3GAZA

Crystal structure of an alcohol dehydrogenase superfamily protein from novosphingobium aromaticivorans
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
331
structure length
331
Chain Sequence
PTMIAAVVEEANGPFVLRKLARPQPAPGQVLVQIEASGTNPLDAKIRAGEAPHAQQPLPAILGMDLAGTVVAVGPEVDSFRVGDAVFGLTGGVGGLQGTHAQFAAVDARLLASKPAALTMRQASVLPLVFITAWEGLVDRAQVQDGQTVLIQGGGGGVGHVAIQIALARGARVFATARGSDLEYVRDLGATPIDASREPEDYAAEHTAGQGFDLVYDTLGGPVLDASFSAVKRFGHVVSCLGWGTHKLAPLSFKQATYSGVFTLHTLLANEGLAHFGEMLREADALVQTGKLAPRLDPRTFSIAEIGSAYDAVLGRNDVPRQRGKIAITVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of alcohol dehydrogenase superfamily protein from Novosphingobium aromaticivorans
rcsb
source organism Novosphingobium aromaticivorans
molecule tags Oxidoreductase
molecule keywords Alcohol dehydrogenase superfamily protein
total genus 100
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gazA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3gazA01
4E6PA 5JNLA 3JQ9A 5JYDA 3H6KA 3M1LA 4YDRA 5LC1A 4BQRA 3CEAA 3ZHBA 3A4VA 1NNUA 4F45A 5EQFA 3MJVA 3WB9A 3COSA 1FDVA 2B69A 3ZNOA 3GFGA 3OICA 1ZMTA 4LRTB 4DC0A 1VPDA 5KWEA 1MFPA 2GGSA 1EDZA 3LVFO 4L8VA 1D4FA 1CDOA 1AHHA 3ZWYA 4YQZA 4CMBA 3RBXA 1LRJA 4BOYA 5EINA 3WTBA 2CDBA 3GY0A 1N2SA 4ID9A 4EUEA 2Y1GA 3PZBA 2E49A 4FBGA 3SEFA 3RUCA 2NVBA 3QP9A 1E6UA 3CMMA 4HX5A 2BELA 4RPHA 3ON5A 5DP1A 4GMGA 2H63A 3E9QA 1CIVA 1T2DA 1U9JA 1DLIA 2RHRA 2TMDA 3JYPA 1VSVA 5JAMA 3M2TA 4R3WA 5DULA 5TGDA 3TZHA 3O9ZA 2GZ1A 2CVOA 4J4BA 3C8MA 1FXSA 1HE2A 1NPTO 5T8KA 1MA0A 3OEWA 5IN4A 2EGHA 2V65A 2B83A 1QV6A 3ETDA 4XYGA 1MX3A 1XU7A 2PKQO 2VHWA 3MWEB 1E3JA 1U8XX 3RC1A 5K0ZA 5KJFA 1H6BA 1HLDA 1NQAO 4PFJA 2Y1FA 3TDKA 5B1YA 2PFGA 2X0JA 3Q9NA 2WTBA 2VRCA 4PG6A 1V6AA 2BH9A 3MOGA 3D4PA 2ZCVA 3MEQA 1LDMA 6ADHA 1P3DA 3IDSA 2VT2A 1M67A 1NM5A 2I6TA 3C1OA 2YDXA 2RCYA 1Q7CA 4YJFA 4DQXA 1DIBA 1W6UA 4IGEA 4ONEA 4O0LA 4TVBA 3JQFA 1RPNA 3IJPA 1I8TA 3F4BA 3U5TA 3UUWA 3VH1A 4U0JA 1EEHA 1G1AA 1HWYA 1HYGA 1I2CA 5A5EA 2PTGA 4PLFA 4MP3A 2BI8A 3BMCB 1TB4A 4B7XA 4DMLA 1FF9A 2O3JA 1DJQA 4PVDA 3DL2A 3I52A 1JA9A 1M2WA 3RROA 1SPXA 1PTJA 3KXDA 4FFLA 2QRKA 3NDJA 4BO7A 1AHIA 5L7YA 1UZLA 1CWUA 4BMVA 4B3IA 4WE3A 3HADA 4R1TA 2YFHA 4E5PA 1PJTA 3DBRB 3GMSA 3WYCA 1K0UA 1HYHA 1HDOA 5K1SA 4BNIA 2P4QA 4BO6A 4AJNA 1YL5A 3JQ8B 1ZNQO 3OM9A 3VPGA 3NAQA 1PR9A 2NLOA 3I4CA 5A4DA 2RH8A 1UP4A 4CM1A 2H1SA 5K9ZA 1YVEI 1OZAA 3EMKA 4W99A 1P0FA 3HDHA 4BL5A 2Y0CA 3ST7A 5A03A 4CLRA 2UAGA 3DQPA 2YDYA 4A5OA 4RF3A 3W4IA 3PJFA 4ZQBA 3NDRA 3ONEA 1CYDA 3DBLA 5JAIA 2GERA 2Q2QA 1JKIA 2J3KA 1K5HA 1U8FO 1PS8A 2ZCUA 1EBUA 3AUUA 4DA9A 4CR7A 1DLJA 2FR0A 1GU7A 4RLSA 4O63O 4PLZA 2PNFA 2Y0EA 1C1DB 4JNKA 3KEOA 3E5RA 3BMQB 4MIOA 3AOEC 3H8VA 3P2OA 4DXHA 2W4QA 4YJGA 4N54A 1MP0A 2P9CA 3WQSB 3O4RA 3GGPA 5DCWA 4YA6A 2A4KA 1DAPA 2Y99A 2GCGA 3BHMA 4N5MA 5THQA 3BA1A 3TWOA 3UCEA 5AVOA 1VKNA 5FF9A 3ZW8A 2HQ1A 2UDPA 1LDYA 2FR1A 3I9JA 3PTZA 4BO8A 1MLDA 4WJZA 3KEQA 1LQTA 3QE3A 4BO1A 1UXIA 1KVRA 4GBJA 3RFTA 3FTPA 2IEDA 4J6FA 4IDBA 3ZWVA 4R5HA 1C3VA 3GZ4A 1UH5A 2BFPA 3DFUA 4WLEA 1AXGA 2HRBA 3EK2A 4KWIA 3I9NA 2HDHA 3JQBA 2JCVA 1ISJA 1AUPA 4QX6A 1DC4A 3LSYA 4Y8VA 5IN5A 1KEPA 4ZRMA 2ZQYA 4QO8A 4G5HA 4E4YA 4JP3A 4IJUA 5EQDA 1U7HA 2GASA 3DZHA 4J0FA 4QQRA 2CUKA 