3GAZA

Crystal structure of an alcohol dehydrogenase superfamily protein from novosphingobium aromaticivorans
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
331
structure length
331
Chain Sequence
b'PTMIAAVVEEANGPFVLRKLARPQPAPGQVLVQIEASGTNPLDAKIRAGEAPHAQQPLPAILGMDLAGTVVAVGPEVDSFRVGDAVFGLTGGVGGLQGTHAQFAAVDARLLASKPAALTMRQASVLPLVFITAWEGLVDRAQVQDGQTVLIQGGGGGVGHVAIQIALARGARVFATARGSDLEYVRDLGATPIDASREPEDYAAEHTAGQGFDLVYDTLGGPVLDASFSAVKRFGHVVSCLGWGTHKLAPLSFKQATYSGVFTLHTLLANEGLAHFGEMLREADALVQTGKLAPRLDPRTFSIAEIGSAYDAVLGRNDVPRQRGKIAITVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alcohol dehydrogenase superfamily protein
publication title Crystal structure of alcohol dehydrogenase superfamily protein from Novosphingobium aromaticivorans
rcsb
source organism Novosphingobium aromaticivorans
molecule tags Oxidoreductase
total genus 100
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gazA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3gazA01
1XIVA 5BT9A 8ADHA 4WLVA 1BGVA 5JYDA 4NJMB 2I99A 2Y1CA 4PLHA 2YYYA 2Y0CA 4D3SA 4B7CA 1NYTA 3DL2A 1C1DA 3BTOA 3ENKA 3WXBA 4YJDA 1LI4A 4W7IA 3S2FA 3HFGA 2NUAA 3VH4A 2O7SA 4KWHA 2P5UA 3E5MA 1I24A 3TZCA 1LXCA 1YVEI 3ZI0A 3F1KA 4AJIA 4ESOA 4BHTA 4AJNA 1I3LA 2YJZA 5IDXA 3TDKA 3WQRA 4AJEA 1LNQA 3K6JA 1HE2A 1WPQA 1DC3A 3H3JA 4QECA 1TB4A 2DBZA 2Y1GA 2J3HA 3BTSA 4NK4A 5GZ6A 1WNTA 2B5WA 1HT0A 1NPYA 4MPDA 1J0XO 4MP8A 4Q3BA 1H6BA 1GZ6A 1E3LA 2Q2VA 3PP8A 3RBVA 4YA6A 4A2CA 4QX6A 3VVCA 4J9UE 4YT4A 4CR6A 3Q1LA 1QLJA 4L0QA 3GUYA 2FPPA 2X6TA 4ZQEA 1GR0A 1MGOA 1Z6ZA 4QFDA 4CMKA 5JS6A 4PVCA 5DZSA 1YRLA 2X4GA 4JX8A 4J91A 3ZU2A 1MFZA 4Z3KA 1CQIA 1LDNA 2PGDA 4OSOA 5ER9A 4F45A 1QORA 2HK8A 2FPIA 3NKLA 2A4KA 4HFNA 1GQ2A 3OF2A 1PS8A 3VDRA 5A03A 2HQ1A 1CYDA 3FNFA 4J7CA 4KDEA 1E1LA 3DHEA 3RC7A 5IFLA 5FYDA 1ZSNA 3ORFA 2WD7A 3PJGA 2BGMA 4LMPA 2HK7A 3PEFA 3OFSA 4R5MA 4P4LA 4FS3A 4B7UA 1IULA 1EZ4A 2VQ3A 1LC3A 4TVOA 3OEYA 4MIOA 1YGYA 4CM6A 1E3SA 4R5HA 4XYMA 2ZTLA 1IPFA 2BFAA 4PG6A 1HLPA 2O4UX 3P5SA 3L9XA 2C20A 4BV9A 3K96A 3A14A 3JQBA 4CQLA 3U5TA 3ZCXA 5EMHA 1B7GO 2FZWA 4KTTE 4LVUA 2PZJA 3L4BC 2C59A 2E49A 4U0JA 1NPTO 1YWGO 2OP0A 3GZ4A 5IN4A 1PQWA 4YT8A 3DZBA 2X86A 4BMSA 1X1TA 1MA0A 3UKOA 3GRKA 1K6JA 4IBOA 5AOVA 5G0UA 2X0JA 4D79A 4EI2A 3PZBA 3VPHA 4GX0A 1H6CA 4FR5A 1M67A 3NRCA 3WLFA 4J2OA 1Y8RA 1B3BA 3AOEC 1H93A 4J3FA 5C7OO 1EQ2A 2PWZA 4JJIA 4YAIA 1LRLA 4ZQGA 1HDRA 1DJQA 2B5VA 5L40A 1Y5RA 2B4QA 3I9NA 1QYWA 2PNFA 5JE8A 5KTKA 4FFNA 2D1YA 2Y1DA 3JQ7B 4P22A 4PRKA 4QUKA 3W4IA 1M76A 4HFRA 1C1XA 2EKLA 3JD1A 3AOEA 3AW9A 4NBVA 4RF3A 4Z0HO 1VRWA 1DFGA 4FQ8A 3WG9A 3HFSA 3N58A 1WZEA 4Q3CA 3O4RA 3R0IA 3SXPA 1P77A 2B35A 4Q3NA 5JMPA 1R4NA 3CXRA 1JKJA 1YOVA 3NT5A 2Y05A 5BSHA 2QQ5A 3AWDA 3LLVA 2JL1A 5A5EA 3FR7A 2EKQA 5DBGA 4R1SA 5JAQA 2YFQA 4YJFB 2X9NA 1UZNA 2GGSA 3H2ZA 1V6AA 3H6KA 3FHLA 4MIYA 4W6ZA 2XOXA 4AICA 5KOIA 2OORA 1U28A 4AJ1A 5F1OA 1QYVA 5G0SA 2HMTA 4R54A 3BMCB 4QT0A 3E18A 3X2EA 4BL5A 2AQ8A 1AN9A 2FZEA 2QZ9A 2V6MA 2WD8A 4Y6PA 2D5AA 4RDHA 2FMUA 3UCEA 1ZJZA 1C0PA 2PKQP 1VM6A 3CH6A 3TZ6A 2NM0A 4WCFB 1TEHA 3D1LA 3ITDA 4ALIA 2CF6A 4XYBA 4NFSA 4ALLA 3OJOA 3NUGA 4WOKA 4Y67A 3N7UA 3GF4A 5G0WA 4XCVA 4JXKA 2EP5A 5ES3A 2AEJA 1ZK2A 4FC7A 5GMOA 4TRJA 4W7HA 5TJ9A 2VUTA 1HE3A 4P8RA 4XYLA 4IS3A 1ONOA 2EG9A 4RF4A 2WM3A 4U0KA 4U7WA 3PWKA 3QWBA 4BNXA 1AXGA 3I4CA 4XQEA 4NBTA 3RBXA 3ENNA 3ITKA 1J6UA 3UICA 3IS3A 2HLPA 2DBRA 2GN6A 5BNIA 1O8CA 4JBGA 1TLTA 4JCOA 3GC6A 4IJUA 3EZYA 1ENZA 3V5NA 2NLOA 3BZUA 1HDYA 3CPSA 2HRZA 4IIVA 2OHXA 1DIAA 2ZCUA 4DIBA 4LSMA 1HDOA 4BNLA 3OSUA 5JDCC 2VHVA 1JA9A 3ZHBA 4CM4A 4LK3A 2NVWA 4DLLA 3TSCA 4EJ0A 3ZZNA 2NWQA 1W6UA 2JCXA 4MVJG 4XQCA 5CAEA 2VRCD 2VRCA 3OQ1A 1OBFO 5IG2A 5KVSA 1ZK4A 5JDCA 2XF8A 1WVGA 3I9JA 1F8GA 1R15A 5EN4A 4A26A 1Q2XA 4WGGA 3PHGA 5L7YA 2BGKA 1U4SA 4J1QA 1MFPA 4B3HA 1G1AA 1BMDA 1Q7CA 1GQQA 3H4VA 1C3VA 4UVGA 3WNVA 4WECA 1DBVO 4FJ1A 3PGXA 1RM3A 2CNBA 2HCTA 3R6DA 4Z9XA 4AJ2A 4R9SA 2ZCVA 4GX5A 3WIDA 4BNUA 1CRWG 4DL9A 3A4VA 1QYDA 4ONEA 2V65A 4F46A 3UHAA 4FOSA 1K6XA 2VOJA 2WYUA 4WASA 1X7HA 4BNJA 4AL4A 4IS2A 3ZV6A 4AVYA 3RC2A 2P9GA 1HDZA 5FI3A 2X5JO 1MP0A 4MO2A 2CD9A 1HYEA 2VCYA 3WYCA 3QWAA 4KWIA 4BNTA 3RKUA 1V3UA 3KSDO 2GN8A 4CMIA 4DC0A 4B4VA 1UDCA 5JO0A 4CR8A 4XDYA 3IOYA 4BGEA 3DZIA 2ZYGA 1R6DA 4DQVA 4FDAA 4FIZA 1U8XX 1GYRA 2P68A 5B37A 5A1TA 1GV1A 1ZKMA 1P74A 4OGWA 3IC5A 3MJVA 3QVOA 1CF2O 1GYQA 4XB2A 3E48A 1C0KA 3ASUA 5JAMA 1GCOA 1HZJA 4NU5A 4E5PA 4IJVA 1LU9A 1P44A 1PJ3A 3PQDA 4GSLA 5KVQA 3TZHA 3ZHYA 1T2DA 1D1SA 4Y8VA 3CTMA 4P4NA 5K6AC 4Q9NA 5A5FA 2YQ4A 4NIMA 4XA8A 3OJ0A 4IDFA 3W4KA 1SOWA 3KV3O 3OJFA 2H9IA 3GLQA 2WMDA 3QW2A 3WGIA 3GT0A 3TN7A 5TIIA 1Y6JA 3GA0A 4PIVA 3GFGA 3OIGA 5I8ZA 3DXFA 3AY7A 2WE7A 4RQTA 5IF3A 1K0UA 3H9QA 3I9KA 5H81A 3DEYX 2EJWA 5K6AA 1NTOA 2QYTA 3PXXA 4HXYA 1OOEA 3EY4A 3K9QO 1KETA 1IYZA 2VYVD 2VYVA 1HYHA 1HE4A 1XG5A 2D59A 2Y99A 1C1DB 1CDOA 1WDLA 2C29D 1A72A 3DBHA 1CERA 1VL6A 3PYMA 3FPCA 4WLOA 2AE1A 3HB5X 3G1TA 4P38A 3RUEA 1HETA 3PQEA 3ZWYA 4FFRA 2CFCA 3H9GA 1R16A 1R66A 1XDWA 2UYYA 1WDMA 4FJ0A 1T2AA 6ADHA 2CVZA 4I1IA 1VKNA 2X9VA 5TLSA 