3GAXA

Crystal structure of monomeric human cystatin c stabilized against aggregation
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
109
structure length
107
Chain Sequence
b'GPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRACQVVRARKQIVAGVNYFLDVELCRTTCTKTQLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cystatin-C
publication title Crystal structure of human cystatin C stabilized against amyloid formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor
total genus 25
structure length 107
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3gaxA00
1IV9A 1YVBI 4LZIA 3KFQC 2OCTA 1R4CA 3UL5A 2O9UX 1STFI 3NX0A 3Q2PA 4N6LA 1GD4A 1CYVA 1N5PA 4EYCA 5LC6A 3QRDA 5LC7A 1PFPA 4IT7A 4N6OB 4CCVA 3PYJA 1A67A 4TX4A 1M9GA 1MOLA 5EQLA 2CH9A 1NB5I 3GAXA 3MWZA 3UL6A 5A0OB 1DVCA 1WNHA 1N9JA 1FUWA 1CYUA 3PS8A 1RN7A 1CEWI 3PXMA 4N6V0 3KSED 3LH4A 1A90A 4N6MA 1TIJA 4N6UA 5ELJA 1NB3I 3IMAB 3L0RA 3K9MC 1ROAA 1DVDA 1FA3A 2W9PA 3S67A 1MNLA 2W9QA 1G96A 2KXGA 1KWIA 4N6TA 1EQKA 1IV7A 2BO9B 4N6NB 1N5HA 4ZM8A 5ELUA 3SVAA 1LXEA 1GD3A
chains in the Genus database with same CATH superfamily
3HOHA 1AR0A 1CH0A 2K3DA 1UCJA 3D79A 4FR9A 3AMOB 4LZIA 3M8CA 1JZDA 2OCTA 3VSYA 3GSPA 1R4CA 1YJW3 3UL5A 3OWUA 2GSPA 2CW9A 5BIRA 2AAEA 1I2GA 3F7SA 3NBRA 1W2ZA 1BUQA 3OXAA 1US1A 1L5GB 1A2KA 1E3RA 2BHMA 7STDA 2GXFA 3LTDA 2BMOB 1BVIA 3IJEB 3MKIA 2O3OA 3NHXA 1CYVA 1GD4A 1I2FA 2R4IA 2OQEC 1UI8A 5LC6A 3EN1B 3DGNA 4N6OB 3HIIA 1STDA 3HIGA 4RNZA 4CCVA 1OHPA 3BNCA 2SARA 1J2BA 5BU4A 2XGLA 1Q7Y4 1GMPA 1F8NA 2YX9A 3MHEA 3CCE3 5IF6A 4EBGA 1QVF2 1RGKA 3AHWA 1N8QA 1GSPA 2CG0A 3DY5A 4CDLA 1LNIA 1GOVA 3TDGA 3HX8A 4XM4A 1LQGC 1TJDA 1RGLA 3FG1A 3CNMA 1EA2A 3NXJA 2MC8A 1NB5I 3GAXA 3RGRA 2GEXA 2F56A 1DVCA 1B2ZA 1RGHA 3B8LA 1RGAA 4XDVA 5IG5A 1N9JA 3F7XA 2F4YA 5AEWB 1GOUA 3WA2X 1RGCA 1Q9EA 4FMCA 3PS8A 1JN5A 1OF5A 2KF4A 1JB5A 5G1KA 5G2GA 3URPA 4MMZB 1JJ22 2F99A 3OWYA 1B2SA 3FH1A 3PXMA 3GZRA 4EC6A 1V74A 4N6V0 3KSED 4WYKB 2STDA 1M1K4 1Q864 3LH4A 4BTWA 5D81A 3LXUX 1W5ZA 1DE3A 1S5AA 3G8ZA 3KN4A 2INXA 2L1SA 4I4KA 2CWTA 3S27A 3CU3A 2IUJA 3ZFZA 3KSPA 2XFSA 2RBIA 4HM7B 1BNRA 1VQ93 5AYRB 4IPBA 1UDII 3CCR3 1ULIB 1FUTA 4N6UA 1IVUA 1JB2A 1Q824 3IMAB 2GBWB 3K9MC 1MWRA 4CPKA 5JPUA 1EUIC 2F86B 3MPHA 3GRDA 2W9PA 1OGXA 1D6UA 1O7WB 2J8XB 2Q07A 2QA43 2LQVA 4HM0B 5IG4A 3G4S3 5HOHA 2GEYA 3GZYB 1UUWB 3VGNA 1O7MB 4N6TA 2HMNB 2PNCA 3K63A 1RCKA 2P38A 3X3ZA 1ISKA 4FCJA 3BB9A 1R4YA 2YFJB 1HZ1A 4EW5A 2BNGA 2BO9B 4MMXB 1N5HA 2HMKB 4ZM8A 5ELUA 1TP6A 3JUOA 2Y74A 4L8OA 1X1YA 3EBTA 1RSNA 1RN1A 4RBNA 1FGTA 3CCU3 2W56B 4R1KA 1YGWA 1RNTA 3Q1CA 1YJ93 1RDSA 1TFOA 1VQO3 1BAOA 1RLSA 1IYYA 2BT3A 3N9HA 3S28A 3NBJA 4J9AA 4J5KA 8CHOA 3IPTA 4WP5A 1DETA 3K0ZA 2CWUA 3CC73 4FMBA 1STFI 1QAKA 1T2IA 3JUQA 4O02B 1IDPA 1LOXA 3ER7A 4R9KA 1UCKA 2F98A 3F8HA 3G713 3ZG0A 3ECFA 3JVCA 3EF8A 3Q2PA 4N6LA 5AYSC 1BSBA 1V58A 3DMCA 2KF6A 1N5PA 4EYCA 1AY7A 3CCL3 5BXQA 1Q7HA 5EEOA 1I8VA 1NNVA 1O7PB 1PFPA 2RCDA 2XH9A 6STDA 1BSAA 1UGIA 3CPOA 1IU7A 3E99A 1GMQA 1TU5A 1VQN3 3WR2A 1VQ73 4R4KA 4HKVB 1OPYA 3UB1A 3U1WA 1KQS2 3I553 4BL3A 1JBSA 1G02A 2C4BA 3BU4A 3FF0A 5IEPA 1Q40A 4GL6A 3GZXB 1GS3A 1SQWA 4HBRA 2CH9A 2GU1A 3D9RA 4KFEA 4N3VA 1RMSA 1ZS7A 4HAAA 1UUGB 1DYUA 1B20A 1IT8A 4OUQA 1YIT3 2M7OA 3UL6A 2RGQA 2KAAA 4RNTA 5IW9A 1LRAA 3VF1A 2WGOA 3B4PA 3LMLA 5A0OB 1RKYA 2IY2A 1UCIA 3F9SA 1Q814 1GY6A 2BMRB 3AHSA 1YVSA 1EEJA 1B27A 3NV0A 1T5YA 1V57A 3SOYA 2CFLA 3MG1A 3PCSA 1K734 3BNDA 3LTCA 1B3SA 3EC9A 1VQK3 3G0KA 1AVKA 1RN7A 3KIIA 1NDOB 1ROVA 1CEWI 4HZ9B 1YIJ3 4KZ1A 4HVNA 1B2UA 4L8PA 4G1MB 2BU4A 3EBYA 3OWSA 1JNQA 3FG3A 3MSOA 4WWUC 3WODG 5KP1A 2MF7A 1C7HA 3N8BA 3CCV3 3CD63 1OHOA 1BRIA 1BRKA 1JB4A 2C10A 2ZHXB 1BGSA 5AI1A 1I3IA 4IIAA 4XDWA 3X3YA 1BNEA 1SPUA 4XBYA 1GY7A 1BUJA 1JBTA 