H2C A;  3EGH C;  4NMR A;  5HFE A;  2KV8 A;  4JI5 H;  3VKE A;  4NMO A;  5HEY A;  1ZUB A;  2LUI A;  1UM7 A;  1Y7N A;  1N7T A;  1VAE A;  2X7Z A;  4JL7 A;  3PV4 A;  3RL7 A;  4F8K A;  4DV6 H;  5A2P A;  2F5Y A;  4X64 H;  4YYX A;  1X5Q A;  3KDK A;  2QKV A;  3BPU A;  1R6J A;  2LRR A;  3JXT A;  1WI4 A;  1N99 A;  1TE0 A;  4Z33 A;  4NZR M;  3QJN A;  1X4N A;  2BA0 A;  1OBZ A;  2REY A;  2EGO A;  2JSN A;  2BL5 A;  4DR7 H;  2DGR A;  1UM1 A;  2PNT A;  4E35 A;  1PDR A;  2QKU A;  2PZD A;  4LF8 H;  1VJ6 A;  1L6O A;  1UJV A;  4E34 A;  4HOP B;  2KG2 A;  2X06 A;  1N36 H;  2CS5 A;  2JEB I;  4JI1 H;  2LOB A;  2CTJ A;  4EDJ A;  1I16 A;  4OX9 H;  5HF1 A;  4P2A B;  1SEI A;  3MH6 A;  3EZJ A;  3R0H A;  2AWU A;  1V6B A;  5E22 A;  2LC7 A;  4Q2Q A;  2LF0 A;  4KHP H;  4JOR A;  1NTE A;  1N6D A;  3SUZ A;  3SHW A;  3FY5 A;  4NMQ A;  1GQ5 A;  2L97 A;  4HOP A;  2LC6 A;  2R4H A;  2YQR A;  3SB1 A;  3J81 W;  4JV5 H;  4LFA H;  4X65 H;  2EEI A;  1UEQ A;  3I0P A;  1UJD A;  1FJG H;  2KJD A;  3ZRT A;  2CWH A;  2D92 A;  4WAN A;  1U39 A;  1X5R A;  2GZV A;  3CYY A;  1KEF A;  3PV2 A;  4NNM A;  1WJL A;  2VZ5 A;  4DV2 H;  4Q2O A;  2CPQ A;  3GDV A;  5DTH A;  5H3J A;  3CBY A;  5HF4 A;  4AIM A;  1T2M A;  4WYT A;  2UU9 H;  3VQG A;  5HFB A;  2QBW A;  2YUB A;  2GEF A;  5B6L A;  2EEJ A;  3QJM A;  3U1K A;  4Z8J A;  2DJT A;  1XNQ H;  1VB7 A;  2BYG A;  4JOG A;  5HDY A;  2HGA A;  1M5Z A;  1MFL A;  3K1R A;  1J5E H;  2KQF A;  4NXQ A;  4JYA H;  4JOH A;  2Q9V A;  2QT5 A;  4DR1 H;  1KY9 A;  2DLU A;  2AXY A;  2KA9 A;  1S20 A;  2DLS A;  1HNX H;  5E1Y A;  2PDZ A;  4IC6 A;  1D5G A;  1UFX A;  2ZQE A;  4FLN A;  4DV1 H;  1BE9 A;  3FAU A;  2EDV A;  3KHF A;  3HPK A;  4Q2P A;  1S03 G;  4B8T A;  3J7A K;  2UUA H;  1X8S A;  1X5N A;  3SHU A;  4Q6H A;  2ANN A;  1N32 H;  3HPM A;  2E3U A;  3STJ A;  4JI7 H;  1VIG A;  2EEH A;  1UEZ A;  2E7K A;  1N6E A;  1N6F A;  1J5K A;  2DAZ A;  4PDB A;  1W9O A;  5ILB A;  5GLJ A;  1N34 H;  3AXA A;  1QAV A;  4UU6 A;  3VQF A;  4N6X A;  1UF1 A;  1WFV A;  2HH3 A;  2OQS A;  4PQW A;  1PQX A;  2OS6 A;  2L4T A;  2JIK A;  4AMH A;  1G9O A;  1SOT A;  5E11 A;  5BR8 H;  4JI6 H;  2JE6 I;  4DUY H;  2PA1 A;  3ID2 A;  3CH8 