3GAFA

2.2a crystal structure of 7-alpha-hydroxysteroid dehydrogenase from brucella melitensis
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
249
structure length
249
Chain Sequence
SPFHLNDAVAIVTGAAAGIGRAIAGTFAKAGASVVVTDLKSEGAEAVAAAIRQAGGKAIGLECNVTDEQHREAVIKAALDQFGKITVLVNNAGGGGPKPFDMPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAGENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDALATVLTPEIERAMLKHTPLGRLGEAQDIANAALFLCSPAAAWISGQVLTVSGGGVQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.2A Crystal Structure of 7-Alpha-Hydroxysteroid Dehydrogenase from Brucella Melitensis
rcsb
source organism Brucella melitensis
molecule tags Oxidoreductase
molecule keywords 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
total genus 94
structure length 249
sequence length 249
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.159: 7-alpha-hydroxysteroid dehydrogenase.
pdb deposition date 2009-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gafA00
4PZEA 5JW6A 3RUHA 3TPCA 2I9PA 3JQ9A 1LLCA 3FR8A 5G4KB 2FN7A 3LC7O 4GSKA 1CQIA 3PI7A 4DA9A 3MOGA 4NBRA 4K6CA 1KOLA 5G0UA 2NVBA 1WW8A 1XHLA 4EBFA 3AUTA 2JHGA 4S3MA 2IXBA 3PJEA 1R4NB 1E7RA 2TMDA 2EP5A 4CLXA 2D2IA 2PZMA 3ONFA 2GLXA 5LCXA 3WQRA 3G3EA 3ICCA 4UUMA 1YKFA 3O03A 4OHUA 1UR5A 1HE5A 1K5HA 4M49A 3N7UA 2DM6A 4CQMD 4YXFA 5DBIA 1BVRA 4EUFA 5GZ1A 3F3SA 2X86A 1XU9A 1YL6A 3JV7A 3PYMA 3LQFA 5G0VA 1TT5B 1EMDA 4JROA 5BNIA 3FWNA 2HCTA 2WEKA 4IM7A 4OGWA 1PU2A 2A9FA 3KM0A 3FSRA 1LSUA 4B4OA 4B7XA 1MG5A 3HNPA 4E3ZA 1SAYA 2GN4A 4CM9A 3CEAA 2AEJA 3AOEA 3QHAA 2PY6A 1KC3A 5JNLA 3AFNA 5ENDA 1P33A 4UEOA 4ZQHA 1I3KA 3WNVA 1Q0HA 1LQUA 2VYND 1GUZA 1HETA 2JCXA 2P91A 3JD3A 3PZBA 4KUEA 2EW2A 4WOKA 1PJCA 3GZNB 5L53A 3W8EA 4BKPA 1V6AA 3LC2O 2IODA 3FNFA 2DBRA 3WGQA 2I99A 3I9JA 4R9SA 2BFPA 4YA6A 2VTDA 4E30A 2VRBA 3PEFA 1U3TA 3BYZA 4RL6A 3CTMA 4CR8A 4JP2A 2EIHA 1L7EA 1ZJZA 2DTEA 5GZ3A 4RCVA 5IG2A 3E9NA 2YZ7A 4CUKA 1Y8RA 3STHA 3RBZA 1M66A 2GZ1A 4RV9A 1QLJA 3GVHA 1ZK4A 2CFCA 3GMSA 4IPTA 4YTEA 4BO1A 4G5HA 4FFLA 2GO1A 3BHIA 4XA8A 3ROMA 4BKUA 2B35A 1X13A 5JMPA 3K2BA 4A27A 2ZCUA 3AY6A 4WLFA 5KJEA 4PLFA 1BSVA 4OQYA 1YH3A 1MXHA 1EBUA 1A5ZA 2G17A 1HYHA 4NJOA 3KRTA 3SJ7A 2O4CA 1NPYA 2IYOA 5TS3A 1B8PA 4J7UA 4NI5A 3VTFA 1Z7BA 1H6BA 4WASA 1U8FO 4YQZA 3IC5A 3BIOA 1R15A 2Y1GA 3D3WB 1GZ6A 3DWFA 2R6JA 3KYCA 4QO7A 3IKTA 3GDOA 5H83A 3BMQA 2J3HA 3TN7A 4DLBA 2OO5A 1ZH8A 4NPCA 5AVOA 3ZNOA 1SEPA 4ALMA 2YDXA 5KJ6A 5HA5A 1Y7TA 3CMMA 5BSFA 2FR0A 4GBJA 1LC0A 2H1SA 4PG6A 5JAMA 1GUFA 4ZGWA 1JW9B 1ZSNA 2YV3A 2BGKA 1Y9EA 1R12A 5U4QA 4ALIA 3A14A 5AXDA 4J4TA 5L4LA 2CDCA 4MIYA 1T2EA 4FC6A 3CPSA 3BMQB 5KKAA 1DIGA 1BXZA 2A94A 1PJSA 2Y0DA 1O6ZA 2TMGA 1YXMA 1NFFA 3K5PA 1NAIA 3LLSA 5JY6A 4Z9FA 1QYXA 4YT8A 2EF1A 3GG9A 1NWHA 3WYCA 4E5NA 4CM8A 2CMDA 1ZMTA 1E3IA 1Y5RA 2J5KA 1GY8A 1MFZA 4RLSA 4IDEA 4B7CA 2HQ1A 4O5OA 3VDQA 4WNCA 1DC4A 1E1MA 1KERA 1HXHA 5K6AA 3VAZA 1I3NA 3K31A 5JC1A 4N18A 2EHDA 3ZDFA 2GYYA 4XRRA 3JYQA 3Q2KA 2QG4A 2Q1UA 1P45A 4M87A 1BMDA 3GMDA 4R4JA 2PA3A 4L4RA 5COQA 4CLRB 2IZZA 4TMFA 2RCYA 4XQCA 2R2GA 3DBHA 1QR6A 3GZNA 4GWKA 1P1IA 5BQFA 1VSVA 4CLRA 1CETA 2JFHA 3E03A 4W7HA 1ONNA 5CFZA 2NVWA 3GLQA 3TJRA 4L4XA 2ZYAA 4W7IA 3L9XA 5B4VA 2ZKLA 2QYTA 1K89A 2EW8A 3B1JA 4A03A 4TZKA 5CG2A 1IHYA 2BFOA 4CUZA 4ILKA 3QE3A 1PJ3A 2YFHA 1JWBB 5A9SB 4FFOA 2DBVO 4DQXA 1LSJA 5B12A 4IJKA 3ZV4A 4XR4A 5DN9A 1K2WA 5CEEA 3WGIA 4YVFA 5JO9A 2V7PA 1ONOA 2X6TA 4JXKA 4PG4A 2X7HA 2DT5A 3W1VA 2O48X 3L07A 3GQVA 2E37A 4R9RA 1F8GA 1R37A 1V3UA 4L4SA 3ZWCA 3A4VA 4OXNA 2E82A 1VJ1A 4KZPA 4D0SA 5TRTA 4PN3A 2OBYA 5HM8A 3P2OA 5IDQA 4BO5A 4Q9NA 4CM9D 1P31A 5LDHA 1ADGA 1BGVA 2Y1FA 3F5SA 4FFRA 2B37A 3NEPX 4XEHA 5TJ9A 1CERA 1PL8A 4RPHA 5IXYA 4YDRA 2EP7A 5JDCC 3MJEA 3HB4X 1U1IA 5A9TA 1YBAA 2I66A 3RROA 1T2FA 3FR7A 3OA0A 1GZ3A 5ES3A 2ZYGA 4J1TA 4ZICA 4WKGA 3JYNA 4Y98A 3U3XA 5JCJA 2HMUA 1PZGA 1PZHA 3ON5A 2OOSA 4JBHA 5JS6A 4BUCA 1CYDA 3C85A 4NZ9A 4YB8A 4AJNA 1BXGA 1KVQA 3I4CA 4IIVA 4IINA 4CV1A 4CMCA 5IXSA 1LNQA 3ROQA 5TJHA 2IDZA 1FXSA 3E18A 4YJHB 4D42A 3WSVA 2GCGA 4P4NA 1W0CA 1G0OA 3NTOA 1DFIA 5IZCA 2ZQYA 2HMWA 3EZLA 4C7KA 3DB2A 1JU9A 2VWQA 2VUSA 3RVDA 2WD7B 3MTJA 4BNHA 4XGIA 1DBVO 1KVUA 2YHIB 4XGNA 1GL3A 3WYEA 3HQ4O 1DIHA 2NU8A 2VOEA 2BI7A 1UXIA 3PTZA 1F8FA 3UUWA 1QORA 4UVEA 4TQGA 3QA9A 1LDNA 1QG6A 1M2WA 2AA3A 2GZ3A 1R16A 2C82A 1V9LA 3GVXA 3IIEA 4BNFA 1GEGA 4XX0A 2JKVA 3KLMX 3LT0A 3VPGA 3VPXA 5TGDA 1E6WA 5A3JA 4AL4A 4GX0A 2YUTA 2OORA 3L6DA 2PFGA 3QVXA 1DPGA 1CF2O 4ZN6A 1NPTO 5HS6A 4O63O 5G0SA 1MA0A 3WLEA 1SCUA 3JQFA 2PD6A 2HMVA 4L75A 2Q4EA 4RF5A 2I76A 4TSKA 7MDHA 1BDBA 2PGDA 2P2SA 3I3OA 4FQ8A 1I32A 4XGKA 1R0SA 1CRWG 1HLPA 4CM6A 2G5CA 2Y05A 4J7CA 5F1OA 5B1YA 3IQDB 3DFZA 5TIIA 1Y1PA 1AXGA 4DQUA 3PJDA 4J16A 1PJQA 1LUAA 3JQAD 3RUEA 3WIEA 3TZ6A 2D5CA 1F17A 2C59A 2VRCD 4YRBA 4IDFA 5L7TA 1ZJYA 1C0LA 3T7EA 4LVUA 4IGFA 4PRKA 4YJDA 4FJ1A 1LSOA 2A92A 4RLHA 1UUFA 1UZLA 3OJ0A 4K28A 1E7YA 2FZWA 4LSWA 3ZV3A 8ADHA 1GFSA 1OC2A 4NHEA 1DJQA 2ZK7A 4FPXA 2DQ4A 2IRWA 2C07A 1HDYA 2VOJA 3IOYA 2VNAA 2VZ8A 5TX7A 4FSHA 1IULA 1ULSA 1EQ2A 1V35A 3KVOA 3PHIA 