3GABA

C-terminal domain of bacillus subtilis mutl crystal form i
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
190
structure length
183
Chain Sequence
RVPIMYPIGQMHGTYILAQNENGLYIIDQHAAQERIKYEYFREKVGEPEVQEMIVPLTFHYSTNEALIIEQHKQELESVGVFLESFGSNSYIVRCHPAWFPKGEEAELIEEIIQQVLDSKNIDIKKLREEAAIMMSCKNRHLRNDEIKALLDDLRSTSDPFTCPHGRPIIIHHSTYEMEKMFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA mismatch repair protein mutL
publication title Structure of the endonuclease domain of MutL: unlicensed to cut.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 53
structure length 183
sequence length 190
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08676 MutL_C MutL C terminal dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.20 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3gabA01
3.30.1370.100 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3gabA02
1X9ZA 3KDGA 5B42A 3GABA 3KDKA 3NCVA
chains in the Genus database with same CATH superfamily
3HVQC 5HETA 4H8AA 3KDGA 1ZOKA 1L6OA 2I0IA 3WKMA 2FNEA 1N7TA 4FGMA 2YTWA 4OD6A 1HNZH 3QJNA 3I4WA 1N32H 2QKTA 4B3MH 4H11A 4NNLA 2UUAH 2EAQA 5HEBA 1VIGA 4NZRM 3NFKA 1PQXA 4NMPA 1N6DA 2K20A 3K1RA 2EEGA 2EGKA 2EEJA 4JI8H 1R6JA 1OBXA 4JOFA 5C0XG 2JEAI 4F8KA 2Z0SA 5A2PA 1GQ5A 3DJ1A 1FC9A 3R68A 4IC6A 4B3SH 4JOPA 2M3MA 3PV4A 1I94H 4JJ0A 5BR8H 3ID3A 1LCYA 2FE5A 3QDOA 4WALA 1N33H 2LUIA 2JOAA 2YT7A 1ODHA 1N99A 1U38A 4L8NA 2M0ZA 4Q2NA 4LF5H 5HFCA 2CS5A 2VKCA 3AEVB 4NMRA 1GQ4A 1N7EA 1WF8A 2M8WA 3O46A 4NMTA 3TMHA 2GEFA 1WTJA 2OS6A 2Z9IA 2P3WA 1V62A 2L97A 4NBQA 2AWXA 2E5LH 2BL5A 2H3MA 4Q6SA 5E11A 5H3JA 4Z8JA 2LTMA 5DT9A 2QG1A 1FJGH 4IFDG 4JV5H 3NCVA 2YQRA 4EC5A 4OAJA 2AXYA 2IWNA 2QKUA 4LF7H 1X5RA 2DAZA 4AM3A 1OBZA 2KQFA 3VQFA 2F5YA 2REYA 2UZCA 4DR3H 4PDBA 3AXAA 3OSSD 5IT9W 2M0UA 3OTPA 2LRRA 1QAVA 2FPHX 4G69A 2EXGA 2VPHA 5JXBA 1TP5A 5ILBA 3NGHA 3STJA 4OEOA 1YBOA 1X8SA 3GJ9A 1Q3OA 4YY3H 4LFAH 4NXMH 2DC2A 1RY4A 4E34A 5HFDA 4DR2H 1DTJA 2CPQA 5HEYA 2ZM6H 3DIWA 3TSVA 1F0XA 2OCSA 2VSPA 3J7AK 2EEHA 4DR1H 2HE2A 4OCHA 4FLNA 2YUYA 3QIKA 4E35A 2VWRA 1RZXA 2D9IA 2OMJA 1ZZJA 3LNYA 2DB5A 3OETA 3SFJA 1VIHA 1NTEA 1UFXA 4JI2H 1U39A 5FB8C 2CWFA 4DV6H 4LIJA 2DJTA 2I0LA 4P0CA 5IWAH 4LFCH 1X4NA 4JI3H 3QO6A 2JREA 2AINA 1WJLA 4GVDA 4REYA 2H3LA 4Z33A 3RL8A 2MX6A 1ZTGA 1VCWA 2QNDA 4N6XA 4DUYH 2PQUA 1PDRA 1UG8A 2P2RA 2Q3GA 2LTLA 1UJVA 3FY5A 3QJMA 1V6BA 2NN6G 4NZTM 4HOPB 2L4TA 5HF1A 2M6QA 4Q3HA 3ZRTA 3PV2A 5HFFA 1UITA 2D90A 4UU6A 2QT5A 4Q6HA 2UU9H 2BA0A 2UXBH 1WI2A 1RGWA 1NXUA 3MH7A 1V5QA 2Z17A 2E3UA 4K76A 1IBMH 2IWOA 4DR7H 3BPUA 5F3XA 4JI6H 2RRMA 3WKLA 4O06A 1B8QA 2PKTA 4XHVA 1BFEA 5LMUH 1V9NA 2YT8A 2CTMA 2KL1A 3GKUA 5A2QW 4K6YA 5JEAG 1KY9A 5FHTA 2E7KA 1OBYA 2DLUA 4OX9H 4DV7H 1W9EA 5HJ1A 2ZPMA 1WHRA 2I4SA 2LA8A 1AN7A 2JXOA 