1QJGA 2HMLB 1BNSA 1K8A4 1B21A 3L0RA 1GYBA 1BIRA 2LYXA 1ROAA 1IQ8A 3CCJ3 4LGQA 3S67A 4BTXA 5DRVA 1AVLA 4EXRA 2W9QA 1QMAA 3DM8A 3EJVA 1MWUA 3H51A 1BNIA 1G96A 2OOVC 4K1VA 1BSEA 3JUMA 3F8XA 2RNTA 1VQ83 3CMA3 1RHLA 4K61A 5KP4A 3X40A 3RGAA 3RNTA 1KSIA 4XB5A 1DMQA 3D4AA 3D5GA 1BSDA 4XBTA 1EKMA 1U8CB 1BNJA 1JKGA 3HI7A 2C11A 3PCRA 5AIGA 4BU4A 4HM1B 2W03A 1LXEA 3FF2A 2UGIA 5CXOA 1UUVB 4PEJA 2CX0A 4HM4B 1OH0A 1RRLA 4R9LA 3J7Yd 4QWTA 3QK9A 1BRJA 2WO0A 1PU4A 1B2MA 4O8SA 3X3XA 2XF3A 5CK6A 1YHQ3 3CC43 2O9UX 1M1XB 5I97A 1IVVA 3NX0A 4NPBA 3AMOA 3SX1A 1HYFA 2BMQB 5M18A 1SJWA 1LOVA 3NM2A 4NHFA 2GBXB 3F14A 3DGMA 1O7HB 1E97A 1WQLB 4LYLB 3UNLA 6RNTA 3SXXA 1K9M4 3EHCA 4HM5B 3STDA 1LQMB 4STDA 3QRDA 1BRHA 5LC7A 1O7GB 2GU3A 2XFTA 4DKIA 4K1UA 4IT7A 1NU3A 1BU4A 3X41A 4FCZA 4AKYA 4JF8A 1A67A 2OQEA 2FXTA 3ALAA 1RCLA 1TRQA 4TX4A 1M9GA 2ZL8A 1MOLA 3RDEA 4WFOA 1TFKA 2WGQA 1PY3A 4AKZA 3WOEB 3DGOA 1BRSA 4X2HA 1WMNA 3I563 1K28A 1X1UA 1IVWA 3EX9A 5HGRA 1G0TA 2L4VA 2P0XA 2XRXB 5EQLA 2CK3H 3B7CA 2FNQA 1W00A 3WHOA 5M19A 1A2PA 4KFDA 5FW5A 4BL2A 1A2VA 1PYLA 2P0MA 1ZGXA 3T0UA 4HJLB 2CHCA 1O7NB 3LT9A 3MG3A 1FGQA 4MEIA 1FUSA 1WNHA 1JN5B 1OF5B 3Q90A 1C54A 3DGYA 2ML6A 3NBBA 1RGFA 3HK4A 1UGHI 1BRGA 5IEOA 6GSPA 5JBSA 1WMOA 1DMMA 1HKXA 2WOFA 3SOAA 4FMDA 5CF1A 1S723 1VQ53 3LOYA 1W4NA 1D6YA 1RJOA 5AEUB 1TRPA 2W04A 4LMIA 2RFRA 5M1AA 3V92A 1AV4A 3G6E3 2W0QA 1LVNA 1IQYA 4HOHA 2KF5A 4WHAA 2B24B 1MGWA 3JUNA 1TUHA 1UW1A 1LOYA 1DMNA 1BOXA 3V99A 2SBLA 4K90B 3KCHA 1OHSA 4FMAA 4KFFA 4N6MA 4WYKA 2H0GA 1W02A 1TIJA 4XBXA 3NQZA 3OV4A 4HZBB 5G1LA 3FCSB 4FCMA 3K7CA 3FLJA 3O8YA 2H0HA 2HOHA 1NB3I 2E2VA 4MMYB 2OTJ3 2IYJA 3WMDA 3KKGA 3EB8A 1FYSA 3CME3 1DVDA 5FGOA 1X1XA 3G16A 2CFWA 4H3UA 1MNLA 1YJN3 1RRHA 4EV2A 2Z76A 1OGZA 2CFDA 1I0VA 4H61A 2OTL3 2YFIB 1FZUA 3DH2A 3CCM3 1KWIA 2CKFB 1NWWA 3FSDA 4GB5A 1MWSA 2XGNA 5D82A 5IG0A 3CCS3 1SIIA 3A5EA 4CJNA 3DXOA 3LTBA 3T8UA 5D83A 4X2OA 3BNBA 1IV7A 1CQSA 3NUVA 2KRTA 3UJMA 3ZG5A 4N6NB 3MYTA 3KE7A 3SVAA 7GSPA 2AADA 3EN8A 5IENA 2QEX3 1N8R4 1T3BA 1RGEA 3AGNA 2YFLB 2HMMB 1NJI4 1WTHA 1IV9A 1VZZA 5DREA 1YVBI 1BNGA 1T2HA 1FGRA 3DZLA 2UUGC 3V98A 1MWTA 3KFQC 5IG3A 3NQYA 5AIIA 3ROBA 1ZO2A 1VQQA 1W6YA 4LSOA 3S5CA 2A15A 2W56A 1IQXA 1RN4A 2XEPA 1EG9B 3KZTA 5TGNA 5RNTA 4RNYA 4AEQA 2D1WA 1BNFA 4J5GA 2F5MA 3FGYA 1K41A 1Y4KA 2F5WA 3JUPA 2CIUA 4KT3B 3GWRA 3FKAA 1TTOA 2XSOB 1W6GA 1VQ63 1GMRA 1WMPA 1JBRA 1OCVA 2WOHA 1RGGA 2K0MA 1LNHA 3LTAA 3PYJA 5AIFA 1I3FA 1JRQA 1Q40B 3SLUA 2CC3A 5BVBA 9RNTA 1OUNA 1Q42A 1I0XA 1U5OA 2R41A 4O2HA 5CF2A 2XR8B 3B4OA 1X1WA 3N54B 8RNTA 3WA3A 1B2XA 2CX1A 1FGOA 3D5IA 3CXC2 3BIRA 3T8NA 1VQP3 1KD14 1VQ43 4HM6B 1SARA 3LYGA 2ML5A 1BANA 5STDA 2XSHB 4RZMA 2QIYA 1VQM3 1ULJB 2CG1A 1BSCA 4ORLA 3MWZA 3NV0B 2Z77A 1YI23 2UX0A 1JZOA 3X42A 3CCQ3 2QGUA 1AQZA 2B1XB 3EE1A 1D6ZA 1QAFA 1W7CA 3LZAA 3PGBA 4I5QA 3PZWA 1QALA 3AGOA 1M904 1FUWA 2W2CA 1KC84 1I2EA 3H3HA 4HM3B 1ZX2A 4O3VA 1UI7A 3A76A 1W2B2 1CYUA 1IK3A 3FZWA 1YNVX 1SIHA 1RTUA 2E2UA 2CFKA 4Q53A 5AIHA 1E3VA 1GOYA 4JRFA 2V1LA 3SYUA 2Z6BA 4ILFA 2I9WA 2P05A 5CLKA 1GY5A 3BLZA 3DUKA 2CFGA 2CWVA 3D3LA 1A90A 3CC23 1N9EA 2IUKA 1NO3A 1RNBA 1W6CA 4EV5A 4HYZA 1Z1SA 3K5TA 2BIRA 3SEDA 3CPW2 1ASKA 1IT7A 2E2TA 2Y73A 3NM7A 4HM8B 2ZDJA 4KVHA 2W6JH 3U97A 4NREA 3WOFB 3DGLA 2KF3A 1HU9A 2FGTA 4BTYA 5IERA 4R80A 1I70A 2IMJA 2ZA4A 4J8TA 5ELJA 2H0IA 3LT8A 3OX9A 4GSPA 4U13A 1QVG2 3CNXA 3EQQB 7RNTA 2K54A 4OVMA 2D42A 1FA3A 1FW7A 1FGMA 5KP3A 1LOWA 5GSPA 2IA7A 3Q3FA 2KCDA 3I0YA 4HM2B 2JQ5A 3GZBA 1IVXA 2KXGA 1YGEA 3WDGB 2OWPA 1UCLA 2JDIH 1OACA 1JKGB 4L7KA 2HMOB 3F40A 2OOVA 2RSXA 1EQKA 1MGRA 2Z7AA 5EVHA 3S29A 4GHOA 4OK0A 4MJDA 3MG2A 4LEHA 1W01A 2PZVA 3FG4A 1VQL3 2HMJB 1BRNL 3HZPA 5JPPA 4BIRA 1JV2B 3BNEA 3OW22 2P09A 1GD3A
chains in the Genus database with same CATH topology