A;  4GVC A;  3TSW A;  3KDG A;  3K50 A;  2I0L A;  4NMS A;  5C0X G;  3L4F D;  4LF6 H;  2W7R A;  5F3X A;  4G08 A;  1VA8 A;  4X66 H;  4DR5 H;  5IT9 W;  4JI8 H;  4KFW A;  3J80 W;  3R69 A;  2KOM A;  2YT8 A;  4R2Z A;  2Z9I A;  2OPV A;  4EC5 A;  4B8C D;  3ID4 A;  4WAL A;  2KAW A;  1ODH A;  4JI2 H;  2LA8 A;  3WKM A;  1ZZJ A;  1WFG A;  2CTL A;  2H3L A;  4LFB H;  3TMH A;  1Q3O A;  4LF5 H;  3ID3 A;  2FNE A;  1XZ9 A;  1Z87 A;  3QD7 X;  1MC7 A;  1IU2 A;  2PT7 G;  4UU5 A;  4OCH A;  4YHH H;  4E3B A;  3PDZ A;  1HNW H;  2F4V H;  5JXB A;  1TUA A;  2NN6 G;  3OSS D;  5LMN H;  2OSG A;  4FJS A;  2Z0S A; 
#chains in the Genus database with same CATH homology
 3R68 A;  2AIN A;  4DR2 H;  4NXR A;  2EJY A;  2UXD H;  2VWR A;  2KPK A;  2HHH H;  2M3M A;  1W9Q A;  3DIW A;  2VKC A;  4GKK H;  2VSP A;  3DOR A;  2DB5 A;  3WKL A;  2IWO A;  4NMV A;  1B8Q A;  5FHT A;  4B3S H;  2YUY A;  2AWW A;  2ZM6 H;  4REY A;  4JOJ A;  2ENO A;  2M0U A;  4K76 A;  1TP5 A;  2QG1 A;  2CSS A;  3T1Y H;  1XMO H;  1AN7 A;  5HED A;  2JIL A;  3I4W A;  1UEW A;  1Q7X A;  1OZI A;  4FGM A;  3OTP A;  4NMT A;  5HEB A;  1WIF A;  5EYZ A;  4B3R H;  2KOH A;  1UJU A;  2UUC H;  1OBX A;  5HJ1 A;  3MH7 A;  2IWP A;  3DJA A;  2G2L A;  1RGR A;  1UIT A;  4OEO A;  2O2T A;  1V5Q A;  2M0Z A;  5I7Z A;  5EZ0 A;  4OEP A;  5F67 A;  2YTW A;  3GR5 A;  2K1Z A;  4NZT M;  3RLE A;  2EDZ A;  4NXN H;  1RY4 A;  3O46 A;  3LNX A;  3NFL A;  1BFE A;  1YBO A;  2I6V A;  3QGL A;  4MPA A;  2VQF H;  4L8N A;  2YT7 A;  3MH4 A;  5LL6 b;  1NF3 C;  3DJ3 A;  2EGN A;  2JIN A;  1UHP A;  2I0I A;  1MFG A;  2EEG A;  3SOE A;  1QAV B;  3KZD A;  2FPH X;  2F0A A;  4DV0 H;  1HR0 H;  1FC6 A;  5LMU H;  5DT9 A;  4DV7 H;  1LCY A;  1WF8 A;  3CC0 A;  3GAB A;  5IWA H;  3OTO H;  4JOP A;  4K6Y A;  1XNR H;  4NXP A;  1VCW A;  1WG6 A;  3TSV A;  2H3M A;  2IWQ A;  2Z17 A;  2DC2 A;  3CS0 A;  2FCF A;  3O5N A;  2EAQ A;  3QIK A;  1TQ3 A;  2OMJ A;  3EGG C;  5HFF A;  3NGH A;  2HE4 A;  2AWX A;  3I18 A;  3GDU A;  4JJ3 A;  2EDP A;  4AQY H;  3QE1 A;  2D9I A;  2D8I A;  1U37 A;  4JI0 H;  4K75 A;  4Q3H A;  4JOE A;  4DUZ H;  4X62 H;  2G5M B;  2DMZ A;  1WF7 A;  4GVD A;  2I04 A;  4NNL A;  3QO6 A;  2Q3G