4NBUA 1QV6A 1QG6A 4XD2A 3S2EA 1R0SA 3VDQA 1GFSA 3CUKA 2PGJA 4WNCA 1EFLA 1QYCA 3DMYA 5COAA 1SO8A 3AUTA 3E9MA 4DWVA 1V0JA 3MCVA 3JD0A 4BO5A 3T7CA 1EBUA 1VSUA 4AFNA 2QZZA 5IXSA 1PU2A 1ZSVA 3ZWBA 2VN8A 3KYBA 1JW9B 4N18A 2ZJ1A 4WEQA 2AQHA 3K31A 3GVXA 3G3EA 1E7RA 3RAJA 1P1IA 2AE2A 3KVOA 3UN1A 4CM1A 4LW8A 3VKUA 1MV8A 3PK0A 1PJLA 4KTVE 1E6WA 3VZQA 3V8BA 5JBIA 2HMWA 1UAYA 3ZWNA 4NK5A 3DAPA 2UUOA 2Q4EA 3M2PA 4L8VA 5KJCA 2IYOA 5HRUA 3RD5A 2R00C 4LCJA 3OJEA 4K26A 4YT5A 4XRRA 2D4AA 3AM3A 2JCYA 1R12A 5FEUA 3B1JA 1U1IA 3ROPA 3GDGA 3WWZA 4CLRA 1XWFA 3GNSA 4NZ9A 4XEHA 1SNYA 1EEHA 2WD7B 4CM8A 1Z45A 3QV1A 1XCBA 4F6CA 4B7XA 3GEDA 3P19A 3SX2A 5MGBA 1BXKA 4ZHSA 4MINA 4FGSA 1E5QA 3M6IA 3D64A 4TKLA 2JHGA 3VPGA 4TRRA 3ZW8A 5DP1A 4W9NA 3VKVA 2CDAA 1ADCA 3D5TA 1FMCA 4BKUA 5J23A 1WW8A 4CQLB 1V35A 2DFVA 5B4TA 4YDRA 3FD8A 3DO5A 3UF0A 3PRJA 4B4WA 1NPDA 1YB1A 1BRMA 4FC6A 1NR1A 1N7GA 2GN9A 5A3VA 1YO6A 1X0XA 1UP7A 1G0NA 4ZRMA 5EL0A 5TT0A 1ZK3A 4HKTA 1PQPA 2W2KA 1U4OA 2JD2A 4EEZA 2O48X 5IZCA 1HDCA 2XXJA 4G2NA 2IE0A 4ZQFA 1P3DA 2PKRA 4KOAA 1Y8RB 4RVFA 3C1TA 1QYXA 3VHRA 4MVJF 1DLIA 2DTEA 3DZHA 2DBQA 1DOHA 4ILKA 3TWOA 1RM0A 5HA5A 2F1KA 1LLDA 3H5RA 4RVUA 2IZZA 2HO5A 4KP7A 2EXXA 3JQ6A 1JLLA 2NQ8A 4PLGA 1C1XB 2Q2QA 4TZTA 1NP3A 4IMPA 1A71A 2RIRA 3EDMA 4YB8A 2GPTA 5DCUA 1LDBA 3IQDB 2Q3EA 4IPTA 2HUNA 1I3KA 2X5KO 2AQIA 1R4NB 4DQUA 3NV9A 3NJ8A 4L4RA 1YOVB 4E2XA 3EAGA 1E6UA 1PJ2A 2ZIZA 3DBRA 2Y93A 5LCXA 1EBFA 1UAGA 5ENVA 5U1PA 3HG7A 4URFA 4BGVA 4NDNE 2WSBA 3BTVA 4FCCA 4NR0A 4IUYA 4JROA 1P1HA 3QWFA 4GBJA 4O0LA 4ALJA 3NTQA 3VPFA 3EW7A 4DMLA 3G1UA 5T57A 4ALKA 1BW9A 4NJOA 1E77A 1HSZA 1RM5A 2GRAA 3S55A 4A73A 2TMDA 4GL4A 4RLHA 2IODA 3IP3A 5B4UA 4Q3AA 4J2HA 1DIRA 1E3EA 3DZJA 1ZH8A 1ISGA 2I65A 3RFXA 2E48A 4XKJA 4MP6A 4AJLA 3MJSA 3LVFO 1GUZA 3HADA 2BFMA 2FSVA 1LC0A 4IJWA 2Y0DA 1E7YA 4TROA 3C8MA 2Q46A 3D4OA 4EGFA 2B37A 1BTOA 3WYEA 4PLYA 5ICSA 2DFDA 2YHIA 3KEOA 3HDQA 4UEOA 5B12A 4N5LA 3GR6A 2B83A 2C07A 2ZYDA 2IEBA 2QRLA 3WS7A 3L07A 1B3RA 2D8AA 1X1EA 3WSVA 4CJXA 1UP4A 3JQEA 4IGFA 3C24A 2RCYA 1DB3A 1YL7A 3FWNA 4Y6SA 4XGIA 3GUCA 5A3JA 3IIEA 2Q1TA 1N1GA 2QRJA 1ZMOA 4GGPA 3WSWA 5TGDA 1KEUA 3K30A 1H5QA 4UREA 4DYVA 1NQTA 2X22A 4MJLA 5LC1A 3PFWO 3W8EA 4YRDA 2FRDA 4M8SA 4MVJP 4L76A 4EUFA 3ASVA 4BNWA 4BQRA 3ZGYA 3ADOA 3AY3A 4CMAA 1XELA 5CPFA 2EF1A 3K92A 5F1PA 5JPIA 5KWEA 1ULSA 5DCWA 4CM4B 2BD0A 3FCOA 2PV7A 3FBGA 4KUEA 4DQXA 1CWUA 4R1TA 5TX7A 4J43A 4OM8A 5BQFA 3GFBA 3G0OA 3TL2A 2CY0A 3JQFA 3WQQA 1U7HA 4BKPA 1YBMA 4YT2A 1ZNQO 4F6LA 1VSVA 1Q1NA 1LQUA 4CUJA 1V3VA 1Z73A 4B3IA 4GSKA 2X23A 4XQ9A 1EUZA 2NQTA 3AUUA 2W2LD 2W2LA 3WTCA 3SLGA 3FRJA 1DRVA 1BDMA 3OBBA 2YV1A 5KIAA 1PTJA 4K6FA 2EW8A 4RGBA 3LC7O 2P4HX 4ZICA 1KYQA 4XGKA 3I9LA 4I5DA 1O0SA 4TZKA 1HKUA 3U4CA 1DXYA 1YB5A 4IJKA 4XQGA 3VVBA 3JD2A 4B4OA 5G4LA 4DRYA 1EFKA 3R3JA 3ZU3A 1IY8A 1Q0LA 3Q3CA 2GERA 5HTOA 4RF5A 2NVUA 3I4FA 2P9EA 2Y66A 4B8WA 3WMXA 2IDZA 2CSUA 3GG9A 4PZDA 1YH3A 4GKBA 1H0KA 4CMIB 3DOOA 2W90A 4E0BA 3U9LA 4WLFA 4J9VA 4YAJA 2I3GA 5CEFA 1ARZA 1VPDA 3DDNA 1LJ8A 4LGVA 2ZYAA 1LA2A 3G79A 3ST7A 2B4TO 3LT1A 1LSJA 1IZ0A 3EHEA 3LU1A 2X58A 3WGQA 4ZVVA 1JQBA 4B8ZA 2WJPA 4ROSA 3MOGA 3DOCA 2Q45A 3TOXA 1IB6A 1GL3A 1I2BA 3WGHA 3AK4A 3KLMX 5H83A 2QYSA 4OIMA 1XR3A 2D0IA 4MVJI 3JYPA 4YAKA 3STHA 1E3WA 1WMBA 2EWMA 5ITWA 4PLZA 4IY1A 3JQGA 4L4SA 3IDSA 4TWRA 2POQX 3BMQA 9LDTA 5AXAA 3WDSA 1GEEA 3HB4X 1LUAA 2QHXA 3INRA 5HS4A 3DBHB 1BHSA 1U3UA 1YONA 5AXDA 4J4TA 2OUIA 3TF5A 2ZB8A 2I5PO 4HNGA 1BXGB 4KZPA 4FB5A 2FOIA 1MX3A 2DC1A 3RUIA 5L51A 1PGQA 3HDYA 4YEDA 1EUDA 2J3IA 3ZHZA 4WLNA 2PD3A 4OL9A 1I3MA 1N7HA 3RWBA 4DBZA 4PG8A 3PWSA 1KOLA 4UVDA 1WDKA 3JQ9C 1EDOA 3QJ5A 4WOJA 1HDGO 3MTGA 2EHDA 1HXHA 4D7AA 3PIIA 5I7VA 3T7EA 3AFNA 1PWZA 4R4JA 5L95A 3O03A 4PG5A 2GASA 4CLEA 2GD1O 4L9RA 3JQBC 1RWBA 1EVJA 2C54A 3H5NA 3JQ9A 1KEVA 1NAHA 2AHRA 4Q3DA 1NVGA 4LRTB 4INAA 3KZVA 2PGLA 4CLOA 3IAHA 1H2HA 3ONDA 1NWCA 3GG2A 3PHLA 1ZCJA 3GH3A 2FSSA 4PVDA 1O9BA 2X0RA 3SVTA 4DPMA 4RPKA 4CLRB 3UH1A 4RPHA 2C82A 4I08A 3DR3A 2R2GA 5H82A 1UJMA 1EVIA 4RVSA 3WGYA 3DQPA 4GLLA 4XJTA 4CM8B 1A4IA 4L75A 1NHWA 4C4OA 1ULUA 4WEOA 1DHRA 3COSA 3KBOA 5EESA 1PJSA 3MZ0A 1J4AA 3PFFA 3RUCA 4A0SA 3D3EA 3Q6IA 4XR4A 2OZPA 3Q0EA 4E12A 4QEDA 1NFFA 2XXBA 3VH2A 2ZTVA 1WAMA 3OETA 3U4IA 3DB2A 3JYQA 2PD4A 3NT2A 1PZFA 3ABIA 4O1MA 3L6DA 4FOOA 5FWNA 4J90A 2BFOA 3TOZA 1P33A 3PJEA 3GN1A 2X0NA 3PHJA 4FPXA 2ZB7A 4PLPA 3PQFA 1B16A 3O8QA 1WXDA 2P91A 4ZQBA 4J16A 4J1TA 3F6YA 4CLHA 2W2KB 1ZFNA 3FN4A 3UGKA 2VWGA 3C7AA 3CZRA 3P2OA 5F21A 3ANMA 3RIHA 2YQ5A 3RKRA 2NSDA 4BB5A 3LK7A 3O9ZA 2OMEA 3ZU4A 5A04A 1NFRA 3WBBA 4YCAA 4DIFA 4MVJM 1EK5A 1PX0A 4X54A 2W8ZA 3RUFA 4LSWA 3GNQA 3GZNA 3SLKA 4EBFA 5L7WA 1D4FA 1L1FA 3E03A 2GN4A 4M1QA 2O3RA 5ENDA 1N2SA 2HK9A 5CPBA 1N5DA 3GQVA 5KVVA 3JYLA 4IDGA 1GYPA 1I33A 2OGUA 4PLCA 4RPJA 5I9MA 3IUSA 4O59O 3OP4A 3DBRB 5JW6A 1UZMA 3ETEA 3I6IA 5TC4A 1T24A 2WYWA 1CETA 2WWRA 3DZKA 4RZIA 4IDAA 3NTOA 3E1KA 1ZEJA 1GUYA 3PVZA 1L7DA 3CINA 4PCVA 4RLSA 4U6SA 2ZQYA 3KEQA 5TQVA 3F4BA 2DKNA 3ZWCA 4HX5A 1YBAA 3GVIA 4E5YA 3LYLA 3K2EA 1BW9B 1PSDA 1IL0A 1TI7A 1O6ZA 1YB4A 4BO3A 