5IXYA 2EGGA 1Y8QB 4CMJA 3I4FA 4MVJD 4U8GA 3TL2A 3GUCA 3TZ6A 2DUWA 1GAEO 5THKA 3PZRA 4GX2A 4AL4A 1YJQA 1E3WB 1NR1A 3K5PA 4E5KA 4WCFC 1F8FA 3QWAA 4D3SA 3V2UA 3NJ4A 4U0KA 2CF5A 4RVGA 4ZHSA 1FDUA 4IZHA 3ZV5A 1NX6A 2J8ZA 5KCZA 1C1XB 4L0QA 4MKZA 1LDGA 4NH4A 1T4DA 1X1TA 3DR3A 3HFGA 4P4GA 3WMXA 4CJXA 4TRNA 3QSGA 2NSDA 4UEOA 1PJQA 1Y7TA 2IE0A 3OJOA 4B79A 3PWZA 2DAPA 4CMHA 1ZSYA 1P1FA 3TOXA 2NTJA 2FPPA 1DJNA 3M2PA 1MFZA 1EZ4A 4FB5A 4A26A 1ZMOA 1BVRA 1DRUA 3H5NA 4JBGA 2EF1A 4RQTA 3N74A 3PJDA 2G82A 4BNGA 1Z82A 1SEPA 3PQEA 3G17A 5G0VA 1ENPA 1Y6JA 3RI3A 3JQ7B 4XYLA 3C1AA 3S1LA 3N7UA 5K6AC 4OH1A 4M86A 4NBVA 4F6CA 5DBGA 2JD2A 1VJTA 1PJCA 1BMDA 3SBOA 4UVGA 3JQDA 4D7AA 3GEDA 4RCVA 1ZEMA 4AJOA 1UDCA 2I3AA 1FDWA 2PKRA 1PZHA 2C82A 1H6CA 2WYVA 2J6IA 1YJ8A 4UULA 4PCVA 1W8DA 2IYPA 5U9CA 2TMGA 5DNAA 2JHFA 4G81A 2UVDA 1KBZA 2JHGA 2W2LA 4RVSA 4EDFA 4M55A 5BNIA 3OIFA 1PQWA 3HB5X 1E6WA 3GUYA 4UEJA 3ITDA 5IZCA 4M89A 1QORA 3RFVA 2DM6A 3GT0A 3HN2A 4Y6PA 2VWHA 3UCFA 4AJHA 4WLNA 4HKTA 3MOIA 2VCYA 3LT2A 4RZHA 1Y81A 2WJPA 1YDEA 2JFFA 4FN4A 3RQSA 1U3TA 3VVCA 1N1EA 3NGLA 1ISFA 3GVHA 1XCBA 2VWGA 3M6IA 2G17A 2VTEA 5EL0A 1B3RA 1ZFNA 4HBGA 3GOHA 3TN7A 4CMIB 3PEFA 1NQ5A 3M1AA 2PGDA 1PX0A 1W4ZA 4W9NA 1EVZA 2B4RO 4JCOA 5A06A 3LQFA 1NWHA 4CL8A 4YJHB 3A1NA 3QVOA 1ONPA 7ADHA 1E92A 5C7IO 3ROKA 2FMUA 1UP7A 3HSKA 4FFNA 3UW3A 3RD5A 4CV3A 4J1QA 3IKTA 2GN6A 2P9EA 5I9NA 1LLUA 4B4WA 3GNTA 1N9GA 1QSGA 3DAPA 1BRMA 1QYXA 4AJ2A 3GN2A 3PWSA 4WOJA 3WICA 3RCBA 4ZVVA 1NAIA 3DTTA 1H6DA 4D46A 2Q46A 3U4CA 1QYVA 4BO9A 2ZB4A 1DBVO 4BVAA 1LRLA 3NV9A 4FGWA 4YWJA 4L4SA 2VHXA 1PZGA 3PGJA 3FR7A 3CH6A 2HSDA 4KOAA 1SAYA 3WIEA 5JFOA 2NM0A 5JLAA 1UZMA 3AU9A 4BB5A 3MJ4A 4GGOA 4NG5A 4CM9D 1ADGA 1Y8RB 4S1VA 3DOOA 4CUKA 3KHUA 2JCXA 5L51A 1HE4A 4J43A 1PR3A 1PJBA 1VL8A 2NQTA 4A27A 1EVIA 1TT7A 1D3AA 2QYSA 2X58A 5GZ3A 4L9RA 3H3JA 1XWFA 1PJ2A 4LISA 1UR5A 2I76A 3LT1A 4Q9NA 1VSUA 3ORFA 3RBVA 1M76A 2OP1A 3HQ4O 3OA0A 1H2HA 4J3FA 3L4BA 3E03A 3UICA 4D41A 4GVXA 5FWNA 3GHYA 4YB8A 2W2KB 4K26A 1PQUA 2X22A 3VTFA 2I65A 1ZUD1 1NVGA 1OMOA 2YV2A 4ND5A 4AVYA 1E3EA 2VHYA 4ZQGA 3RKUA 3ZDFA 1GUFA 3JD4A 3QWBA 5JE8A 4C7KA 3QJ5A 1H2BA 2FSSA 2ZB7A 1R4MB 1YL6A 2YY7A 3DB2A 2VNSA 1Y9AA 4AJLA 4FW8A 5C3MA 1KVTA 3TJRA 4NI5A 4CPDA 2C2YA 3WG9A 5CEJA 1GY8A 5DDIP 2J3JA 3INRA 1YO6A 2A9FA 4J4TA 3UH1A 4IDGA 4E13A 4PVCA 2GN8A 1N1GA 4ALJA 4HV4A 1HXHA 2J3HA 3FBTA 1KVSA 4I5GA 3S2GA 3VPXA 5GZ1A 3EVNA 4NBRA 3F5QA 3RC7A 3HJAA 4ZGWA 1BWSA 1LSSA 3H2ZA 1EUCA 4WLFA 5KVCA 3V1YA 1X1EA 3H9GA 3JD0A 3A28A 5I8ZA 1I3LA 2JFGA 2CMDA 2O3QA 4BV9A 3K9QO 4MO2A 5JAQA 4NFHA 3I23A 1FDSA 3KOUA 3F9IA 1EFLA 3IOYA 3EHEA 4GQAA 3TNLA 3IP3A 3C1TA 1EFKA 1HZJA 3BMOB 1B16A 3DAFA 3MCVA 4XR9A 2WWRA 5GZ6A 1LJ8A 3OP4A 3Q3CA 4W7IA 1DC3A 1NPDA 3QV1A 4YRAA 2AQHA 3QWIA 4N5LA 3Q2KA 3WBFA 1ZBQA 4CM7A 3U4HA 4WASA 4B7CA 3DOJA 3U3XA 1BXGA 4NFSA 4FFMA 1SMKA 1DAOA 5T67A 4CUZA 5FI3A 2O2YA 4BMNA 5TF4A 1R4MA 2OGUA 4MKRA 2GR9A 4IDCA 3JCZA 3ONFA 1X15A 4UAGA 1XHLA 5KNLA 3DHEA 2AW5A 1K6JA 3KV3O 3S8MA 3ROMA 4RPKA 1RYDA 3EDMA 2PGLA 3W4JA 1C0IA 4AG3A 3ZHYA 3U0BA 4P38A 5DT9A 1N7GA 1BTOA 1MC5A 1KOLA 4J90A 4MDHA 2VRBA 1EQUA 1MB4A 1SOVA 3FNFA 4OOEA 4RDHA 2HK8A 4IBOA 5L53A 1BHSA 1E1MA 1HDZA 4TZKA 1HE3A 4BNWA 1XR3A 3B1JA 1TLTA 1GUZA 3BTVA 4M49A 