3WLFA 4ZHSA 1A71A 2PTGA 1OI7A 5DOVA 4E32A 4N5NA 1P0CA 3DBLA 3RWBA 1GPJA 3P5SA 3EAGA 1LDGA 4BMNA 3G0OA 3O26A 2X1HA 2ZYDA 4XYEA 4A5OA 1LEHA 1S6YA 1GQYA 4AJKA 4M55A 4R1SA 1UP7A 2W8ZA 4IQ0A 4LN1A 2VCYA 3ZV5A 3FI9A 3HADA 2HLPA 3RD5A 5IDYA 4A0SA 4AJIA 1O94A 2EJWA 5JAIA 4Q3EA 1NYTA 4BB6A 3NDIA 4EUEA 2OFPA 4L76A 2FPIA 4AVYA 4IBOA 1UXJA 2O3RA 2X22A 3DZFA 2OP0A 2Y1OA 1NR7A 2X4GA 3MOIA 3OF2A 3QVTA 4CMHA 1ZCJA 3ETEA 3HFGA 1EFKA 2OBNA 3AM4A 2BELA 5KOIA 2DFDA 2Q1WA 1O89A 5COAA 2CZCA 3JD4A 4U5QA 5A06A 2OL4A 4H16A 3EHEA 2P4HX 3OMLA 4PCVA 2B5VA 2HMTA 3JQAA 3PQEA 1NHWA 4A26A 1NM5A 1OBFO 4K1LA 4BNJA 5GMOA 3BHMA 3WGGA 4JGBA 1T24A 3GFGA 3AUUA 4YYZA 3TOXA 3KLPX 4YT4A 3GAZA 1LA2A 3GUCA 4GAEA 4PVDA 1LLUA 2X8LA 4XRGA 4RJTA 3LSYA 3AOGA 4WCFC 1V8BA 4J43A 3DZHA 5JFOA 4MINA 2HMSA 1I3LA 1QXSA 2OGUA 1C1DA 1CWUA 4FW8A 1P74A 3LDHA 4DPLA 4GWGA 5IZ4A 1C14A 1JTVA 2NQTA 1ZW1A 4Z9XA 2I5PO 1QMGA 3HG7A 3NDJA 2XXBA 5GZ6A 5I7FA 1H5QA 1F06A 4L73A 3TZHA 3WR5A 2JCVA 3RCBA 3JQCA 1ZSYA 4QT0A 1RWBA 1M6HA 1MGOA 1UH5A 4FIZA 3GVPA 1ISIA 4S1VA 3B20A 3U4CA 3M2TA 1BW9B 5MGBA 4HFJA 4U0JA 3LF2A 3E1KA 2SCUA 2J8ZA 4I08A 5DT9A 5B4TA 2WYWA 1Q0LA 2WSBA 4J9VA 4DYDA 2RIRA 3ZWMA 3RC1A 3DTTA 4UVGA 1E3JA 3HN2A 2PD4A 4K6FA 4U6QA 1XWFA 3B70A 3D4NA 3ETDA 2H9IA 3QWIA 3FWZA 1LXCA 1RM0A 1LLQA 1U9JA 1PZEA 3C7AA 4ID9A 4OAQA 4XYLA 4E0BA 1WZIA 1VC2A 4GKBA 4BKOA 1U7TA 3WMWA 2P9GA 2WYUA 2GERA 3GN2A 4ND4A 3ZU4A 3B1KA 4QFDA 3KSZO 2WE7A 1SNYA 4MVJE 3HFSA 4F45A 4NJMA 3QVWA 3DAFA 2WYVA 5EPOA 1PQPA 3PXXA 3VHRA 3WSWA 3ZI0A 2RAFA 3JQ8A 1I3MA 4ZD6A 4DRYA 2AQIA 4U8GA 2HUNA 4A73A 3AW9A 3MTGA 3KETA 1PJ2A 5CG1A 9LDTA 1NASA 3LT1A 1J5PA 4WCFA 3PRJA 1ZNQO 4FJ2A 3WNQA 3PLNA 3WX0A 4P4GA 4KP7A 4JBGA 4RQUA 5F1PA 1EK6A 3UCXA 4FFMA 3ENKA 1HSZA 4WLNA 4FFPA 3ADPA 5EJ2A 3ICPA 3M1AA 4BQRA 3HDJA 1JKFA 1ISJA 1PL6A 5CP8A 2B83A 1F12A 2PH3A 1DDOA 3U5TA 4KDFA 4M89A 3ZWVA 4TRRA 2FR8A 4DIFA 2CNBA 4A2CA 3W8FA 4GQAA 1YB1A 5G4LA 3VH1A 3MWEB 3C7CB 4NK4A 2P68A 3VZSA 4AJ2A 3ZZNA 3TQHA 4CQLB 3LZ6A 4J0FA 3U4DA 4B4UA 3Q11A 1N8KA 1ZK2A 1HSOA 2HU2A 2YHIA 3PK0A 4K9DA 4GGOA 3R0IA 1MFPA 2D4AA 4Z3DA 3UAGA 1JQBA 4BNYA 2DKNA 4D41A 4BO7A 1ZVMA 4MDHA 4EITA 1VI2A 2B4RO 1BTOA 1AHHA 3EW7A 4JX8A 2EXXA 4DC1A 5A9RA 5G2OA 2VWPA 4B79A 5KNLA 4CM8B 5BSGA 1VLLA 2D8AA 4YBZA 3WICA 2O4UX 4IGEA 1HDGO 2BLLA 4B4VA 1ADBA 1LSSA 5IDXA 2UV8A 1DFHA 5JO0A 3DONA 2EERA 3HE3A 1N7HA 1T26A 1PGPA 3GK3A 2ZB3A 4I5EA 3NAQA 1XKQA 4XJSA 3F4BA 1MC5A 2B5WA 3PJFA 4GMGA 5CHEA 5I8ZA 4CMEA 1I5RA 1SOWA 2D3TA 4BMVA 4DVJA 3I5MA 2H5LA 1RM4A 2HRBA 3WBBA 3EMKA 4J90A 1KYQA 1PL7A 1GYRA 3HZZA 1VL0A 1JKIA 2NVUA 3E9MA 1E0DA 2Z1NA 4CMJA 4Z0PA 1Y9AA 4XYMA 2JL1A 4LSMA 3K2EA 4FJ0A 2C2YA 1K6XA 1AGNA 1KIFA 1X0VA 3GC6A 3W4IA 5L95A 3DZKA 1NQ5A 3TSCA 4E2WA 1UJMA 2EG9A 4HWKA 1IYZA 2DUWA 4EJMA 1AN9A 3JQDA 1KS9A 4NFSA 4D3SA 4IJWA 1GU7A 1P44A 2A4KA 4YQYA 4OYRA 1PWXA 2IZ1A 3NYWA 4HXYA 4ZQGA 3ZW8A 3FRJA 3UF0A 5HWSA 3S55A 2J6IA 1DOHA 3OJEA 2EKLA 4KTVE 4NU6A 1JVSA 1QKIA 3DHEA 2Z1MA 1H2BA 2IEDA 1GYPA 1I10A 1Y8RB 1Q7GA 3RKRA 4TRJA 1ZZEA 5BNFA 1UP4A 3AU9A 3K73O 4HX5A 4G65A 1LC3A 2EGGA 1VL6A 4R16A 1NWCA 2BHLA 1GCOA 2GUGA 3PYXA 4OO3A 4G81A 1GAEO 3OIDA 4RVSA 2Q45A 4PVCA 4I9NA 4UULA 4YAKA 1SC6A 1FK8A 4WNIA 1ONPA 4YJFA 3TL3A 4BKQA 3X2FA 1HDOA 1A7KA 1DHTA 3LU1A 3O8QB 4D7AA 1H0KA 3UCFA 3WGZA 4R54A 1HEUA 1E1LA 2IZ0A 4CMIA 4CLOA 5CEJA 3LVFO 2ZQZA 4FB5A 4MVJF 2B4QA 1XCBA 3WYBA 1Q0QA 4F6CA 1AXEA 1W4ZA 4AJLA 4MP3A 5CDSA 5EL0A 4BO2A 3H5AA 5L4SA 2VNSA 3CZMA 3INGA 1UZNA 2J3IA 5L51A 3G79A 3QLJA 3DR3A 1I2CA 1W6UA 1XDWA 2HK9A 3W6ZA 1F14A 4J49A 1I0ZA 3ZU5A 5K0ZA 1DHRA 1UP6A 4N7RA 2DVMA 1B26A 1FDSA 3TNLA 4HADA 1EVZA 2VZ0A 2CSUA 1H93A 2GRAA 4EGFA 4YCAA 3S2GA 1MC4A 2VHVA 3GFBA 4E5KA 3A28A 3WDSA 1R4NA 3I9LA 1IZ9A 3B1FA 3VZQA 4ALLA 2GGSA 1E3WB 1LDMA 1NFRA 1T1RA 4BIIA 4MVJA 4JIGA 3V2UA 3OICA 4BVAA 3K96A 3PVZA 2OMEA 2YV1A 1SZJG 3F1LA 3HJAA 1YBMA 1OOEA 4BS9A 4OQZA 2RHRA 2F00A 3ZU3A 1BW9A 1VM6A 3D3WA 4I9UA 3GVIA 1NBOA 1XA0A 4F46A 1DIRA 3ZV6A 3UXYA 1YGYA 3ITKA 3QWFA 1DRWA 4QX6A 1H9AA 4IDBA 5EQDA 4PFJA 1YBVA 5ADHA 3IKVA 1I30A 3DZIA 1X1EA 1PS9A 4HNHA 3IMFA 3I9MA 3PFFA 4OIMA 5T57A 1UZMA 2C54A 2RHCA 1U7HA 4FS3A 1JKJA 3VPFA 5JCXA 4KMSA 5EESA 1O9BA 1G1AA 3ROPA 2HRZA 1DXYA 2X9GA 3GR6A 4CJXA 3QWAA 2Q3EA 3PFWO 1JA9A 1P1RA 3OJOA 1OMOA 1H6CA 4IIUA 1EK5A 1KEWA 2CDAA 1KVTA 2W98A 5TQVA 3TFQA 4CM1A 1E1NA 1LDEA 4J7XA 2FR1A 4J3FA 1H9BA 4UEKA 2PLAA 2EEZA 4FGSA 4EEZA 4AJPA 4GL4A 1UXHA 5C7LO 1RKXA 4NBWA 3NX4A 3KTDA 5CPBA 3FPCA 4AFNA 1IHXA 2VUUA 4IDGA 4OKIA 4OXYA 3GG2A 2Q49A 4MVJP 1N92A 1IPFA 1W8DA 1TLTA 5C7IO 1D4FA 1N9GB 2XOXA 3FNGA 1RYDA 4CR6A 2ZTMA 3LYLA 4ND3A 5U1PA 1X15A 2AXQA 3OHSX 3UFXA 2O23A 1U28A 4DWVA 2CVQA 3GNSA 2X0JA 3ONEA 3RFTA 4JK3A 4RF4A 2PD3A 1NNUA 4DC0A 5IZCC 3DZGA 4PG8A 3D3EA 2UUPA 2V6MA 1TI7A 4Z3KA 2D59A 2R00C 3NRCA 4XIYA 5J23A 1A7AA 4L74A 1Q2XA 2XXJA 4ZRMA 2BRUA 3GF4A 3RBXA 3CSDA 3RC9A 3OJLA 1EZ4A 4XYBA 3WMXA 5DBGA 2NWQA 4YPOA 2GASA 3L77A 3QWHA 4MIOA 3JD2A 2FZEA 4Y6PA 4DL9A 4XCVA 5JSFA 3MCVA 4M1QA 4MKZA 5DOZA 4E5YA 5L9AA 1C1XB 1Y81A 1R4MA 1Z45A 1HYGA 3GEDA 2DPGA 3WIDA 1IB6A 3I6IA 1IY8A 4PZDA 5T67A 2YQ5A 3RSHA 