4D3DA 1I36A 4G81A 4DLBA 1LQTA 3LZ6A 3NGXA 4UVIA 1YQGA 1LRKA 3UW3A 1PQUA 1ML3A 1YL5A 1PJTA 4BQPA 3BA1A 1GUFA 3V1TC 3AI3A 2X0IA 4MKRA 1MLDA 1I5RA 4ID9A 4AJHA 1PIWA 1E0DA 2ZTUA 5G4KA 3A28A 1PWXA 3AM4A 2YHIB 3C7CB 4TRNA 3WGOA 1DC6A 3L6EA 4IQGA 3GEGA 4CM9A 1ZVMA 3K2BA 2O3UA 3V2GA 4NH4A 4TKMA 3V1YA 4ITUA 3S1LA 4QSMA 4RL6A 3ZN2A 1Y1PA 1I32A 3I6QA 1AE1A 3FNGA 4DVJA 4BNZA 4BOYA 4J7XA 1ISMA 4D41A 3KLPX 3TFQA 2CDBA 5DOVA 1VE9A 1UXGA 4JJFA 4WKGA 1I30A 3KSUA 1SAYA 4U5QA 1NAIA 4FFMA 4XYGA 1U9JA 1HTBA 1TT7A 2C7VA 4J7UA 5GZ3A 1PS9A 3D3WA 4YVFA 5ILOA 4DMMA 4EUHA 5AXBA 5IJZA 3ETDA 3F4LA 1V8BA 1W73A 4E33A 3WR5A 1B0AA 4BMNA 1T1SA 4XZ3A 3WMWA 1U3WA 1J5PA 2PR2A 4QXMA 1GADO 4K1LA 4NI5A 3AOGA 4CMCA 3QHAA 1SOVA 2BRUA 2C5AA 1A27A 1E92A 1ZJYA 4OXNA 5IDQA 4YRAA 3ZWVA 4QO7A 4H7PA 4E4YA 2CVQA 4I9HA 4GI2A 4E13A 1KY4A 3ZWMA 3KOUA 1F14A 5IAAA 4XWYA 3TPCA 3W1VA 4CV0A 5I7FA 2B36A 3RVDA 5B4VA 3I3OA 3I52A 1U5AA 1OZAA 4J49A 4CODB 3RU7A 1ORRA 1EE9A 2EW2A 3WIEA 3LT4A 1P31A 1DC5A 1FDWA 2Q99A 3GEMA 1VC2A 1N9GA 3C1AA 3ON5A 3GPDG 1SEPA 4BO0A 1I2ZA 2FR1A 2RH4A 3KYCA 5IXYA 1DFHA 2AMFA 1A5ZA 3BMNA 3DOJA 5A06A 4GMGA 2NU7A 3DZFA 3ICCA 2JKVA 2H6EA 3QLJA 3ZWAA 3E9QA 1PGPA 5HBRA 2NVUB 1D7OA 4RPLA 2IEDA 5DN9A 3OECA 4BNKA 2DLDA 1GU7A 3EVNA 3GVHA 5THQA 3E5RA 1E7QA 4QQRA 3FSRA 5FFFA 4A03A 4M89A 1Y8QA 3M1LA 4RO0A 1GPDG 2DPHA 4IM7A 1HEUA 5AYVA 3WJAA 4AJ4A 1XGKA 4MVJH 1Z7EA 3QVSA 1PGNA 3P7MA 3FF4A 4JQCA 1F17A 4FN4A 3M2TA 3VTZA 5A02A 1O5IA 2YDYA 3SEFA 2IZ0A 5T6BA 4RJTA 1BXZA 3GN2A 1HWYA 4DREA 4GVLA 3UXYA 5L45A 3NTRA 4IQ0A 3RC9A 2YZ7A 3ROKA 2X9GA 2DM6A 4YTEA 3RFVA 5CHEA 3PYLA 2ZJ0A 1KVTA 2FY8A 1BXGA 3GMSA 4KUGA 4WK6A 4CUKA 2PZKA 2DQ4A 3PYXA 1V3TA 2Z1NA 3CMMA 2BKAA 4PG4A 5BNTA 7ADHA 4OOFA 1YDEA 2WEKA 4GPD1 5A9TA 4S3MA 4J1SA 3NJ4A 4Z9YA 3IKTA 1DFIA 2V7PA 4FJ2A 5G0TA 1E3WB 3HN2A 1LRJA 3MWEB 3HHPA 3RJ9A 5KKAA 1NVMB 5KKCA 3QVWA 1BG6A 2UAGA 4BO6A 4BNMA 3OEWA 1DJNA 3JQGB 3PJDA 4BNVA 4O63O 4K28A 3AI2A 3BMQB 3A06A 2Z5LA 3D4NA 3MJCA 3S2IA 2I67A 1PL7A 1B15A 5I8WA 3B1FA 3QVTA 4CV2A 4G65A 3WJ7A 2GZ3A 4ALMA 4A7PA 2NU9A 3FR8A 3OA2A 1DAOA 2UV8A 2YV3A 4R9RA 4YYZA 3BXXA 3KRTA 3MJTA 2RHCA 3KETA 2Q4BA 4CMBA 1YL6A 4ZGWA 3GDFA 4LVCA 4E2WA 2E82A 1M6HA 3GY0A 4MIEA 1M6WA 3CIFA 4OXYA 2CVOA 1RPNA 1P45A 4W9NC 2DAPA 1JKIA 3CSDA 2PZLA 3JSAA 4RORA 3TQHA 3DFUA 1MB4A 3V1UA 3RUAA 1ENPA 1MG5A 1GQYA 3L9WA 4HADA 4EYEA 2O2SA 2JD1A 3SJ7A 1GY8A 1HSOA 2VOEA 3NDRA 4QTZA 1GDHA 3R1IA 4YPOA 2C5EA 3KO8A 3FNHA 1I3NA 1I8TA 2O4CA 4CLOB 2J3KA 1GV0A 5JC8A 3AI1A 3X2FA 1BVUA 5A4DA 2O2YA 2QW8A 4XIJA 5IZCC 3JD4A 5L7TA 4A10A 5G2OA 2PFGA 3L77A 1JKFA 1PJBA 1PR3A 5U9CA 4AJOA 1Z7BA 4HBGA 3PLNA 3IL2A 3H9JA 4JBIA 5CDUA 5KJFA 4J4HA 3CKYA 4YXFA 4NBWA 1Q0HA 5U4QA 2NU8A 5IDWA 2VWHA 3INTA 3O26A 3RC1A 3ZWWA 1KIFA 4H3VA 2LDBA 3I9MA 1DIHA 4P4GA 1Q7BA 4BGUA 4OHUA 1KC1A 2WE8A 2VHXA 3MOIA 2YFHA 3ONFA 4GWGA 4DYDA 1KEPA 5JFOA 5DOZA 3QQPA 1K3TA 4ZJUA 4B4UA 4I8XA 3GGPA 5CEJA 1XLTA 1UXKA 4ALNA 1R0KA 2WYVA 3I83A 4TVBA 5CDSA 4DTIA 3O8QB 2J5RA 4RCVA 3QIVA 3DBLA 2OBNA 2G82A 3KYDA 3PPIA 1O94A 3FTPA 1U2GA 5EJ2A 4RQUA 3DHNA 4XYEA 1Y81A 4OQYA 5JO9A 4OYRA 3VPXA 1MUUA 1P0FA 3NT4A 1TT5A 5C7LO 1GD1O 2J5KA 1JTVA 3WFJA 2WTBA 2JCVA 5EQDA 3V2HA 3WGGA 1RKXA 1Q7GA 4NHEA 4OJNA 3GZNB 4CMJA 2G76A 4CV1A 5L4SA 1T2CA 4GH5A 3KUXA 2DVMA 3TZQA 4YJGA 3RASA 1Z82A 3KB6A 3WGZA 5JNLA 1ZUD1 1TA4A 3VPSA 1M2WA 2H5LA 2RHRA 3PHIA 4PZEA 4RPGA 1B8PA 4FBGA 4OAQA 3BMOA 3FNEA 4PLTA 4R41A 5MDHA 1HZZA 5C7IO 2AA3A 4BKRA 2BH9A 2Q49A 4D44A 1M75A 1E1MA 5DNAA 4Z0PA 3RCBA 1B8UA 1DIBA 1OMOA 3AFMA 3JQAD 3JQAA 2HRBA 4ZD6A 2GZ1A 1IZ9A 2RH8A 3EVTA 3GHHA 5CDGA 1VI2A 1IUKA 4MKZA 3DAGA 1BVRA 3WGTA 2Y1FA 2Y1EA 4KQWA 4TRMA 2ZK7A 2JFHA 4EDFA 1ID1A 2QRKA 3ZHXA 4JIGA 1C0IA 2OBYA 4NU6A 4YJHA 2Y68A 5JC1A 2CZCA 3JQCA 5A9RA 3PJFA 3ULKA 5HM8A 2IXAA 1DPGA 3JQFC 2PZMA 5G4KB 3BHMA 5KVCA 1DEHA 2HDHA 2A35A 5EINA 3ROMA 4J0EA 4R1UA 2XPCA 2E6UX 1RJWA 2IZ1A 5JDIA 2PK3A 5L3ZA 5EERA 1YXMA 4ND4A 4BB6A 3GNTA 1EMDA 1Z74A 1E7SA 1Q0QA 1T4DA 5L9AA 1UUFA 2JFFA 1EVYA 2XAAA 2X8LA 4N5MA 4IDDA 1FDTA 4MVJD 1A7KA 3LDHA 2GNAA 3GDOA 4MVJA 1H94A 1GZ4A 2GUGA 2NADA 2GLXA 2I3AA 4E31A 1YJQA 2PD6A 2V6FA 3QY9A 2I66A 1MG0A 3W6UA 3D3WB 4OXKA 1XA0A 1C0LA 2EIHA 3SC6A 4NFYA 4NQZA 5EIOA 3HSKA 4H16A 4BO9A 3OIFA 2I76A 4FGWA 5A9SA 2VZ0A 3BYZA 2O3JA 1I01A 3F46A 1NASA 4M86A 3A9WA 4W99A 3U09A 1U3VA 1CIVA 3GVPA 2BF7A 3OQBA 1ISHA 3JQ8A 1AHIA 2VRBA 4E3ZA 2D2IA 3ZNOA 4R3WA 1XKQA 1LEHA 1LDYA 2QX7A 2PTGA 3WBFA 4LCEA 3G49A 1JVSA 4RVDA 2EJVA 2C2YA 3WICA 5CG1A 2WDZA 3ZWPA 4DGSA 3D4PA 1KVRA 5A05A 2NV6A 1A9YA 2GSDA 3OQ6A 5TF4A 2O50A 3WOHA 4EUEA 1LLQA 3JQDA 3DTTA 2FP4A 3PIDA 2NU6A 4IZIA 1AGNA 4XDZA 4BNYA 1N9GB 1U8FO 1LLUA 2AEMA 1MXHA 1UP6A 2OO5A 3F5QA 5LDHA 3OA0A 3KYCB 5BSEA 1IE3A 3BMNB 1YDWA 1SBYA 3FWZA 2GF2A 5LDGA 1H9AA 6LDHA 1W0CA 4OQZA 4FFPA 2AQKA 3Q2IA 1JVBA 2EV9A 3ONEA 4UVHA 3U4HA 2C0CA 3DWFA 2NNLD 3OMLA 2AW5A 4XJSA 4TMFA 2AG5A 1WP4A 1IHXA 4HNHA 2DU8A 4CLDA 2ZB4A 1JN0A 1QR6A 1Y8QB 4DA9A 1CQJA 2GO1A 3ADPA 3ZV3A 2EP7A 5AVOA 4UEJA 3GMDA 5ADHA 1YBVA 1OI7A 1DRWA 2H1SA 3F5SA 4IIUA 3VOSA 3H7AA 4UULA 3AY6A 2PY6A 1V9LA 1LSOA 2PKQO 3AUSA 1VL0A 