4LMMA 3CBXA 4Q2QA 2HHHH 2DLSA 3GCOA 2FMRA 4WANA 2CTLA 3E17A 3GSLA 1V1TA 4FJSA 4QMFB 1ZUBA 1D5GA 2MJHA 4DV5H 1N34H 2JVZA 3DJ3A 1X0AA 1IU2A 2Q9VA 5DTHA 3KDKA 4DV2H 3OU0A 5HDYA 3ID2A 3T1YH 4K78A 1V8CA 2H2BA 2PKUA 3GR5A 1N7FA 4NMQA 3UOEA 4PQWA 1MFGA 1QAVB 5GLJA 4AIMA 5K36G 3L7ZC 1TP3A 2CTKA 2YUBA 4K0KH 1J5KA 5IL9A 1UEWA 2KOMA 5HFEA 4K75A 1BE9A 1FC6A 4LF4H 1Z86A 3PDZA 4JL7A 4OEPA 3O5NA 1X5NA 4NMOA 2W7RA 3I1EA 1S20A 4X66H 3SHWA 1UHPA 3RL7A 2GZVA 4YDPA 1UM1A 1N36H 2I6VA 3SOEA 1WHDA 1TUAA 4NMSA 2QBWA 3NFLA 2KA9A 2EGNA 3K82A 3HPMA 2EHRA 1WVNA 2KJPA 4DUZH 4JI0H 1WIFA 4KFWA 1W9QA 5G1DA 2A1SA 3GDUA 2O4CA 1FKAH 4B3RH 3T1HH 1X6DA 2AWUA 2F0AA 2CTFA 4JI4H 2KAWA 2JE6I 1K32A 4NNMA 5G1EA 3J81W 1WE8A 3EGHC 3TSZA 3GDVA 1DT4A 3U1KA 5F67A 2PZDA 4JOHA 4OO1G 2VZ5A 2KPLA 5B42A 2ZQEA 5LL6b 4EDJA 4DV3H 1S03G 2LF0A 2ANRA 1SEIA 1QLCA 2JILA 4JVYA 1EC6A 1IU0A 2G8YA 2FCFA 2PDZA 1X45A 1FCFA 1Y7NA 1WG6A 2KBSA 3SB1A 5HF4A 1ZZIA 1HNXH 4JJ3A 1IBLH 4DR5H 2KJDA 1UJDA 3DORA 1UEQA 1WHAA 5E1YA 2EDPA 2OPGA 1UM7A 2EV8A 4E3BA 2X7ZA 1VBIA 3R0HA 4B8CD 1XNRH 4JOGA 4X65H 5B6LA 1Z2IA 3J80W 4DV4H 2FFMA 3CS0A 1I92A 1GM1A 4FJUA 2OZFA 2I04A 2UUCH 2LC7A 3QGLA 2PA1A 1X9ZA 2EJYA 2R3YA 2ENOA 4GHNA 3RLEA 1J4WA 3JXTA 1I16A 2UXCH 2G2LA 2HH3A 2PT7G 3R69A 3RF2A 1X5QA 3CH8A 2CPMA 2CSSA 4DV0H 1W9OA 1TE0A 2MHOA 2X06A 2OPUA 2I1NA 2R4HA 3QE1A 2BYGA 3TSWA 1IHJA 2UXDH 1M5ZA 4JVHA 2KYLA 2OSGA 2VRFA 2W4FA 1RGRA 2F4VH 1KWAA 4YYXA 4JI1H 2WL7A 4X62H 1Z87A 2V90A 1Q3PA 2ANNA 3QD7X 1WFGA 5EZ0A 3GABA 5FLXW 2LOBA 2VQEH 2KOHA 2VSVA 2EGOA 4HOPA 5D13A 4G08A 3V69A 2OQSA 1MC7A 1QAUA 1XNQH 5E21A 2EDVA 3PDVA 2CTJA 4JOJA 3JAMW 3OTOH 5E6PB 2FN5A 1P1EA 2D92A 2D8IA 2K1HA 4E9JA 2KV8A 1UEPA 4RI0A 2IWPA 2PNTA 3CBYA 4K72A 4GKKH 2HGAA 2DMZA 1KHMA 3DJAA 3GDSA 5HFBA 3ID1A 4JOEA 3SHUA 1IBKH 1UEZA 3VQGA 2JINA 1ZZKA 1MSZA 2EDZA 1FC7A 2KJKA 2QKVA 1XZ9A 3EGGC 3MH4A 2RCZA 3I18A 1HNWH 3K50A 1WI4A 2KOJA 4NXQA 1VJ6A 2DM8A 4JOKA 2JZXA 4KFVA 4JYAH 3ID4A 2H2CA 2Y3MA 4AQYH 2ZPLA 1WFVA 2JIKA 2M0TA 5I7ZA 1K1GA 1U37A 3CBZA 1SOZA 2OGPA 1XMQH 1WF7A 1Y8TA 4NXNH 2IWQA 2DKRA 2CTEA 3PV5A 4LF8H 4JI7H 2CWHA 4UU5A 2PY9A 4KHPH 2V1WA 3FAUA 4WYUA 1VA8A 2HE4A 1VB7A 2KPKA 1N6EA 2G5MB 4GKJH 1UJUA 1V5LA 2JWEA 1G9OA 1J5EH 4LF9H 4LF6H 1Q7XA 3GGEA 3LNXA 4BA2I 1XRHA 1N6FA 2UUBH 1MFLA 4DV1H 2K1ZA 5E22A 4AMHA 2OPVA 3PS4A 2AWWA 1UF1A 2JA9A 3HPKA 4JORA 4MPAA 5EYZA 3CC0A 4WYTA 4NXPA 4NXRA 3I0PA 1T2MA 1X4MA 1XMOH 1I6UA 3KZEA 4Q2PA 4B3TH 4YHHH 2LC6A 3CYYA 2KG2A 3L4FD 3SUZA 4P2AB 2JSNA 5LMNH 1HR0H 4DR4H 1U3BA 2CSJA 3KZDA 4Q2OA 1OZIA 5GNDA 2HH2A 1KEFA 2VQFH 3B76A 2M0VA 2M10A 2KRGA 4DR6H 2O2TA 1TQ3A 3EZJA 5HEDA 4X64H 1WH1A 1NF3C 4GVCA 4NMVA 4BA1I 3GCNA 4R2ZA 1VAEA 2JEBI 2EEIA 2L4SA 3MH6A 3KHFA 1P1DA 4JI5H 1SOTA 4B8TA 4LFBH 2DGRA 3VKEA
chains in the Genus database with same CATH topology