A;  2DKR A;  4JOF A;  3OU0 A;  3TSZ A;  2OCS A;  2V90 A;  3GJ9 A;  4RI0 A;  4G69 A;  3QDO A;  4LF4 H;  4H11 A;  1F0X A;  4K78 A;  2IWN A;  2KJP A;  4YDP A;  1I92 A;  5G1E A;  3RL8 A;  2JOA A;  2UXB H;  2MHO A;  3HVQ C;  1OBY A;  2M10 A;  1IHJ A;  4DV3 H;  1IBK H;  3GGE A;  2FE5 A;  5E6P B;  1X6D A;  4XHV A;  2Y3M A;  2D90 A;  5HET A;  4JJ0 A;  1FC9 A;  1K32 A;  2PKT A;  1FCF A;  4LF7 H;  2PKU A;  3RF2 A;  4B3T H;  4Q2N A;  2R3Y A;  1W9E A;  2QKT A;  3GCN A;  2P3W A;  4GKJ H;  4YY3 H;  4LFC H;  1ZOK A;  4K0K H;  3OET A;  2JRE A;  3GCO A;  4O06 A;  2MX6 A;  2UZC A;  1X9Z A;  5A2Q W;  1GM1 A;  4DV5 H;  3LNY A;  2I4S A;  1IBL H;  3CBX A;  2FN5 A;  4K72 A;  3SFJ A;  2UXC H;  2ZPL A;  4DR6 H;  1FC7 A;  4E9J A;  5D13 A;  2WL7 A;  3T1H H;  3NFK A;  4KFV A;  1I94 H;  1SOZ A;  1N7E A;  3ID1 A;  4WYU A;  2KBS A;  2OGP A;  3GDS A;  1V62 A;  1IU0 A;  2L4S A;  3DJ1 A;  2RCZ A;  3KZE A;  2UUB H;  1WHA A;  2E5L H;  2CSJ A;  4LMM A;  2KL1 A;  5IL9 A;  5HFD A;  2KPL A;  1TP3 A;  1U38 A;  3I1E A;  1IBM H;  2VRF A;  2VQE H;  4OD6 A;  4DR3 H;  3E17 A;  1HNZ H;  1WH1 A;  4DR4 H;  4JI3 H;  1GQ4 A;  1RZX A;  4DV4 H;  1QAU A;  2RRM A;  2VPH A;  2EHR A;  1V1T A;  4Q6S A;  1RGW A;  2M0V A;  1WHD A;  2K20 A;  4NMP A;  2O4C A;  2V1W A;  4GHN A;  4NXM H;  1QLC A;  5G1D A;  3B76 A;  1WI2 A;  1I6U A;  2H2B A;  2I1N A;  1N33 H;  1UEP A;  1V5L A;  5HFC A;  1XMQ H;  2W4F A;  1KWA A;  1X45 A;  1P1E A;  5FLX W;  2VSV A;  2KRG A;  2JXO A;  4OAJ A;  2EXG A;  3PDV A;  2DM8 A;  3K82 A;  1Y8T A;  3CBZ A;  2KJK A;  4B3M H;  2JWE A;  5FB8 C;  4JI4 H;  2KYL A;  3PS4 A;  2M0T A;  3PV5 A;  1P1D A;  2EGK A;  2OPG A;  1Q3P A;  1FKA H;  4LF9 H;  4JOK A;  2OZF A;  5GND A;  2HE2 A;  5B42 A;  2KOJ A;  1N7F A;  5E21 A;  3NCV A;  2EV8 A;  3JAM W;  4P0C A;  2ZPM A;  1Z86 A;  3GSL A;  1U3B A;  2H2C A;  3EGH C;  4NMR A;  5HFE A;  2KV8 A;  4JI5 H;  4NMO A;  5HEY A;  1ZUB A;  2LUI A;  1UM7 A;  1Y7N A;  1N7T A;  1VAE A;  2X7Z A;  4JL7 A;  3PV4 A;  3RL7 A;  4F8K A;  4DV6 H;  5A2P A;  2F5Y A;  4X64 H;  4YYX A;  1X5Q A;  3KDK A;  2QKV A;  3BPU A;  1R6J A;  3JXT A;  1WI4 A;  1N99 A;  1TE0 A;  4Z33 A;  4NZR M;  3QJN A;  