1AR0A 4LZIA 4FR9A 3AMOB 3M8CA 2OCTA 3VSYA 1YJW3 1R4CA 3UL5A 3OWUA 2CW9A 3F7SA 3NBRA 1W2ZA 1BUQA 3OXAA 1US1A 1L5GB 1A2KA 1E3RA 2BHMA 7STDA 2GXFA 3LTDA 2BMOB 3IJEB 3MKIA 2O3OA 3NHXA 1CYVA 1GD4A 2R4IA 2OQEC 1UI8A 5LC6A 3EN1B 3DGNA 4N6OB 3HIIA 1STDA 3HIGA 4RNZA 4CCVA 1OHPA 3BNCA 1J2BA 1Q7Y4 2XGLA 1F8NA 2YX9A 3MHEA 3CCE3 5IF6A 4EBGA 1QVF2 1N8QA 2CG0A 4CDLA 3DY5A 3TDGA 3HX8A 4XM4A 3FG1A 3CNMA 1EA2A 3NXJA 2MC8A 1NB5I 3GAXA 3RGRA 2GEXA 1DVCA 3B8LA 4XDVA 5IG5A 1N9JA 3F7XA 5AEWB 3WA2X 4FMCA 3PS8A 1JN5A 1OF5A 5G2GA 1JB5A 4MMZB 1JJ22 2F99A 3OWYA 3FH1A 3PXMA 3GZRA 4EC6A 1V74A 4N6V0 3KSED 4WYKB 2STDA 1M1K4 1Q864 3LH4A 4BTWA 5D81A 3LXUX 1W5ZA 1S5AA 3G8ZA 3KN4A 2INXA 4I4KA 2CWTA 3S27A 3CU3A 2IUJA 3KSPA 2XFSA 4HM7B 1VQ93 5AYRB 4IPBA 3CCR3 1ULIB 4N6UA 1IVUA 1JB2A 1Q824 3IMAB 2GBWB 3K9MC 5JPUA 2F86B 3MPHA 3GRDA 2W9PA 1OGXA 1D6UA 1O7WB 2Q07A 2QA43 2LQVA 4HM0B 5IG4A 3G4S3 2GEYA 3GZYB 1UUWB 3VGNA 1O7MB 4N6TA 2HMNB 2PNCA 3K63A 2P38A 3X3ZA 1ISKA 4FCJA 3BB9A 2YFJB 2BNGA 2BO9B 4MMXB 1N5HA 2HMKB 4ZM8A 5ELUA 1TP6A 3JUOA 2Y74A 4L8OA 3EBTA 4RBNA 1FGTA 3CCU3 2W56B 4R1KA 3Q1CA 1YJ93 1TFOA 1VQO3 2BT3A 3N9HA 3S28A 3NBJA 4J9AA 8CHOA 3IPTA 4WP5A 3K0ZA 2CWUA 3CC73 4FMBA 1STFI 1QAKA 3JUQA 4O02B 1IDPA 1LOXA 3ER7A 4R9KA 2F98A 3F8HA 3G713 3ECFA 3JVCA 3EF8A 3Q2PA 4N6LA 5AYSC 3DMCA 4EYCA 1N5PA 3CCL3 5BXQA 5EEOA 1PFPA 1O7PB 2RCDA 2XH9A 6STDA 3CPOA 1IU7A 3E99A 1TU5A 1VQN3 1VQ73 4R4KA 4HKVB 1OPYA 3UB1A 3U1WA 1KQS2 3I553 3FF0A 5IEPA 1Q40A 4GL6A 3GZXB 1GS3A 1SQWA 4HBRA 2CH9A 2GU1A 3D9RA 4KFEA 4N3VA 1DYUA 1IT8A 4OUQA 1YIT3 2M7OA 3UL6A 2RGQA 5IW9A 3VF1A 2WGOA 3B4PA 3LMLA 5A0OB 1RKYA 3F9SA 1Q814 1GY6A 2BMRB 3NV0A 1T5YA 3SOYA 2CFLA 3MG1A 3PCSA 1K734 3BNDA 3LTCA 3EC9A 1VQK3 3G0KA 1AVKA 1RN7A 3KIIA 1NDOB 1ROVA 1CEWI 4HZ9B 1YIJ3 4KZ1A 4HVNA 4L8PA 4G1MB 3EBYA 3OWSA 1JNQA 3FG3A 3MSOA 4WWUC 3WODG 5KP1A 2MF7A 1C7HA 3N8BA 3CCV3 3CD63 1OHOA 1JB4A 2C10A 5AI1A 4IIAA 4XDWA 3X3YA 1SPUA 4XBYA 1GY7A 1QJGA 2HMLB 1K8A4 3L0RA 1GYBA 2LYXA 1ROAA 1IQ8A 3CCJ3 4LGQA 3S67A 4BTXA 5DRVA 1AVLA 4EXRA 2W9QA 1QMAA 3DM8A 3EJVA 3H51A 1G96A 2OOVC 4K1VA 3JUMA 3F8XA 1VQ83 3CMA3 4K61A 5KP4A 3X40A 3RGAA 1KSIA 4XB5A 1DMQA 4XBTA 1EKMA 1U8CB 1JKGA 3HI7A 3PCRA 2C11A 5AIGA 4HM1B 2W03A 1LXEA 3FF2A 5CXOA 1UUVB 4PEJA 4HM4B 1OH0A 1RRLA 4R9LA 3J7Yd 4QWTA 3QK9A 2WO0A 1PU4A 4O8SA 3X3XA 2XF3A 5CK6A 1YHQ3 3CC43 2O9UX 1M1XB 5I97A 1IVVA 3NX0A 3AMOA 3SX1A 2BMQB 1SJWA 3NM2A 4NHFA 2GBXB 3F14A 3DGMA 1O7HB 1E97A 1WQLB 3UNLA 3SXXA 1K9M4 3EHCA 4HM5B 3STDA 4STDA 3QRDA 5LC7A 1O7GB 2GU3A 2XFTA 4K1UA 4IT7A 1NU3A 3X41A 4FCZA 4AKYA 4JF8A 1A67A 2OQEA 2FXTA 3ALAA 4TX4A 1M9GA 2ZL8A 1MOLA 3RDEA 4WFOA 1TFKA 2WGQA 4AKZA 3WOEB 3DGOA 4X2HA 3I563 1WMNA 1K28A 1IVWA 3EX9A 5HGRA 2L4VA 2P0XA 2XRXB 5EQLA 2CK3H 3B7CA 2FNQA 1W00A 4KFDA 5FW5A 1A2VA 2P0MA 3T0UA 4HJLB 2CHCA 1O7NB 3LT9A 3MG3A 1FGQA 4MEIA 1WNHA 3Q90A 1JN5B 1OF5B 3X42A 2ML6A 3NBBA 3HK4A 5IEOA 5JBSA 1WMOA 1DMMA 1HKXA 2WOFA 3SOAA 4FMDA 5CF1A 1S723 1VQ53 3LOYA 1W4NA 1D6YA 1RJOA 5AEUB 4LMIA 2W04A 2RFRA 3V92A 1AV4A 3G6E3 2W0QA 1LVNA 1IQYA 4WHAA 2B24B 3JUNA 1TUHA 1UW1A 3V99A 1DMNA 2SBLA 4K90B 1OHSA 4FMAA 4KFFA 4N6MA 4WYKA 1W02A 1TIJA 4XBXA 3NQZA 3OV4A 4HZBB 3FCSB 4FCMA 3K7CA 3FLJA 3O8YA 1NB3I 2E2VA 4MMYB 2OTJ3 3WMDA 3KKGA 3EB8A 3CME3 1DVDA 5FGOA 3G16A 2CFWA 4H3UA 1MNLA 1YJN3 1RRHA 4EV2A 2Z76A 1OGZA 2CFDA 4H61A 2OTL3 2YFIB 3CCM3 1KWIA 2CKFB 1NWWA 3FSDA 4GB5A 5D82A 2XGNA 5IG0A 3CCS3 1SIIA 3DXOA 3LTBA 3T8UA 5D83A 4X2OA 3BNBA 1IV7A 1CQSA 3NUVA 2KRTA 3UJMA 4N6NB 3MYTA 3KE7A 3SVAA 3EN8A 5IENA 2QEX3 1N8R4 1NJI4 2YFLB 2HMMB 1WTHA 1IV9A 1VZZA 5DREA 1YVBI 3DZLA 1FGRA 3V98A 5IG3A 3KFQC 3NQYA 5AIIA 3ROBA 1ZO2A 1W6YA 4LSOA 3S5CA 2A15A 2W56A 1IQXA 2XEPA 1EG9B 3KZTA 5TGNA 4RNYA 4AEQA 2D1WA 3FGYA 1K41A 1Y4KA 3JUPA 2CIUA 3GWRA 