3HVQC 5HETA 3KDGA 1ZOKA 1L6OA 2I0IA 3WKMA 2FNEA 1N7TA 4FGMA 2YTWA 4OD6A 1HNZH 3QJNA 3I4WA 1N32H 2QKTA 4B3MH 4H11A 4NNLA 2UUAH 2EAQA 5HEBA 4NZRM 3NFKA 4NMPA 1N6DA 2K20A 3K1RA 2EEGA 2EGKA 2EEJA 4JI8H 1R6JA 1OBXA 4JOFA 4F8KA 5A2PA 1GQ5A 3DJ1A 1FC9A 3R68A 4IC6A 4B3SH 4JOPA 2M3MA 3PV4A 1I94H 4JJ0A 5BR8H 3ID3A 1LCYA 2FE5A 3QDOA 1N33H 2LUIA 2JOAA 2YT7A 1ODHA 1N99A 1U38A 4L8NA 2M0ZA 4Q2NA 4LF5H 5HFCA 2CS5A 2VKCA 4NMRA 1GQ4A 1N7EA 1WF8A 3O46A 4NMTA 3TMHA 2GEFA 2OS6A 2Z9IA 2P3WA 1V62A 2L97A 2AWXA 2E5LH 2H3MA 4Q6SA 5E11A 5H3JA 4Z8JA 5DT9A 2QG1A 1FJGH 4JV5H 3NCVA 4EC5A 4OAJA 2IWNA 2QKUA 4LF7H 1X5RA 2DAZA 1OBZA 2KQFA 3VQFA 2F5YA 2REYA 2UZCA 4DR3H 4PDBA 3AXAA 3OSSD 5IT9W 2M0UA 3OTPA 1QAVA 2FPHX 4G69A 2EXGA 2VPHA 5JXBA 1TP5A 5ILBA 3NGHA 3STJA 4OEOA 1YBOA 1X8SA 3GJ9A 1Q3OA 4YY3H 4LFAH 4NXMH 2DC2A 1RY4A 4E34A 5HFDA 4DR2H 5HEYA 2ZM6H 3DIWA 3TSVA 1F0XA 2OCSA 2VSPA 3J7AK 2EEHA 4DR1H 2HE2A 4OCHA 4FLNA 2YUYA 3QIKA 4E35A 2VWRA 1RZXA 2D9IA 2OMJA 3LNYA 2DB5A 3OETA 3SFJA 1NTEA 1UFXA 4JI2H 1U39A 5FB8C 4DV6H 2DJTA 2I0LA 4P0CA 5IWAH 4LFCH 4JI3H 3QO6A 2JREA 2AINA 1WJLA 4GVDA 4REYA 2H3LA 4Z33A 3RL8A 2MX6A 1VCWA 4N6XA 4DUYH 1PDRA 2Q3GA 1UJVA 3FY5A 3QJMA 1V6BA 4NZTM 4HOPB 2L4TA 5HF1A 4Q3HA 3ZRTA 3PV2A 5HFFA 1UITA 2D90A 4UU6A 2QT5A 4Q6HA 2UU9H 2UXBH 1WI2A 1RGWA 3MH7A 1V5QA 2Z17A 4K76A 1IBMH 2IWOA 4DR7H 3BPUA 5F3XA 4JI6H 2RRMA 3WKLA 4O06A 1B8QA 2PKTA 4XHVA 1BFEA 5LMUH 2YT8A 2KL1A 5A2QW 4K6YA 1KY9A 5FHTA 2E7KA 1OBYA 2DLUA 4OX9H 4DV7H 1W9EA 5HJ1A 2ZPMA 2I4SA 2LA8A 1AN7A 2JXOA 4LMMA 3CBXA 4Q2QA 2HHHH 2DLSA 3GCOA 3E17A 3GSLA 1V1TA 1ZUBA 1D5GA 4DV5H 1N34H 3DJ3A 1IU2A 2Q9VA 5DTHA 3KDKA 4DV2H 3OU0A 5HDYA 3ID2A 3T1YH 4K78A 2H2BA 2PKUA 3GR5A 1N7FA 4NMQA 4PQWA 1MFGA 1QAVB 5GLJA 1TP3A 2YUBA 4K0KH 5IL9A 1UEWA 2KOMA 5HFEA 4K75A 1BE9A 1FC6A 4LF4H 1Z86A 3PDZA 4JL7A 4OEPA 3O5NA 1X5NA 4NMOA 2W7RA 3I1EA 4X66H 3SHWA 1UHPA 3RL7A 2GZVA 4YDPA 1UM1A 1N36H 2I6VA 3SOEA 1WHDA 4NMSA 2QBWA 3NFLA 2KA9A 2EGNA 3K82A 3HPMA 2EHRA 4JI0H 2KJPA 4DUZH 1WIFA 4KFWA 1W9QA 5G1DA 1FKAH 3GDUA 2O4CA 4B3RH 3T1HH 1X6DA 2AWUA 2F0AA 4JI4H 2KAWA 1K32A 4NNMA 5G1EA 3J81W 3EGHC 3TSZA 3GDVA 5F67A 2PZDA 4JOHA 2VZ5A 2KPLA 5B42A 2ZQEA 5LL6b 4EDJA 4DV3H 1S03G 2LF0A 1SEIA 1QLCA 2JILA 1IU0A 2FCFA 2PDZA 1X45A 1FCFA 1Y7NA 1WG6A 2KBSA 3SB1A 5HF4A 1HNXH 1IBLH 4JJ3A 4DR5H 2KJDA 1UJDA 3DORA 1UEQA 1WHAA 5E1YA 2EDPA 2OPGA 1UM7A 2EV8A 4E3BA 2X7ZA 3R0HA 4B8CD 1XNRH 4JOGA 4X65H 5B6LA 3J80W 4DV4H 3CS0A 1I92A 1GM1A 2OZFA 2I04A 2UUCH 2LC7A 3QGLA 2PA1A 1X9ZA 2EJYA 2R3YA 2ENOA 4GHNA 3RLEA 2UXCH 3JXTA 1I16A 2G2LA 2PT7G 3R69A 3RF2A 1X5QA 3CH8A 2CSSA 4DV0H 1W9OA 1TE0A 2MHOA 2I1NA 2R4HA 3QE1A 2BYGA 3TSWA 1IHJA 2UXDH 1M5ZA 2KYLA 2OSGA 2VRFA 2W4FA 1RGRA 2F4VH 1KWAA 4YYXA 4JI1H 2WL7A 4X62H 1Z87A 2V90A 1Q3PA 3QD7X 1WFGA 5EZ0A 3GABA 5FLXW 2LOBA 