3W6UA 3RIHA 3ITDA 5LC1A 1P3DA 3DFUA 5KKCA 3KSUA 2HSDA 4UVDA 4RDHA 4ESOA 3OIFA 1WMAA 4XR9A 4DGSA 4FN4A 2VHXA 5JAZA 1DRVA 3DEYX 1N2SA 1QSGA 4GH5A 3DZBA 3GRPA 4IXTA 5I9LA 2VYVA 3GZ4A 4Z0TA 3D64A 3QQPA 1PJBA 3AUSA 2PWZA 2Y66A 2RH8A 4NR0A 4KUGA 4X54A 4WLUA 4BO9A 2Y67A 1JAXA 3PWZA 1YONA 4K26A 3E48A 1YQXA 4QECA 4AJOA 3G17A 1KY5A 3H65A 4Y67A 4YAEA 1Q7BA 1VKNA 1ZXBA 2DTDA 2YFQA 4GLLA 4KWIA 3AUAA 5CDUA 5IDWA 4GI2A 1EUZA 2I3GA 3H9QA 3DBRB 3EY4A 2Y93A 2DAPA 3H2ZA 4WLOA 4YWJA 2BFMA 2UVDA 4I8XA 3Q9NA 2J5RA 3LLVA 1O0SA 3ZNPA 3R1IA 4BKRA 1EVYA 4YJGA 1HDZA 3DOJA 1Q7CA 3JQ6A 1DJNA 4KWHA 2PKQP 1GCUA 4E2ZA 2Q2VA 1ZUD1 3P2YA 1YOVB 5G0WA 1LTHR 3W4KA 4A10A 1B14A 3ABIA 2WD7A 2IEBA 2OP1A 2V6GA 4IQ8A 4AJJA 3WOHA 3NJ8A 2PV7A 1PTJA 3BMCA 1FMCA 4ZQEA 3W4JA 3RC7A 1B0AA 5DCWA 1D1TA 2CD9A 2QW8A 2CF5A 3G1TA 1MP0A 5THKA 3EVNA 4CM7A 5KJCA 5ICMA 4P38A 4BGEA 1WVGA 3A9WA 3V1UA 1TT7A 2WJPA 2Z95A 1E6EA 1SB8A 1BXKA 3ASVA 3I9KA 1DIBA 4CM4A 2VT2A 4OMUA 3RU9A 4B3IA 3ZHZA 1GZ4A 5I7VA 4ND2A 3U4HA 3WJ7A 1MUUA 4OSPA 3D5TA 5KJFA 4BGIA 4BNVA 3UVEA 1F0YA 4D3DA 1M75A 3ZHYA 4QSMA 1MB4A 2HAEA 3HDHA 1PZFA 3JQ7A 4PIVA 3WQSB 2G0TA 4CL8A 3QY9A 2NV6A 4OH1A 1B3BA 2X5JO 4RDIA 4CMEC 1GTMA 1BVUA 1KEPA 3I4FA 4D0RA 1QYWA 1I33A 1I8TA 1SO8A 5L4NA 1NHGA 4RF3A 2G1UA 2C0CA 5DBFA 2IYPA 3GT0A 4MVJD 4Y6SA 1X0XA 2GSDA 1Z7EA 3GUYA 1PGNA 4R01A 1IE3A 3E9QA 5F21A 5BR7A 4JN6B 4J4BA 3PWKA 5C7OO 4TRMA 4J91A 1YL7A 4YEDA 2YDYA 4R1NA 4CODB 4C7JA 2AW5A 3D1LA 4G2NA 1TEHA 3B6ZA 1YQDA 3KYBA 4Q3BA 4YT5A 3UW3A 1GR0A 3BMOA 1QV7A 2NACA 4JP3A 5TF4A 1C0PA 1ENPA 2P4QA 4R41A 3ZH2A 3T4EA 1PGJA 1XYGA 1KEUA 4H3VA 5AOVA 1GADO 1WDLA 2AG5A 1SPXA 2VYNA 4NK5A 5L7WA 1K0UA 1HE2A 3CE6A 3V2GA 2JHFA 3N58A 3SEFA 1U5CA 1PR9A 1V0JA 2JD1A 1YJ8A 2IXAA 1U8XX 3CKYA 3IP3A 5I9NA 1J6UA 3JSAA 2GN9A 3L9WA 2D5AA 2B36A 3OBBA 1ARZA 4MKXA 3SC4A 1M76A 3DBHB 1H94A 3VH2A 1DO8A 3SJUA 4YJFB 5H82A 3C3XA 2A35A 3PWSA 1J49A 4CV0A 2FHSA 2EV9A 4P8RA 3AU8A 3NTRA 1MX3A 4EJ0A 1XQ6A 3ZNNA 5LDGA 2O7QA 3COSA 1FDWA 3HHPA 4O6VA 1T2CA 2B4TO 3EYWA 3AK4A 5EMHA 4YAIA 3ZN2A 2YV2A 4AJ4A 5K6AC 1SBYA 4JBIA 4XQ9A 2W90A 3ZHXA 1ZO8A 3NJ4A 4GMFA 2NTNA 3TDKA 3L4BC 3RUFA 3V1YA 1AUPA 3I1JA 4JJFA 3CINA 2C5EA 4LK3A 4DREA 4KQWA 1P1KA 1I36A 1GQ2A 5FI3A 4YT2A 1YJQA 2O3QA 1LRKA 4I9HA 4MVJH 3C1AA 3FHLA 3IS3A 4DMLA 1CDOA 2OHXA 1MXFA 4EDFA 1FJHA 1DAOA 1DLJA 1JAYA 2FY8A 4W9NA 4BGVA 4BNMA 4XD2A 3VVBA 2GPTA 4FC7A 4BGUA 3S2FA 4TVOA 1QRRA 4LCEA 3JYPA 4UVIA 1ISHA 4IZIA 5L45A 4Q3AA 2QQ5A 4LRTB 5ER6A 3DHYA 4E13A 3GEMA 1Z73A 2VHWA 1KVRA 1D3AA 1EEHA 3Q1LA 4NMHA 2O3SA 3F46A 3KXDA 5JDCA 4IDAA 1ZEJA 5L3ZA 2PH5A 3O4RA 1WDKA 1PJ4A 3BXXA 5DDIP 2VUTA 1A9ZA 4IDCA 3SLKA 4Z6KA 1N5DA 5KVQA 4NG5A 4I5FA 3BA1A 2YQ4A 4ITUA 1WNTA 3PQFA 4BMSA 1H6AA 4R1TA 2EGHA 3HDQA 3DL2A 3E5MA 4EUHA 5KWEA 2HDHA 3UN1A 3BTVA 1DLIA 2JD2A 3JQGA 3VVCA 3WB9A 5I8WA 5U9CA 1KETA 1ZIDA 3L4BA 1HKUA 3ZWYA 5A3VA 1NVGA 3MWDB 2PZJA 1UAGA 5AXAA 1E5LA 1O95A 2DBZA 1EE2A 3GHYA 5FEUA 3D5QA 2FP4A 4QTZA 4XQGA 1OFGA 3PGJA 3WFJA 3ST7A 2VRCA 2BI8A 1G6KA 1WP4A 3R3SA 3U4IA 3VZPA 5IN4A 5C3MA 1HZJA 1EFLA 4QEDA 2JJYA 3UICA 4WUVA 4OM8A 5T8KC 1U4SA 4CLOB 4CMIB 4J9UE 4DBZA 5JMWA 2CVOA 3D0OA 1LDYA 4P22A 4RVHA 1YB4A 1HE4A 2RBEA 5IAAA 3O8QA 3VDRA 1Y8QB 1VE9A 5A4DA 1T4BA 2JD0A 4PRLA 2X0IA 1Y8QA 2Q46A 3Q6IA 4HKTA 1M6WA 5BT9A 2DC1A 2FPGA 2PR2A 4W99A 1A9YA 5IFLA 2NM0A 2WDZA 2YYYA 1E3EA 2CDBA 3FNEA 2VYVD 4EW6A 1N1EA 5KIAA 5HRUA 2QZ9A 3DC2A 3BMNA 2GN6A 2Y68A 2C7VA 3K9QO 5DCYA 1NP3A 3KYDB 4IUYA 4GX5A 4BNKA 4ALNA 2DBQA 4UUOA 4GSLA 2X23A 1CQJA 4D43A 2O2SA 1A27A 3R3JA 4PLCA 1HDCA 4CM5A 3GGOA 3JQGB 4CUJA 3JYLA 4FBGA 4D44A 2FPPA 3WS7A 2BGLA 5TNXA 1PQWA 4BV9A 4CPDA 3KEQA 3E5RA 3VZRA 3ZU2A 4MOWA 4XQEA 3VH3A 4RVFA 4Z9YA 2DU8A 3RJ9A 4IDDA 4BNZA 3C8MA 4L9RA 3K92A 4WEOA 1UDBA 3ONDA 4U6SA 3CH6A 1TXGA 2GF2A 5A5FA 1E77A 2F1KA 1U5AA 5KVVA 1ZEMA 2Y0EA 4ZA2A 2AG8A 3C1TA 4PLYA 4BNGA 4RZHA 4RPJA 3W8DA 1U3VA 2VZ9A 2EKPA 4BNUA 3OQ1A 1U3WA 1VJTA 1N7GA 4TVBA 4C4OA 3PDJA 2Y1CA 3GY0A 3GHHA 1XIVA 3KYCB 1A4IA 5ITVA 3GDGA 3K8ZA 4J2HA 3RFVA 3IJPA 1HRDA 1PS0A 1EUCA 2DPHA 3TOZA 4ONEA 2E49A 5T64A 1V3TA 4FOOA 3PHLA 6ADHA 1ORRA 3DOOA 1DSSG 3RASA 4BB5A 4DPMA 3PZRA 2CY0A 3F47A 4I5DA 2NSDA 4AICA 4LMPA 1C1DB 5ICSA 4EI2A 1WAMA 4QUKA 1B8VA 3OQ6A 3GAFA 4YACA 3QVOA 4FDAA 1GYQA 3QP9A 3GA0A 5JC8A 2HKIA 2V6BA 3DMTC 3JQFC 1VSUA 2IE0A 1R6DA 4HY3A 1B7GO 2BF7A 4BNTA 5KCZA 5FF9A 2Z5LA 5L7YA 1ZK3A 5KVCA 1YOVA 4CMBA 1PGQA 4NFHA 5K9ZA 4EYEA 3EUWA 5ENVA 4PLVA 1OC4A 5BSHA 3D4OA 4TKLA 4BL5A 4BNIA 3PP8A 4PLWA 3M1LA 4PG7A 4WOJA 3RUCA 1ZXLA 1LJ8A 2AE1A 1CIVA 1GQQA 3K6JA 3FTNA 4UAGA 3KHUA 3I9NA 5JXWA 5EINA 4WK6A 1ISMA 4WLVA 2LDBA 2X9VA 5BNTA 2PKQO 4LGVA 2HK8A 3U0BA 3PDUA 4DUPA 5DP2A 2BFAA 3Q2IA 2X0NA 1FDTA 2G82A 3P19A 3BMOB 3EZYA 1QYCA 3JQEA 4O0LA 1V3VA 3TZCA 3MJCA 4XB1A 4WECA 1TT5A 4MVJM 1ULUA 3AY7A 1T1SA 3L6OO 3TZKA 1HDRA 2AQKA 1NX6A 2ZTLA 1SEVA 1QYVA 3QIVA 4NJMB 1Z75A 1XGKA 1GDHA 3LT2A 5JAQA 3U62A 1NTOA 4XIJA 2UAGA 4Q3CA 4A7PA 1U2DA 1PR3A 2QX7A 4MIEA 5JE8A 3RBVA 5JDIC 4TWRA 5A5EA 2QIOA 3O38A 3SBOA 3RC2A 4NBUA 3PHGA 5F5LA 1KBZA 3S2IA 1JDJA 1C1XA 2YHUA 2W4QA 3JD1A 3N74A 5G4KA 2AEFA 1O5IA 