3H9JA 2NWQA 1YONA 2JKVA 4CMAA 4L76A 4LSWA 1KVUA 3DTYA 3E6AA 4E2WA 4XZ3A 2Q50A 3PIIA 3C24A 4HFMA 1O5IA 3KTDA 3IUSA 5JSFA 1UAGA 1DFHA 1ZIDA 4BGUA 1IYZA 2ZQZA 1I3NA 5JXWA 1RM4A 4B8WA 4E21A 3SJUA 4LW8A 5I8WA 1R4NA 2WD8A 3WFIA 4D0SA 3IC5A 5IZCC 4JLWA 1JU9A 4ZN6A 1HT0A 4ZU3A 4FC6A 1C14A 3UGKA 4XDZA 1QXSA 9LDBA 1EVJA 2OXIA 3P7MA 1HTBA 3KUXA 4WLOA 4E2ZA 4KTTE 5BQFA 2Y67A 5B12A 1XU9A 2W8ZA 5EMHA 1N9GB 3K92A 3PI7A 3CMCO 4HADA 1PJ4A 1FDTA 1FMCA 2PH5A 2OOSA 4F6LA 4NJMA 1U4SA 5JY1A 2QZZA 4IS2A 2O3SA 5JDCC 4U6QA 2UUPA 3L9WA 4H16A 1P33A 3IKVA 4E12A 3TFOA 4U6SA 3DO5A 2EJVA 1LC0A 3ZWAA 3KYDB 4RV9A 3D3EA 4JX8A 2H9IA 1ISGA 2F1KA 4D43A 3E8XA 2J5QA 1K6IA 4GH5A 1A9ZA 3DZBA 4R16A 3MWDB 4M8SA 5I9MA 3FSRA 2NTNA 3W8FA 1WNTA 3AUSA 4AJKA 1O8CA 4OKIA 2CVQA 3ADPA 1U5AA 3OMLA 4IM7A 3ZWPA 5KIAA 3FWNA 3L0DA 5GY7A 2DVMA 4NIMA 1DXYA 1GZ6A 4R01A 4R51A 4ZQFA 4WCDA 4AFNA 2Q2VA 3GGGA 1NQOA 4GX5A 3U4DA 1I0ZA 3GG2A 3FF4A 1O6ZA 1YS4A 3ZHZA 4FS3A 4CV1A 3K96A 5KTKA 1V3TA 3RIHA 1HETA 4I8XA 3JYLA 1SEVA 1HDGO 4Q3BA 1M6WA 1E1KA 1EBFA 1KC3A 1U3WA 2JAHA 5I7EA 3RFXA 4YRBA 3R1IA 1EK5A 1SCUA 3DDNA 2X5JO 4I5DA 1A7AA 1LU9A 2VZ0A 4M87A 2B5WA 1JWBB 1DHTA 2ILTA 2V6FA 2QRJA 2WMDA 3JQGB 5KKAA 3ZWWA 4GKVA 5MGBA 4FOSA 5TJHA 3AY7A 1XEAA 1K6XA 4MOWA 1U7TA 2B4QA 2VWQA 1OC2A 1VJ0A 4HFRA 4UUOA 4BUCA 1VLLA 2XOXA 1EE9A 2W2LD 2Q3EA 4LRSB 3C85A 4NK4A 3OBBA 4Z6KA 1SNYA 1MGOA 3PLNA 1UP6A 4MVJI 1HDCA 1V3UA 5AXDA 3EGOA 1I01A 1I2BA 1D8AA 1C1XA 3VZRA 1CRWG 3PFWO 3I9KA 2BFOA 4TRJA 2PD4A 2B36A 2RH4A 3EAGA 5EN4A 3DBHB 2P9GA 3WGYA 2D5AA 4IQ0A 3CUKA 4QFCA 3RUAA 2AG5A 4OO3A 4P4LA 4B8ZA 5CP8A 1LTHR 1LDNA 4ALMA 1PGJA 5JC8A 1YL7A 3AI2A 4IY1A 1UXHA 1WDLA 4HXYA 4R1UA 3RWBA 3VAZA 1WZEA 4CODB 1ADCA 4W7HA 4YQYA 1GEGA 2LDBA 1WW8A 2I9PA 3OQBA 1H9BA 1PL6A 3JQBC 5HS6A 4GL4A 3WJ7A 2J5KA 1Q0LA 2AA3A 4A7PA 1T4BA 2R6JA 3KSUA 4QSMA 3VH3A 3VZSA 3MTJA 4ROSA 1NPYA 2HCTA 4HP8A 1E77A 1LSUA 1O9BA 4DYDA 2D5CA 3RVDA 5TT0A 1F17A 1SBYA 4E0BA 2AQIA 4XJSA 5JCJA 4JBHA 4LK3A 3UVEA 9LDTA 4KUEA 3AUAA 1I30A 1SB8A 4R1NA 3B70A 4BNKA 3INTA 2O50A 3LLSA 3AW9A 1I5RA 2VUUA 3F4LA 3GAZA 1NWCA 3RASA 3CXRA 3F1LA 2DBQA 2X6TA 2YHUA 4S3MA 5G4KB 1R12A 1ZSNA 2FRDA 4CLXA 4TZTA 5KJEA 1EQ2A 1YB4A 2EW2A 1QKIA 4RLHA 1ULSA 3GHHA 4U5QA 3RC2A 1KS9A 4XRRA 1W73A 1LC3A 3BMQA 1U1IA 5JPIA 5AQ1A 1XSEA 4BO2A 4IDAA 3RUEA 3WMWA 3DZGA 1DRVA 5F1KA 5GMOA 5CAEA 3U62A 3QWHA 2CZCA 3WS7A 3I9OA 4QFDA 4IINA 2DT5A 5U1PA 1XYGA 3OJLA 1UXKA 4FIZA 3D0OA 4LSMA 4M54A 4TRRA 2GD1O 4Z0PA 3KO8A 1ZZEA 2DBZA 1Q0HA 3KRTA 3GFBA 3JD3A 4IPTA 1WZIA 1L7DA 3W8DA 3D7LA 2AQ8A 1RM5A 4IGFA 3SLKA 3ASVA 4CLRB 2D0IA 2X5OA 4CR8A 4PIVA 1E1LA 4XB2A 1JDJA 1X0VA 2E37A 3F3SA 4UVIA 3JV7A 1GQQA 3KLMX 4PZDA 3WNQA 3DMTC 4TKMA 4LN1A 5ADHA 4UUPA 2C59A 4FQ8A 3ETEA 3ABIA 1ONOA 1TEHA 2BLLA 3AUTA 3JQ8A 5IDWA 3HB4X 2P5UA 1YXMA 5K6AA 3PFFA 4IMPA 1XQ6A 4O1MA 4E32A 4I9HA 3UFXA 3BMNA 4Z9YA 1R15A 3ZWXA 2IXBA 4TRMA 4DYVA 3FTNA 1PWXA 1LLDA 1DB3A 2EIHA 3HFSA 3OA2A 4YR9A 3WGOA 3EY4A 1YBAA 4BGEA 3O03A 4D3DA 1HF3A 3L6EA 2VZ9A 2Y66A 1GYRA 4GLLA 3WGHA 5A3VA 1H5QA 3AM3A 1ZK2A 4UREA 4GGPA 4UVHA 4OKNA 1E7YA 2VUTA 4IQGA 4RVDA 3E9MA 4IXTA 3HDQA 1BDMA 1PGNA 1X7DA 5A9RA 4CV2A 1KY4A 1EDOA 1NVTA 5HS4A 2Q2WA 3GR6A 3PJGA 3F5SA 3G49A 3I5MA 4FD3A 5ENVA 5JYEA 2Y1OA 3GVXA 4RPLA 4D42A 