3FKAA 2XSOB 1VQ63 1W6GA 1WMPA 1OCVA 2WOHA 2K0MA 3PYJA 1LNHA 3LTAA 5AIFA 3SLUA 1JRQA 1Q40B 2CC3A 5BVBA 1OUNA 1Q42A 1U5OA 4O2HA 5CF2A 2XR8B 3B4OA 3WA3A 3N54B 1FGOA 3CXC2 1VQP3 3T8NA 1KD14 1VQ43 4HM6B 3LYGA 2ML5A 5STDA 2XSHB 4RZMA 2QIYA 1VQM3 1ULJB 2CG1A 4ORLA 3MWZA 3NV0B 2Z77A 1YI23 2UX0A 3CCQ3 2QGUA 2B1XB 3EE1A 1D6ZA 1QAFA 1W7CA 3LZAA 3PGBA 3PZWA 1QALA 1M904 1FUWA 2W2CA 1KC84 3H3HA 4HM3B 1ZX2A 4O3VA 1UI7A 3A76A 1W2B2 1CYUA 1IK3A 3FZWA 1SIHA 2E2UA 2CFKA 4Q53A 5AIHA 1E3VA 4JRFA 2V1LA 2Z6BA 5CLKA 2I9WA 2P05A 1GY5A 3BLZA 3DUKA 2CFGA 2CWVA 3D3LA 1A90A 3CC23 1N9EA 2IUKA 1NO3A 1W6CA 4EV5A 4HYZA 1Z1SA 3K5TA 3SEDA 3CPW2 1ASKA 1IT7A 2E2TA 2Y73A 3NM7A 4HM8B 2ZDJA 4KVHA 2W6JH 3U97A 4NREA 3WOFB 3DGLA 1HU9A 2FGTA 4BTYA 5IERA 4R80A 2IMJA 4J8TA 5ELJA 3LT8A 3OX9A 4U13A 1QVG2 3CNXA 3EQQB 2K54A 4OVMA 2D42A 1FA3A 1FGMA 5KP3A 2IA7A 2KCDA 3I0YA 4HM2B 2JQ5A 3GZBA 1IVXA 2KXGA 1YGEA 3WDGB 2OWPA 2JDIH 1OACA 1JKGB 4L7KA 2HMOB 3F40A 2OOVA 2RSXA 1EQKA 2Z7AA 5EVHA 3S29A 4OK0A 4MJDA 3MG2A 4LEHA 1W01A 2PZVA 3FG4A 1VQL3 2HMJB 3HZPA 5JPPA 1JV2B 3BNEA 3OW22 2P09A 1GD3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IV9 A;  1YVB I;  4LZI A;  3KFQ C;  2OCT A;  1R4C A;  3UL5 A;  2O9U X;  1STF I;  3NX0 A;  3Q2P A;  4N6L A;  1GD4 A;  1CYV A;  1N5P A;  4EYC A;  5LC6 A;  3QRD A;  5LC7 A;  1PFP A;  4IT7 A;  4N6O B;  4CCV A;  3PYJ A;  1A67 A;  4TX4 A;  1M9G A;  1MOL A;  5EQL A;  2CH9 A;  1NB5 I;  3GAX A;  3MWZ A;  3UL6 A;  5A0O B;  1DVC A;  1WNH A;  1N9J A;  1FUW A;  1CYU A;  3PS8 A;  1RN7 A;  1CEW I;  3PXM A;  4N6V 0;  3KSE D;  3LH4 A;  1A90 A;  4N6M A;  1TIJ A;  4N6U A;  5ELJ A;  1NB3 I;  3IMA B;  3L0R A;  3K9M C;  1ROA A;  1DVD A;  1FA3 A;  2W9P A;  3S67 A;  1MNL A;  2W9Q A;  1G96 A;  2KXG A;  1KWI A;  4N6T A;  1EQK A;  1IV7 A;  2BO9 B;  4N6N B;  1N5H A;  4ZM8 A;  5ELU A;  3SVA A;  1LXE A;  1GD3 A; 
#chains in the Genus database with same CATH topology
 3HOH A;  1AR0 A;  1CH0 A;  2K3D A;  1UCJ A;  3D79 A;  4FR9 A;  3AMO B;  4LZI A;  3M8C A;  1JZD A;  2OCT A;  3VSY A;  3GSP A;  1R4C A;  1YJW 3;  3UL5 A;  3OWU A;  2GSP A;  2CW9 A;  5BIR A;  2AAE A;  1I2G A;  3F7S A;  3NBR A;  1W2Z A;  1BUQ A;  3OXA A;  1US1 A;  1L5G B;  1A2K A;  1E3R A;  2BHM A;  7STD A;  2GXF A;  3LTD A;  2BMO B;  1BVI A;  3IJE B;  3MKI A;  2O3O A;  3NHX A;  1CYV A;  1GD4 A;  1I2F A;  2R4I A;  2OQE C;  1UI8 A;  5LC6 A;  3EN1 B;  3DGN A;  4N6O B;  3HII A;  1STD A;  3HIG A;  4RNZ A;  4CCV A;  1OHP A;  3BNC A;  2SAR A;  1J2B A;  5BU4 A;  2XGL A;  1Q7Y 4;  1GMP A;  1F8N A;  2YX9 A;  3MHE A;  3CCE 3;  5IF6 A;  4EBG A;  1QVF 2;  1RGK A;  3AHW A;  1N8Q A;  1GSP A;  2CG0 A;  3DY5 A;  4CDL A;  1LNI A;  1GOV A;  3TDG A;  3HX8 A;  4XM4 A;  1LQG C;  1TJD A;  1RGL A;  3FG1 A;  3CNM A;  1EA2 A;  3NXJ A;  2MC8 A;  1NB5 I;  3GAX A;  3RGR A;  2GEX A;  2F56 A;  1DVC A;  1B2Z A;  1RGH A;  3B8L A;  1RGA A;  4XDV A;  5IG5 A;  1N9J A;  3F7X A;  2F4Y A;  5AEW B;  1GOU A;  3WA2 X;  1RGC A;  1Q9E A;  4FMC A;  3PS8 A;  1JN5 A;  1OF5 A;  2KF4 A;  1JB5 A;  5G1K A;  5G2G A;  3URP A;  4MMZ B;  1JJ2 2;  2F99 A;  3OWY A;  1B2S A;  3FH1 A;  3PXM A;  3GZR A;  4EC6 A;  1V74 A;  4N6V 0;  3KSE D;  4WYK B;  2STD A;  1M1K 4;  1Q86 4;  3LH4 A;  4BTW A;  5D81 A;  3LXU X;  1W5Z A;  1DE3 A;  1S5A A;  3G8Z A;  3KN4 A;  2INX A;  2L1S A;  4I4K A;  2CWT A;  3S27 A;  3CU3 A;  2IUJ A;  3ZFZ A;  3KSP A;  2XFS A;  2RBI A;  4HM7 B;  1BNR A;  1VQ9 3;  5AYR B;  4IPB A;  1UDI I;  3CCR 3;  1ULI B;  1FUT A;  4N6U A;  1IVU A;  1JB2 A;  1Q82 4;  3IMA B;  2GBW B;  3K9M C;  1MWR A;  4CPK A;  5JPU A;  1EUI C;  2F86 B;  3MPH A;  3GRD A;  2W9P A;  1OGX A;  1D6U A;  1O7W B;  2J8X B;  2Q07 A;  2QA4 3;  2LQV A;  4HM0 B;  5IG4 A;  3G4S 3;  5HOH A;  2GEY A;  3GZY B;  1UUW B;  3VGN A;  