2G0TA 4LN1A 2ZB3A 5I7EA 1HDXA 3OHSX 1F0YA 1R37A 3JD3A 1DHTA 3P2YA 1KS9A 4IINA 3K8ZA 5KJEA 4L74A 2EERA 1DLJA 1CEQA 2RAFA 5TT1A 3U49A 2D3TA 3ETGA 4DPKA 5DBIA 1P9LA 1PJQA 1M66A 5ER6A 1PJCA 3IUPA 3ROQA 5DULA 1FDVA 2FR8A 1DC4A 3TNLA 4E32A 4DXHA 5I9LA 3GGGA 3E8XA 3FBTA 4RZHA 1UH5A 3EC7A 5F1KA 4M54A 3QRWA 4UVEA 1U7TA 2DTXA 2ZTMA 2RBEA 4YBZA 4CQMD 4CQMA 3E9NA 1XQ6A 4UUNA 1B26A 3I5MA 4YQZA 3DZGA 4JJGA 2BHLA 4J4BA 4BNFA 2BFPA 2R6JA 5B1YA 1NQ5A 3UCXA 4FD3A 1O89A 1GAEO 1D8AA 2NTJA 1ENYA 2VYND 2HSDA 1H9BA 2VYNA 5T64A 2I6TA 4E5MA 4BIIA 5BSFA 4OMUA 2W98A 5TJHA 1DIGA 1UR5A 2AG8A 1DO8A 3RROA 2VNSA 5BSGA 2YUTA 3LT0A 2Z1MA 1P1RA 3K5PA 1HYGA 1PJ4A 1DDOA 5IZ4A 1J49A 4R01A 7MDHA 4B3JA 3DMTC 4MP3A 3FTNA 5TS3A 4B79A 3DONA 4KMSA 1W4ZA 4J1NA 1R4MA 3RBZA 1IPEA 1B2LA 2TMGA 2VUSA 1I2CA 4OOEA 2Z95A 3WTBA 3BHJA 4R1NA 2VT3A 1VKOA 3GPIA 4XIYA 1ZIDA 4EZBA 3GVCA 3DMTA 4RV9A 3OICA 4TSKA 1EQUA 1FJHA 1X7DA 1NFQA 4MDHA 4NNJA 2X7HA 4EJ6A 3L4BA 1SPXA 4S1VA 4NG5A 5JYEA 1LBEA 2VZ9A 4BUCA 5EQFA 2Q1SA 4XGNA 3N74A 2HMSA 4II3A 4IXTA 3C7DB 1QV7A 1DSSG 3IKVA 2BI8A 4AJPA 3B70A 4WJZA 1TXGA 3U0BA 4BS9A 3ZV5A 2NTNA 3U3XA 3S2GA 4DUPA 4EW6A 4JN6B 4JGBA 3W6ZA 3VZSA 1PS0A 2ET6A 2VTDA 3NX4A 1NBOA 3RUDA 3Q2KA 5C37A 1QSGA 3L6OO 5L53A 4BKOA 2HU2A 4ZRNA 1NHGA 4DPLA 3WFIA 3TZKA 3DBLB 2JAPA 3W8FA 5ICMA 4G5HA 3W8DA 3KYDB 3RJ5A 1T2EA 4E6PA 4FFOA 4I5GA 5CEEA 2ZQZA 3A1NA 3NEPX 4GVXA 3NYWA 3IP1A 4UUOA 1XQ1A 3C1OA 3DBVO 4WPGA 1JWAB 3F3SA 4D42A 1C14A 2G5CA 1TT5B 5HS6A 1NNUA 3JYOA 4D43A 5BNFA 3LQFA 5K1SA 2UVDA 2X1HA 2C7GA 3AJRA 3JCZA 3GAZA 4I9UA 4JBHA 1LSUA 2AXQA 3JV7A 1OFGA 3NAQA 4D0RA 3I1JA 1SZJG 5BR7A 1LDEA 3EMKA 2Q2WA 1D3AA 1KERA 3E82A 2VT2A 3WNQA 1HL3A 1AHHA 4J0FA 1A9ZA 4YJGB 2AEFA 1X7GA 1P1FA 1SC6A 4A5OA 3HN7A 4I5FA 4II2A 3F9IA 1NVTA 3IJRA 3H9UA 4MVJE 1E3JA 4NBRA 4I9NA 4MKXA 4J6FA 5GZ1A 1H2BA 2DPGA 4IXWA 3BMOB 5F5LA 3T4EA 4CL8A 5K0ZA 4ND5A 4OSPA 4M87A 4PFJA 2GR9A 4GGOA 4KUHA 1ZBQA 3H9EO 1AUPA 3PTZA 1BDBA 1EE2A 4W4TA 4ZQHA 4CM9D 2LDXA 2A9FA 3JQAB 2A94A 4R68A 4Z3DA 4E5NA 3DAFA 4Y6RA 4EJMA 3ANLA 1UDBA 1GPJA 3INGA 1XU9A 5C5IA 2GDZA 2DUUA 3MTJA 5KJ1A 3HJAA 2FPGA 2O3TA 4IQ8A 3ZU5A 2G1UA 3G17A 3BAZA 3HUDA 3KHUA 2IYPA 2P5YA 4YJHB 4CMGA 2E37A 4BNIA 3C3XA 4JK3A 1LLCA 2E4AA 2P4QA 3TJRA 3VZPA 1NQAO 2IXBA 4NFHA 4UUPA 2EGHA 3E6AA 3EGOA 4GQAA 4HUJA 4AJKA 5DBFA 1YS4A 3GK3A 1FF9A 1FDUA 1GCUA 3IJPA 1Y9AA 4DLAA 1U3TA 4CV3A 4YWJA 3M1AA 4D46A 1EVZA 3PGJA 2FWMX 1KEWA 5CFZA 4AJJA 2YHUA 3MWDB 2UUPA 4YQYA 3PI7A 3S8MA 2OL4A 2YW9A 3T4XA 3QE3A 2HMVA 1XEAA 3DFZA 3UVEA 4E2YA 5JXWA 3HDHA 5DT9A 4IDEA 1PEDA 4BO2A 2P9CA 4YAGA 4QFCA 1P0CA 2A92A 2JJYA 1LX6A 3FPLA 3PZRA 5TRTA 3UAGA 2PLAA 4PN3A 2D5CA 1UXIA 4RVGA 3L4SO 1YJ8A 3C85A 4BO7A 2J3JA 3DC2A 4RVHA 5A9SB 3W4JA 3RFTA 1IHYA 2QIOA 3HDJA 3D0OA 1NWHA 3Q9NA 4GAEA 3JQ8B 2PH5A 4CL3A 4OO3A 2EEZA 3AU8A 3U62A 2FR0A 5IN5A 2FHSA 3ZV4A 3I9OA 4E30A 4ZN6A 1O95A 1JAYA 2O7QA 4QO8A 3PDUA 2Q1WA 1RM4A 5THKA 1NR7A 2OP1A 2B4RO 1Y7TA 4PLFA 2EKPA 3BTUA 2CDCA 1P1KA 4HFMA 1JDJA 4NJMA 4MOWA 1UXJA 3K73O 3TRIA 5TNXA 4GX1A 4I5EA 3KM0A 2Q1UA 2V6BA 4L4XA 4RF2A 3NDIA 3VH3A 1ISFA 3FI9A 4WCDA 1WZIA 4XR9A 5IDYA 3UCFA 4R51A 1ZMTA 2VHYA 1X14A 4OKIA 3WLEA 2NACA 1ADGA 1E3IA 1ONNA 3QA9A 2EGGA 2UDPA 3AUAA 4LRSB 1I10A 3ZH2A 2IRWA 3O38A 1HF3A 4NMHA 1PL8A 5FF9A 1XYGA 3AM5A 1F8FA 1ZO8A 1ISJA 4M49A 3WX0A 3UOGA 4Y98A 1ISIA 3B1KA 1VJ1A 2JHFA 5KNLA 3H3FA 3VZRA 5FI5A 1G0OA 3LC1O 3ZWOA 3RU9A 1E6EA 1LDMA 5DP2A 4M55A 5I9NA 3LT2A 3L0DA 2Y1OA 1OC4A 3H65A 4XB1A 4CLXA 1X0VA 2HMUA 3WQSB 3ZNPA 4Q3EA 5DCYA 8LDHA 3Q11A 4YR9A 1ONPA 4PLWA 4ZU3A 1QMGA 3OIDA 2DBVO 4XX0A 3VTFA 5JCXA 5HWSA 4WE3A 1T1RA 4U8GA 1ZXLA 1Y9EA 4GMFA 1H6AA 1I0ZA 5TSDA 1NX6A 3SBOA 1S6YA 5G0VA 1A4UA 3I23A 5CDTA 1BWSA 4WUVA 1AXEA 4ND2A 3SC4A 5JMWA 4KDFA 5L4NA 2CF5A 4BGIA 1E7MA 3CZMA 4UAGA 1IOLA 1T26A 1RYDA 2PH3A 3V2UA 4BNHA 4H15A 2BI7A 3WYBA 1DRUA 4HY3A 5JAIA 3QSGA 4GWKA 4E5KA 3MJ4A 3TFOA 1ZW1A 1PZEA 4BMVA 4BO8A 4N7RA 5F3RA 5JLAA 1SCUA 2GZ2A 4XRGA 4EEXA 1E1NA 1U2DA 1ZK0A 4ND1A 2FN7A 1KVUA 2JD0A 4RDIA 3EK2A 1NM5A 2JFGA 2YDXA 1F06A 1LDGA 1OAAA 2DTDA 3OH8A 4IDBA 3VC7A 4CQMB 4R69A 2VNAA 2HJSA 4PGFA 1JWBB 2VUUA 3KXDA 1SEVA 1ZK1A 2R00A 1X13A 3QWIA 3RQSA 1GEGA 2PA3A 3GAFA 3LF2A 1Z75A 4OKNA 1T25A 1GZ3A 5I7SA 3QVXA 3WWYA 3U4DA 2J8ZA 1ADFA 1NQOA 5T67A 1N1EA 3GOHA 1YKFA 1H6DA 1MC4A 2VWQA 4YACA 1EUCA 3LC2O 3QP9A 4WLUA 1LSSA 3JQ7A 2GCGA 1HE5A 4CR7A 2Y0EA 3PDJA 1R4MB 1NXQA 1R0LA 2OOSA 4WNIA 4K9DA 4BKQA 1K6IA 1ZEMA 2BELA 2VHZA 4OH1A 1BSVA 2Q50A 3ANNA 4EITA 5ITVA 3WB9A 1TVEA 1S7CA 3D5QA 3QWHA 1WMAA 4A27A 1JAXA 1K5HA 4E2ZA 1XU7A 3ZDFA 1QLHA 4YJFA 4Z9FA 1UXHA 1RYEA 2W4QA 1ENOA 1WWKA 3DTYA 3H5AA 5CDYA 2H63A 4PRLA 4JP3A 4PZCA 2ZATA 4JP2A 4WCFC 2NTVA 1E7WA 1E1KA 4ZA2A 1B14A 1ZZEA 4HWKA 4PLVA 1DAPA 3BMCA 3CMCO 3HE3A 4E21A 1FK8A 3RUHA 1WLYA 3ZW9A 3VH1A 1PGJA 4U6QA 1A7AA 4FFLA 4WCFA 2BGLA 3CE6A 5CP8A 3OM9A 2V6GA 3EUWA 5K9ZA 4JLWA 4KQXA 5COBA 2I9PA 1QRRA 2VWPA 3GRPA 4HFJA 3LSYA 3BHIA 2JAHA 2F00A 3MJEA 4TQGA 3RI3A 4BVAA 2J5QA 3IMFA 1VJTA 2BLLA 5GY7A 3D7LA 4R16A 3TL3A 4IZHA 4UEKA 9LDBA 2CUKA 2HJRA 3AU9A 3PWZA 2OXIA 4HV4A 1L7EA 1OC2A 3KTDA 1CJCA 