3GPDG 4DIFA 1ML3A 2ZIZA 4FSHA 2Q1WA 3WFJA 3BTSA 1UZNA 3I1JA 1G0NA 1FK8A 5L95A 3FPCA 3K8ZA 3FD8A 4NMHA 4Q3EA 1IOLA 5TC4A 1PJSA 4Z0HO 3V1TC 2HLPA 3EZYA 1XQ1A 4WEOA 4XWYA 2NTVA 3TPCA 4DTIA 2Q1TA 4ZA2A 3JD1A 3ADOA 4QT0A 4Q3NA 3FNEA 1N7HA 1ZKMA 3DBVO 3NDIA 3P2YA 1GZ3A 4R3NA 3H7AA 1B8UA 4M1QA 4OQYA 4R9RA 3K30A 2A92A 5ES3A 4KUGA 5FI5A 2BKAA 2PD6A 3QY9A 1YH3A 1R0SA 4N5NA 3U09A 3UOGA 1IB6A 1HE5A 1VC2A 1LUAA 3MJSA 1E7MA 3VDQA 1B0AA 1PL8A 3DMYA 3F1KA 5LDHA 1PJ3A 2HJRA 2IXAA 1GYPA 2GN9A 4A2CA 1K89A 5G0SA 3BMNB 1V3VA 4KQXA 4Z9FA 4DWVA 4J49A 5ICMA 2PZKA 2D1YA 3GEMA 5G2OA 1PJLA 1DIGA 3I83A 3I3OA 3DOCA 2P68A 4TMFA 3GA0A 3QLJA 3H3FA 2EKLA 1GV0A 3L4SO 4FCCA 2C7VA 1F12A 4II3A 1ZK3A 2NU6A 3P19A 4D44A 4EJMA 1P45A 2V7PA 1V9LA 4E2XA 2GF2A 3VPHA 2VHZA 4J9VA 3OHSX 1F06A 4IJWA 3NRCA 4A10A 3VTZA 5KOIA 4XQEA 5JS6A 1JQBA 1B14A 1CQJA 4BNNA 4W6ZA 3ZWCA 4E5MA 2VN8A 2ZB8A 3ZU4A 2JD0A 4W9NC 3RUFA 3S2IA 2C54A 3AOGA 4Y98A 4BO0A 2OL4A 2H5LA 1AXEA 1KYQA 4GSLA 1LSOA 1UAYA 2I66A 4MINA 5ER9A 4EGFA 3DMTA 3QWFA 1RYEA 1YQXA 1HEUA 3KLPX 1PZEA 3BAZA 1T2FA 3KBOA 4WEQA 4BNZA 1GQYA 1DFIA 1P1RA 4IQ8A 3RUHA 4CV0A 5G4KA 3WIDA 2QRLA 3KB6A 1MG0A 4UEKA 4PLYA 5AOVA 3K2BA 4OGWA 1ZVMA 4U7WA 4HFNA 5DCUA 3VVBA 2YUTA 1BW9A 3IUPA 2X0RA 4RO0A 4EW6A 5JDIA 3HG7A 3S2FA 4KQWA 7MDHA 2I3GA 3OETA 1P1IA 3GPIA 4CLOB 2YHIA 4AICA 4BGIA 4D0RA 4CQMB 3ULKA 3GVCA 4H7PA 5HM8A 2BMAA 3OFSA 2RAFA 2QHXA 1IY8A 3OSUA 1EE2A 2X0NA 4BKPA 5ENDA 3I6QA 2YW9A 3PYMA 1B2LA 5HWSA 5KJ1A 4E33A 2EXXA 2UV8A 1PEDA 3LLVA 2WSBA 4JBIA 4IS3A 1QYDA 3BHJA 3X2FA 4J4HA 4Y9DA 3PXXA 2XF8A 1E3SA 3LT0A 1P1JA 1VRWA 5TLSA 1ISMA 1TVEA 3RAJA 3RC9A 4CQLA 4DUPA 3Q11A 4IDEA 2G0TA 1H0KA 4MVJG 3W6ZA 3GRPA 2QW8A 3S2EA 1DIHA 3L6OO 3AI3A 2FR8A 3LT4A 4GPD1 4WUVA 2YZ7A 4AJ1A 4PLWA 5F5LA 3SJ7A 4BNYA 4CL3A 4WOKA 1ZO8A 1M6HA 2P91A 4BNMA 3PPIA 3H9UA 3DBHA 1ZK4A 3CE6A 5H81A 5CEEA 3AY3A 4J2HA 3QVTA 1E7WA 1ZXBA 1PWZA 5F1PA 4ALIA 1ZSVA 1ISHA 2HMUA 4CLEA 1U2GA 3WGGA 5CPBA 2NADA 5CPFA 2IYOA 4KDFA 1BGVA 3KETA 3Q1LA 4WGGA 1JAXA 1NYTA 3FR8A 2DBRA 3IP1A 3LF1A 4GKBA 4RF2A 2BD0A 1LEHA 2GYYA 4R5MA 1X0XA 3AM4A 4Q3DA 4J2OA 4CUJA 3VZPA 4WNCA 3RUDA 4E31A 3G79A 4DVJA 5L3ZA 1NFQA 3UKOA 1A9YA 1LXCA 3JQGA 1LRKA 3PP8A 1Z7BA 2WEKA 2D8AA 4R68A 1Q0QA 2R2GA 1DRWA 2CY0A 1Z74A 3VKVA 1OFGA 3H9QA 1LX6A 3NKLA 3FRJA 4DREA 2Y1CA 3VHRA 4BB6A 2ZJ0A 3GAFA 3L4BC 4D45A 3OJEA 4FJ2A 1ZH8A 3NT4A 3WWZA 3ZV6A 1T26A 2QG4A 4OL9A 1JKFA 1IHXA 5BSEA 1DEHA 1SZJG 3TOZA 4FR5A 2DFDA 4MVJH 4C4OA 4FFRA 4I5FA 2J3IA 4BIIA 2HMTA 4XR4A 4UVEA 4K1LA 5G0TA 3TRIA 4J7XA 2ZJ1A 4KP7A 1A4UA 3PQFA 3H9EO 3MJEA 3G3EA 1U4OA 5A02A 1GADO 2DTEA 4RQUA 1H6AA 5L4NA 5L7WA 1OAAA 4Z3KA 3V1UA 1Z73A 1VJ1A 4L4RA 4YAKA 2D59A 5FYDA 1SOWA 4F3YA 1E5QA 5EESA 2ZTMA 1RM3A 4B4UA 1MV8A 3GDFA 2ZYAA 3UHAA 4DIOA 4PG7A 2Y93A 5EIOA 3OQ1A 1KY5A 1QG6A 2O3TA 5TRTA 2IZZA 4H3VA 3T4EA 1HDRA 4RZIA 2G5CA 1A5ZA 3KYDA 4AJEA 1EUDA 1CF2O 3IMFA 1LSJA 4I9UA 4MVJP 5T57A 3ZNNA 1HSOA 3I9MA 3NTRA 4FGSA 4NJMB 3IAHA 4TROA 4XQCA 1I32A 2PZMA 1ID1A 4BNTA 5BNFA 5B4VA 2V6BA 4N18A 4MVJF 1ENOA 1A7KA 4XD2A 4B4VA 4IDFA 5H83A 5DN9A 1CERA 4XCVA 1C0PA 2P5YA 3GRKA 4AJPA 1V8BA 1GCUA 1R4NB 1WP4A 4YJDA 1DPGA 4KTVE 3GGOA 1J6UA 5EPOA 5CG2A 3ANMA 1EMDA 3DZKA 3NEPX 2ZK7A 3SX2A 3D3WA 2GDZA 5CFZA 4IIUA 2W98A 1JVBA 1GPJA 