2Q50A 4XKJA 3WGHA 4IS3A 3HDYA 4BNWA 4EZBA 4QFCA 3AI1A 4ND1A 4ROSA 3I52A 3JYOA 1SOVA 4IXWA 4CM4B 2BGMA 3ZWOA 1DB3A 5T6BA 2PZKA 4CV3A 3LC1O 3ZWNA 5ILOA 1HWYA 1BRMA 1H2HA 4MVJG 4TKMA 3V2HA 1JWAB 1AHIA 4INAA 4J1QA 4PZCA 3ZWWA 3DDNA 3RJ5A 3NDRA 2QRJA 5DF1A 3OETA 4LVCA 2NQ8A 4QXMA 3VPHA 1I24A 4RPLA 2I67A 3UGKA 1E1KA 4D3FA 1BG6A 2XPCA 1D1SA 3M2PA 4JCOA 2P9CA 2J3KA 1N9GA 1YWGO 3PHJA 4RPGA 1D8AA 3NTQA 3X2EA 3PLRA 5F3RA 2VHYA 2PGJA 1SMKA 3INTA 1X7DA 2B0JA 4CLHA 3FD8A 3PIDA 2NTJA 2RH4A 4PG5A 3AWDA 3D4PA 4DIOA 1GV1A 3PIIA 4E5MA 1XEAA 4BQPA 3LT4A 4DXHA 4GX1A 1IL0A 2I3AA 3BTUA 3OECA 4DYVA 4GVLA 3GPIA 4PLGA 4RVUA 2VN8A 3H3JA 1UXKA 4HFNA 4TRNA 1YL5A 3QWBA 4RVDA 5THQA 1LRJA 2V65A 4GPD1 3MZ0A 4CL3A 5BSEA 4UVHA 1PX0A 3MJTA 3BHJA 3INRA 4NIMA 3ZWXA 1WWKA 7ADHA 4URFA 4BNNA 4J6FA 4D46A 4OOEA 1LDBA 3OEYA 4H15A 1E3LA 1T2DA 1QLHA 3L6EA 1C3VA 4YJHA 3G1UA 5AQ1A 4NBTA 3UKOA 3V8BA 4EEXA 2WD8A 4RF2A 3DBVO 1YVEI 4CR7A 5A03A 3I6QA 5CPFA 3U49A 5TC4A 4M86A 1NQAO 3DBLB 1UAYA 2PGLA 1IOLA 1JN0A 2VT3A 1WXDA 4JQCA 4HFMA 3BZUA 3ROKA 2ZJ0A 3ZWAA 1E3SA 1R4MB 3Q0EA 4YRAA 1NPDA 1QYDA 4CLEA 1ISGA 3I9OA 3VH4A 1VKOA 4CQMA 3WWZA 1WLYA 1DRUA 3ENNA 1Z82A 1PJLA 2LDXA 4JNKA 1P0FA 1J4AA 1IZ0A 2X58A 1TA4A 3WTBA 1Y6JA 1PS8A 1O8CA 3AI2A 3T4XA 5G0TA 5COBA 3H2SA 4IMPA 1QP8A 3ETGA 3ANNA 4GKVA 2AQHA 4DLAA 2NU7A 3IDSA 5FWNA 2CUKA 2Q4BA 1RYEA 2JAHA 4J0EA 1AE1A 1HL3A 4HV4A 3NT2A 5MDHA 4J1SA 3EDMA 2HJRA 3GDFA 4IZHA 5EIOA 2YJZA 5DP1A 3JQBC 3OQBA 4BO8A 2QZZA 1NR1A 3H9UA 2NADA 3PPIA 2WTBA 5A02A 4ALKA 5HS4A 3HUDA 4Y9DA 5DULA 3F5QA 3JCZA 4DIBA 2YW9A 3RUAA 2H63A 4FR5A 5A9SA 3DOCA 1OAAA 1NXQA 3RKUA 2X0RA 3LF1A 3KYDA 3KOUA 1Z74A 4WCDA 4MPDA 4ZQFA 3WWYA 2O50A 4FFNA 4ZRNA 1NAHA 1WPQA 4M8SA 2XAAA 3RUDA 1CJCA 3DXFA 3TWOA 1UDCA 2QRLA 3P7MA 3VKVA 4BO6A 1JLLA 8LDHA 4IMRA 3WXBA 1E7WA 5C5IA 1FF9A 2O2YA 2W2KB 1NVTA 5KTKA 4J2OA 3ZGYA 4LMRA 4FD3A 4R68A 4D79A 3H3FA 3K30A 3T7CA 3WGTA 1X14A 4ZU3A 4OXKA 4W4TA 3ANLA 4W82A 3U09A 2GDZA 5TSDA 4B8ZA 4KUHA 1WMBA 3A1NA 1FDVA 5JY1A 1U2GA 3OIGA 5HBRA 2ET6A 3CMCO 3CXRA 3DMTA 3Q3CA 4N54A 1B15A 1D7OA 4MVJI 2ZB8A 3TL2A 2Q1TA 2UUOA 2OZPA 4BO4A 1QV6A 2CVZA 1VJ0A 4KDEA 4B3JA 3QJ5A 4D45A 5JBIA 2V6FA 3WTCA 5IN5A 3DO5A 4E12A 1EVJA 2X9NA 4GLOA 3V1TC 1EUDA 5L40A 3H9JA 2Y1DA 2FRDA 9LDBA 3UH1A 3L0DA 3H9EO 1JVBA 4HNGA 2WE8A 3OFSA 1XQ1A 3OSUA 4GX2A 2NU9A 3GN1A 1DAPA 1RM5A 1BXGB 4N5LA 1C0KA 3OH8A 2WM3A 4NDNE 4E2XA 4RQTA 3HWRA 1LQTA 5F1KA 4CV2A 3MJSA 3QRWA 2Q99A 3AJRA 1LRLA 4DLLA 1IUKA 3GNQA 1MG0A 2NVUB 4N5MA 3WGYA 1TB4A 2EJVA 3DZJA 4OOFA 4NQZA 4BNXA 1YDWA 3KEOA 4E31A 1E3WA 3SLGA 1YB5A 4WPGA 1UDAA 3E8XA 2W2LD 3AFMA 3R6DA 3WFIA 2C7GA 2VTEA 1XLTA 4MJLA 5JDIA 1NFQA 4XWYA 4LRSB 4XJTA 3WG9A 3WGOA 1ENYA 1PJTA 5C37A 4P4LA 4XDZA 2BKAA 2X5KO 1LX6A 3OA2A 3E82A 3PHHA 1SB9A 1DC3A 1T2AA 2WWRA 3EVTA 5I9MA 4DMMA 4BO0A 2O3TA 1YRLA 3EK2A 2W2LA 1YDEA 4LISA 1K6IA 1Y5MA 5HTOA 3KO8A 5DCUA 4BOYA 1IPEA 3ASUA 4II2A 3QVSA 3Q9UA 3H9GA 4O1MA 2ZCVA 5JPIA 3WBFA 3DQPA 1PIWA 2Y0CA 4WJZA 4GGPA 1K3TA 1LBEA 4IQGA 3GNTA 3GH3A 4J4HA 1MV8A 3NKLA 1EQUA 2HO5A 5A1TA 1EDOA 5B37A 1Z6ZA 2VQ3A 2E4AA 5GY7A 2X5OA 1HYEA 2VHZA 5EN4A 5TT1A 3BMNB 4EJ6A 4Y8VA 1W73A 4CQLA 3FNHA 2AQ8A 4IJVA 1GD1O 2GD1O 1TVEA 3OEWA 1B3RA 2ILTA 3NGXA 4R69A 1L7DA 2NU6A 4E21A 2DTXA 5TT0A 2W2KA 2AEMA 5H81A 1X7HA 3M6IA 4E2YA 4R51A 4HBGA 4ND5A 2C5AA 4WLEA 3L4SO 2B69A 2YY7A 1B2LA 4B3HA 1U3UA 1DC5A 5FFFA 1U4OA 3IL2A 5ILGA 3S2EA 3NT4A 1P9LA 2AMFA 4E6PA 5KVSA 1PSDA 2Y99A 3JTMA 5DZSA 4NFYA 2JFGA 3FTPA 4PLHA 3RUIA 3ZW9A 1ML3A 1H6DA 1MLDA 2NLOA 1DFGA 3H8VA 3BAZA 1KC1A 4GVXA 1R0KA 2PK3A 1A4UA 2P5UA 5AYVA 1ADCA 3SX2A 1DEHA 4F3YA 1Q1NA 2E48A 3VC7A 3GRKA 3C24A 1X7GA 2VWGA 4UUPA 3RAJA 3VPSA 3WQQA 5TLSA 1E5QA 1ISFA 4KOAA 2DLDA 4RORA 3HSKA 4LW8A 4E33A 4UREA 5F5NA 3OJFA 4Q3NA 1ZKMA 2QRKA 2D0IA 5CAEA 1ADFA 3ZHBA 3MEQA 3F1KA 3H5NA 4BHTA 2FSSA 4FCCA 4RZIA 1P77A 2OXIA 1P1HA 1BWSA 3BTOA 3JQ7B 2I65A 3I83A 2O3UA 3JQ9C 3NV9A 5KJ1A 5FYDA 3AM5A 4TZTA 1N1GA 1L1FA 2OUIA 1YS4A 2P5YA 4IS2A 4KQXA 2FSVA 1WZEA 2C2XA 3ORFA 4AJ1A 3JD0A 4HFRA 3SC6A 2NTVA 1ZFNA 4PLPA 2AE2A 3KZVA 2FOIA 2J5QA 3QSGA 4HP8A 1GEEA 5B4UA 3CZRA 4WEQA 2R00A 3HB5X 4B7UA 4FGWA 3V5NA 2H6EA 2ZB4A 5JYDA 1RPNA 2I6TA 3PJGA 4MP6A 5A05A 1GPDG 3GOHA 3RU7A 5ER9A 3IP1A 2NNLD 3KBOA 3BMCB 5IJZA 4J1NA 2DUUA 2HJSA 4RPKA 4TROA 5CEFA 1C0IA 3H4VA 1EBFA 5A04A 3FCOA 1T25A 3NT5A 3F9IA 2GNAA 1J0XO 2P9EA 1PWZA 1XSEA 3A06A 3NUGA 1LI4A 3GVCA 1I2ZA 3TRIA 4CMKA 2XF8A 4II3A 4YJGB 4Y6RA 1S7CA 3UOGA 4MKRA 5EQFA 1E7MA 3TZQA 4E5PA 2GR9A 4DPKA 3ADOA 4YAJA 1XELA 3D7LA 3DTYA 5JYEA 2HK7A 3WJAA 4IY1A 4RGBA 4NH4A 2FWMX 2BMAA 5CDYA 3HN7A 1B8UA 2PNFA 4YR9A 1HLDA 3LK7A 2Q2QA 3RI3A 3KB6A 1EDZA 1VRWA 5AXCA 4PGFA 4ZVVA 4UEJA 4CMGA 3AOEC 3PQDA 4F6LA 1GUYA 2ZB7A 2ZTUA 4JLWA 4Q3DA 4BV8A 4DQVA 4E4YA 1E7SA 1VPDA 1M67A 3MJVA 4WCFB 1P1FA 2E6UX 2BH9A 1I01A 3ANMA 3E6AA 4RO0A 4UUNA 4OL9A 3KUXA 1EE9A 3KV3O 1EVIA 2WMDA 2UYYA 3VOSA 3JQ8B 4AG3A 1ZBQA 3PYLA 4Z0HO 4KTTE 3O9ZA 3IJRA 1HDXA 3UHAA 1PGOA 4ALJA 5CDGA 5AXBA 4B8WA 1ENZA 5IF3A 2O3JA 1YO6A 3FPLA 4L0QA 2AHRA 4NNJA 4R5MA 5DNAA 2O7SA 3TFOA 1E6UA 3FBTA 3DAGA 4BO3A 4BNLA 3AI3A 4NBVA 2GZ2A 