1O7M B;  4N6T A;  2HMN B;  2PNC A;  3K63 A;  1RCK A;  2P38 A;  3X3Z A;  1ISK A;  4FCJ A;  3BB9 A;  1R4Y A;  2YFJ B;  1HZ1 A;  4EW5 A;  2BNG A;  2BO9 B;  4MMX B;  1N5H A;  2HMK B;  4ZM8 A;  5ELU A;  1TP6 A;  3JUO A;  2Y74 A;  4L8O A;  1X1Y A;  3EBT A;  1RSN A;  1RN1 A;  4RBN A;  1FGT A;  3CCU 3;  2W56 B;  4R1K A;  1YGW A;  1RNT A;  3Q1C A;  1YJ9 3;  1RDS A;  1TFO A;  1VQO 3;  1BAO A;  1RLS A;  1IYY A;  2BT3 A;  3N9H A;  3S28 A;  3NBJ A;  4J9A A;  4J5K A;  8CHO A;  3IPT A;  4WP5 A;  1DET A;  3K0Z A;  2CWU A;  3CC7 3;  4FMB A;  1STF I;  1QAK A;  1T2I A;  3JUQ A;  4O02 B;  1IDP A;  1LOX A;  3ER7 A;  4R9K A;  1UCK A;  2F98 A;  3F8H A;  3G71 3;  3ZG0 A;  3ECF A;  3JVC A;  3EF8 A;  3Q2P A;  4N6L A;  5AYS C;  1BSB A;  1V58 A;  3DMC A;  2KF6 A;  1N5P A;  4EYC A;  1AY7 A;  3CCL 3;  5BXQ A;  1Q7H A;  5EEO A;  1I8V A;  1NNV A;  1O7P B;  1PFP A;  2RCD A;  2XH9 A;  6STD A;  1BSA A;  1UGI A;  3CPO A;  1IU7 A;  3E99 A;  1GMQ A;  1TU5 A;  1VQN 3;  3WR2 A;  1VQ7 3;  4R4K A;  4HKV B;  1OPY A;  3UB1 A;  3U1W A;  1KQS 2;  3I55 3;  4BL3 A;  1JBS A;  1G02 A;  2C4B A;  3BU4 A;  3FF0 A;  5IEP A;  1Q40 A;  4GL6 A;  3GZX B;  1GS3 A;  1SQW A;  4HBR A;  2CH9 A;  2GU1 A;  3D9R A;  4KFE A;  4N3V A;  1RMS A;  1ZS7 A;  4HAA A;  1UUG B;  1DYU A;  1B20 A;  1IT8 A;  4OUQ A;  1YIT 3;  2M7O A;  3UL6 A;  2RGQ A;  2KAA A;  4RNT A;  5IW9 A;  1LRA A;  3VF1 A;  2WGO A;  3B4P A;  3LML A;  5A0O B;  1RKY A;  2IY2 A;  1UCI A;  3F9S A;  1Q81 4;  1GY6 A;  2BMR B;  3AHS A;  1YVS A;  1EEJ A;  1B27 A;  3NV0 A;  1T5Y A;  1V57 A;  3SOY A;  2CFL A;  3MG1 A;  3PCS A;  1K73 4;  3BND A;  3LTC A;  1B3S A;  3EC9 A;  1VQK 3;  3G0K A;  1AVK A;  1RN7 A;  3KII A;  1NDO B;  1ROV A;  1CEW I;  4HZ9 B;  1YIJ 3;  4KZ1 A;  4HVN A;  1B2U A;  4L8P A;  4G1M B;  2BU4 A;  3EBY A;  3OWS A;  1JNQ A;  3FG3 A;  3MSO A;  4WWU C;  3WOD G;  5KP1 A;  2MF7 A;  1C7H A;  3N8B A;  3CCV 3;  3CD6 3;  1OHO A;  1BRI A;  1BRK A;  1JB4 A;  2C10 A;  2ZHX B;  1BGS A;  5AI1 A;  1I3I A;  4IIA A;  4XDW A;  3X3Y A;  1BNE A;  1SPU A;  4XBY A;  1GY7 A;  1BUJ A;  1JBT A;  1QJG A;  2HML B;  1BNS A;  1K8A 4;  1B21 A;  3L0R A;  1GYB A;  1BIR A;  2LYX A;  1ROA A;  1IQ8 A;  3CCJ 3;  4LGQ A;  3S67 A;  4BTX A;  5DRV A;  1AVL A;  4EXR A;  2W9Q A;  1QMA A;  3DM8 A;  3EJV A;  1MWU A;  3H51 A;  1BNI A;  1G96 A;  2OOV C;  4K1V A;  1BSE A;  3JUM A;  3F8X A;  2RNT A;  1VQ8 3;  3CMA 3;  1RHL A;  4K61 A;  5KP4 A;  3X40 A;  3RGA A;  3RNT A;  1KSI A;  4XB5 A;  1DMQ A;  3D4A A;  3D5G A;  1BSD A;  4XBT A;  1EKM A;  1U8C B;  1BNJ A;  1JKG A;  3HI7 A;  2C11 A;  3PCR A;  5AIG A;  4BU4 A;  4HM1 B;  2W03 A;  1LXE A;  3FF2 A;  2UGI A;  5CXO A;  1UUV B;  4PEJ A;  2CX0 A;  4HM4 B;  1OH0 A;  1RRL A;  4R9L A;  3J7Y d;  4QWT A;  3QK9 A;  1BRJ A;  2WO0 A;  1PU4 A;  1B2M A;  4O8S A;  3X3X A;  2XF3 A;  5CK6 A;  1YHQ 3;  3CC4 3;  2O9U X;  1M1X B;  5I97 A;  1IVV A;  3NX0 A;  4NPB A;  3AMO A;  3SX1 A;  1HYF A;  2BMQ B;  5M18 A;  1SJW A;  1LOV A;  3NM2 A;  4NHF A;  2GBX B;  3F14 A;  3DGM A;  1O7H B;  1E97 A;  1WQL B;  4LYL B;  3UNL A;  6RNT A;  3SXX A;  1K9M 4;  3EHC A;  4HM5 B;  3STD A;  1LQM B;  4STD A;  3QRD A;  1BRH A;  5LC7 A;  1O7G B;  2GU3 A;  2XFT A;  4DKI A;  4K1U A;  4IT7 A;  1NU3 A;  1BU4 A;  3X41 A;  4FCZ A;  4AKY A;  4JF8 A;  1A67 A;  2OQE A;  2FXT A;  3ALA A;  1RCL A;  1TRQ A;  4TX4 A;  1M9G A;  2ZL8 A;  1MOL A;  3RDE A;  4WFO A;  1TFK A;  2WGQ A;  1PY3 A;  4AKZ A;  3WOE B;  3DGO A;  1BRS A;  4X2H A;  1WMN A;  3I56 3;  1K28 A;  1X1U A;  1IVW A;  3EX9 A;  5HGR A;  1G0T A;  2L4V A;  2P0X A;  2XRX B;  5EQL A;  2CK3 H;  3B7C A;  2FNQ A;  1W00 A;  3WHO A;  5M19 A;  1A2P A;  4KFD A;  5FW5 A;  4BL2 A;  1A2V A;  1PYL A;  2P0M A;  1ZGX A;  3T0U A;  4HJL B;  2CHC A;  1O7N B;  