2PV7A 2Z1MA 4G2NA 3WXBA 3WWYA 5L9AA 4J7CA 3GDOA 4CM6A 3ZGYA 2CD9A 2C0CA 4CMEA 2GO1A 3MJTA 4JJIA 1P44A 3EZLA 4PLHA 4L4XA 4OXKA 4DLLA 4YAJA 5IJZA 5LCXA 3E18A 1GQ2A 1VL6A 1QYWA 1BSVA 1IL0A 4GVLA 4R54A 1DSSG 4DPKA 4ZQHA 4NFYA 1DO8A 5CDUA 3TL3A 4E5NA 1OOEA 2VYVA 1F0YA 1X7GA 2P4HX 1HLPA 2VWPA 3JQEA 3OJFA 3JQ6A 1DOHA 3DZIA 2FWMX 3ANLA 5IDYA 3ZV4A 3O8QB 1BXGB 2HJSA 1K3TA 4IJKA 4EEXA 1U3VA 3ROPA 2GUGA 5CDYA 5JDIC 1PS9A 2Y0DA 4BNHA 3H65A 2X9GA 3VPSA 1F8GA 3ZV3A 4I08A 3IJRA 5L4LA 5JAZA 1U28A 1DFGA 1GCOA 3TF5A 5HRUA 1WDMA 1DDOA 3NTOA 5DZSA 4FDAA 5T5QA 3NYWA 2AE2A 1HZZA 2NQ8A 2OP0A 3BMOA 3ANNA 3VPFA 1S7CA 4LVUA 4L75A 4B3JA 1HYEA 2X4GA 3IS3A 3JQCA 8LDHA 3D1LA 5IDXA 4YRDA 2E4AA 4WPGA 3LC2O 4FC7A 2YV3A 2VHVA 1KC1A 4O5OA 4E2YA 5L40A 4GSKA 3WGQA 4RJTA 3VC7A 1UDBA 2FZWA 2HU2A 2VQ3A 5J23A 2BHLA 1Z7EA 1CQIA 3VOSA 4ALKA 5B4TA 5IXSA 4NBTA 3NUGA 3ITKA 4JN6B 1R66A 1T1SA 4DQUA 4XRGA 4JJGA 4F46A 4UVDA 4YACA 3G1UA 4NU6A 4OQZA 2JD1A 3WGTA 2OMEA 4EI2A 2ZTVA 1A72A 2V6GA 1IULA 2DU8A 1P74A 1UXJA 1JKJA 1DC6A 5A9SA 1P1KA 2OZPA 1YB1A 2DLDA 2GPTA 3RSHA 3MTGA 5KJ6A 4CR6A 4Z0TA 1A4IA 1W0CA 4BNVA 1J49A 4RGBA 3R3SA 1R37A 1Q7GA 3NTQA 4WECA 1E7RA 3KYBA 4ZJUA 3SC4A 4KDEA 5AXBA 4YVFA 3ONDA 4OAQA 4UUMA 3PHJA 2O4CA 2YV1A 5IF3A 3FN4A 2W2KA 3CKYA 4YYZA 5AXCA 4WK6A 1R0LA 2X9VA 4E3ZA 2POQX 4Q3CA 5ER6A 3JD2A 3PK0A 5KVSA 4FJ0A 2WD7B 4BKOA 4EUFA 5F5NA 1Q2XA 2DTDA 4FFOA 4XEHA 4XB1A 1D1TA 4XJTA 5ICSA 4MIEA 3L07A 1M75A 2I67A 3NT5A 5TS3A 1HKUA 4BO3A 1E7SA 5CDGA 1B7GO 4ALLA 4OHUA 6LDHA 3C7DB 4W82A 5C5IA 3TFQA 3H5AA 5C7LO 4QUKA 1RWBA 1Y8RA 1YGYA 3H5RA 4LMRA 4BO5A 1B26A 2EP7A 1IPFA 1IUKA 2EP5A 2FHSA 2Q1UA 1OC4A 3JYNA 2DBVO 4RF4A 5BNTA 3WGIA 1DIAA 2CSUA 3HN7A 3F47A 1XGKA 3JSAA 1YQGA 4J1TA 5DOZA 1UUFA 2NVWA 1G0OA 5JW6A 4IUYA 1LQUA 1E6EA 1NP3A 4B4OA 4OM8A 5G4LA 1PZFA 4MIYA 2AEMA 4R69A 1YQDA 2X5KO 1L1FA 3A9WA 4Q3AA 3WGZA 3LU1A 2B0JA 1T1RA 4HNGA 5IG2A 5JCXA 3I9LA 2J5RA 1NASA 2BGKA 2LDXA 4JJFA 4GWGA 1DIRA 1GZ4A 4HY3A 1NAHA 1NXQA 2EV9A 5B4UA 5DF1A 2QX7A 1P0CA 1OBFO 5TNXA 2BGMA 3LK7A 5T6BA 3V5NA 1MXHA 3PQDA 5BR7A 3C7AA 3E1KA 4J7UA 4ND3A 3CPSA 2HAEA 2XXJA 4DQVA 2VRCD 2GSDA 2BF7A 3OJ0A 5F3RA 1ZXLA 4I9NA 1QV7A 4ZQEA 4CMCA 3DFZA 1H94A 1PGOA 1NFRA 5G0WA 3ZW9A 4DLAA 2CDAA 1T2CA 5H82A 4EZBA 4YJHA 2XXBA 3ZU3A 3F46A 1WPQA 2JFHA 3JQ9C 3FCOA 3ZI0A 4CM4B 4CMIA 1VM6A 4DPLA 5DOVA 1YDWA 1EK6A 2Z5LA 3D5QA 4JQCA 1LA2A 3EYWA 5A05A 3GLQA 3LDHA 3CZRA 1QLHA 3JQAA 1V0JA 1XKQA 5L7TA 2EJWA 4NPCA 4IDDA 4OXYA 4XA8A 2B35A 4KUHA 4ILKA 4B7UA 2DUUA 2PLAA 4UUNA 2DTXA 3A14A 4LVCA 2X86A 1YB5A 3JQAD 2QYTA 2PWZA 4YPOA 4ND2A 1XDWA 4A73A 3A06A 2ZYGA 3X2EA 3NJ8A 4X54A 5DCYA 4J1SA 4Q39A 2FOIA 3QQPA 2HMVA 1GR0A 2C7GA 3K73O 2O3UA 2Y68A 3WLFA 2X9NA 2VOJA 1JW9B 2BRUA 5F1OA 3KYCA 2RIRA 2OO5A 1KIFA 3WTCA 4O59O 4MKXA 5LDGA 1LLCA 4CMKA 5C7OO 1QP8A 4IIVA 3ZH2A 4RDIA 3HWRA 2NU7A 3WSVA 3IIEA 4CM8A 1LDBA 3UXYA 3Q0EA 5T64A 2GLXA 4YT2A 4URFA 5BT9A 1Q7BA 2DPHA 2RBEA 3QA9A 1O95A 3FWZA 5T8KC 2PZJA 3JQ7A 1OI7A 4QTZA 3WYBA 2IDZA 1Q1NA 1MC4A 3U9LA 3EUWA 4RVUA 2Y05A 3E48A 4INAA 4CQMD 5JY6A 4YBZA 3PYLA 3H2SA 1MG5A 3S55A 4GLOA 1GV1A 1E1NA 1HSZA 5JC1A 1P1HA 5EERA 5I7VA 1A71A 2E6UX 3D4OA 3FBGA 4EJ0A 3BZUA 3CIFA 2F00A 2ZTUA 3ZCXA 4DBZA 1TT5B 4DIBA 1XA0A 3ROQA 1BXKA 3DHNA 1VI2A 1D1SA 5HBRA 