2VQEH 2KOHA 2VSVA 2EGOA 4HOPA 5D13A 4G08A 2OQSA 1MC7A 1QAUA 1XNQH 5E21A 2EDVA 3PDVA 3JAMW 4JOJA 3OTOH 5E6PB 2FN5A 1P1EA 2D92A 2D8IA 4E9JA 2KV8A 1UEPA 4RI0A 2IWPA 2PNTA 3CBYA 4K72A 4GKKH 2HGAA 2DMZA 3DJAA 3GDSA 5HFBA 3ID1A 4JOEA 3SHUA 1IBKH 1UEZA 3VQGA 2JINA 2EDZA 1FC7A 2KJKA 2QKVA 1XZ9A 3EGGC 3MH4A 2RCZA 3I18A 1HNWH 3K50A 1WI4A 2KOJA 4NXQA 1VJ6A 2DM8A 4JOKA 4KFVA 4JYAH 3ID4A 2H2CA 2Y3MA 4AQYH 2ZPLA 1WFVA 2JIKA 2M0TA 5I7ZA 1U37A 3CBZA 1SOZA 2OGPA 1XMQH 1WF7A 1Y8TA 4NXNH 2IWQA 2DKRA 3PV5A 4LF8H 4JI7H 4UU5A 4KHPH 2V1WA 3FAUA 4WYUA 1VA8A 2HE4A 1VB7A 2KPKA 1N6EA 2G5MB 4GKJH 1UJUA 1V5LA 2JWEA 1G9OA 1J5EH 4LF9H 4LF6H 1Q7XA 3GGEA 3LNXA 1N6FA 2UUBH 1MFLA 4DV1H 2K1ZA 5E22A 4AMHA 3PS4A 2AWWA 1UF1A 3HPKA 4JORA 4MPAA 5EYZA 3CC0A 4WYTA 4NXPA 4NXRA 1T2MA 1XMOH 1I6UA 3KZEA 4Q2PA 4B3TH 4YHHH 2LC6A 3CYYA 2KG2A 3L4FD 3SUZA 4P2AB 2JSNA 5LMNH 1HR0H 4DR4H 1U3BA 2CSJA 3KZDA 4Q2OA 1OZIA 5GNDA 1KEFA 2VQFH 3B76A 2M0VA 2M10A 2KRGA 4DR6H 2O2TA 1TQ3A 3EZJA 5HEDA 4X64H 1WH1A 1NF3C 4GVCA 4NMVA 3GCNA 4R2ZA 1VAEA 2EEIA 2L4SA 3MH6A 3KHFA 1P1DA 4JI5H 1SOTA 4LFBH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X9Z A;  3KDG A;  5B42 A;  3GAB A;  3KDK A;  3NCV A; 
#chains in the Genus database with same CATH topology
 3HVQ C;  5HET A;  4H8A A;  3KDG A;  1ZOK A;  1L6O A;  2I0I A;  3WKM A;  2FNE A;  1N7T A;  4FGM A;  2YTW A;  4OD6 A;  1HNZ H;  3QJN A;  3I4W A;  1N32 H;  2QKT A;  4B3M H;  4H11 A;  4NNL A;  2UUA H;  2EAQ A;  5HEB A;  1VIG A;  4NZR M;  3NFK A;  1PQX A;  4NMP A;  1N6D A;  2K20 A;  3K1R A;  2EEG A;  2EGK A;  2EEJ A;  4JI8 H;  1R6J A;  1OBX A;  4JOF A;  5C0X G;  2JEA I;  4F8K A;  2Z0S A;  5A2P A;  1GQ5 A;  3DJ1 A;  1FC9 A;  3R68 A;  4IC6 A;  4B3S H;  4JOP A;  2M3M A;  3PV4 A;  1I94 H;  4JJ0 A;  5BR8 H;  3ID3 A;  1LCY A;  2FE5 A;  3QDO A;  4WAL A;  1N33 H;  2LUI A;  2JOA A;  2YT7 A;  1ODH A;  1N99 A;  1U38 A;  4L8N A;  2M0Z A;  4Q2N A;  4LF5 H;  5HFC A;  2CS5 A;  2VKC A;  3AEV B;  4NMR A;  1GQ4 A;  1N7E A;  1WF8 A;  2M8W A;  3O46 A;  4NMT A;  3TMH A;  2GEF A;  1WTJ A;  2OS6 A;  2Z9I A;  2P3W A;  1V62 A;  2L97 A;  4NBQ A;  2AWX A;  2E5L H;  2BL5 A;  2H3M A;  4Q6S A;  5E11 A;  5H3J A;  4Z8J A;  2LTM A;  5DT9 A;  2QG1 A;  1FJG H;  4IFD G;  4JV5 H;  3NCV A;  2YQR A;  4EC5 A;  4OAJ A;  2AXY A;  2IWN A;  2QKU A;  4LF7 H;  1X5R A;  2DAZ A;  4AM3 A;  1OBZ A;  2KQF A;  3VQF A;  2F5Y A;  2REY A;  2UZC A;  4DR3 H;  4PDB A;  3AXA A;  3OSS D;  5IT9 W;  2M0U A;  3OTP A;  2LRR A;  1QAV A;  2FPH X;  4G69 A;  2EXG A;  2VPH A;  5JXB A;  1TP5 A;  5ILB A;  3NGH A;  3STJ A;  4OEO A;  1YBO A;  1X8S A;  3GJ9 A;  1Q3O A;  4YY3 H;  4LFA H;  4NXM H;  2DC2 A;  1RY4 A;  4E34 A;  5HFD A;  4DR2 H;  1DTJ A;  2CPQ A;  5HEY A;  2ZM6 H;  3DIW A;  3TSV A;  1F0X A;  2OCS A;  2VSP A;  3J7A K;  