4D3FA 2X5OA 1LTHR 3H8VA 5L4LA 4CM5A 3GGOA 1QKIA 5ILGA 4DC1A 2VZ8A 3R3SA 4O6VA 4YRBA 1XSEA 1SMKA 3MEQA 1KY5A 4LMRA 4F3YA 3KSZO 1HLDA 3EYWA 4NPCA 1F12A 2YY7A 1VJ0A 3RSHA 3DHYA 3Q9UA 5JDIC 1T4BA 1YQXA 3OJLA 1HRDA 5F5NA 3ZWXA 4YAEA 3SJUA 5AQ1A 1B8VA 2NVBA 1VLLA 4ND3A 4HP8A 2VHWA 1G6KA 1EK6A 1UZLA 5JY6A 1N8KA 3GHYA 3UUWA 2SCUA 1PGOA 1FDSA 5KCZA 4Q39A 1X15A 5JCJD 5JCJA 5AXCA 4CM7A 1QXSA 1MXFA 1SB8A 4CPDA 1GTMA 1VL8A 4W82A 3B6ZA 2O3SA 4Y9DA 1YQDA 4PG7A 5JY1A 2GYYA 3BIOA 2ZKLA 3HQ4O 1PR9A 1W8DA 2BMAA 2QG4A 5EPOA 1K2WA 4GKVA 2YV2A 3ZNQA 2HKIA 2C2XA 1XHLA 5C3MA 3CEAA 2B0JA 1JU9A 4O5OA 1PZHA 3EZLA 3LLSA 2CMDA 4N54A 4JNKA 4CMHA 4CM3A 5JSFA 3NGLA 1K89A 4FW8A 4BNNA 5KJ6A 2OFPA 1ZXBA 5JAZA 4CUZA 1U5CA 1UDAA 3PLRA 1KVQA 5T5QA 1FXSA 2HAEA 4GX2A 4GLOA 4BNGA 4L73A 3JYNA 1ADBA 2O23A 4Z0TA 4K6CA 2DT5A 5DDIP 4IGEA 1SB9A 4UUMA 1E5LA 4LISA 2B69A 3LF1A 1N92A 1QP8A 5T8KC 4BO4A 2ILTA 3F47A 4FSHA 4CMEC 1KBZA 4DIOA 1YE3A 3ICPA 2VTEA 2O3QA 2G17A 3JTMA 4C7KA 3NDJA 2Y67A 4C7JA 4BV8A 3HWRA 4D45A 1D1TA 3HZZA 1Y5MA 3F1LA 3UFXA 3H2SA 1ZSYA 2J6IA 3ZNNA 1PZGA 4N5NA 3B20A 4D0SA 1KC3A 1PL6A 1EDZA 1T2FA 4R3NA 5T8KA 4BO1A 1KVSA 3PHHA 4CMEA 4IMRA 5COQA 2P2SA 3VAZA 4DBVO 4Z6KA 2DUWA 4WLEA 5CG2A 1P1JA 4IDCA 5DF1A 1MC5A 3HNPA 4AG3A
chains in the Genus database with same CATH superfamily
4WNYA 3Q40A 1QZZA 5CLQA 4D9IA 4BECA 1QZTA 3NHWA 3R8XA 2R751 4B6FA 5DBEX 2XDQB 2C9YA 2WVAA 4QEKA 4L9WA 1ISRA 2BW0A 1C50A 2I99A 2VP5A 4PLHA 3T1VA 2Y0CA 1NYTA 4FR0A 2REQA 2JEYA 4RNCA 5MFPA 3P9KA 5KCMA 1YK0A 2NUAA 3VH4A 4UBJA 2ZPAA 1EWYA 3ADKA 3DEJA 4CG1A 3W5VA 4DJEC 3TLGB 4DR2B 3GLHA 3OE7A 1UFRA 3TZCA 5K4HA 1YVEI 4FX2A 4N8DA 3ZUPA 4AJIA 3OZCA 5D3MA 3WADA 3DO8A 4C6TB 3AKZA 1WMSA 2IV2X 4AJEA 1HE2A 4MHTA 1OWNA 2Y1GA 2I91A 4NK4A 3ZK7A 1E96A 5GZ6A 5LP6B 1D6SA 3A32A 2HHLA 1L7MA 1YVRA 1HT0A 4UM7A 3WO0A 4A16A 4MPDA 1J0XO 3VKWA 2RGUA 4JT2A 3BK2A 2WU1A 2P69A 2GJ8A 3K9HA 4Q3BA 4QTXA 4MUIA 3NHJA 3QX8A 3RF6A 4B48A 4JLJA 1AB6A 1WV1A 2QNRA 4M88A 4XD7D 1GZHB 1GZ6A 2UZ3A 2Q2VA 1ZICA 2XTNA 3ZVNA 1FMLA 3SJBA 1Z5OA 1HRKA 4YT4A 4B76A 2WVGA 4CR6A 1FE8A 2DPXA 1F7UA 4ZT4A 2J6CA 4UHHA 3Q1LA 3R9IA 3OM1A 1S2GA 2ISSD 3FCYA 2PIDA 3OQJA 2ZCJA 3HU5A 4QFDA 5JS6A 4P92A 5DZSA 2RHOA 2X4GA 4B31A 3I8OA 4DLTA 4JI1B 4J91A 4Q4JA 4JSRA 5B5SA 1MFZA 1CQIA 3ZJUA 2E5FA 4JJ8A 2PGDA 3MJDA 4OSOA 1QORA 2HK8A 5CD9A 1F1JA 2D74A 3O8NA 1DKUA 4L51A 4JI7B 1C5KA 2P40A 2X3YA 4BAZA 1PS8A 1PWEA 1W5AA 5K51A 3CZQA 3LQKA 4ARUA 4DLSA 4IG4A 5A03A 1OV4A 3QOYA 4DV3B 4JOQA 4GUAA 1F60A 2NG1A 3ZEAA 3OT1B 3H84A 2R11A 3LRXA 3PJGA 1RWVA 4D8UA 5M04A 4BEBA 2XMSA 1XNRB 2ZUVA 4KMOA 3EOZA 1XPRA 4A1FA 3R7WA 4Z99A 4BMDA 1LC3A 3RW9A 4B7AA 4TVOA 4NARA 4N1AA 3P26A 4MIOA 2ZJOA 1V1MB 2F59A 1WXIA 4FMBB 4R5HA 1RC8A 1F5NA 3CNLA 1I4DD 5ALLA 3NU1A 1TF5A 1PBTA 2Q3DA 3KTOA 3LT5A 1JXMA 1E2FA 4MR7A 1U6KA 4TV8F 1SCUB 2O4UX 1ESCA 2RGDA 5LQRA 2NYVA 3K96A 1E89A 3A14A 2ZAOA 3KUCA 3FH0A 4OHRA 3GQBB 3DKIA 3T95A 2FZWA 4KTTE 3ZCXA 1FTYA 2X2FA 3VR1A 4DJFC 5TARA 1EVEA 3L4BC 3UHPA 2BGRA 3BFKA 3SAJA 3WL8A 1Z5VA 1NPTO 3GZ4A 2R7MA 4BKMA 5EUBA 3ORQA 5IN4A 3E3AA 5BV7A 4RY0A 4UATA 5DNUA 2PWPA 1T43A 4BMSA 2NO7A 2H4ZA 2H65A 4FHZA 2OTCA 3O1HB 3GRKA 2YMLA 1GRNA 1SG0A 3BH7A 3GD5A 5KEIA 4D4IA 2G0AA 1WQ4A 4D79A 4FYJA 3BXGA 2ACWA 3PZBA 4EI2A 1G7SA 2OOKA 1M67A 3W1WA 1P60A 5KC9A 2XZLA 1Z17A 1NE7A 3L5KA 2DFPA 4R2KA 1EGHA 2WU3A 4RLQA 4U5XA 3TI7A 3U3KA 1LZKA 3T99A 2PNJA 4YAIA 4MJXA 2PV0A 5EUMA 2VNHA 2O06A 2WINI 4Q5IA 3QNUA 1Y5RA 2ZSKA 5B1IA 2B4QA 2PPVA 2HRCA 1VZ3A 4EENA 2O0LA 3QTLA 4I4TB 2D1YA 4M9XA 3JQ7B 2HPZA 1O6BA 1Y6RA 2ADMA 1UWVA 4QXRA 3H42B 4RH3A 1U2ZA 3KHSA 1VPEA 2EVWX 3BF7A 1G7TA 3AOEA 5JI3E 1I9GA 2CE2X 1YOBA 2C97A 4FCTA 3V6LA 4B40A 5HZMA 2QSUA 3LQQA 1DFGA 2YN0A 3M34A 1YZYA 2WHYA 2Z9DA 3PQ7A 3N58A 1WZEA 3VR0A 3A31A 4C20A 3O4RA 4V2IA 4DDVA 4PEVA 1R4NA 5JMPA 1FP6A 4I55A 3CXRA 1JXQA 3NUZA 4OD0A 1YOVA 2ATXA 1JKMA 3NYIA 3NT5A 1XTZA 4HWSA 1IN7A 4HWGA 4I8DA 2QQ5A 3LLVA 5AM2A 4QBGB 5BSHA 5A0TA 5GJWC 5A5EA 1R7RA 3FR7A 3H2KA 3KVYA 2J9XB 4QOEA 4I1PA 2NO1A 1DT5A 2WNSA 5KBYA 4GDMA 1UPTA 5D5HA 5CCXA 3H6KA 1LKZA 4W6ZA 1JQLB 1U28A 4I36A 4PPNA 4KPYA 1BO6A 3BEOA 3CE9A 2RHDA 1HV8A 1L5SA 3GA5A 3SWWA 1PZMA 4AQDA 4QT0A 3QUTA 5JD3A 3VNSA 4NY1A 2QZ9A 2I1LA 3A3NA 2H1VA 4Y6PA 3QVUA 4A2PA 1RI3A 3NATA 3UCEA 1E9EA 2BJWA 1KI3A 1C0PA 6Q21A 2I7CA 1EHYA 1N2JA 1ZN8A 3CH6A 4JJ7A 4UFOA 1TEHA 3ITDA 1ZH6A 4RU1A 3DMHA 5FTLA 3J7AC 4L6AA 2WZDA 4UPDA 1U9IA 1FZTA 1UK7A 2R8RA 9ATCA 4M1WA 2PTHA 5C4IA 4Y67A 4TZ6A 3AEYA 4XCVA 4JXKA 4FT2A 2NZ2A 3UJPA 3VJMA 2AEJA 3R7AA 3F5DA 2IT1A 1K68A 1M2EA 4BX8A 4MQ6A 4EKNB 1HE3A 2C04A 1LVUA 1XAHA 1M8KA 2X40A 2ZUDA 1C7IA 2P2YA 4PX9A 3KL4A 4JZKA 3PWKA 4BNXA 4CCSA 1AMNA 3IH5A 4XQEA 1OWOA 2P62A 1P39A 4NENB 1FJ2A 3ITKA 3IS3A 1XMVA 1RAAA 2GAOA 2GN6A 4G1UC 4R40A 4MRNA 2VDWA 5FI1B 5TQ0A 2JJMA 2ID9A 2WYIA 1NVVR 4AF6A 4Z86A 4Z51A 1RZ3A 2C7OA 2DHRA 3UGJA 4BB9A 2XYHA 3E61A 2Y27A 3FPBA 4IIVA 5J5CA 3TD2A 3U4QA 5HQJA 1KRWA 3E22A 1DIAA 1GXSB 2QE7A 4X6XA 4C7OA 3K1AB 5JDCC 2VHVA 1EWQA 2FUNB 3IP7A 2BGWA 4BFWA 3EGDA 2D2XA 1SC1A 2XITA 3AWIA 3L18A 4RK0A 4O5AA 4CM4A 1A5BB 2H9AA 1Y5NA 