2RHCA 3K2EA 4N7RA 4QXMA 1Z6ZA 2X0IA 2IZ1A 4YAEA 3WR5A 1ZCJA 2OORA 4WLVA 4BNUA 3CTMA 3OIDA 1NHWA 3RJ5A 1C0KA 1T24A 4TQGA 1IHYA 1WVGA 2VYVD 4PG8A 3JTMA 1KEUA 1E3WA 4O6VA 5COAA 3UF0A 4A0SA 1H9AA 2B37A 4QECA 1AE1A 1MUUA 4DPMA 1AGNA 1JTVA 3AFNA 3PLRA 3LC1O 3AK4A 1HDYA 3B6ZA 3GH3A 5A5FA 3GC6A 1Y8QA 4BQPA 2EERA 2VZ8A 4XIYA 5TQVA 3R6DA 1J4AA 4OSPA 1VL0A 4OIMA 3ZWOA 5JCJD 1I2ZA 2D2IA 3QVWA 3U49A 4BS9A 5DBIA 4JIGA 1YE3A 3E5MA 3PHIA 1XIVA 1TT5A 4PG5A 4I5EA 1P31A 4MVJM 2QZ9A 5HA5A 4XYBA 3AM5A 5JMPA 4NK5A 4DMMA 1QR6A 3P5SA 3R0IA 2GNAA 1DC5A 3GMDA 1ZJZA 3K31A 4Y6RA 3Q2IA 1I33A 3GK3A 3IQDB 3NGXA 5KVQA 5JO0A 1Y1PA 1YBMA 3OF2A 3OIGA 4ND4A 1VE9A 2PGJA 1DHRA 2O7SA 1C0LA 1JAYA 1J5PA 2IODA 4CM8B 4RORA 5A3JA 5AXAA 4OYRA 3BXXA 4PLVA 2C20A 2E48A 3KYCB 3WOHA 2ZATA 1J0XO 4NBUA 4XIJA 4XQ9A 3WBBA 4Z3DA 2YJZA 2IEBA 3DXFA 2HMWA 1ULUA 3KM0A 5JO9A 1PIWA 1S6YA 2IZ0A 4BNFA 4YJGB 1PGPA 4I1IA 3WJAA 4ALNA 3DONA 3DWFA 4MP8A 5A1TA 3ZU2A 2JL1A 1ZK1A 2X1HA 1C1DA 4OXNA 4PZCA 1PL7A 4OMUA 5CDTA 1LNQA 2FP4A 4K9DA 3PJEA 4CM5A 2ZB3A 1PS0A 1WMAA 3UN1A 5AYVA 2UYYA 2EEZA 2Y1EA 3JQAB 4FJ1A 5B37A 2PD3A 3DBLB 3HZZA 4IXWA 2CF6A 5I7FA 4B3HA 3L9XA 4BO4A 4C7JA 1ADFA 2VOEA 2Y1DA 1G6KA 2X7HA 2B4TO 4HFJA 2NU8A 4JXKA 2G76A 4CM4A 2VNAA 1Y9EA 1JN0A 2C29D 2GRAA 2ZYDA 3KVOA 3O26A 2CVZA 5ILGA 1XG5A 3DZFA 3Q9UA 3V2GA 2EHDA 4XKJA 4BNXA 3AOEA 4MVJE 3NX4A 1E3LA 1NBOA 4J9UE 1RKXA 2I5PO 3WQRA 2VYND 3BTUA 2Z95A 2IRWA 1O94A 4EYEA 1WLYA 3UCXA 3DBRA 4OSOA 3DZJA 3WQQA 5TIIA 3JYQA 4ZICA 1BDBA 2BFAA 4GMFA 4K6CA 3VZQA 2C5EA 2FSVA 1ZW1A 1KVQA 5JBIA 4CLDA 4DGSA 3BMCA 1AN9A 2O48X 3DHYA 2NU9A 2FPGA 4YEDA 2X23A 3TZKA 2NV6A 1N8KA 3R3JA 1ENYA 4MVJA 3E9NA 4BV8A 1N92A 1HRDA 4YJFB 1B8VA 4J16A 3CZMA 1R16A 1WXDA 1GTMA 1V35A 4PLGA 2D3TA 5BSHA 1NR7A 5U4QA 3O38A 3ETGA 2HKIA 2VYNA 3KSDO 4PZEA 4W4TA 3PHHA 2E82A 2AEFA 1A27A 1NVMB 2H6EA 2WD7A 4NZ9A 3D5TA 1ZJYA 2CFCA 5CHEA 3G1TA 1T25A 1CJCA 3PGXA 1ORRA 4NU5A 3INGA 3ZWNA 3PHLA 3MZ0A 3T7EA 1EVYA 1KEVA 3WSWA 1BXZA 1XLTA 4E30A 3AI1A 3VH2A 4ESOA 5JMWA 5KKCA 3AU8A 4P8RA 3BTOA 5HTOA 3AWDA 3E82A 3LC7O 3TSCA 5A9SB 2A35A 3KZVA 1L7EA 1PSDA 1E5LA 2Q45A 3RKRA 2Q49A 1GD1O 2G1UA 3GEGA 4XQGA 4K28A 3GNQA 3QW2A 3DAGA 3STHA 3HDYA 2YFQA 5KJCA 2OFPA 4DBVO 3AY6A 3V8BA 4CMEC 2XAAA 4EITA 1Y5MA 1GFSA 4YAIA 3U4IA 2WYWA 4FPXA 4BGVA 4JP2A 2W90A 1GEEA 2EKQA 5TSDA 2HK9A 5TT1A 2SCUA 2DPGA 5DBFA 5IFLA 3Q6IA 3PIDA 3OH8A 1U2DA 2O3RA 2AG8A 3PYXA 4IZIA 2PR2A 1PQPA 4MP6A 1E0DA 3LYLA 1T2EA 2JCYA 3G0OA 3PVZA 1I3MA 4TWRA 4JROA 2C2XA 3SVTA 1R6DA 2Q99A 3D64A 1KERA 4YCAA 2FY8A 1RJWA 3UAGA 2O7QA 2QIOA 1Z75A 4YXFA 1XELA 4GWKA 1SO8A 3HDJA 3O8QA 4NR0A 1YRLA 1F14A 4IMRA 1WWKA 4XYEA 1GL3A 1T2AA 2FZEA 4IJVA 3AJRA 2CNBA 3ZZNA 3N58A 5CG1A 3L77A 1WAMA 1I10A 2O4UX 5F21A 1H93A 2WYUA 1X13A 3ZNQA 4NDNE 3CSDA 3PDUA 4BNLA 3L6DA 1BG6A 4NHEA 3WNVA 5L4SA 2Q4BA 3LZ6A 2XPCA 1LBEA 4PN3A 1PU2A 1KEWA 1RM0A 3OQ6A 1YOVA 4TKLA 1GUYA 4NJOA 3ZNPA 4BNJA 4HUJA 4DL9A 5COQA 3GDGA 4WKGA 3FNHA 4ND1A 5A9TA 5FEUA 3BHIA 4XX0A 2GZ3A 3HUDA 4GI2A 4J91A 2C07A 2PKQP 2O23A 2NNLD 4AJ4A 2NVUB 4PRLA 4ZRNA 5I9LA 4GX1A 3SLGA 3QRWA 5I7SA 1QRRA 3OEYA 4XGIA 2CDCA 1MXFA 4BHTA 3D3WB 3PHGA 5COBA 2C5AA 2YYYA 3FNGA 4L74A 2ZKLA 4KWHA 1NQTA 1IZ0A 2EW8A 4LMPA 3PDJA 4CMGA 4QEDA 1CETA 1E7QA 4J0EA 4YAGA 1UDAA 