2EEH A;  4DR1 H;  2HE2 A;  4OCH A;  4FLN A;  2YUY A;  3QIK A;  4E35 A;  2VWR A;  1RZX A;  2D9I A;  2OMJ A;  1ZZJ A;  3LNY A;  2DB5 A;  3OET A;  3SFJ A;  1VIH A;  1NTE A;  1UFX A;  4JI2 H;  1U39 A;  5FB8 C;  2CWF A;  4DV6 H;  4LIJ A;  2DJT A;  2I0L A;  4P0C A;  5IWA H;  4LFC H;  1X4N A;  4JI3 H;  3QO6 A;  2JRE A;  2AIN A;  1WJL A;  4GVD A;  4REY A;  2H3L A;  4Z33 A;  3RL8 A;  2MX6 A;  1ZTG A;  1VCW A;  2QND A;  4N6X A;  4DUY H;  2PQU A;  1PDR A;  1UG8 A;  2P2R A;  2Q3G A;  2LTL A;  1UJV A;  3FY5 A;  3QJM A;  1V6B A;  2NN6 G;  4NZT M;  4HOP B;  2L4T A;  5HF1 A;  2M6Q A;  4Q3H A;  3ZRT A;  3PV2 A;  5HFF A;  1UIT A;  2D90 A;  4UU6 A;  2QT5 A;  4Q6H A;  2UU9 H;  2BA0 A;  2UXB H;  1WI2 A;  1RGW A;  1NXU A;  3MH7 A;  1V5Q A;  2Z17 A;  2E3U A;  4K76 A;  1IBM H;  2IWO A;  4DR7 H;  3BPU A;  5F3X A;  4JI6 H;  2RRM A;  3WKL A;  4O06 A;  1B8Q A;  2PKT A;  4XHV A;  1BFE A;  5LMU H;  1V9N A;  2YT8 A;  2CTM A;  2KL1 A;  3GKU A;  5A2Q W;  4K6Y A;  5JEA G;  1KY9 A;  5FHT A;  2E7K A;  1OBY A;  2DLU A;  4OX9 H;  4DV7 H;  1W9E A;  5HJ1 A;  2ZPM A;  1WHR A;  2I4S A;  2LA8 A;  1AN7 A;  2JXO A;  4LMM A;  3CBX A;  4Q2Q A;  2HHH H;  2DLS A;  3GCO A;  2FMR A;  4WAN A;  2CTL A;  3E17 A;  3GSL A;  1V1T A;  4FJS A;  4QMF B;  1ZUB A;  1D5G A;  2MJH A;  4DV5 H;  1N34 H;  2JVZ A;  3DJ3 A;  1X0A A;  1IU2 A;  2Q9V A;  5DTH A;  3KDK A;  4DV2 H;  3OU0 A;  5HDY A;  3ID2 A;  3T1Y H;  4K78 A;  1V8C A;  2H2B A;  2PKU A;  3GR5 A;  1N7F A;  4NMQ A;  3UOE A;  4PQW A;  1MFG A;  1QAV B;  5GLJ A;  4AIM A;  5K36 G;  3L7Z C;  1TP3 A;  2CTK A;  2YUB A;  4K0K H;  1J5K A;  5IL9 A;  1UEW A;  2KOM A;  5HFE A;  4K75 A;  1BE9 A;  1FC6 A;  4LF4 H;  1Z86 A;  3PDZ A;  4JL7 A;  4OEP A;  3O5N A;  1X5N A;  4NMO A;  2W7R A;  3I1E A;  1S20 A;  4X66 H;  3SHW A;  1UHP A;  3RL7 A;  2GZV A;  4YDP A;  1UM1 A;  1N36 H;  2I6V A;  3SOE A;  1WHD A;  1TUA A;  4NMS A;  2QBW A;  3NFL A;  2KA9 A;  2EGN A;  3K82 A;  3HPM A;  2EHR A;  1WVN A;  2KJP A;  4DUZ H;  4JI0 H;  1WIF A;  4KFW A;  1W9Q A;  5G1D A;  2A1S A;  3GDU A;  2O4C A;  1FKA H;  4B3R H;  3T1H H;  1X6D A;  2AWU A;  2F0A A;  2CTF A;  4JI4 H;  2KAW A;  2JE6 I;  1K32 A;  4NNM A;  5G1E A;  3J81 W;  1WE8 A;  3EGH C;  3TSZ A;  3GDV A;  1DT4 A;  3U1K A;  5F67 A;  2PZD A;  4JOH A;  4OO1 G;  2VZ5 A;  2KPL A;  5B42 A;  2ZQE A;  5LL6 b;  4EDJ A;  4DV3 H;  1S03 G;  2LF0 A;  2ANR A;  1SEI A;  1QLC A;  2JIL A;  4JVY A;  1EC6 A;  1IU0 A;  2G8Y A;  2FCF A;  2PDZ A;  1X45 A;  1FCF A;  1Y7N A;  1WG6 A;  2KBS A;  3SB1 A;  5HF4 A;  1ZZI A;  1HNX H;  4JJ3 A;  1IBL H;  4DR5 H;  2KJD A;  1UJD A;  3DOR A;  1UEQ A;  1WHA A;  5E1Y A;  2EDP A;  2OPG A;  1UM7 A;  2EV8 A;  4E3B A;  2X7Z A;  1VBI A;  3R0H A;  4B8C D;  1XNR H;  4JOG A;  4X65 H;  5B6L A;  1Z2I A;  3J80 W;  4DV4 H;  2FFM