3QVVA 4GEKA 1AK9A 3LAWA 1BOOA 1W6UA 2B3TA 4XQCA 4WY5A 5H3CA 3U9SA 5CAEA 3D81A 3NOQA 3L0SA 2WMYA 2Z8XA 4FK8A 1CFJA 1YJAA 1TIBA 5DPMA 2PS3A 1C8BA 3LX8A 4JXZA 2VUIB 3NVAA 3H18A 4O4IA 4WV3A 2ZP1A 4DSOA 2GA9A 4FNGA 2JHPA 4PX5A 4Y1EA 1CZOA 1R15A 2EFGA 2GZMA 2PT5A 3MJFA 2Q5LA 5EXTA 3ILXA 2G04A 5F7JA 3PHGA 4ZREA 4YLYA 5L7YA 2BGKA 1FFXA 1U4SA 3T54A 5FWYB 1SA0A 1TU4A 3U40A 1T3SA 1MFPA 1SUDA 1UKZA 2AZDA 3SIPA 2L18A 3A4YA 3CC8A 1YHNA 3U3DA 2GCEA 1C3VA 3H4VA 4PM4A 4OA8A 4UVGA 3ZD9A 1NMSA 4BFXA 1ULAA 4LE0A 5CA0F 1RRGA 4RIFA 5SZHB 4Z9XA 4HAXA 4IAOA 2XQJA 4TTSA 2OYRA 1RAFA 4GX5A 3DDOA 4HF7A 3WIDA 2G09A 1J2UA 4OGKA 1E61A 3KT0A 4DL9A 1M1YA 2I6SA 1QYDA 3BGOS 1XP8A 1XQXA 3PUIA 4HGRA 3HBMA 1ZBDA 4X66B 1K6XA 1I7DA 4MS4B 5TXGA 4IS2A 4TLCA 5BWNA 3DQQA 5LA6F 3LQYA 2P9GA 3ZQKA 2OCKA 3EEYA 3NXSA 2FG6C 2CD9A 1W88A 4N7JA 3NH6A 1GTJ1 1HYEA 1ZZGA 1TM2A 4GP7A 2QTBA 4C5AA 3GGDA 3WL3A 2W93A 5JZBA 3KSDO 4D1YA 2GN8A 2QS9A 4DC0A 1DL5A 4MK4A 5DKFA 5JO0A 2OAEA 3PRKE 3NEYA 5TY0A 4BGEA 3NC4A 3DZIA 2ZYGA 5SZJA 4DQVA 2R6DA 4MVYA 5JNVA 1F6DA 3GEHA 1YCHA 3KAQA 4AAYA 4LZPA 3SHVA 1CZNA 4J2TA 2GXQA 1GV1A 1ZKMA 1L5VA 2O8BA 2V1XA 1TRKA 3IC5A 4UEWA 2C9ZA 4JFRA 3QVOA 3UXHA 3FMIA 4LOAA 4XB2A 1GL7A 3V4ZA 4Y2SA 3FUVA 3ND9A 2VDVE 3EGXA 1P44A 3MTBA 4GSLA 3TZHA 4M53A 4EAAA 5LQJA 2VBCA 3ABZA 3VO9A 3ZDAA 2JLVA 3CPHA 1T2DA 1KL7A 4O1IA 5A5FA 5FL7D 3RSQA 3BBLA 4XA8A 3T9FA 1Y33E 3W4KA 2LD4A 4IHKA 1TEZA 4AMVA 5A7GA 2WMDA 2ZYUX 1UEXC 4L5CA 5HUHA 1QVZA 4U2KA 5I4KA 5TIIA 4IQ4A 1Y6JA 1J99A 2W8BA 4Q05A 1CVRA 2WE7A 3AY7A 4S1NA 5K6AA 5H81A 3SZMA 2EC5A 2EJWA 5AVSA 4HO1X 2AJBA 3KKKA 2QJTA 1XEWX 2VYVD 3VHXA 1B6TA 4DWOA 1HYHA 5KX5B 4N48A 4ZAZA 1QOQB 3S5JA 3NBFA 1IFXA 3DBHA 1MU0A 1VE6A 1Z15A 2C2OA 1PJ8A 3DV0A 3ER6A 3RUEA 4QKQA 1WCV1 5EJ6A 2MHCA 4DCMA 4EATA 4EHKA 1G21A 2CFCA 1R16A 1TA9A 1P4HA 4MS1A 2X2EA 4F3TA 1WHSB 2FNAA 1P7CA 2CVZA 3ISTA 5FPTA 2BSXA 1GDDA 2D0OB 2ODEA 4OI2A 3EQ9A 3LFTA 5ALNA 1QG6A 4FGLA 3EGEA 4RD3A 1ZVJA 1NBIA 1WMEA 1ZUHA 2HC9A 2NZVG 4WNCA 5EXSA 2QE6A 5BQXA 3JRNA 1QIGA 4PRYA 1SXQA 1RXCA 3Q8WA 3CLSD 4Q4AA 3ZX4A 4POOA 1XVUA 2GEFA 3E9MA 2VG8A 3O94A 4DWVA 3MTQA 3ORRA 3GELA 4IRXA 5A4AA 4DA6A 4U0JA 1X1DA 2G1PA 1XVIA 1NJ8A 1EBUA 3QKSB 2JEOA 4I1RA 5TV2A 4AKEA 3ZHSA 1K6MA 4WEQA 3BRWD 2DWOA 3FUWA 3G3EA 1A96A 1L7QA 2Z2XA 5IAKA 1U2DC 2JH9A 4ZKEA 2FPPB 1C9YA 1RLOA 3KVOA 1DO2A 4LW8A 2FB9A 1MV8A 4EO4A 2O8FA 1Z4PX 4I1VA 3M4JA 4U3JA 2HMWA 1JEJA 2WFZA 1NVXQ 3U6BA 1FYFA 2UUOA 2Y4NA 2Q4EA 3I32A 4A9AA 2QBYA 4X8MA 1JQ5A 3X1MA 2R00C 2YX1A 3R8CA 1NRXA 4LCJA 4NV0A 3ZHUA 3M9LA 4E1BA 4YT5A 2VJOA 3GJTA 4QE3A 2NT3A 3ZJTA 1A82A 5CFNA 3GPLA 2ILVA 2X15A 4CLRA 1D9XA 4P5DA 1Y9JA 3V97A 4L8LA 3GNSA 2ZRBA 2IBMA 1ZW6A 3SZOA 4J0DA 1MVLA 1TM1E 2WD7B 4GYYA 4FDVA 1FFCA 4LXHA 1BX0A 3UPTA 4QT4A 4ZVQA 1FQOA 4B7XA 1OTXA 1Q16A 1LBQA 2PVPA 2ON6A 2QXTA 4M0UA 4E11A 4MINA 2XUGA 4FGSA 2IHVA 1LX7A 3M6IA 3D64A 2XXAA 4TKLA 2JHGA 4FUQA 4L8WB 4UHFA 5LKAA 5ESXA 1PNQA 1PEYA 2XWQA 3E7WA 5DP1A 4LXGA 3A2KA 1TTHA 5JANA 4GBMA 5D2CA 1ADCA 3D5TA 5CW2A 1FMCA 3DWGA 2RIPA 4M6WA 4CQLB 3W1EA 2I2DA 1SZDA 2LNDA 3MSCA 4EB6B 1F4LA 2ID7A 4O4JF 1I6WA 4YDRA 4LRQA 3UANA 3L7BA 1NUTA 5F73A 3UF0A 2ST1A 4DEXA 5JYBA 5LSAA 2PSFA 1YB1A 4LHSA 1EJBA 4K9LA 2QEQA 4FC6A 5D00A 4BDTA 2ASEA 6ABPA 1RMQA 2XYQA 2DHDA 5EL0A 1G0NA 2WWXA 5TT0A 3NMUF 4HKTA 3J80A 2W2KA 1U4OA 2BM0A 2JIPA 4TN5A 3U4GA 1KK0A 3D0QA 1M7GA 4G2NA 2XXJA 2RE8A 2IE0A 4ZQFA 1A5SB 1P3DA 1WQ3A 1XVVA 2X5NA 2XMQA 1QYXA 4GWLA 2PUVA 4QTTB 5CIQA 1DLIA 3AVWA 1FRVA 1ZUNA 3BL6A 1JIQA 1MJNA 4MLCA 1DOHA 3DSRA 1BS1A 3T5MA 2F1KA 4RVUA 3T94A 2GYWA 2GBPA 3K5WA 4IWYA 2IZZA 2HO5A 5JAHA 1D2AA 2UYOA 4OGGA 4B71A 4PLGA 4E7PA 4DSTA 3T0FA 4JGGA 1E20A 2V3WA 3NP7A 3KZNA 5ADVA 3EZ6A 4ENQA 1OH8A 1H8ED 1RWOA 5KYNA 4ITVA 2PRJA 3CEJA 1PLJA 2R47A 2H57A 3EARA 3HKBA 2QN8A 4XFDA 4YN3A 2Q3EA 3M6VA 2ZULA 4MUGA 4Z7NB 5FUQA 3ROFA 1VI5A 3K8QA 1JKJB 3UMBA 3MS7A 3EAGA 1D07A 1PJ2A 3SMVA 2XB4A 2Y93A 2AVNA 2ZJFA 1TTQB 1UAGA 1W0JA 1D09A 5U1PA 1NI5A 4P6VF 4BYGA 5IHXA 3K6SB 4ENVA 3IESA 3MW8A 4N82A 1ECPA 1UIMA 2IPOA 2O0HA 1HO3A 4P4TA 1G8KA 1EUYA 4PZAA 3WG9A 4BMXA 3BTVA 1C9JA 4IUYA 1D5CA 2D62A 3QUCA 1AS3A 1P1HA 2HZBA 3LIIA 2BE9A 2DULA 1KKUA 2I6XA 3OJCA 3PFBA 3Q98A 4RQAA 3C8HA 4UE6A 4CL0A 3VPFA 3EBOA 4WX2B 3G1UA 2YICA 4NJOA 1UJ2A 3KNZA 3N0RA 3T6KA 4GL4A 4J0HA 4RLHA 4TUYF 5EAIA 5DYGA 5B4UA 1E3EA 4AKIA 3DZJA 1C3OB 1V11B 1YRQA 4AJLA 1F2TA 1ZI8A 2BYTA 3S2YA 1GUZA 3HADA 3B1VA 2BFMA 4EMBA 4F4FA 2DH6A 2ODQA 2I7DA 1NJFA 2GB4A 2JZOA 2INGX 2AW3A 2IYWA 2JH3A 3B1XA 4PSAA 4ZOQI 3AP3A 2B37A 3C45A 3H4MA 3CF6R 3MBKA 4PLYA 2DFDA 2ECOA 2CZQA 4YS6A 3R76A 2YHIA 4W1SA 2CK3A 1PV1A 4NPHA 3GR6A 4RKFA 3RFUA 2B83A 2C07A 1QJCA 5DASA 1EXDA 2JCGA 2QRLA 3L07A 2ZIXB 4I4CA 1B3RA 4COKA 4X00A 3P9YA 3TE7A 1UP4A 1E6LA 1V48A 5KDOA 3CVUA 2FRDC 3OHMA 3FWNA 3GEEA 2BFCB 4XGIA 5DBOA 1ECGA 3EX7C 1DQPA 3IIEA 4HQ6A 4N9WA 1FW8A 2QRJA 1I7LA 1ZMOA 4GGPA 4K6OA 3WSWA 1KEUA 2J0VA 3K30A 5CTJA 5JS8A 1BMFA 4I1UA 2IYFA 2V74B 5DLYA 1GNQA 4JP1A 4DYVA 1CRLA 4TV8B 1KFKB 3COYA 1KYIA 1ZMXA 4MJLA 5LC1A 2YIDA 4P80A 5CUQA 4KFCA 2C78A 3TM5A 3VGJA 4L76A 4PWYA 4EUFA 1LBIA 1EQAA 1XXLA 