3DMYA 4OKNA 2FMUA 3MJ4A 2GN8A 1HTBA 3CIFA 3UCEA 1ZK1A 1UXGA 3VKUA 2JCYA 4PLTA 1HZZA 2JFFA 4HUJA 4CQMB 2EWMA 1K6JA 1P1JA 4LCJA 1I2BA 1NVMB 2ZJ1A 2G76A 3FBGA 3IUPA 1LU9A 3C7DB 1PEDA 3EC7A 1ID1A 2QYSA 3GGGA 4I5GA 4M54A 3EGOA 4Q39A 4W9NC 3ULKA 3H6KA 3GEGA 1A72A 3TF5A 4QQRA 4B4WA 1RM3A 2UDPA 3DHNA 3IUSA 1XR3A 3H5RA 1B16A 1YQGA 2Q2WA 3I23A 3CUKA 4R3NA 4AJHA 3U9LA 1KY4A 4R5HA 1DC6A 3RFXA 3FN4A 3G49A 3PGXA 4YRDA 1WDMA 4ZJUA 2EKQA 2DFVA 3DAPA 3OP4A 3AM3A 1R0LA 4WGGA 4U0KA 1T4DA 3ZCXA 2PZLA 5FI5A 1R66A 3GPDG 1CEQA 3BTSA 4PLZA 4R1UA 2PKRA 3F6YA 3GGPA 4L8VA 3ZWBA 1KEVA 1NQOA 4W6ZA 5T5QA 1LLDA 3S1LA 1RJWA 2ZATA 3SXPA 4O59O 4FOSA 2ZTVA 3KSDO 5JLAA 3OM9A 4CLDA 3JQAB 4XZ3A 2C20A 2C29D 2JAPA 5ITWA 6LDHA 4WE3A 4AJEA 1ENOA 2Y1EA 1BDMA 1BHSA 1XG5A 2J3JA 3QW2A 4CM3A 2Q1SA 1YE3A 4ZQBA 1E92A 3DBRA 4DBVO 4CMAA 4RVGA 4XYGA 3FF4A 4I1IA 3S8MA 3F4LA 5T8KA 3AY3A 5I7EA 1ZMOA 4JJIA 4YAGA 3ZWPA 1DIAA 5EERA 3SVTA 4XB2A 1NQTA 4R3WA 1ZSVA 1HT0A 4NU5A 3NGLA 2CF6A 5JCJD 1G0NA 4OSOA 2VWHA 4QO8A 3C1OA 1FDUA 4H7PA 2NUAA 4MO2A 1OZAA 1ZK0A 4IJUA 4OJNA 3QV1A 2QHXA 3ZNQA 2POQX 3VTZA 3RQSA 3IAHA 1HF3A 1E7QA 3JQBA 1HE3A 2D1YA 4JJGA 4DTIA 1KVSA 1XU7A 1GV0A 4MP8A 4XDYA 1X1TA 1PQUA 4U7WA 2BD0A 1VL8A 5CDTA 3H7AA 5I7SA 2ZIZA
chains in the Genus database with same CATH superfamily
3N2GA 4X71A 5JW6A 4HS9A 1NMEA 4YPVA 4CHGA 3RUHA 3ZUPA 4MYRA 3SFVA 1GPUA 2R6GA 5FKJA 2C00A 1ZIXA 3ZDZB 2G40A 3FR8A 3ENZA 4L57A 3CUWA 3NGMA 5CYGA 1RLUA 1CQIA 1D2HA 4QJBA 2IPNA 4UD2A 4BYGA 1JP7A 3UPDA 4AUNA 4K6CA 1KOLA 4L8GA 5G0UA 4R2LA 1XHLA 1X86B 1KSGA 4EBFA 4RDXA 4HNTA 5K0TA 3WGVA 4HAOA 2H4ZA 2ZT5A 1E7RA 2JBAB 5A4KA 4RTMA 3VGPA 1RRCA 3W78A 3S40A 3SIPA 1ADJA 2PZMA 5DN6A 3T52A 1KIAA 1QCCA 1B6RA 1WUTA 2CNNA 5LCXA 2ZSIA 1UM9B 2EVWX 1BA3A 4EW1A 1SVSA 1LFDB 2XTNA 3L0ZA 3FRIA 1L5OA 5DIFA 4NYIR 1K5HA 1L9XA 2LD4A 3MVEA 3FAZA 3D1JA 3PC3A 4IZOA 4EUFA 5I4CA 2XEDA 4TMYA 2DWUA 5AVQA 3PYMA 2PUDA 1L5LA 1TT5B 1W9HA 3E5NA 3D0KA 3OX4A 2F9LA 3L1VA 1A97A 1JFFA 3FWNA 2HCTA 4FXOA 4JGGA 4TOIA 5KI6A 2G0NA 1UWVA 2A9FA 3DFKA 3W5JA 4Q82A 1LSUA 1UBSB 2OO7A 3OIVA 3UFXB 4LJLA 2JIQA 4UASA 4WZBB 2QTFA 2P79A 1J07A 1V5WA 2GN4A 2ZDGA 3E2PA 4HTAA 4N8DA 2AEJA 2PX6A 3AHEA 4KKXB 3WLMA 4BZXA 4FNMA 1L7AA 2VDUE 1KC3A 3CRW1 2Q0QA 1BMTA 1MJGM 3KWFA 1XJQA 2OV8A 2P62A 5J2TA 3T0IA 3OFVA 2ZAMA 4PTZA 3WLOA 4EO9A 1M8FA 4UTNA 2AN4A 1BEEA 2EEPA 4E3WA 1KR5A 1K98A 3LC0A 3OMXA 5CNJA 4JR1A 5K3SA 1K0FA 1HETA 2H1WA 2XE7A 1MO4A 2P91A 2PL1A 4IO0A 2XECA 3W8EA 2BEJA 2ODEA 4PC6A 1V6AA 3SHOA 4GECA 1GZDA 3I9JA 2X2PA 4D9CA 4U02A 4BLPA 4K81B 2PKCA 3AR9A 4DILA 3KKZA 2V0CA 3BYZA 4RL6A 3CTMA 4JLUA 1LPBB 3TB4A 4DLKA 4AECA 1QBGA 1ZJZA 2DYKA 3QPUA 5GZ3A 3UJBA 5IG2A 3IRVA 4CUKA 1FVFA 2H2IA 2HRDA 4FUQA 3PG5A 3LQQA 1QLJA 4WSOA 2GD2A 4KO3S 1SBHA 2D3WA 4G5QA 5JS7A 4BO1A 4G5HA 2WU1A 4FT4A 3KOMA 4ETWA 4OP3A 4KB5A 1TU4A 2P7IA 2AF4C 4P4SA 4WLFA 4D8TA 4DARA 2W4IA 1YH3A 1YRHA 4Q1VA 5C8XA 4AKHA 3QJYA 2ACWA 1D4AA 2A67A 3GJQA 3KRTA 3W77A 2O4CA 4BWFB 4FFBA 4KLNA 5JSUA 1OY1A 1WB5A 3N8KA 2EFDB 3VTFA 4WASA 4LBYA 5TQ0B 4YQZA 1H9CA 1BWPA 2Y1GA 3SICE 2H1IA 3G2OA 2R60A 5BN5B 3NBMA 3A6HA 4BFTA 1VSTA 1MB0A 3BMQA 5H83A 4EI7A 3PICA 5J4KA 4G0NA 4M76B 1SXJE 4JJKA 3EVGA 1ZH8A 4NPCA 3V42A 4B35A 3DSRA 5AM4A 2YDXA 4ALMA 5KJ6A 4ZREA 3FW1A 5D87A 1DWUA 3THSA 4RNDB 1HORA 4R2IA 3DMNA 3HU2A 5JAMA 5LQRA 1DKRA 4DCPA 1U8YA 1J8QA 1ZSNA 2DWOA 2BGKA 2QRVB 1Y9EA 3FOAA 5LMUB 4QYTA 3ZKWA 3C8HA 3EA0A 2DHRA 3BIXA 1CNMA 2B8JA 2CDCA 4MIYA 1T2EA 2PU5A 3CPSA 4FC6A 4W5OA 3BMQB 2YYSA 2Q6KA 4PCAA 4RTPA 4RKQA 4MZXA 4BEVA 4UDNA 1O6ZA 2TMGA 2Y0DA 3EDOA 1NFFA 1J8VA 4EVRA 3LLSA 4U1RA 4ZGBA 3GPCA 3ZCSA 3SLRA 4DA0A 4ITVA 1W5AA 4YMSA 1T5DX 4RD3A 3QPVA 1UKAA 3GJ3A 1ZMTA 2P30A 2DUJA 2RB4A 3RSSA 2AOWA 1GY8A 4XVHA 5BSVA 1NL3A 5CX4A 1YE5A 1RRVA 4O5OA 4WNCA 4EK9A 3PC8A 1DC4A 1KERA 1G5HA 3E9RA 4IIXA 1R88A 3V8NA 4X7RA 5DNCA 5K6AA 1ODFA 3VAZA 1P8AA 5CVJA 1TAQA 4DV0B 4H7DA 4OHBA 3K31A 1JNYA 3LOUA 1G20B 5I47A 2AFHA 1TUIA 5ECYA 5JC1A 2DRIA 3N86A 2EHDA 1Q20A 2GYYA 4S1TA 2GZHA 3QLEA 5ESXA 3ZDFA 1A95A 1GTZA 3N2YA 1G8AA 1R6BX 2C92A 4EJSC 4KE9A 2KBFA 2WJAA 2WHPB 3ANSA 3E4CA 5A6SB 1J9EA 1BMDA 1G4HA 4AC9A 3LFUA 5DM2A 4ILEA 2J7KA 1XRLA 3GMDA 3ZJUA 2IZZA 3O2QB 4CEIB 3LKZA 3G5AA 2CXUA 2Q6VA 3GZNA 4INZA 5J2TF 4ETNA 5BQFA 4M99A 4CLRA 3U3JA 2F3PA 2JFHA 3AWIA 1Q84A 4F9GA 3LBYA 5CFZA 2NVWA 3GLQA 3BBLA 2XEXA 4LHYA 4M21A 3DXXA 2VC2B 4YCSA 3W2EA 3ECAA 3H7IA 2PIAA 3FGPA 1K89A 3TBFA 3B1JA 3ZE8A 2RGAA 1J24A 4CDGA 1H1TA 1AKWA 4F8YA 4X7MA 3VSBA 4KDRA 1P9RA 2IUSA 4ILKA 2GK4A 2WPDD 1UKVY 3L7IA 1W94A 4WZBA 5KTPA 4X85A 4XXHA 3DT8A 1LSJA 1JEOA 3I01M 2ZJ8A 4M0EA 1Z3CA 4DMRA 1ZN2A 4HWSA 4XR4A 3QYPA 1K2WA 5KHAA 1MPXA 2ZRFA 1J23A 3RVQA 3WGIA 3LUFA 1ONOA 2BUCA 2E1PA 3O2SB 3NHRA 1EHYA 2DT5A 2X7HA 4GPZA 3V00A 4ZMSA 1Z0UA 1I6MA 4FR0A 3ZHRA 2LKCA 4L4SA 4WESA 3COPA 3FGOA 4OXNA 1P60A 4CU5A 4DMCA 1VJ1A 1ZCFA 3TQIA 1VOTA 2VEOA 2VF7A 5TRTA 4TYWA 3LPCA 1JJBA 3IELA 4LX8A 2CGEA 3AF6A 1R3DA 3AF5A 3HB0A 4MV8A 521PA 4Q9NA 4X8LA 1PV1A 2YZMA 5JTTA 4LDNA 5DYGA 4DDTA 1ADGA 5IU6A 1VPTA 2Y1FA 3MD9A 3NEPX 1C8VB 4ZVLA 5TJ9A 2XZDA 1XLTC 3WLKX 1XXHE 3C6ZA 2K2QB 