A;  3CS0 A;  1I92 A;  1GM1 A;  4FJU A;  2OZF A;  2I04 A;  2UUC H;  2LC7 A;  3QGL A;  2PA1 A;  1X9Z A;  2EJY A;  2R3Y A;  2ENO A;  4GHN A;  3RLE A;  1J4W A;  3JXT A;  1I16 A;  2UXC H;  2G2L A;  2HH3 A;  2PT7 G;  3R69 A;  3RF2 A;  1X5Q A;  3CH8 A;  2CPM A;  2CSS A;  4DV0 H;  1W9O A;  1TE0 A;  2MHO A;  2X06 A;  2OPU A;  2I1N A;  2R4H A;  3QE1 A;  2BYG A;  3TSW A;  1IHJ A;  2UXD H;  1M5Z A;  4JVH A;  2KYL A;  2OSG A;  2VRF A;  2W4F A;  1RGR A;  2F4V H;  1KWA A;  4YYX A;  4JI1 H;  2WL7 A;  4X62 H;  1Z87 A;  2V90 A;  1Q3P A;  2ANN A;  3QD7 X;  1WFG A;  5EZ0 A;  3GAB A;  5FLX W;  2LOB A;  2VQE H;  2KOH A;  2VSV A;  2EGO A;  4HOP A;  5D13 A;  4G08 A;  3V69 A;  2OQS A;  1MC7 A;  1QAU A;  1XNQ H;  5E21 A;  2EDV A;  3PDV A;  2CTJ A;  4JOJ A;  3JAM W;  3OTO H;  5E6P B;  2FN5 A;  1P1E A;  2D92 A;  2D8I A;  2K1H A;  4E9J A;  2KV8 A;  1UEP A;  4RI0 A;  2IWP A;  2PNT A;  3CBY A;  4K72 A;  4GKK H;  2HGA A;  2DMZ A;  1KHM A;  3DJA A;  3GDS A;  5HFB A;  3ID1 A;  4JOE A;  3SHU A;  1IBK H;  1UEZ A;  3VQG A;  2JIN A;  1ZZK A;  1MSZ A;  2EDZ A;  1FC7 A;  2KJK A;  2QKV A;  1XZ9 A;  3EGG C;  3MH4 A;  2RCZ A;  3I18 A;  1HNW H;  3K50 A;  1WI4 A;  2KOJ A;  4NXQ A;  1VJ6 A;  2DM8 A;  4JOK A;  2JZX A;  4KFV A;  4JYA H;  3ID4 A;  2H2C A;  2Y3M A;  4AQY H;  2ZPL A;  1WFV A;  2JIK A;  2M0T A;  5I7Z A;  1K1G A;  1U37 A;  3CBZ A;  1SOZ A;  2OGP A;  1XMQ H;  1WF7 A;  1Y8T A;  4NXN H;  2IWQ A;  2DKR A;  2CTE A;  3PV5 A;  4LF8 H;  4JI7 H;  2CWH A;  4UU5 A;  2PY9 A;  4KHP H;  2V1W A;  3FAU A;  4WYU A;  1VA8 A;  2HE4 A;  1VB7 A;  2KPK A;  1N6E A;  2G5M B;  4GKJ H;  1UJU A;  1V5L A;  2JWE A;  1G9O A;  1J5E H;  4LF9 H;  4LF6 H;  1Q7X A;  3GGE A;  3LNX A;  4BA2 I;  1XRH A;  1N6F A;  2UUB H;  1MFL A;  4DV1 H;  2K1Z A;  5E22 A;  4AMH A;  2OPV A;  3PS4 A;  2AWW A;  1UF1 A;  2JA9 A;  3HPK A;  4JOR A;  4MPA A;  5EYZ A;  3CC0 A;  4WYT A;  4NXP A;  4NXR A;  3I0P A;  1T2M A;  1X4M A;  1XMO H;  1I6U A;  3KZE A;  4Q2P A;  4B3T H;  4YHH H;  2LC6 A;  3CYY A;  2KG2 A;  3L4F D;  3SUZ A;  4P2A B;  2JSN A;  5LMN H;  1HR0 H;  4DR4 H;  1U3B A;  2CSJ A;  3KZD A;  4Q2O A;  1OZI A;  5GND A;  2HH2 A;  1KEF A;  2VQF H;  3B76 A;  2M0V A;  2M10 A;  2KRG A;  4DR6 H;  2O2T A;  1TQ3 A;  3EZJ A;  5HED A;  4X64 H;  1WH1 A;  1NF3 C;  4GVC A;  4NMV A;  4BA1 I;  3GCN A;  4R2Z A;  1VAE A;  2JEB I;  2EEI A;  2L4S A;  3MH6 A;  3KHF A;  1P1D A;  4JI5 H;  1SOT A;  4B8T A;  4LFB H;  2DGR A;  3VKE A; 
#chains in the Genus database with same CATH homology