1P9LA 4J1NA 1I24A 1IZ9A 2O2SA 4HWKA 3HNPA 3VH4A 2AHRA 1CEQA 4WCFB 3T7CA 3C3XA 3DC2A 2BFMA 2JAPA 4LGVA 1ENZA 3FPLA 3ZU5A 5EJ2A 4JK3A 3SXPA 1U3UA 5CDSA 3GVIA 4NQZA 4BKRA 5IZ4A 2R00C 4ITUA 4DC1A 1JLLA 4ZD6A 3QIVA 4YT4A 5ITVA 4H15A 3V2HA 2NUAA 4P4NA 3C7CB 4II2A 3GQVA 1HL3A 2D4AA 4PLPA 3PWKA 3VKUA 3ZHXA 1N5DA 1YWGO 3GZNB 3T4XA 3TZQA 1WMBA 4PRKA 5CEFA 5BSGA 4OJNA 1BVUA 3K6JA 2PZLA 2EWMA 4DLBA 4KMSA 3WLEA 3GN1A 4RVFA 1E3IA 4EEZA 3QHAA 3ASUA 3W8EA 4R1SA 1QYCA 3BIOA 4KZPA 4R9SA 1ZK0A 4P22A 3RU9A 4TSKA 1SB9A 1O0SA 3ZN2A 1HDXA 4OOFA 2A94A 1X14A 3B1KA 3ENNA 3I6IA 4CM9A 2PK3A 3WX0A 2V6MA 4RL6A 3ZWBA 2EKPA 2NACA 4K6FA 3EC7A 5TJ9A 2AMFA 3W4KA 3RU7A 5JDCA 3WDSA 1GYQA 1TA4A 3TZCA 1I36A 2HUNA 3FI9A 2HK7A 4LCJA 2WM3A 3QVSA 3B20A 3GF4A 4LCEA 1U5CA 4Y67A 4RPGA 1Z45A 2ET6A 4PGFA 4EBFA 3IL2A 4NBWA 5BSFA 4Z9XA 2Z1NA 2GZ2A 2DC1A 2EG9A 4BKUA 1B3BA 2AXQA 4L73A 4D79A 4TVOA 4R41A 1M66A 4CM3A 4PLCA 2UUOA 4YT5A 1IE3A 1JWAB 1UXGA 2DFVA 1X7HA 4FOOA 1PGQA 3BYZA 3FHLA 1WDKA 2PA3A 3GZNA 3KSZO 5IDQA 1NHGA 4MPDA 2PH3A 4BMSA 3AFMA 5FFFA 1B8PA 2HMSA 5KVVA 5C37A 1LI4A 5ITWA 2JJYA 2I99A 1ISIA 4XGNA 2HRZA 4GX0A 3WYEA 1YBVA 3EW7A 4XYMA 5DP2A 2BGLA 4MJLA 4HNHA 5MDHA 4PLTA 3ICPA 2YQ5A 5L45A 3HHPA 1FJHA 2Q1SA 4WCFA 2VTDA 2PY6A 1ADBA 1QMGA 4PG4A 2VUSA 4AJIA 1ONNA 2AE1A 2DQ4A 2AQKA 3B1FA 4XDYA 4WLUA 2OUIA 4G65A 2FN7A 5ILOA 1GDHA 1K2WA 2OBNA 4FFPA 2AEJA 1JVSA 4A03A 3GVPA 4RF5A 1LLQA 3W1VA 1EUZA 1QLJA 3HE3A 1ZEJA 3OECA 4JGBA 4CQLB 4D3FA 1IPEA 1D7OA 1P77A 5G0UA 2GN4A 1ARZA 4Y6SA 4YTEA 5TX7A 2VT3A 5A04A 1R0KA 4YT8A 3RJ9A 1LDEA 2FPIA 2YQ4A 3D4NA 1O89A 2NVUA 2Q4EA 1TXGA 4QO7A 4R4JA 2OBYA 3PRJA 3CINA 4RVHA 2X8LA 3W6UA 2R00A 3DEYX 2DKNA 4XGKA 3TQHA 1Y5RA 3ZWMA 3GNSA 1YOVB 3ENKA 4CQMA 3SC6A 4AJJA 2OHXA 2YHIB 4EUHA 1NFFA 1B15A 4CLOA 2BI7A 3ICCA 2P2SA 3JQFC 3F6YA 1I3KA 4GAEA 2WDZA 5IAAA 3QVXA 1UJMA 8ADHA 4EJ6A 1BW9B 4E5YA 3GG9A 4DRYA 3VDRA 3JYOA 4CLHA 1YKFA 2WE8A 1SC6A 3RUIA 1NTOA 2HO5A 3MJCA 3LF2A 2WE7A 1TI7A 4BKQA 4RPJA 1VKOA 3NT2A 4WNIA 4NNJA 3RBZA 2QQ5A 1GPDG 2B5VA 3H4VA 1KETA 2ZTLA 3EVTA
chains in the Genus database with same CATH superfamily
4A0GA 4LG1A 4MI6A 3JQ9A 1RXIA 1Q1BA 5JYDA 2IBMA 3M1LA 3LA8A 4QE3A 4BX8A 4YDRA 3RYFB 2XCOA 2BP7B 2CHUA 1SXGA 1B00A 4TV9F 5EQFA 1GL9B 2A88A 4ZQIA 2B69A 1MQSA 2WJIA 1LI7A 3IVGA 2X1LA 3GFGA 4QRIA 4LY6A 2C00A 4QQ8A 1MHTA 2PUJA 2I55A 1GTG1 1FLNA 1R9JA 2PXXA 5AKIA 3ODGA 1XDDA 3LVFO 3DDHA 4G0VA 1DCKA 3CX3A 3OWOA 2GFHA 4GVPA 4ESHA 1CDOA 1AHHA 3O4FA 2QX4A 4YQZA 3ZDEA 2A9OA 2GBPA 3MFYA 4REMA 1CJBA 5DO9A 3RBXA 4X62B 1Z36A 4BOYA 1NP7A 2CFIA 3SE7A 3JX9A 3G5MA 1XMJA 2J07A 5KPJA 2E49A 3NCTA 1XLVA 3RUCA 2BELA 2YNMC 3WMFA 4RPHA 1RXUA 4KV7A 5HGJA 3RIMA 2OYCA 3E9QA 4JD5A 1HX7A 1CIVA 1U9JA 3DMFA 3VQTA 3WKBA 3QEMA 3BWDD 3G82C 1KYTA 4G67A 4Z9AA 5JAMA 2A9VA 3MMSA 3NQ41 3IB6A 4ZVKA 3GRRA 4BAZA 2NOAA 2BFCB 3TZHA 1C3XA 1EGVB 2GJ8A 3GUUA 3N53A 1KAMA 1ZNXA 3RVKA 5A0TA 4J4BA 4Z53A 1HE2A 3DHVA 2CXOA 1Z4NA 3PTAA 1WIWA 3OEWA 4BDTA 4ACBA 2C4KA 3WC4A 4YRMA 1TM2A 4OHVA 1EYZA 4Y0VA 4QJBA 4QOHA 3B3JA 2B83A 1QV6A 3D6HA 2IPAB 3FGOA 4I3FA 1NF8A 4H3HB 3UT5B 5L6LB 1EWQA 2XUGA 4D4GA 2XHZA 1QF9A 1XZEA 2VJAA 2AN4A 2RI1A 4IHAA 1GL6A 1Q44A 4QOGA 1T0PA 5EMLA 1Q1EA 2PFGA 1QO0D 2WTBA 3MOGA 4IJQA 3ELUA 2C83A 3H5LA 4OUKX 