3UT6A 4MW6A 3RS0A 3EZNA 5GIPE 2YASA 3GUZA 1LCIA 1JLSA 3HB4X 4LXYA 2BUAA 1SKYE 3G0GA 1YBAA 2OE2A 2I66A 5KEIA 2C9YA 4NOKA 3A9UA 2ZYGA 4HB2A 3WKEA 3TAUA 2KBEA 4BUZA 3R76A 1YOBA 2LBPA 3JYNA 4Y98A 1PLJA 1PZHA 3ON5A 4QQFA 1Z3IX 3P4YA 2PKWA 4BUCA 2AC2A 4NZ9A 2ZYTX 1XMIA 1CUWA 2K2WA 3IIJA 1SXJC 4AJNA 3ZCVA 1PLKA 4OXQA 1FVXA 1SJ9A 4C88A 3RR2A 4LOIA 4BLSA 4IIVA 1JBKA 4CF6A 5BN4B 1VHLA 5IXSA 1LNQA 3ZY4A 3ROQA 3UK1A 4QEKA 3A05A 4EKEA 4Q3OA 3W5IA 4FNGA 3E18A 4YJHB 3B8HA 2HLDA 1YZUA 1L5KA 2OPHA 5FV7A 1UOPA 4AQYB 3HZRA 2FMXA 3TM4A 1C3OB 4NNOA 5GONF 3NTOA 4OHZA 1LPNA 1S4QA 3QVVA 4MB6A 4X1IB 3TPFA 3EZLA 3HA3A 5ALQA 2Q6LA 1Z8FA 4EM6A 4U2KA 3DB2A 2IHUA 4GZMA 4QPDA 3TPZA 1JU9A 4NMXB 2VUSA 3V4OA 1NW6A 3MTJA 3PFIA 2ZVQX 1JXOA 1RT9A 1V4BA 2HFJA 2YHIB 1H5NA 3BE4A 3D6MA 1GL3A 4O0MA 4WKOA 4XGNA 2NU8A 1KARA 1P4AA 3ZGXA 2BI7A 1IOZA 4JSYA 1OFVA 1UXIA 5FWXA 3CW8X 3NBZC 1YDGA 1QORA 5A2GA 2H5JA 4CYMA 1FFGA 5CXUA 1MVNA 1O97D 1OA0A 2V5UA 4B6SA 1CDEA 1LDNA 3QA9A 1M2WA 1G5IA 3A0UA 1R16A 3SK0A 1KXZA 1T34A 5K01A 4AMVA 1QK4A 4RH3A 5E6SB 1SIWA 3R7SA 2JKVA 3VPXA 1JHUA 1E6KA 1KQOA 2J9GA 2WPNA 4OQEA 1M1YB 2WF6A 5A5DA 1E2DA 1T3HA 2XMQA 3L0IB 3DTVD 1JH9A 2PFGA 3GXBA 1S01A 2XCLA 3AESA 3QVXA 2JVIA 1FA9A 1TA9A 2Z2YA 5F7JA 5ALOA 3GLTA 1WNFA 4R84A 1FTSA 1N6PA 2QX9A 2X76A 4BLVA 2XDAA 3QELA 4ZN6A 2VHUA 5HS6A 4I99A 2IH4A 1LI7A 1ZESA 2MSLA 2WWFA 3JQFA 1WX1A 2BGGA 2HMVA 1N0WA 2Q4EA 4G9EA 2P11A 3OO1A 1BDBA 3TIIA 1W88B 2P2ZA 1X6VA 2P2SA 2GBLA 2WTNA 4HAZA 4Y0NA 5FPKA 3DS8A 1HLPA 5H4HA 4CM6A 2P1ZA 2G5CA 5L3QA 721PA 1SHZA 4H27A 4NYMQ 5JFGA 1PWEA 3HJRA 1ECCA 3BN3A 4I3FA 4QVIA 1BH2A 5TIIA 1Y1PA 1JE0A 1YIOA 2ZR7A 3GPBA 5KS2A 3PJDA 2HX1A 4DJTA 5LP1A 3PV0A 2ANCA 4X1YA 4CG2A 2JGMA 2XMCA 3GQBB 1EFDN 1YZNA 2OYRA 2JFXA 1SHTX 2GHRA 4CG3A 2QD4A 4MPRA 3RYIB 4CI9A 2QMZA 1Q83A 3GZTB 3GRVA 3H2KA 4YJDA 2QY9A 5B3JC 4FNOA 2WWXA 3DE6X 2E5WA 2IYUA 1NYLA 1UUFA 4N3NA 2FZWA 4IIFA 3ZV3A 3T7AA 4ZT3A 2MSCB 1V2GA 4NHEA 2FFHA 1QAOA 1WUHS 1IXZA 2CHGA 2DQ4A 2IRWA 2C07A 4UBIA 2G4LA 2OAP1 3V4PB 2HRCA 4RA6A 2VNAA 2I7VA 2SCUB 4KPGA 1RYFA 3B6JA 3L8FA 3WLFA 4MWBA 1R6XA 1ULSA 3VI4B 2W2NA 1UDWA 2GCEA 3ESXA 4AXXA 4E6EA 2W0SA 3KZXA 4E7OA 4N5NA 2RHBA 3N6XA 4UHFA 1GPJA 2QRZA 3P5SA 4CRWB 4ZTZB 1QPZA 1GGVA 4TLCA 2FJPA 4XYEA 1EU1A 5FBQB 3R9XB 5LQNA 5ICEA 1TCBA 4GI1A 1O77A 4KFSA 4L8LA 2FE4A 4Z1OA 4R1SA 1NGSA 1ODLA 3AX6A 5JSKA 2W8ZA 4LN1A 3T3EA 3HADA 1VIMA 2HLPA 5C5EA 5JZMA 3PTAA 4A0SA 4AJIA 2ZIXB 5WRFA 2EJWA 4MUHA 3HO8A 3LYUA 4B82A 4EUEA 2OFPA 4L76A 2NXWA 4IBOA 4OB8A 3DZFA 4J76A 3L4EA 1WQ4A 1TYBE 4WI1A 1T4CB 4CMHA 1I7SB 3SYNA 4BBPA 2OCIA 1FQKA 5LMNB 3ETEA 3K9CA 1E1DA 2J9YB 1G5FA 1BQEA 1EFKA 1NVWQ 2YBDA 3AM4A 2LZ0A 2BELA 3EG9A 4KH1A 3RSFA 4RTSA 1L8LA 1L7MA 1QGUA 3RUPA 4E4RA 3HSSA 5AW6A 2E89A 2KS6A 1QHHA 1GT91 3D3NA 4L6CA 3WZ2A 4KI7A 1C9DB 4H18A 4PCVA 1M34B 3T3GA 2HH9A 3JQAA 1WB6A 2KW5A 4FQ7A 3W2GA 4V1CI 1NM5A 2AZTA 1OBFO 1ZRSA 2BKEA 1W46A 3BHMA 3DV0B 1U8UA 3NALA 4QG3A 3EXEA 2IEGA 2I4LA 3QFFA 4NFLA 3OOHA 4QM6A 4ZYUA 4JLMA 4YYZA 4DTIA 5AQEA 4R6WA 3VVLA 3D2BA 4OYYA 3HZOA 3GEIA 3GUCA 1LA2A 2PT5A 4TLDA 4UE2A 1XMJA 2Z2ZA 4GAEA 4PVDA 2QP3A 2VEDA 3B9BA 3ELDA 3PTLA 4B43A 2J0SA 4QU0A 4RV4A 3LSYA 3AOGA 4HGRA 1QGED 4XTCS 1V8BA 3CVOA 3IP6A 1C4WA 2B25A 2XNJA 1I3LA 2PTHA 4U7HA 3IQZA 4XD7A 2OGUA 5AHXA 2BYTA 2RJNA 3LDHA 3NHLA 4MV4A 1YRYE 4OI0A 2CFOA 5K0SA 1BGWA 1J22A 2OKGA 1G7SA 1JTVA 1NOJA 5D7NA 1CEXA 1NVAA 2M6RA 1U8AA 3HG7A 3QF7A 2XXBA 4RKWA 4LQCA 1QS0A 4C7BA 1H5QA 2GPYA 4NMMA 2ZJ2A 3EAFA 3RS5A 1K7YA 2H4WA 1HI9A 2PX0A 1RWBA 3JRXA 4MEBA 4QT0A 4L5AA 4ABYA 1DTWB 4FIZA 3U5ZB 3GVPA 2J3MA 1T5OA 3EIEA 3KB1A 1JI3A 4HZUA 3M2TA 4K6OA 4JFAA 3SU8A 1VA4A 3LF2A 1QPGA 2SCUA 5JZVA 2J8ZA 5IC4A 2EZ9A 1X42A 4GMKA 1JDBB 2WSBA 4RMNA 1J8DA 4GPBA 4EQ6B 4NMWA 2V9ZA 2EHJA 3L7BA 2RH5A 2XOEA 1L6RA 3QX9A 4P36A 1TM7E 5LIRA 1A2KC 3E7FA 4QXPA 4FOPA 1KP2A 4KREA 3Q8MA 2G7ZA 3EEBA 4NV0A 3LRPA 4EPVA 2Y1XA 1WDTA 2XOKD 2WAYA 1GGEA 3ETDA 4KO4S 5JS8A 1YA6A 4X8MA 2OESA 3I45A 3KK0A 1LXCA 5IJ9B 1IN4A 1EFHA 1FLVA 2W37A 2YWCA 1LLQA 4H6PA 3TZBA 1WM1A 1F7UA 1HQYE 1U9JA 1G1MA 3Q12A 4DRZA 5CA1A 3GNLA 4H1HA 3WOVA 3DUFA 1VC2A 1F9AA 3ZLBA 1U7TA 3RYFB 2P9GA 3FPSA 1SU4A 1FY2A 4ZEVA 5GINE 2FUEA 2WT9A 2PG3A 4QFDA 4X1YB 5ECWA 5EWJB 2CJFA 2ZU0C 4B3BA 1UM8A 4MVJE 4X7PA 5EJ9A 3MAAC 3QVWA 2A14A 4RAOA 3DAFA 3EQ2A 3A04A 3VHRA 3PNYA 2ABWA 3MCWA 5JAOA 3EEYA 4JEUA 1KJQA 1ZJJA 5C53B 3QKUA 1K1EA 4DRYA 3S5JA 3I2IA 4FVTA 1ST2A 3FF1A 3SSNA 4M1EA 5CG1A 4IUDS 3AETA 1NASA 3EIXA 1J5PA 2REBA 3GJXC 3LT1A 1K6EA 9LDTA 1CLUA 3D6JA 4B76A 1CHDA 3EXHB 3ZE2B 4F5YA 3PE6A 5JISA 4HXFB 4CTMA 4KP7A 4JBGA 5F1PA 2CXTA 3NP7A 5DRYA 3VR3D 5IVHA 3HYRA 3DTVB 2HW8A 4GS5A 4LHEA 4NENB 2ORIA 4FFPA 2A59A 2E9SA 4M83A 4Q7EA 5EJ2A 4BQRA 3IVXA 3HDJA 1XZNA 1ISJA 1RQLA 2H1CA 1KA9H 1PHPA 1UC8A 2B83A 1E58A 3CNLA 4ANFA 3TECE 4DKJA 3FTQA 2PFSA 4KMRA 3E3LA 4M89A 1WP9A 1H1DA 4DIFA 2CNBA 2GOYA 4D4LA 1G8JA 1FMTA 3BT7A 2BFNA 4B73A 2VO1A 4GQAA 2YZGA 3DT6A 3LJKA 5G4LA 3MWEB 2OM2A 2B8WA 2CE7A 3VH1A 2DG2A 1VI5A 4AJ2A 3ZZNA 4KXVA 5EXDA 3IPYA 3VU8A 2L69A 2GVZC 3LZ6A 4P0QB 4OQMA 4J0FA 4F0JA 1IHOA 4B4UA 2JH9A 4UBOA 1ZK2A 