 3HVQ C;  5HET A;  3KDG A;  1ZOK A;  1L6O A;  2I0I A;  3WKM A;  2FNE A;  1N7T A;  4FGM A;  2YTW A;  4OD6 A;  1HNZ H;  3QJN A;  3I4W A;  1N32 H;  2QKT A;  4B3M H;  4H11 A;  4NNL A;  2UUA H;  2EAQ A;  5HEB A;  4NZR M;  3NFK A;  4NMP A;  1N6D A;  2K20 A;  3K1R A;  2EEG A;  2EGK A;  2EEJ A;  4JI8 H;  1R6J A;  1OBX A;  4JOF A;  4F8K A;  5A2P A;  1GQ5 A;  3DJ1 A;  1FC9 A;  3R68 A;  4IC6 A;  4B3S H;  4JOP A;  2M3M A;  3PV4 A;  1I94 H;  4JJ0 A;  5BR8 H;  3ID3 A;  1LCY A;  2FE5 A;  3QDO A;  1N33 H;  2LUI A;  2JOA A;  2YT7 A;  1ODH A;  1N99 A;  1U38 A;  4L8N A;  2M0Z A;  4Q2N A;  4LF5 H;  5HFC A;  2CS5 A;  2VKC A;  4NMR A;  1GQ4 A;  1N7E A;  1WF8 A;  3O46 A;  4NMT A;  3TMH A;  2GEF A;  2OS6 A;  2Z9I A;  2P3W A;  1V62 A;  2L97 A;  2AWX A;  2E5L H;  2H3M A;  4Q6S A;  5E11 A;  5H3J A;  4Z8J A;  5DT9 A;  2QG1 A;  1FJG H;  4JV5 H;  3NCV A;  4EC5 A;  4OAJ A;  2IWN A;  2QKU A;  4LF7 H;  1X5R A;  2DAZ A;  1OBZ A;  2KQF A;  3VQF A;  2F5Y A;  2REY A;  2UZC A;  4DR3 H;  4PDB A;  3AXA A;  3OSS D;  5IT9 W;  2M0U A;  3OTP A;  1QAV A;  2FPH X;  4G69 A;  2EXG A;  2VPH A;  5JXB A;  1TP5 A;  5ILB A;  3NGH A;  3STJ A;  4OEO A;  1YBO A;  1X8S A;  3GJ9 A;  1Q3O A;  4YY3 H;  4LFA H;  4NXM H;  2DC2 A;  1RY4 A;  4E34 A;  5HFD A;  4DR2 H;  5HEY A;  2ZM6 H;  3DIW A;  3TSV A;  1F0X A;  2OCS A;  2VSP A;  3J7A K;  2EEH A;  4DR1 H;  2HE2 A;  4OCH A;  4FLN A;  2YUY A;  3QIK A;  4E35 A;  2VWR A;  1RZX A;  2D9I A;  2OMJ A;  3LNY A;  2DB5 A;  3OET A;  3SFJ A;  1NTE A;  1UFX A;  4JI2 H;  1U39 A;  5FB8 C;  4DV6 H;  2DJT A;  2I0L A;  4P0C A;  5IWA H;  4LFC H;  4JI3 H;  3QO6 A;  2JRE A;  2AIN A;  1WJL A;  4GVD A;  4REY A;  2H3L A;  4Z33 A;  3RL8 A;  2MX6 A;  1VCW A;  4N6X A;  4DUY H;  1PDR A;  2Q3G A;  1UJV A;  3FY5 A;  3QJM A;  1V6B A;  4NZT M;  4HOP B;  2L4T A;  5HF1 A;  4Q3H A;  3ZRT A;  3PV2 A;  5HFF A;  1UIT A;  2D90 A;  4UU6 A;  2QT5 A;  4Q6H A;  2UU9 H;  2UXB H;  1WI2 A;  1RGW A;  3MH7 A;  1V5Q A;  2Z17 A;  4K76 A;  1IBM H;  2IWO A;  4DR7 H;  3BPU A;  5F3X A;  4JI6 H;  2RRM A;  3WKL A;  4O06 A;  1B8Q A;  2PKT A;  4XHV A;  1BFE A;  5LMU H;  2YT8 A;  2KL1 A;  5A2Q W;  4K6Y A;  1KY9 A;  5FHT A;  2E7K A;  1OBY A;  2DLU A;  4OX9 H;  4DV7 H;  1W9E A;  5HJ1 A;  2ZPM A;  2I4S A;  2LA8 A;  1AN7 A;  2JXO A;  4LMM A;  3CBX A;  4Q2Q A;  2HHH H;  2DLS A;  3GCO A;  3E17 A;  3GSL A;  1V1T A;  1ZUB A;  1D5G A;  4DV5 H;  1N34 H;  3DJ3 A;  1IU2 A;  2Q9V A;  5DTH A;  3KDK A;  4DV2 H;  3OU0 A;  5HDY A;  3ID2 A;  3T1Y H;  4K78 A;  2H2B A;  2PKU A;  3GR5 A;  1N7F A;  4NMQ A;  4PQW A;  1MFG A;  1QAV B;  5GLJ A;  1TP3 A;  2YUB A;  4K0K H;  5IL9 A;  1UEW A;  2KOM A;  5HFE A;  4K75 A;  1BE9 A;  1FC6 A;  4LF4 H;  1Z86 A;  3PDZ A;  4JL7 A;  4OEP A;  3O5N A;  1X5N A;  4NMO A;  2W7R A;  3I1E A;  4X66 H;  3SHW A;  1UHP A;  3RL7 A;  2GZV A;  4YDP A;  1UM1 A;  1N36 H;  2I6V A;  3SOE A;  1WHD A;  4NMS A;  2QBW A;  3NFL A;  2KA9 A;  2EGN A;  3K82 A;  3HPM A;  2EHR A;  4JI0 H;  2KJP A;  4DUZ H;  1WIF A;  4KFW A;  1W9Q A;  5G1D A;  1FKA H;  3GDU A;  2O4C A;  4B3R H;  3T1H