4GI1A 1ZIXA 1G7CA 1VL2A 5TDHA 1CRPA 5CPFA 3G2JA 2EF1A 4HTFA 5F1PA 3GFSA 3IODA 3NIWA 3PUYA 2H8GA 5DCWA 1X7ZB 3SSOA 3FCOA 1L5LA 1T9DA 2IDMA 3WOVA 3LTEA 3PQ3A 3HCPA 5BQFA 3HBFA 1O4VA 1U7HA 3GT4A 3ZQ6A 3O74A 2ZXFA 1R5OA 4MRMB 4YT2A 5KHOC 1ZNQO 4FDTA 3UBMA 4F6LA 1VSVA 1FX0A 1CDZA 3DLBA 1LQUA 2WUWE 2IJGX 4CUJA 4KQFA 1X1QA 2D00A 1E2PA 2AEEA 3FETA 4DXDA 3C43A 2XRZA 3IXLA 1NKTA 5JRJA 2P3LA 1V1JA 2NQTA 3W5UA 2V9ZA 2W2LD 5KAMA 2QTFA 5E6SB 3SLGA 2FWRA 1RPTA 3HXLA 1DRVA 4PZ9A 4X97A 4LNAA 3OBBA 4R8VA 3S29A 3VUEA 3W5IA 1MRSA 3O4GA 1E64A 3WLHA 4XVUA 2FOLA 1UPAA 2ZYRA 4GDFA 1ECFA 3C3BA 2QZSA 2EW8A 3CNNA 3NIDB 3LC7O 1L7NA 2EQ5A 3LPCA 1EI9A 2P4HX 1D2CA 2BKEA 5LP1A 2C57A 4V02A 3I9LA 3TD9A 2W6IA 4I5DA 5HTKA 2CHEA 3UUGA 5HMLA 4TZKA 3U4CA 1FJXA 4B4OA 3PF9A 5CLJA 1H5NA 2QGFA 5K8IA 1EFKA 5LOVF 3B38A 3I2GA 3RYCB 3GFRA 3PGMA 3QLEA 1IY8A 5ESRA 4MUNA 1MF7A 1NUUA 3RGGA 4RK6A 2H5JA 2NVUA 5GJVC 1CY0A 4TYPA 2P9EA 5LWQA 3VX4A 2AJTA 4FYVA 1G59A 4JI8B 4PZDA 1YH3A 1DMSA 1GNTA 1H0KA 1Z34A 2FPXA 2PMBA 2PU5A 2XMBA 3CY6A 1AQIA 4KIFA 4IIHA 4MV9A 2W90A 4CMIB 4QD3A 4U2GA 4UNRA 2R6HA 1ZQ1A 4N03A 4FXOA 3B12A 3BSYA 2C95A 4QJ4A 5HILA 4YV0A 3UWMA 3QM1A 3EODA 4G5FA 3IEUA 4B34A 1ARZA 1JFFB 1WZUA 3BIJA 2QN2A 1ZWKA 3AVTA 3L1JA 4EY6A 1HA3A 1Z9BA 3ST7A 2BCEA 1V6SA 5H9WA 1LSJA 2IU4A 2OCDA 3DOEA 4MMXB 5F3WB 2QX4A 1G63A 1NC1A 2D1QA 2QG9A 5CK5A 4ZVVA 2C2MA 5FBQB 1QLWA 3HH8A 1DTWA 2PL9A 3L8ZA 4ROSA 5DTJA 3SP1A 4B8ZA 2JLUA 1JNYA 3VMMA 2CUZA 1RAGA 3DOCA 4PBTA 5ALEA 3SQWA 4RTMA 3K9LA 2HXSA 4UW9A 1I2BA 5CXQA 1CUHA 1LB1B 2IKQA 3AK4A 3HB7A 3NWEA 4HRXA 3LM8A 3P32A 4K46A 5H83A 2QYSA 3W2IA 4L16A 1P0QA 1Z8HA 4OIMA 2D0IA 3FM9A 4EFKA 1E3WA 2ZBDA 5CM9C 4C4YA 3HEMA 2EWMA 4QLBA 4PC7A 1ODLA 2ASVA 1SBHA 2VBIA 2OHGA 4KR0A 2BKLA 3FMPB 4P4SA 5ITZB 3NR2A 1IEVA 3NHKA 4IY1A 3JQGA 1CE8B 2CXPA 1VA5A 4L4SA 2O0KA 1Q7EA 4PSDA 3WI7A 4H77A 4LVOA 2HB6A 4G0PA 2EOAA 3BMQA 3DV9A 7ADHA 3ME5A 9LDTA 2E4VA 3L6UA 5EMJA 3WDSA 3CRNA 1TAHA 3INRA 1UBLS 1ZHOA 3ZD8A 3U13A 4RD2A 1BHSA 1U3UA 3LYAA 4MS3B 4YP7A 1VDMA 2JFPA 3BH6A 3ANXA 3WL5A 2REOA 5LMUB 1DBSA 1UBHS 3P9CA 4YCCA 2ZZMA 1BXGB 3EEOA 4KZPA 1VSTA 2P9FA 4N3GA 3UV7A 1OZ0A 3AJAA 3ICQB 3HDYA 3HXKA 4LOHA 1V16A 4I7EA 3HBAA 3W5AA 1EEXB 2J3IA 4UTRA 3R8FA 1QTIA 1ZN7A 1IY2A 1YMQA 2QD1A 2XT0A 3NAZA 1ZR4A 3GB9A 1N7HA 4EW1A 3K0SA 4RUKA 3PWSA 5H8WA 1LF0A 3MTGA 3QF7A 1HXHA 1HQYE 1OAKA 3PFKA 4KRGA 4D7AA 3N2GA 5E2IA 3T61A 3ZLVA 1TYCA 5M34A 5FAXA 4C2BA 1FYEA 1SBIA 1XA3A 3DXZA 3FKSD 4OHBA 3O03A 2GD1O 4XLZA 4L9RA 5L3QB 3UGTA 3SXUA 5AOAA 5DISB 1KEEA 4OU5A 4Q3DA 4D4LA 4UAJA 4LRTB 3VVLA 4OK6A 4C5BA 4CLOA 2PWBA 2WWVD 1Y7LA 1YE8A 1OF1A 4PQRA 2BZSA 1GM5A 4NDAA 3SVTA 5B6PA 2ZM5A 4RPKA 5C8VA 5K5EA 4B81A 1P7WA 1SIOA 4RPHA 1G3QA 4INPA 8AT1A 4WY8A 1JALA 5H82A 2WF6A 4JBWA 2ONZA 2X4LA 2FKAA 2PQ0A 3B3JA 3KEGA 3MCUA 4CM8B 1XRQA 1MBZA 3W05A 1NDQA 1NHWA 4DCNA 5L8VA 2FX3A 3COSA 2UKDA 3KBOA 5TVKA 1P8JA 1PJSA 3C39A 3MZ0A 2W2NA 1XQYA 2FDCA 4WTOA 3R3WA 3DKVA 2VHUA 4LY9A 2OA0A 2QNIA 1NFFA 4MW9A 1TMKA 3VH2A 3C8DA 4C4XA 3ZDDA 3U4IA 4DQDA 3F7OA 4AC9A 2PD4A 4HG2A 4ASUA 3ABIA 1CJMA 3JU3A 3D7NA 4E08A 2DX7A 4LSGA 2PT6A 1ZNWA 2GJKA 3GROA 2GJAA 3ZXYA 1E98A 1K06A 2DRIA 4BBZA 1NGSA 5FX2A 2YYZA 5BUCA 4HDAA 4L95C 4PR3A 3VR6H 1AZSC 5IBRA 2J9FA 4OU4A 3O8QA 1DBIA 4Z3OA 5TQ2B 3ICOA 1YTLA 3MRXA 4Q9KA 3L8FA 3PUHA 3F6YA 5B2EA 4GMXA 3SR4A 3A70A 1BZYA 2O19A 3OX1A 1E2HA 1JF8A 3UGKA 4OQFA 3G8YA 4C7MA 3JXEA 2VF4X 4TLBA 1KMNA 4KXVA 1CG6A 1KFCB 1LJUA 2WAAA 5J2UA 4PCUA 1CUAA 4Z4GA 4KB5A 2VXYA 4HNQA 3G5UA 4LKRA 4X7MA 2TMKA 3LK7A 4Y30A 3CIOA 3LV8A 1EK5A 4RM3A 2W8ZA 1X7WB 2ADOA 4KAAA 4X1KB 2OQ2A 2QRNA 4JYZA 3X1DA 3ZGXA 1KPGA 2E9SA 4EBFA 1I7PA 1VLMA 1JGTA 4JQYA 1C30A 5A4IS 2BR4A 2RC6A 5ENDA 1T91A 2HK9A 3KQOA 4JDPA 2B25A 4NECA 1RWPA 3E2MA 5DGDA 4KR2A 4NXMB 2HCJB 2NYAA 3JYLA 1GYPA 3R5KA 1FXWF 1GOTA 2VHEA 2OGUA 3IOMA 2XKKA 3L84A 3IUSA 4GFDA 3MSXA 3VSDA 3VO1A 3UKOA 4HSEA 5ALVA 1SHTX 3AERA 2EWVA 3LBHA 1RXEA 3EZ9A 4CT0A 4RSHA 4S24A 5HQ3B 3S27A 4ZV7A 5ISMA 1UZMA 2H5EA 4BLSA 2WYWA 3H5VA 2SICE 3AEUA 5GONA 5GM1A 2WWRA 4A8JA 4V1CA 3V4PB 1EVQA 3E1KA 1GUYA 4P33A 3I0MA 1QM5A 3TH5A 5HKLA 1MOSA 5TQVA 3B2EA 3F4BA 3FSGD 3IP5A 3QE0A 4HX5A 1E3DA 1YBAA 2NAPA 4Q7LA 4UDOA 5EY5B 2OPHA 3RRXA 2C3YA 1IL0A 4H4DA 4BO3A 4LC0A 3NHMA 2ECKA 3WL7A 1EX9A 2L82A 4IFBA 2CFRA 3CH4B 4MCJA 3LZ6A 1G18A 1YQGA 3HYCA 3TSWA 1PQUA 4PFKA 5G3YA 4BQPA 5K3EA 1U0OC 3UC5A 1GFWA 5BRNA 3ZE9A 1P7VA 1YE5A 2I8CA 2MMCA 3AI3A 1PK8A 1B8NA 3TIIA 4QM6A 2KW5A 3P9RA 3HKEB 1A2KC 1OBHA 4RL4A 2PH1A 4IYJA 1FL9A 3F9CA 2WIBA 3I6ZA 5B1DA 2N46A 4FFVA 1YC2A 3GEGA 4MV4A 3IEVA 3SHFA 1D4ZA 5BQ3A 2ZJ5A 4Y9RA 2UVPB 2FZKA 5BUQA 3H3XA 1V8ZA 1JB1A 2BEWA 4RL6A 4Q9IA 1XMPA 1I32A 4REOA 1CF9A 4BBJA 2GAIA 3PDWA 1QHHB 2AJ8A 2NZXA 3T8YA 4BOYA 5TMPA 1TK9A 2UXDB 2B8JA 3UNXA 4D41A 4YMUA 1U8AA 2CDBA 3PNSA 1ZESA 5DOVA 2L42A 3SX0A 5LDDC 1VE9A 2AYZA 3IHTA 3KFLA 3CEPB 1JEOA 5FWXB 4U5QA 1NAIA 4FFMA 1X39A 4XYGA 2AN9A 2BBOA 2FMTA 2ERCA 2GD0A 2QTTA 1KI6A 1HTBA 5DLPA 1FC0A 5DRTA 2BMFA 2C2ZA 1SZCA 3TLAA 4UDXX 2LKDA 1YHYA 3EUAA 4YJ3F 3ETDA 3F4LA 5HMMA 1NXXA 3NHYA 1W73A 2ZROA 5B2FA 3FTQA 4I19A 3SD7A 