3LT9 A;  3MG3 A;  1FGQ A;  4MEI A;  1FUS A;  1WNH A;  1JN5 B;  1OF5 B;  3Q90 A;  1C54 A;  3DGY A;  2ML6 A;  3NBB A;  1RGF A;  3HK4 A;  1UGH I;  1BRG A;  5IEO A;  6GSP A;  5JBS A;  1WMO A;  1DMM A;  1HKX A;  2WOF A;  3SOA A;  4FMD A;  5CF1 A;  1S72 3;  1VQ5 3;  3LOY A;  1W4N A;  1D6Y A;  1RJO A;  5AEU B;  1TRP A;  2W04 A;  4LMI A;  2RFR A;  5M1A A;  3V92 A;  1AV4 A;  3G6E 3;  2W0Q A;  1LVN A;  1IQY A;  4HOH A;  2KF5 A;  4WHA A;  2B24 B;  1MGW A;  3JUN A;  1TUH A;  1UW1 A;  1LOY A;  1DMN A;  1BOX A;  3V99 A;  2SBL A;  4K90 B;  3KCH A;  1OHS A;  4FMA A;  4KFF A;  4N6M A;  4WYK A;  2H0G A;  1W02 A;  1TIJ A;  4XBX A;  3NQZ A;  3OV4 A;  4HZB B;  5G1L A;  3FCS B;  4FCM A;  3K7C A;  3FLJ A;  3O8Y A;  2H0H A;  2HOH A;  1NB3 I;  2E2V A;  4MMY B;  2OTJ 3;  2IYJ A;  3WMD A;  3KKG A;  3EB8 A;  1FYS A;  3CME 3;  1DVD A;  5FGO A;  1X1X A;  3G16 A;  2CFW A;  4H3U A;  1MNL A;  1YJN 3;  1RRH A;  4EV2 A;  2Z76 A;  1OGZ A;  2CFD A;  1I0V A;  4H61 A;  2OTL 3;  2YFI B;  1FZU A;  3DH2 A;  3CCM 3;  1KWI A;  2CKF B;  1NWW A;  3FSD A;  4GB5 A;  1MWS A;  2XGN A;  5D82 A;  5IG0 A;  3CCS 3;  1SII A;  3A5E A;  4CJN A;  3DXO A;  3LTB A;  3T8U A;  5D83 A;  4X2O A;  3BNB A;  1IV7 A;  1CQS A;  3NUV A;  2KRT A;  3UJM A;  3ZG5 A;  4N6N B;  3MYT A;  3KE7 A;  3SVA A;  7GSP A;  2AAD A;  3EN8 A;  5IEN A;  2QEX 3;  1N8R 4;  1T3B A;  1RGE A;  3AGN A;  2YFL B;  2HMM B;  1NJI 4;  1WTH A;  1IV9 A;  1VZZ A;  5DRE A;  1YVB I;  1BNG A;  1T2H A;  1FGR A;  3DZL A;  2UUG C;  3V98 A;  1MWT A;  3KFQ C;  5IG3 A;  3NQY A;  5AII A;  3ROB A;  1ZO2 A;  1VQQ A;  1W6Y A;  4LSO A;  3S5C A;  2A15 A;  2W56 A;  1IQX A;  1RN4 A;  2XEP A;  1EG9 B;  3KZT A;  5TGN A;  5RNT A;  4RNY A;  4AEQ A;  2D1W A;  1BNF A;  4J5G A;  2F5M A;  3FGY A;  1K41 A;  1Y4K A;  2F5W A;  3JUP A;  2CIU A;  4KT3 B;  3GWR A;  3FKA A;  1TTO A;  2XSO B;  1W6G A;  1VQ6 3;  1GMR A;  1WMP A;  1JBR A;  1OCV A;  2WOH A;  1RGG A;  2K0M A;  1LNH A;  3LTA A;  3PYJ A;  5AIF A;  1I3F A;  1JRQ A;  1Q40 B;  3SLU A;  2CC3 A;  5BVB A;  9RNT A;  1OUN A;  1Q42 A;  1I0X A;  1U5O A;  2R41 A;  4O2H A;  5CF2 A;  2XR8 B;  3B4O A;  1X1W A;  3N54 B;  8RNT A;  3WA3 A;  1B2X A;  2CX1 A;  1FGO A;  3D5I A;  3CXC 2;  3BIR A;  3T8N A;  1VQP 3;  1KD1 4;  1VQ4 3;  4HM6 B;  1SAR A;  3LYG A;  2ML5 A;  1BAN A;  5STD A;  2XSH B;  4RZM A;  2QIY A;  1VQM 3;  1ULJ B;  2CG1 A;  1BSC A;  4ORL A;  3MWZ A;  3NV0 B;  2Z77 A;  1YI2 3;  2UX0 A;  1JZO A;  3X42 A;  3CCQ 3;  2QGU A;  1AQZ A;  2B1X B;  3EE1 A;  1D6Z A;  1QAF A;  1W7C A;  3LZA A;  3PGB A;  4I5Q A;  3PZW A;  1QAL A;  3AGO A;  1M90 4;  1FUW A;  2W2C A;  1KC8 4;  1I2E A;  3H3H A;  4HM3 B;  1ZX2 A;  4O3V A;  1UI7 A;  3A76 A;  1W2B 2;  1CYU A;  1IK3 A;  3FZW A;  1YNV X;  1SIH A;  1RTU A;  2E2U A;  2CFK A;  4Q53 A;  5AIH A;  1E3V A;  1GOY A;  4JRF A;  2V1L A;  3SYU A;  2Z6B A;  4ILF A;  2I9W A;  2P05 A;  5CLK A;  1GY5 A;  3BLZ A;  3DUK A;  2CFG A;  2CWV A;  3D3L A;  1A90 A;  3CC2 3;  1N9E A;  2IUK A;  1NO3 A;  1RNB A;  1W6C A;  4EV5 A;  4HYZ A;  1Z1S A;  3K5T A;  2BIR A;  3SED A;  3CPW 2;  1ASK A;  1IT7 A;  2E2T A;  2Y73 A;  3NM7 A;  4HM8 B;  2ZDJ A;  4KVH A;  2W6J H;  3U97 A;  4NRE A;  3WOF B;  3DGL A;  2KF3 A;  1HU9 A;  2FGT A;  4BTY A;  5IER A;  4R80 A;  1I70 A;  2IMJ A;  2ZA4 A;  4J8T A;  5ELJ A;  2H0I A;  3LT8 A;  3OX9 A;  4GSP A;  4U13 A;  1QVG 2;  3CNX A;  3EQQ B;  7RNT A;  2K54 A;  4OVM A;  2D42 A;  1FA3 A;  1FW7 A;  1FGM A;  5KP3 A;  1LOW A;  5GSP A;  2IA7 A;  3Q3F A;  2KCD A;  3I0Y A;  4HM2 B;  2JQ5 A;  3GZB A;  1IVX A;  2KXG A;  1YGE A;  3WDG B;  2OWP A;  1UCL A;  2JDI H;  1OAC A;  1JKG B;  4L7K A;  2HMO B;  3F40 A;  2OOV A;  2RSX A;  1EQK A;  1MGR A;  2Z7A A;  5EVH A;  3S29 A;  4GHO A;  4OK0 A;  4MJD A;  3MG2 A;  4LEH A;  1W01 A;  2PZV A;  3FG4 A;  1VQL 3;  2HMJ B;  1BRN L;  3HZP A;  5JPP A;  4BIR A;  1JV2 B;  3BNE A;  3OW2 2;  2P09 A;  1GD3 A; 