3FY4A 2UVQA 4DZZA 5EHXA 2HU2A 2YHIA 4K9DA 1YZ3A 4DM4A 1IXYA 3FCXA 2A9PA 4ZVTA 1QVAA 3HXMA 3FOBA 2ZUUA 4QHSA 1MC8A 2D4AA 3TE7A 2DKNA 4IDOA 3TEFA 3JYHA 4KQMA 1YZFA 3DD5A 5D6NA 1WXXA 4C4PA 2XUPA 5AVRA 4YIKA 1KMHA 4HATA 3UJPA 4EITA 5KOYA 1VI2A 1JTEA 3UHOA 4JX8A 1TM3E 1Q95A 2EXXA 2QJTA 5E1BA 2OQ2A 1XXLA 2VWPA 4IIJB 5CVDA 3UO8B 1CW2B 5A9RA 3C8ZA 5HZHA 2YKGA 5KHLB 2BGTA 2C94A 4RSRA 1NRXA 1G41A 4BLQA 2O4UX 4IGEA 2XDYA 5K7SA 4KOEC 5BSWA 2BLLA 1LSSA 3NPMA 2G3YA 5JO0A 4MWCA 5AVWA 2IOFK 2EERA 2Q6OA 4ZHQB 1N7HA 5IMSA 1PGPA 3AIKA 4EPRA 4XVRA 5KUTA 4AWAA 1G60A 4QVKA 1G4AE 4LGCA 1U90A 1ELOA 3LLMA 1E5VA 2GEUA 4GMGA 5KMGA 4EKDA 1JBEA 4CMEA 1ZNWA 3IAS6 4KVAA 4R81A 4BQFA 3U3OA 4YQEA 3FCUB 4MRSA 4ZK2A 4R0NA 1IRIA 2JLRA 3U3ZA 1GPAA 2CLSA 2IEIA 2GZSA 1KYQA 2GCOB 2RGBA 3L7NA 1GYRA 3OZVA 4W7SA 5JV5A 3FG9A 3FVQA 2GT1A 2O1SA 3QKRB 1Z0SA 3VR6A 1NE2A 1JKIA 4ND6A 3E9MA 1DEOA 2EBWA 2V7QA 2DT8A 3UJ9A 2OOKA 1QR2A 3JWHA 4Z0PA 3AIOA 4XYMA 2JL1A 2R25B 4LSMA 3VC2A 2C2YA 1KTIA 1AGNA 1KIFA 2WJ3A 3CB2A 5HKLA 3SC2B 4ZHQA 2WJYA 2FMTA 4L02A 3TDMA 4Q1AA 3O84A 1OVGA 1TCVA 3BRWA 4AQ7A 4FFWA 4LE1A 4A92A 2EG9A 2GYUA 1X2EA 3KR9A 4EJMA 3K16A 3KZ1E 4LRXA 8ATCA 2B98A 4HDAA 4P08A 3VR6D 2HBZA 2A4KA 4YQYA 3TFWA 1G66A 5ICFA 5AJVB 4P83A 2XA9A 4DXAA 2IZ1A 3NYWA 1E9RA 3D59A 4HXYA 2VPWA 1X9HA 1UWKA 1ZN7A 2ZRPA 3UF0A 5M7EA 1DOHA 4OJTA 4HK4A 2TYSB 4NU6A 1S8FA 4A0GA 4JX9A 4ED9A 2A1IA 3DHEA 4C76A 2QGZA 4OMDA 4I4TF 1UKCA 4G0OA 2WZBA 3UJNA 5ALHA 4PBTA 5BNFA 1ZZEA 2PH7A 2G36A 2CZQA 2EGGA 4HGZA 1VL6A 4QOFA 5K3BA 1G2IA 1NWCA 3GEEA 2BHLA 2D0OB 2XW6A 4G5GA 1SUBA 4OO3A 3TAHA 3D6NB 3EGCA 3LL7A 3OIDA 1D6JA 4RVSA 1L5NA 1XJCA 1VMAA 2CK3A 5K6TA 2CYCA 4I9NA 1VQ1A 1ABBA 2G67A 2Y27A 3WHKA 1EZ1A 2C78A 4Q4LA 3DDUA 4FE7A 4YJFA 4UBMA 3X2FA 4BKQA 3W05A 4XCXA 3GRRA 1OYOA 2NU6B 4ISCA 2CLDX 1SPBS 4JLSA 3W0LB 3W1EA 5EA2A 3EDRA 1GGHA 4REMA 1KKUA 1YI0A 2J3DA 2A5DA 4TV9F 5CGZA 5JIBA 1E1LA 5EOVA 4PF1A 4CMIA 2CN1A 4B2YA 1KS2A 1GUAA 1XHEA 2DF8A 1JHDA 3HJHA 4FB5A 1OTYA 4NENA 3P27A 4OREX 3OJXA 5KNBH 3N8GA 2NYVA 4M1WA 4F6CA 1JPUA 1SH7A 2FUCA 1JMYA 2PRKA 3IRUA 4GDMA 4MP3A 4N0PA 1OT3A 4BAGA 4BP9A 5CDSA 1I0IA 3H5AA 4GP6A 1T9GS 2H1FA 4Y6OA 2B7LA 3SR3A 2J3IA 3QW4B 2DQYA 1KO8A 1P1BA 4LZLA 4EB6B 3QYAA 5AHOA 3DR3A 1I2CA 4G24A 3FDZA 1XDWA 2WJ4A 4RFLA 1L4FA 2B8NA 2HK9A 4JUBA 4OLHA 3EPHA 3I58A 3T9BA 1V1MA 3DE1X 1DXHA 1JIUA 4R3UC 3TM5A 3LZCA 2MR5A 5A4IS 1FTWA 2DVMA 1B26A 2G9UA 3K0EA 4Y2QA 2P75A 2X0DA 1EHIA 4BY9E 3BXPA 1EVZA 1CU1A 3CJQA 4JI5B 3N5CA 4ZCLA 4BE9A 4AYXA 4EGFA 2IS4A 3FKSA 4LE0A 3AUXA 2GXAA 5I3CA 3DUFB 3DVAA 5K45A 2Q5HA 1YS2X 2DHDA 2M6SA 3H9BA 3DEFA 3SN6A 1T0UA 2PLRA 3Q41A 4LMAA 1TCAA 2OCDA 4G26A 3A2LA 4P7BA 3LPDA 4ALLA 3VUEA 2GGSA 4WKBA 1E3WB 5DXJA 1J2UA 3K09A 5AKYA 1YULA 2F3SA 1EGHA 5ENZA 3K96A 3PVZA 2OMEA 1JHZA 3M7IA 3WBJA 3EEQA 1SZJG 1M6YA 1JMVA 1XDGA 3HJAA 2D1FA 3OT1A 1ZW6A 2DE0X 3O4HA 2BSXA 5AKXA 4R1LA 4BS9A 1XQYA 1FTYA 2ZFUA 3PRKE 4I9UA 2IUUA 4DR5B 5EVCA 1O6FA 5TQ0A 4ZOQI 1YGYA 2V8OA 1N8SA 4F1JA 1Z7YA 4GI5A 2IIPA 3USZA 4JYCA 4QX6A 4EP1A 4IDBA 3VNBA 4PFJA 3ZZTA 5ADHA 2NXEA 3IKVA 3STTA 4LYYA 2QD3A 2WU8A 3GJ6A 2F8LA 3UZUA 4WZAB 3HJFA 2GK3A 4O4IF 1QOQB 1U9ZA 2DP4E 1GG5A 2PSFA 3PCTA 3KKMA 2DLNA 3PFFA 4OIMA 1Q1ZA 1FFSA 2RHCA 2C54A 4UHCA 5EP3A 3K5WA 1JKJA 3UGTA 3VPFA 5FUWA 5T4HA 1R9JA 5C46F 1G1AA 1GWNA 4UMEA 1Z68A 4S2UA 2P3LA 3GR6A 4URUR 2YICA 4EW3A 3UPUA 2Q3EA 3PFWO 3IAS1 1XQVA 1DU4A 4KXNA 2Q7DA 3OJOA 3HJNA 2XQJA 4O4JA 2K87A 2C3MA 3TLBA 4J03A 1H2ZA 4DABA 4C3ZA 2SBTA 1DBPA 3I1FA 4HYYA 4WT7A 2H85A 1E0JA 2IXEA 3D7RA 3TFQA 5D2CA 3MWEA 2WJZB 4XSHA 1USVA 3C39A 1LDEA 4B6GA 4E7PA 1CUGA 4OGFA 3AR3A 3JS5A 1RNLA 4K0RA 4WXPA 3WJ2A 3R3UA 1DO0A 1BOFA 3E5HA 3PXDA 4A1OA 4LVNA 2GA9A 3P52A 3WGUA 4ZT2A 4LPKA 3ENQA 3U2QA 1BDHA 5JQGF 4L50A 1UODA 3IAXA 4RJIA 1CUDA 2PGIA 4HJXA 4J0JA 5FLEX 4AFNA 5BRJA 3JAWB 1AGPA 3KVYA 4OKIA 1W85A 2O1XA 2P9JA 4MVJP 3SPXA 1XTIA 1MB3A 1XZBA 2XOXA 1SCKA 5LQSA 1TJYA 3LYLA 2AXQA 4L3VA 4DAOA 2CVQA 4M37A 3ONEA 4CKWB 3RFTA 2OG2A 5C31A 4RF4A 2PD3A 1NNUA 2NSHA 2JCGA 3PEWA 4B0PA 4DC0A 5FQNA 3DZGA 4F96A 4PG8A 5LWQA 3LCJA 3D3EA 4N03A 1QRSA 1CRPA 1UK6A 4OGGA 4BMCA 1K8QA 2UUPA 1L5GB 1FFBA 1KY2A 1TI7A 5LU9A 4YDQA 2HCFA 1QGAA 2YNMC 3NRCA 5J47A 2XYPA 3V7WA 3LKBA 5HF9A 1O5OA 5ERXA 5HG0A 1I5OA 3DNFA 4F97A 2X9LA 1U9YA 3QYFA 3L84A 2J3EA 4X3OA 1RI5A 3OJLA 4PY2A 4Q9HA 1EZ4A 2DR2A 3WMXA 3EPKA 1G19A 1ULTA 2W6NA 1OWNA 5DBGA 3NBUA 5DLYA 4N39A 5DSTA 2NWQA 3UXHA 2ZB2A 2JBAA 3BKXA 3OOJA 3L77A 4V0KA 1O3YA 3QWHA 2MR6A 4WBSA 3T41A 1HO3A 4MIOA 4BVJA 2VRNA 2FZEA 4P4UA 4Y6PA 4DL9A 3B3JA 2WJHA 3QITA 1R8XA 5JSFA 2XDQA 4MKZA 5DIZA 1L6IA 1W76A 3O1HB 4BBJA 5KYKA 1UFOA 4DAEA 2VJKA 4RKRA 1YQTA 4XASA 5JXJA 1Q3TA 2R5FA 3N8IA 2Y6UA 5D3QA 2JEYA 1YDFA 3GEDA 1ST3A 3WIDA 4MRVA 4L5BA 1Z34A 6REQA 2HADA 4PZDA 2YQ5A 5GV7A 1XP5A 1RC8A 2JVJA 4QPJC 3DFUA 1QO9A 4L3OA 5KKCA 2HSDA 4UVDA 2ZEJA 4RDHA 4WERA 2D7DA 2IS2A 3C3AA 1A8PA 3FMVA 5LLSA 4R7GA 3RAGA 4BZZA 5JWRA 4RNCA 5DK4A 4H1WA 1FSPA 1QIEA 1ZD8A 4GH5A 5TPWB 2ZT8A 4FSDA 4LJKA 4IXTA 4H4EA 1JYEA 2CFSA 3UMBA 2VYVA 4Z0TA 1BU8A 1LKZA 4AS3A 1DKOA 4KK3A 1CJUC 2Y66A 2GFHA 3G2PA 5JXHA 