3GLVA 1Z37A 1KI9A 1B0AA 1L6IA 1OSNA 4JYMA 4NZZA 4EB0A 3W9YA 2Q5QA 1IZ8A 2MIIA 4OB6A 2WICA 2OB2A 2WUGA 4FW9A 1VB3A 4S0ZA 1A27A 5G3ZA 4JOBA 4KIJA 5BN4B 4M9QA 1ORDA 4YRAA 4ECEA 4ZCTA 2ZIWB 3UT6A 3ZWVA 1JPJA 4YUZA 1FP1D 5A7HA 1JYFA 2OV3A 4E4YA 1Y34E 4N7BA 2I4MA 1IOWA 2Y92A 1MORA 1R0BA 1A4XA 3NTLA 2LWIA 4OY3A 2NMVA 1J1ZA 3KOUA 1F14A 5BNZA 3KB1A 4XWYA 2RD2A 4NMLA 5KO2A 3KOOA 3RADC 3WWDA 2JATA 1TQ4A 1Z29A 2X8JB 2WP8J 3AR2A 4WFJA 1K4MA 1ORRA 2BR5A 2WWIA 1S4MA 3BXHA 2V7TA 1CXZA 1QO9A 3KJQA 3OY2A 5KHLB 4U02A 2H1HA 2AOUB 1FDWA 1G41A 2R1ZA 4MV0A 4L0MA 3T5BA 1QG0A 2PMWB 4L50A 4BO0A 3JZMA 2YFKA 3TZLA 4XARA 3B7GA 4J0CA 2XCIA 3IIJA 3GJ6A 3KYCA 1TLLA 2GEBA 2RG1A 2AMFA 3PHCA 2BJHA 3QHPA 4BLRA 5MHTA 2IPAB 3KOZA 1Z0KA 3WP0A 4OXXA 4YECA 1JG1A 1C3LA 5HBRA 4HXGA 3DDWA 4RPLA 4ZIRB 1MQ9A 4OVKA 1CRQA 1F2VA 2IEDA 1SCDA 2VF8A 1JJIA 4BNKA 3H4IA 3LX4A 1Q20A 1YVDA 3DLAA 4DNOA 2V58A 3CN9A 1OB2A 2XD9A 5FA8A 2QTRA 3EA0A 1XCJA 3GH1A 2GAJA 2VK2A 3MWJA 3QVGA 1QDUA 4MCAA 4UC0A 1B1CA 1CDDA 5FFFA 1PYOA 4M89A 4DCVA 4YRIA 1Y8QA 4LHXA 4RO0A 2F3QA 5H7XA 1HEUA 5HFJA 4PAOA 2JAWA 3QVSA 1PGNA 3PQ5A 1ZU4A 4TT3A 4GZ5A 4LF6B 1SRQA 3M2TA 3FUUA 1UC8A 1O5IA 2WHXA 1M9NA 2OSVA 2BP7A 1M5UA 5FDFA 4L02A 3VYRB 3FAZA 2J31A 1W44A 1BXZA 3GN2A 1HWYA 4RJTA 4GVLA 5L45A 2P7HA 3NTRA 4X8HA 4Y1GA 3L8YA 3MXOA 2YZ7A 4E5SA 2EIXA 1UPBA 4OAPA 2JGRA 4YTEA 3W06A 3PEWA 2ZJ0A 2Z4SA 1P4RA 5IM4A 1JDVA 3L6BA 2B9EA 3GMSA 3NORA 3OWXA 2PZKA 3ESQA 4HTAA 4I50A 4WFKA 1JDBC 1ZGZA 2C8JA 4NICA 4WXMA 2CHVA 2BKAA 1TRHA 2IYZA 4L3WA 4UHBA 1CTQA 1KZ9A 1EFDN 1YDEA 1Z28A 2QRVA 3IFSA 3NASA 2J87A 4JVMA 4S3MA 4LFCB 3UMCA 3IKTA 2RHJA 1DFIA 1JQAA 2VP0A 5G0TA 4MDFA 3HN2A 2BGNA 3ROEA 1LRJA 4AUMA 4RACA 1H3EA 1HI9A 2C5FA 1G8GA 4PXSA 4Y1RB 2K2WA 4BNMA 4P54A 3GEIA 1A9XB 2PGIA 1P91A 1S2MA 3VPBA 2WKQA 4BNVA 3L8HA 4O63O 3O0DA 4ZI2A 4K28A 3AI2A 2QGZA 1V41E 2PKWA 1Q21A 3D4NA 3MJCA 3NIBA 4JBNA 2YCBA 4FZ5A 2JGDB 4LAFA 2GUWA 1YJ5A 1X8JA 1PT7A 5LJLA 5I8WA 2IXEA 3W6PA 3HL4A 1M6YA 3GYBA 1RXUA 2GZ3A 3OU2A 4X41A 4ALMA 1L5FA 7MHTA 1VKRA 2QD2A 3G02A 5J1SB 1B74A 1ZRSA 4UEQA 1DAOA 1RRKA 4B1FA 4FCVA 2UV8A 5IAJA 3R3YA 4YLEA 1EUDB 2GK4A 3BXXA 1C3EA 3K0KA 3NETA 1ZD3A 3MJTA 4WL0A 1KYXA 2RHCA 4YQFA 4HNUA 4ZGWA 1XEXA 4DUZB 3AONB 3BULA 2C4NA 4N9QA 1SRRA 4CKBA 4B3MB 3CW9A 4MIEA 1E2EA 1DXOA 3M4XA 3WK9A 2ZSEA 5HJ5A 4L6IA 3FVTA 3TIXB 1EINA 1GLVA 2HMYB 3N8IA 4NDZA 4J0KA 1QQTA 4URXR 4E03A 3JSAA 1JKIA 2GKOA 2PZLA 3CSDA 1H05A 1MKYA 1NP7A 2VPTA 3TVDA 3RUAA 3T9AA 1ENPA 1Q1ZA 4QJBA 1O57A 1GQYA 1VE1A 4CIVA 3VR5H 3SJ7A 2HA4A 3QLUA 3VNRA 1GY8A 5A2QA 2VOEA 3JPWA 4QTZA 3MWFA 1DCFA 1N8NA 3R1IA 4MWGA 4RHXA 1JJVA 5DNEA 4YPOA 1BJTA 4HBZA 1JLKA 2O14A 2ZIAA 1UMKA 4FINA 5EJ9A 1XPOA 3ZCQA 2X8BA 3M6WA 1BVUA 1EFAA 2GOYA 1RQXA 2Y76A 3CRMA 4YP6A 1A9SA 2I6QA 2XZPA 3FKQA 1MQ8B 5G2OA 2PFGA 2GF0A 2QP4A 3CF4A 3DBIA 1N2CB 3U7JA 4BX0A 1MB3A 5EJMA 3BT7A 1PJBA 2FHPA 1EP3B 3IL2A 5IWCA 1JP7A 3CUUA 4JBIA 4NBWA 2J9ZB 1G20B 5IDWA 4U7HA 3GPBA 4EK9A 4IIYA 1J5EB 4BMOB 2LDBA 3I9MA 3JR3A 4BFVA 5DRYA 5GJBA 4EMSA 3LGSA 4UE2A 3P5BA 1NN1A 1UBUS 4OHUA 3W04A 2VHXA 3G8BA 1MQAA 1Q5PA 2JNWA 1IHUA 3AIIA 1EXNA 3INNA 5JFOA 3P27A 1J8MF 2D1RA 5HVNA 1XCGB 4B4UA 1MOQA 1M7BA 2NAFA 2NZWA 2YZKA 4ALNA 2JI4A 2WYVA 4GF5A 3RE1A 4TVBA 2IPLA 3IEXA 3V1KA 4EHBA 2HPHA 3ET5A 3L4EA 4BC0A 4OQEA 4X7BA 4RCVA 4ZC1A 4G5GA 3H11B 3PCTA 4QNRA 1A2BA 2FEPA 3QIVA 5BVHA 4BVLA 5E9JA 4BXOA 2ID8A 1O77A 2CMGA 4PZYA 4QPZA 2G82A 2J5XA 3PPIA 1O94A 1P3Y1 1UM9A 1WKVA 1U2GA 4WMLA 5BSVA 4RQUA 3CNHA 3DHNA 2C5SA 1STOA 2QD3A 1SKYE 5EE5B 6GPBA 5ALFA 2PSHA 1KJJA 1ANKA 3KT3A 1MUUA 2FLWA 3VPXA 5HRCA 2JBAA 3S2UA 1I4OA 3JASA 3P9SA 3WLSA 3DWIA 3QE2A 1J25A 1K8QA 1TT5A 2QL7A 5IH3A 3UJ7A 1RYNA 1WG8A 1GNPA 1GD1O 5C7LO 4J0IA 3M7IA 1WBJB 3GT7A 3GPCA 4NBNA 5TPZA 5A5GA 5HJ7A 4DWJA 3IEIA 4RD1A 4HDMA 3V2HA 4HQFA 1QC5A 4HC4A 2I7XA 4OQNA 4DTCA 2VP4A 3JWGA 3FW1A 3QOXA 5L4SA 1JUDA 3HSSA 2BTQA 4LBYA 2A0KA 3VR2A 4F7WA 4MW2A 2XZTA 3C5VA 2JGIA 3DGFC 1TNDA 1JI3A 5DGTA 5BNWA 2IYAA 4ZMRA 3VSEA 1E1QD 3RASA 2JLYA 1JHUA 3KB6A 4ETMA 4JUBA 1WS6A 3C3JA 1ZUD1 1TA4A 1WSDA 1LW6E 2G0NA 1X94A 1R00A 2H5LA 2P6OA 2BC9A 2IDKA 3LD9A 5CITA 1XU4A 4RPGA 4L07A 5LQAA 1C29B 2HA3A 3OKAA 4FBGA 3BMOA 3FNEA 4LEIA 5GVRA 3C3WA 1S9HA 2C1XA 3FDXA 4OQXA 1KZ1A 2FEWB 4R41A 4D3YA 4P0TA 3KS9A 3HGTA 5C7IO 1U2RA 2BH9A 3NM6B 4GQBA 2Q49A 4D44A 1MJGM 3D4BA 1ORHA 5IAGA 4Z0PA 3RCBA 2J45A 1E79D 3AFMA 3T38A 3JQAA 4TMYA 2QTVB 2HTFA 1XFDA 2HRBA 2GZ1A 1IZ9A 3EVTA 5B2ZA 2JZNA 4W9RA 1JHAA 1C7EA 1VI2A 2B30A 4A0GA 1YU6A 3HK2A 4MV5A 4DCOA 1YQEA 2WF7A 3UXEA 4DVGA 3BG5A 4EBBA 3OLWA 2XUJA 2Y1FA 1B76A 1ZDMA 4GMHA 2VDLB 4TRMA 4V0ME 1K7SN 2ZK7A 2A8YA 4A2WA 1UF9A 2H08A 3MMZA 3H7IA 3ABRB 4NNPA 4NZMA 5DX1A 1OYYA 4OI1A 3HPQA 2QRKA 2E5LB 1WW2A 1OE0A 5FKJA 3D0KA 2R5WA 1J2JA 1PLKA 1IJEA 3A6GA 1TPZA 1CJUC 3Q5DA 4R81A 2JLXA 1NNSA 1XZHA 4M9SA 1T0UA 4KIUA 4D4KA 2ACVA 1BE0A 2HJ9A 3DH0A 3E3LA 3GBSA 3KKQA 2P3QA 3PDIB 4E4TA 1OIXA 4CKCB 1V4VA 2XD4A 2BFWA 2X14A 4Q19A 3OZEA 4M1EA 4OUDB 2FPKA 1KI2A 3F8SA 1XVLA 2XPCA 2Q3FA 4IIGA 1RJWA 4WHMA 5AMXA 3Q8XB 3Q88A 4Y2JA 3N2YA 1U8YA 5FAKA 4FUTA 4X95A 2XZOA 2FWJA 1VP9A