#chains in the Genus database with same CATH homology
 1AR0 A;  4LZI A;  4FR9 A;  3AMO B;  3M8C A;  2OCT A;  3VSY A;  1YJW 3;  1R4C A;  3UL5 A;  3OWU A;  2CW9 A;  3F7S A;  3NBR A;  1W2Z A;  1BUQ A;  3OXA A;  1US1 A;  1L5G B;  1A2K A;  1E3R A;  2BHM A;  7STD A;  2GXF A;  3LTD A;  2BMO B;  3IJE B;  3MKI A;  2O3O A;  3NHX A;  1CYV A;  1GD4 A;  2R4I A;  2OQE C;  1UI8 A;  5LC6 A;  3EN1 B;  3DGN A;  4N6O B;  3HII A;  1STD A;  3HIG A;  4RNZ A;  4CCV A;  1OHP A;  3BNC A;  1J2B A;  1Q7Y 4;  2XGL A;  1F8N A;  2YX9 A;  3MHE A;  3CCE 3;  5IF6 A;  4EBG A;  1QVF 2;  1N8Q A;  2CG0 A;  4CDL A;  3DY5 A;  3TDG A;  3HX8 A;  4XM4 A;  3FG1 A;  3CNM A;  1EA2 A;  3NXJ A;  2MC8 A;  1NB5 I;  3GAX A;  3RGR A;  2GEX A;  1DVC A;  3B8L A;  4XDV A;  5IG5 A;  1N9J A;  3F7X A;  5AEW B;  3WA2 X;  4FMC A;  3PS8 A;  1JN5 A;  1OF5 A;  5G2G A;  1JB5 A;  4MMZ B;  1JJ2 2;  2F99 A;  3OWY A;  3FH1 A;  3PXM A;  3GZR A;  4EC6 A;  1V74 A;  4N6V 0;  3KSE D;  4WYK B;  2STD A;  1M1K 4;  1Q86 4;  3LH4 A;  4BTW A;  5D81 A;  3LXU X;  1W5Z A;  1S5A A;  3G8Z A;  3KN4 A;  2INX A;  4I4K A;  2CWT A;  3S27 A;  3CU3 A;  2IUJ A;  3KSP A;  2XFS A;  4HM7 B;  1VQ9 3;  5AYR B;  4IPB A;  3CCR 3;  1ULI B;  4N6U A;  1IVU A;  1JB2 A;  1Q82 4;  3IMA B;  2GBW B;  3K9M C;  5JPU A;  2F86 B;  3MPH A;  3GRD A;  2W9P A;  1OGX A;  1D6U A;  1O7W B;  2Q07 A;  2QA4 3;  2LQV A;  4HM0 B;  5IG4 A;  3G4S 3;  2GEY A;  3GZY B;  1UUW B;  3VGN A;  1O7M B;  4N6T A;  2HMN B;  2PNC A;  3K63 A;  2P38 A;  3X3Z A;  1ISK A;  4FCJ A;  3BB9 A;  2YFJ B;  2BNG A;  2BO9 B;  4MMX B;  1N5H A;  2HMK B;  4ZM8 A;  5ELU A;  1TP6 A;  3JUO A;  2Y74 A;  4L8O A;  3EBT A;  4RBN A;  1FGT A;  3CCU 3;  2W56 B;  4R1K A;  3Q1C A;  1YJ9 3;  1TFO A;  1VQO 3;  2BT3 A;  3N9H A;  3S28 A;  3NBJ A;  4J9A A;  8CHO A;  3IPT A;  4WP5 A;  3K0Z A;  2CWU A;  3CC7 3;  4FMB A;  1STF I;  1QAK A;  3JUQ A;  4O02 B;  1IDP A;  1LOX A;  3ER7 A;  4R9K A;  2F98 A;  3F8H A;  3G71 3;  3ECF A;  3JVC A;  3EF8 A;  3Q2P A;  4N6L A;  5AYS C;  3DMC A;  4EYC A;  1N5P A;  3CCL 3;  5BXQ A;  5EEO A;  1PFP A;  1O7P B;  2RCD A;  2XH9 A;  6STD A;  3CPO A;  1IU7 A;  3E99 A;  1TU5 A;  1VQN 3;  1VQ7 3;  4R4K A;  4HKV B;  1OPY A;  3UB1 A;  3U1W A;  1KQS 2;  3I55 3;  3FF0 A;  5IEP A;  1Q40 A;  4GL6 A;  3GZX B;  1GS3 A;  1SQW A;  4HBR A;  2CH9 A;  2GU1 A;  3D9R A;  4KFE A;  4N3V A;  1DYU A;  1IT8 A;  4OUQ A;  1YIT 3;  2M7O A;  3UL6 A;  2RGQ A;  5IW9 A;  3VF1 A;  2WGO A;  3B4P A;  3LML A;  5A0O B;  1RKY A;  3F9S A;  1Q81 4;  1GY6 A;  2BMR B;  3NV0 A;  1T5Y A;  3SOY A;  2CFL A;  3MG1 A;  3PCS A;  1K73 4;  3BND A;  3LTC A;  3EC9 A;  1VQK 3;  3G0K A;  1AVK A;  1RN7 A;  3KII A;  1NDO B;  1ROV A;  1CEW I;  4HZ9 B;  1YIJ 3;  4KZ1 A;  4HVN A;  4L8P A;  4G1M B;  3EBY A;  3OWS A;  1JNQ A;  3FG3 A;  3MSO A;  4WWU C;  3WOD G;  5KP1 A;  2MF7 A;  1C7H A;  3N8B A;  3CCV 3;  3CD6 3;  1OHO A;  1JB4 A;  2C10 A;  5AI1 A;  4IIA A;  4XDW A;  3X3Y A;  1SPU A;  4XBY A;  1GY7 A;  1QJG A;  2HML B;  1K8A 4;  3L0R A;  1GYB A;  2LYX A;  1ROA A;  1IQ8 A;  3CCJ 3;  4LGQ A;  3S67 A;  4BTX A;  5DRV A;  1AVL A;  4EXR A;  2W9Q A;  1QMA A;  3DM8 A;  3EJV A;  3H51 A;  1G96 A;  2OOV C;  4K1V A;  3JUM A;  3F8X A;  1VQ8 3;  3CMA 3;  4K61 A;  5KP4 A;  3X40 A;  3RGA A;  1KSI A;  4XB5 A;  1DMQ A;  4XBT A;  1EKM A;  1U8C B;  1JKG A;  3HI7 A;  3PCR A;  2C11 A;  5AIG A;  4HM1 B;  2W03 A;  1LXE A;  3FF2 A;  5CXO A;  1UUV B;  4PEJ A;  4HM4 B;  1OH0 A;  1RRL A;  4R9L A;  3J7Y d;  4QWT A;  3QK9 A;  2WO0 A;  1PU4 A;  4O8S A;  3X3X A;  2XF3 A;  5CK6 A;  1YHQ 3;  3CC4 3;  2O9U X;  1M1X B;  5I97 A;  1IVV A;  3NX0 