5KYXA 4OHCA 3MS7A 3Q8XB 1G21E 1CRQA 1FTQA 2Y67A 4Y6LA 4ZGGA 4JT4A 5IXJA 1T8PA 3Q6NA 2EL9A 4WOPA 2BMFA 2GJ9A 1U0HC 4QECA 2ZOSA 5EVJA 3WK7A 1VYUA 5AW8A 2JI4A 3I2HA 1KY5A 2CW5A 2XTAA 3H65A 3O4VA 4YAEA 3IB6A 3TRKA 1ZXBA 3TXYA 2ONCA 2YFQA 3AI7A 3MS4A 3AUAA 4LC0A 3RQIA 3OC6A 4BRWA 3FOEC 1TPYA 2ZSDA 3H8WA 3OESA 3F7OA 3ET5A 4J0KA 3MK31 2I3GA 1W48A 3EY4A 1EWYA 5K3OA 1NW7A 3H2ZA 4MZDA 4WLOA 3LPLA 4OBWA 3C5WP 5H3HA 1Q17A 4Z0NA 1DJPA 3I05A 3L7DA 4OHRA 5E2IA 1JECA 4DRXB 5KQGA 1V7PC 3BQMB 1OYVA 3LLVA 3ORHA 3HACA 4ICIA 2V4UA 3DMPA 4IKPA 5E6SA 1EVYA 2ZTHA 4BX8A 5J43A 1XZLA 4ZOAA 1IUNA 2W2TA 1Z83A 1Q7CA 2W00A 3DLPX 3E23A 2PKQP 3DE0X 4UKDA 1RP7A 1ZUD1 5PGMA 5G0WA 1LTHR 2L17A 2ZROA 2B8TA 1KOJA 4ESEA 2JIPA 1ZUHA 5CNKA 1C3EA 3IMKA 1RAIA 1AQYA 4M60A 1C9NA 2IEBA 3H0KA 4G1MB 5AJTA 4GBMA 3CG0A 4XSGA 2H31A 3DLIA 1PTJA 3GROA 3O8NA 4NEGA 4KYIB 4ZQEA 3L1KA 1B0AA 3W4JA 1AS2A 5DCWA 1D1TA 3HN6A 3WB0A 3M0EA 4CT5A 4BVBA 3PPXA 3EVNA 2OB2A 4WKNA 1YCFA 4WZAA 1XUOA 3OZRA 1Y37A 4HB4A 1ZM3A 3GLUA 5AIBA 1VG0B 1ADYA 2BN4A 1RPJA 4H1VA 1OU4A 1I9CA 3WMGA 3O8CA 1G55A 1U2PA 2MHCA 4K86A 3B53X 1Q50A 2BDUA 3K4QA 1WXGA 5LZ9A 1JG1A 1IDN1 1SB8A 1BXKA 1WU7A 4A8HA 5DI3A 3NP9A 1DIBA 5EWLA 1YUMA 3RU9A 2Q1YA 3HR7A 1RFGE 1GZ4A 2IYFA 2UUAB 4QELA 2V0GA 1I4WA 3IT3A 4PHTA 5EGNA 4OSPA 1II0A 3SJZA 1YIDA 3AV0B 4BNVA 1XKLA 4EHNA 1OB2A 1I4LD 4KQ9A 4EJ2A 2B21A 5CDFA 4U2FA 3SSMA 3ZHYA 4BMPB 4J1TC 1PZFA 2ADMA 1KI6A 1GARA 2O07A 2I6XA 3PX7A 1OU0A 3CH5A 5B2FA 2G0TA 2Q4DA 1G2PA 1JHQA 2WKWA 4CL0A 1FFHA 3QY9A 4OH1A 4CMEC 1B3BA 5EIXA 1CUUA 4B46A 2RHMA 1BNCA 2LTAA 4MB2A 5ADWA 1UJBA 3OZDA 4M3NA 2DPYA 2WPDA 1UIRA 2QVYX 3WHIA 4OQFA 5DHQA 3JVEA 1DBWA 4MVJD 3KQKA 3MTDA 2VYQA 1Z5OA 1E69A 2B9VA 1E5XA 2EKZA 1NIPA 1RXCA 4W5HA 1V4NA 2WV7A 4JN6B 1JL3A 4KWCA 1W9MA 2H00A 4TRMA 3RHSA 4CGYA 4QLBA 5CXXA 4IWYA 4CODB 3THRA 4YRIA 2ZAOA 1D6MA 1IWPB 3EMVA 4Q02A 3U37A 1E2JA 2VJMA 1MEOA 1N5IA 1YQDA 3VR0A 4GSYA 4YT5A 4CTNA 1C3LA 1GR0A 2V4MA 4LF8B 3L7AA 1KR2A 1EUQA 2RHJA 3DWGA 2YV4A 3BK7A 3OVMA 1PW7A 1K9SA 3NO4A 4CCAA 4HTFB 2OXCA 1KEUA 1GGJA 1SCUB 1G8GA 1K0UA 1MCZA 2PRSA 4Q15A 4BUJA 1MIHA 3CE6A 4KLCA 3N58A 5MGNA 3SEFA 3W5BA 4GBED 2YIDA 5BWNA 2GETA 4LFBB 3VPCA 3ZQUA 2PXCA 4AUEA 2R86A 4B3SB 4I0WB 2YVLA 2AL7A 4LQLA 1MOZA 5KC8A 4L0DA 2D5AA 1SD1A 1R27A 1NYQA 3I53A 1RBQA 1ARZA 3OBBA 2IGBA 3OD5A 3BWYA 3UMSA 1G7TA 3VR2A 1H94A 4WY8A 5IT4A 4QQ8A 1PNVA 4YJFB 3C3XA 4ZYZA 2PQMA 3NR2A 3PWSA 2WIAA 5BXQC 4GKKB 2RK4A 3AFOA 1OXKB 1QC5A 3AU8A 3NTRA 3RIGA 1J06A 2I1WA 4JDUA 2W93A 1ZWKA 2ODPA 3WRWA 5E9QA 3COSA 1RI3A 4D81A 2PEZA 4DXDA 1T2CA 2FQWA 4DDWA 1O6GA 1LK0A 4YLYA 3V8QA 3U19A 1ZR4A 4X6UA 1PDOA 2FP4B 4YAIA 2YV2A 2Z2IA 2CT8A 3IV6A 3T0FA 2FW8A 1IMJA 4XQ9A 2WNIA 5CB6A 3ZHXA 1ZO8A 3NJ4A 4GMFA 4KBFA 1AA6A 4QARA 3WMFA 3TDKA 3RUFA 3CINA 2X13A 3GCXA 3S2SA 2QI9C 3N7TA 2HIMA 5FI3A 2G8NA 1LRKA 5FEMA 1V5FA 2W2PA 3SQOA 2QRPA 2F9MA 1OUMA 1MXFA 1VMIA 2QG9A 4HQOA 3TIVA 3I92A 2GWHA 3WO0A 3OY7A 3CUUA 1ONBA 1E9AA 3NUQA 3PF8A 2QM7A 4BNMA 4F4UA 2GM4A 3VVBA 5K3FA 4OMCA 4OK3A 2UYHA 4RIHA 3WXMA 1Z88A 3KHTA 2SICE 4TVOA 4LCEA 4YUVA 4RPIA 3T3HA 1FS5A 3GEPA 4KBYA 4IQ4A 1MDFA 3Q9SA 4WNYA 4Q3AA 2V7UA 4Z4HA 2QQ5A 5DMHA 3U56A 1PBNA 5ER6A 3DHYA 2EOAA 1KH2A 1KVRA 1OF1A 4HD8A 5CM2Z 2QVBA 5BOSA 2OZLB 3TW8A 4HYEA 5HHTA 3ZDEA 2XNSA 4DDHA 1L4NA 2QSZA 1PR4A 3ROEA 4GRDA 3M5WA 2AOVA 3ORQA 1NLZA 3EWNA 4OQ4A 1D5WA 5FF9A 1ZD4A 1PEKE 1PYOA 1NKVA 3OWOA 3ZQ4A 5L3ZA 4YRZA 2FX3A 4WXHA 1T9KA 1X80B 2H51A 2PH5A 3EY9A 3KKOA 2BFEA 2WOOA 1C5KA 3F6PA 1DAIA 2OTCA 3FLAA 4TWZA 4LJSA 3AKYA 3DT9A 4OGLA 1BO6A 3ZWDA 4WBNA 1G6Q1 1IQRA 5HDBB 5A3QA 3BA1A 4IIHA 2OCKA 3A31A 3PQFA 4BMSA 2YR0A 2G6BA 5KWEA 2ZREA 3UN1A 4IIJA 3C97A 1DLIA 1JZSA 1RXEA 4B8YA 5GV8A 4TKVA 4MQBA 4WY5A 1IDOA 1PKXA 1D7AA 3F3YA 2UUBB 3C3BA 5E3JA 3TRDA 1E5LA 5JJ5A 2ODTX 4FI3C 4U8HA 3VNRA 4C0JA 3D5QA 2YXBA 1RBZA 4HNAA 1G6KA 2QTGA 5KSOA 1ZH4A 3R3SA 1X1AA 2H0QA 2RJOA 3ANXA 1C7ZA 3FPEA 1X70A 2WT8A 1ACJA 4QNNA 1EFLA 4QEDA 4XE5A 1UEXC 3N2KB 5EKUA 2H1LA 5I7HA 2HIAA 4MV7A 4OCZA 5IJAA 4GHWA 1SIOA 2CVOA 1GFWA 1LDYA 1YB4A 4D0GA 4L3WA 2RBEA 2WTAA 1Y8QB 4HPJB 1T4BA 4PRLA 4P31A 3N2LA 3K70B 5CB4A 1TEZA 2Q3FA 2RI6A 2YMQA 2FZLA 1JGTA 3MELA 5LP6C 2A2ZA 4GZ3A 1PZXA 3IA7A 2E2WA 1F2TA 4O3MA 1G9XA 2YYYA 2CDBA 2XSZD 3FNEA 2VYVD 4O4HB 4EF4A 2IS1A 4MCHA 2FW1A 4EMTA 3KYDB 4N7MA 4IUYA 4MUJA 1MVOA 4UFPA 1BYUA 1G20A 1DIOB 1H69A 1AKNA 1VE6A 5LBTA 2DBQA 4ML3A 4RWEA 2CJWB 1T6XA 4W9MC 2ZJ6A 4LWZA 4X3PA 4D43A 2JA1A 2AHOA 1LV7A 1M0WA 1AN0A 2CLIB 2JG3A 2IY9A 3IEUA 1FSSA 1WOMA 4KQ2A 3JQGB 3GUUA 3COWA 3EC1A 4D44A 3K72B 4B3GA 1J0BA 4CLOA 4EFMA 4KR2A 4Q4DA 1Q74A 3ZK8A 2P5SA 5CK5A 2IOQA 2PUGA 3DEIA 3VH3A 1EWVA 1OLXA 1SBNE 3LI2A 4BOYA 2DU8A 4WBNB 4DZTA 2VHTA 1RHKA 4BNZA 2ZM6B 2NV2B 4D56A 4WEOA 1E1CA 2A78A 3TLCA 3BC1A 2YWBA 4U6SA 3V3TA 5CA1B 3OT4A 3KQPA 3FTEA 1P72A 1QAMA 2VYCA 5IJ9A 1RMYA 2F1KA 5FL7D 1T10A 1KDOA 1L3BA 1IIBA 1ANKA 2ZRAA 1ZEMA 4MGIR 4N6NA 1OGJA 4OVKA 5T4BA 4B3XA 5CD9A 4R6XA 4PLYA 4D9NA 3GRZA 3QHPA 1FMJA 3VYWA 3H1AA 3IBCA 5F2KA 2NQ2C 3ANYB 3UMFA 4BASA 4DR1B 1U3WA 1NVVR 4QYIB 4DUZB 3OX3A 3N2GB 3PDJA 2Y1CA 4QG7A 3GHHA 4YRJA 1YZVA