H;  1X6D A;  2AWU A;  2F0A A;  4JI4 H;  2KAW A;  1K32 A;  4NNM A;  5G1E A;  3J81 W;  3EGH C;  3TSZ A;  3GDV A;  5F67 A;  2PZD A;  4JOH A;  2VZ5 A;  2KPL A;  5B42 A;  2ZQE A;  5LL6 b;  4EDJ A;  4DV3 H;  1S03 G;  2LF0 A;  1SEI A;  1QLC A;  2JIL A;  1IU0 A;  2FCF A;  2PDZ A;  1X45 A;  1FCF A;  1Y7N A;  1WG6 A;  2KBS A;  3SB1 A;  5HF4 A;  1HNX H;  1IBL H;  4JJ3 A;  4DR5 H;  2KJD A;  1UJD A;  3DOR A;  1UEQ A;  1WHA A;  5E1Y A;  2EDP A;  2OPG A;  1UM7 A;  2EV8 A;  4E3B A;  2X7Z A;  3R0H A;  4B8C D;  1XNR H;  4JOG A;  4X65 H;  5B6L A;  3J80 W;  4DV4 H;  3CS0 A;  1I92 A;  1GM1 A;  2OZF A;  2I04 A;  2UUC H;  2LC7 A;  3QGL A;  2PA1 A;  1X9Z A;  2EJY A;  2R3Y A;  2ENO A;  4GHN A;  3RLE A;  2UXC H;  3JXT A;  1I16 A;  2G2L A;  2PT7 G;  3R69 A;  3RF2 A;  1X5Q A;  3CH8 A;  2CSS A;  4DV0 H;  1W9O A;  1TE0 A;  2MHO A;  2I1N A;  2R4H A;  3QE1 A;  2BYG A;  3TSW A;  1IHJ A;  2UXD H;  1M5Z A;  2KYL A;  2OSG A;  2VRF A;  2W4F A;  1RGR A;  2F4V H;  1KWA A;  4YYX A;  4JI1 H;  2WL7 A;  4X62 H;  1Z87 A;  2V90 A;  1Q3P A;  3QD7 X;  1WFG A;  5EZ0 A;  3GAB A;  5FLX W;  2LOB A;  2VQE H;  2KOH A;  2VSV A;  2EGO A;  4HOP A;  5D13 A;  4G08 A;  2OQS A;  1MC7 A;  1QAU A;  1XNQ H;  5E21 A;  2EDV A;  3PDV A;  3JAM W;  4JOJ A;  3OTO H;  5E6P B;  2FN5 A;  1P1E A;  2D92 A;  2D8I A;  4E9J A;  2KV8 A;  1UEP A;  4RI0 A;  2IWP A;  2PNT A;  3CBY A;  4K72 A;  4GKK H;  2HGA A;  2DMZ A;  3DJA A;  3GDS A;  5HFB A;  3ID1 A;  4JOE A;  3SHU A;  1IBK H;  1UEZ A;  3VQG A;  2JIN A;  2EDZ A;  1FC7 A;  2KJK A;  2QKV A;  1XZ9 A;  3EGG C;  3MH4 A;  2RCZ A;  3I18 A;  1HNW H;  3K50 A;  1WI4 A;  2KOJ A;  4NXQ A;  1VJ6 A;  2DM8 A;  4JOK A;  4KFV A;  4JYA H;  3ID4 A;  2H2C A;  2Y3M A;  4AQY H;  2ZPL A;  1WFV A;  2JIK A;  2M0T A;  5I7Z A;  1U37 A;  3CBZ A;  1SOZ A;  2OGP A;  1XMQ H;  1WF7 A;  1Y8T A;  4NXN H;  2IWQ A;  2DKR A;  3PV5 A;  4LF8 H;  4JI7 H;  4UU5 A;  4KHP H;  2V1W A;  3FAU A;  4WYU A;  1VA8 A;  2HE4 A;  1VB7 A;  2KPK A;  1N6E A;  2G5M B;  4GKJ H;  1UJU A;  1V5L A;  2JWE A;  1G9O A;  1J5E H;  4LF9 H;  4LF6 H;  1Q7X A;  3GGE A;  3LNX A;  1N6F A;  2UUB H;  1MFL A;  4DV1 H;  2K1Z A;  5E22 A;  4AMH A;  3PS4 A;  2AWW A;  1UF1 A;  3HPK A;  4JOR A;  4MPA A;  5EYZ A;  3CC0 A;  4WYT A;  4NXP A;  4NXR A;  1T2M A;  1XMO H;  1I6U A;  3KZE A;  4Q2P A;  4B3T H;  4YHH H;  2LC6 A;  3CYY A;  2KG2 A;  3L4F D;  3SUZ A;  4P2A B;  2JSN A;  5LMN H;  1HR0 H;  4DR4 H;  1U3B A;  2CSJ A;  3KZD A;  4Q2O A;  1OZI A;  5GND A;  1KEF A;  2VQF H;  3B76 A;  2M0V A;  2M10 A;  2KRG A;  4DR6 H;  2O2T A;  1TQ3 A;  3EZJ A;  5HED A;  4X64 H;  1WH1 A;  1NF3 C;  4GVC A;  4NMV A;  3GCN A;  4R2Z A;  1VAE A;  2EEI A;  2L4S A;  3MH6 A;  3KHF A;  1P1D A;  4JI5 H;  1SOT A;  4LFB H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...