A;  3AMO A;  3SX1 A;  2BMQ B;  1SJW A;  3NM2 A;  4NHF A;  2GBX B;  3F14 A;  3DGM A;  1O7H B;  1E97 A;  1WQL B;  3UNL A;  3SXX A;  1K9M 4;  3EHC A;  4HM5 B;  3STD A;  4STD A;  3QRD A;  5LC7 A;  1O7G B;  2GU3 A;  2XFT A;  4K1U A;  4IT7 A;  1NU3 A;  3X41 A;  4FCZ A;  4AKY A;  4JF8 A;  1A67 A;  2OQE A;  2FXT A;  3ALA A;  4TX4 A;  1M9G A;  2ZL8 A;  1MOL A;  3RDE A;  4WFO A;  1TFK A;  2WGQ A;  4AKZ A;  3WOE B;  3DGO A;  4X2H A;  3I56 3;  1WMN A;  1K28 A;  1IVW A;  3EX9 A;  5HGR A;  2L4V A;  2P0X A;  2XRX B;  5EQL A;  2CK3 H;  3B7C A;  2FNQ A;  1W00 A;  4KFD A;  5FW5 A;  1A2V A;  2P0M A;  3T0U A;  4HJL B;  2CHC A;  1O7N B;  3LT9 A;  3MG3 A;  1FGQ A;  4MEI A;  1WNH A;  3Q90 A;  1JN5 B;  1OF5 B;  3X42 A;  2ML6 A;  3NBB A;  3HK4 A;  5IEO A;  5JBS A;  1WMO A;  1DMM A;  1HKX A;  2WOF A;  3SOA A;  4FMD A;  5CF1 A;  1S72 3;  1VQ5 3;  3LOY A;  1W4N A;  1D6Y A;  1RJO A;  5AEU B;  4LMI A;  2W04 A;  2RFR A;  3V92 A;  1AV4 A;  3G6E 3;  2W0Q A;  1LVN A;  1IQY A;  4WHA A;  2B24 B;  3JUN A;  1TUH A;  1UW1 A;  3V99 A;  1DMN A;  2SBL A;  4K90 B;  1OHS A;  4FMA A;  4KFF A;  4N6M A;  4WYK A;  1W02 A;  1TIJ A;  4XBX A;  3NQZ A;  3OV4 A;  4HZB B;  3FCS B;  4FCM A;  3K7C A;  3FLJ A;  3O8Y A;  1NB3 I;  2E2V A;  4MMY B;  2OTJ 3;  3WMD A;  3KKG A;  3EB8 A;  3CME 3;  1DVD A;  5FGO A;  3G16 A;  2CFW A;  4H3U A;  1MNL A;  1YJN 3;  1RRH A;  4EV2 A;  2Z76 A;  1OGZ A;  2CFD A;  4H61 A;  2OTL 3;  2YFI B;  3CCM 3;  1KWI A;  2CKF B;  1NWW A;  3FSD A;  4GB5 A;  5D82 A;  2XGN A;  5IG0 A;  3CCS 3;  1SII A;  3DXO A;  3LTB A;  3T8U A;  5D83 A;  4X2O A;  3BNB A;  1IV7 A;  1CQS A;  3NUV A;  2KRT A;  3UJM A;  4N6N B;  3MYT A;  3KE7 A;  3SVA A;  3EN8 A;  5IEN A;  2QEX 3;  1N8R 4;  1NJI 4;  2YFL B;  2HMM B;  1WTH A;  1IV9 A;  1VZZ A;  5DRE A;  1YVB I;  3DZL A;  1FGR A;  3V98 A;  5IG3 A;  3KFQ C;  3NQY A;  5AII A;  3ROB A;  1ZO2 A;  1W6Y A;  4LSO A;  3S5C A;  2A15 A;  2W56 A;  1IQX A;  2XEP A;  1EG9 B;  3KZT A;  5TGN A;  4RNY A;  4AEQ A;  2D1W A;  3FGY A;  1K41 A;  1Y4K A;  3JUP A;  2CIU A;  3GWR A;  3FKA A;  2XSO B;  1VQ6 3;  1W6G A;  1WMP A;  1OCV A;  2WOH A;  2K0M A;  3PYJ A;  1LNH A;  3LTA A;  5AIF A;  3SLU A;  1JRQ A;  1Q40 B;  2CC3 A;  5BVB A;  1OUN A;  1Q42 A;  1U5O A;  4O2H A;  5CF2 A;  2XR8 B;  3B4O A;  3WA3 A;  3N54 B;  1FGO A;  3CXC 2;  1VQP 3;  3T8N A;  1KD1 4;  1VQ4 3;  4HM6 B;  3LYG A;  2ML5 A;  5STD A;  2XSH B;  4RZM A;  2QIY A;  1VQM 3;  1ULJ B;  2CG1 A;  4ORL A;  3MWZ A;  3NV0 B;  2Z77 A;  1YI2 3;  2UX0 A;  3CCQ 3;  2QGU A;  2B1X B;  3EE1 A;  1D6Z A;  1QAF A;  1W7C A;  3LZA A;  3PGB A;  3PZW A;  1QAL A;  1M90 4;  1FUW A;  2W2C A;  1KC8 4;  3H3H A;  4HM3 B;  1ZX2 A;  4O3V A;  1UI7 A;  3A76 A;  1W2B 2;  1CYU A;  1IK3 A;  3FZW A;  1SIH A;  2E2U A;  2CFK A;  4Q53 A;  5AIH A;  1E3V A;  4JRF A;  2V1L A;  2Z6B A;  5CLK A;  2I9W A;  2P05 A;  1GY5 A;  3BLZ A;  3DUK A;  2CFG A;  2CWV A;  3D3L A;  1A90 A;  3CC2 3;  1N9E A;  2IUK A;  1NO3 A;  1W6C A;  4EV5 A;  4HYZ A;  1Z1S A;  3K5T A;  3SED A;  3CPW 2;  1ASK A;  1IT7 A;  2E2T A;  2Y73 A;  3NM7 A;  4HM8 B;  2ZDJ A;  4KVH A;  2W6J H;  3U97 A;  4NRE A;  3WOF B;  3DGL A;  1HU9 A;  2FGT A;  4BTY A;  5IER A;  4R80 A;  2IMJ A;  4J8T A;  5ELJ A;  3LT8 A;  3OX9 A;  4U13 A;  1QVG 2;  3CNX A;  3EQQ B;  2K54 A;  4OVM A;  2D42 A;  1FA3 A;  1FGM A;  5KP3 A;  2IA7 A;  2KCD A;  3I0Y A;  4HM2 B;  2JQ5 A;  3GZB A;  1IVX A;  2KXG A;  1YGE A;  3WDG B;  2OWP A;  2JDI H;  1OAC A;  1JKG B;  4L7K A;  2HMO B;  3F40 A;  2OOV A;  2RSX A;  1EQK A;  2Z7A A;  5EVH A;  3S29 A;  4OK0 A;  4MJD A;  3MG2 A;  4LEH A;  1W01 A;  2PZV A;  3FG4 A;  1VQL 3;  2HMJ B;  3HZP A;  5JPP A;  1JV2 B;  3BNE A;  3OW2 2;  2P09 A;  1GD3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...