1OBZ A;  2REY A;  2EGO A;  2JSN A;  4DR7 H;  1UM1 A;  2PNT A;  4E35 A;  1PDR A;  2QKU A;  2PZD A;  4LF8 H;  1VJ6 A;  1L6O A;  1UJV A;  4E34 A;  4HOP B;  2KG2 A;  1N36 H;  2CS5 A;  4JI1 H;  2LOB A;  4EDJ A;  1I16 A;  4OX9 H;  5HF1 A;  4P2A B;  1SEI A;  3MH6 A;  3EZJ A;  3R0H A;  2AWU A;  1V6B A;  5E22 A;  2LC7 A;  4Q2Q A;  2LF0 A;  4KHP H;  4JOR A;  1NTE A;  1N6D A;  3SUZ A;  3SHW A;  3FY5 A;  4NMQ A;  1GQ5 A;  2L97 A;  4HOP A;  2LC6 A;  2R4H A;  3SB1 A;  3J81 W;  4JV5 H;  4LFA H;  4X65 H;  2EEI A;  1UEQ A;  1UJD A;  1FJG H;  2KJD A;  3ZRT A;  2D92 A;  1U39 A;  1X5R A;  2GZV A;  3CYY A;  1KEF A;  3PV2 A;  4NNM A;  1WJL A;  2VZ5 A;  4DV2 H;  4Q2O A;  3GDV A;  5DTH A;  5H3J A;  3CBY A;  5HF4 A;  1T2M A;  4WYT A;  2UU9 H;  3VQG A;  5HFB A;  2QBW A;  2YUB A;  2GEF A;  5B6L A;  2EEJ A;  3QJM A;  4Z8J A;  2DJT A;  1XNQ H;  1VB7 A;  2BYG A;  4JOG A;  5HDY A;  2HGA A;  1M5Z A;  1MFL A;  3K1R A;  1J5E H;  2KQF A;  4NXQ A;  4JYA H;  4JOH A;  2Q9V A;  2QT5 A;  4DR1 H;  1KY9 A;  2DLU A;  2KA9 A;  2DLS A;  1HNX H;  5E1Y A;  2PDZ A;  4IC6 A;  1D5G A;  1UFX A;  2ZQE A;  4FLN A;  4DV1 H;  1BE9 A;  3FAU A;  2EDV A;  3KHF A;  3HPK A;  4Q2P A;  1S03 G;  3J7A K;  2UUA H;  1X8S A;  1X5N A;  3SHU A;  4Q6H A;  1N32 H;  3HPM A;  3STJ A;  4JI7 H;  2EEH A;  1UEZ A;  2E7K A;  1N6E A;  1N6F A;  2DAZ A;  4PDB A;  1W9O A;  5ILB A;  5GLJ A;  1N34 H;  3AXA A;  1QAV A;  4UU6 A;  3VQF A;  4N6X A;  1UF1 A;  1WFV A;  2OQS A;  4PQW A;  2OS6 A;  2L4T A;  2JIK A;  4AMH A;  1G9O A;  1SOT A;  5E11 A;  5BR8 H;  4JI6 H;  4DUY H;  2PA1 A;  3ID2 A;  3CH8 A;  4GVC A;  3TSW A;  3KDG A;  3K50 A;  2I0L A;  4NMS A;  4LF6 H;  3L4F D;  2W7R A;  5F3X A;  4G08 A;  1VA8 A;  4X66 H;  4DR5 H;  5IT9 W;  4JI8 H;  4KFW A;  3J80 W;  3R69 A;  2KOM A;  2YT8 A;  4R2Z A;  2Z9I A;  4EC5 A;  4B8C D;  3ID4 A;  2KAW A;  1ODH A;  4JI2 H;  2LA8 A;  3WKM A;  1WFG A;  2H3L A;  4LFB H;  3TMH A;  1Q3O A;  4LF5 H;  3ID3 A;  2FNE A;  1XZ9 A;  1Z87 A;  3QD7 X;  1MC7 A;  1IU2 A;  2PT7 G;  4UU5 A;  4OCH A;  4YHH H;  4E3B A;  3PDZ A;  1HNW H;  2F4V H;  5JXB A;  3OSS D;  5LMN H;  2OSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...