2WFLB 2ZCVA 4TLBA 5IKOA 5HJ7A 4R9VA 3IDSA 1CY8A 2R1TB 3EVEA 5EIBD 1J0AA 1NRJB 4QVKA 2GEVA 1AQ6A 2YDXA 5IC5A 2I8CA 2PMCA 4ZO4A 2BF4A 4YJFA 3RBZA 1DWPA 3NDBB 1W6UA 1SVLA 4ONEA 1URPA 2X7JA 4WZAE 3UHOA 2IEYA 1C1HA 2FEKA 2VDQB 3IXQA 3UUWA 5DHFA 3ZIDA 4URVR 2HW8A 3BXFA 3K6KA 3MIZA 3IOBA 4DCVA 1HWYA 1I2CA 1HYGA 3RHTA 1YHZA 1KFKB 4PX3A 4D6YA 2RBGA 4LYHA 1SVUA 4ZALA 4DMLA 1ZVQA 4PVDA 1DJQA 1JJIA 1VE7A 2YZNA 3OZCA 3I52A 1M73E 4C0LA 2VC2B 1PTJA 2FU5C 3DTVD 1NSYA 3IEIA 1ZNYA 2PQ6A 2Y3IA 3LLCA 4FFLA 1JFTA 1U9ZA 1Q0PA 2IPLA 5ALEA 1AHIA 3B3QA 3N86A 4LOJA 5F4BA 1UZLA 3MBIA 4BMVA 1A95A 3J7TA 3GBSA 3B2NA 4PZZA 4DMHA 1IHDA 2WHEA 5CHYA 3K0EA 3WYCA 2V5VA 2GJSA 3NH9A 1K92A 1HYHA 3WZ2A 5IKMA 2HA3A 4O02B 3GOQA 5K1SA 2BM0A 3IOCA 4L5BA 3A3YA 1WETA 3J81A 3OM9A 3ONWA 4HDSA 4Q1EA 1BN6A 4TSFD 3MS4A 4U2DA 4RADA 3WLSA 1ESNA 1A9XB 2P5SA 4WXEA 3I4CA 1I3OA 5KU1A 4CM1A 4F2WA 2H1SA 1YVEI 3EMKA 5HUHA 1SOUA 1P0FA 4MI1A 4AKEA 2NV0A 4P84A 5AK5A 3V4PB 3MYRA 6REQA 4LJAA 2WMOB 3OZUA 2Q3MA 5DW0A 3AUYA 5J2UF 4A5OA 4M0DA 1LZKA 1R6VA 2ORWA 3ZS8A 2HF8A 3DBLA 3I42A 3Q3HA 4R7TA 3HKEB 3M9LA 4POAA 3VI4B 3H0KA 1J8MF 1U8FO 5FBKA 6NULA 3HGTA 2X13A 4B8YA 1UPXA 5I7RA 1SELA 1DLJA 2C2HA 4IJ6A 1GU7A 2BCEA 5CAEB 4RLSA 3W8RA 3PXEA 4O63O 4PLZA 2PNFA 2PRKA 4JNKA 4XD7D 3KEOA 2QVCA 3B2EA 4JB2A 3BMQB 4IJMA 3LHIA 4ZJPA 1S2GA 3P2OA 4N6NA 5AI0A 4P1ZA 1QGAA 3I45A 3RDPA 4BY9E 2QN1A 4ND7A 2XKKA 4X20A 3A04A 4ZKEA 3VO8A 3O4RA 2DH5A 2QIPA 2X3YA 3GBVA 1KI6A 3GGPA 5IH3A 4KO4S 3G0IA 4C9BA 4DDHA 2QN9A 4HLUA 2PVCA 2Y99A 2XOEA 3LL4A 2OECA 1QIMA 2ZRBA 3T35A 2ZWAA 2WV7A 3CRZA 4WBSA 3CJRA 5AMXA 4E1AA 1N36B 5JNVA 2WSYB 2BJHA 4JI0B 3BZWA 1RSZA 4ZJZA 1DC7A 1N8TA 2MU1A 1E0AA 2YFKA 2V9CA 3DDZX 2O7NA 3PTZA 4ARUA 3GJ8A 5LR6A 1LQTA 3NWOA 4NESA 4TMVA 4MW5A 5K0LA 4LI0A 2D2EA 2HB6A 4R5HA 1T4MA 1ZIYA 3MCWA 4DZRA 4UUBA 4DCPA 3GZ4A 3PEYA 1UH5A 3A6DA 4K81B 1QBGA 1A69A 1HBJA 2HRBA 1UZUA 2A0YA 1A1SA 3I9NA 5BP7A 3QVKA 2HDHA 2P2ZA 1B0PA 1A77A 2EQAA 3MG9A 1OLXA 1XP5A 4UBNA 4QX6A 1DC4A 5KI6A 1D4ZA 4JYPA 4Y8VA 2FCRA 2QVBA 1Z8HA 1YRAA 1KEPA 2P9BA 2V5AA 2QL6A 3GMTA 1GQFA 4PZPA 2PLNA 1U2PA 4QRDA 4J0FA 4AKTA 1ZCAA 2CUKA 2QJTA 4RKRA 5IXYA 2HUPA 1S2DA 4LMBA 5AIBA 1Y8QB 3PI6A 3QZUA 3Q5GA 1K8XB 4GX2A 5I4IA 1TYAE 1ZL0A 4YMLA 3AILA 3K5PA 5D1NA 4P08A 3FM9A 5JVDB 3X1WA 3BPSA 5HZMA 5KC9A 1EJ0A 4JKIA 3TBHA 3WB0A 3AZOA 1JHXA 3MHTA 1IDOA 2ZXEA 3BJZA 1NV9A 4GO1A 1CXZA 1C1YA 3D6JA 3E22A 1KI1A 5E7QA 3DT9A 2J8ZA 4RH3A 3QE0A 1LDGA 3DR3A 1X1TA 2ZUWA 1W5FA 4FT2A 3QSGA 1VGRA 2NSDA 1L4MA 2O5CA 1XTIA 1ZSYA 1P1FA 1KO5A 2OKGA 2FPPA 4HH4A 3SZ3A 1TEZA 3LQQA 2BJWA 1Z0ZA 3KT6A 3OE4A 1FRNA 4A26A 1ZA2A 2Z6UA 2EF1A 1HDEA 4OL0A 2Q5OA 2RGBA 3PJDA 2G82A 2QPAA 3EVGA 4MK4A 4PCUA 1SEPA 2QTRA 1ISSA 3R7WB 3G17A 3HCWA 3UO8B 4CDRA 1NN3A 1YCHA 2IF0A 1ENPA 5DBEX 1Y6JA 4KR9A 2QU7A 1M8JA 1CJTC 4JEMA 2BMVA 3A4LA 5FQNA 4HX9A 2VF7A 3TB6A 3SHWA 3TVTA 1DT5A 2V9ZA 3V32A 5K6AC 3IUJA 3IHKA 2HWXA 1ML4A 4OH1A 1O94C 1V5WA 4LZOA 4M86A 3UK1A 2JD2A 3WGKA 1PJCA 4BTEA 2IUYA 4EPVA 2IH4A 4UVGA 3QKIA 3GEDA 3M1YA 4RCVA 1ZEMA 4M21A 5M5BA 5KYXB 1Z39A 2PKRA 1VSBA 3IP7A 2J46A 4FYXA 4R2IA 2WYVA 2JKYA 1IXKA 3GGDA 2AKEA 1EWTA 4NEGA 4PCVA 1W8DA 2OAGA 1Q3TA 1FFCA 1N6OA 3FMIA 2WJVA 5CLHA 4X41A 5AH0A 2PSSA 3IAS6 5K2MA 1KOJA 1D6MA 2JHFA 2UVDA 1KBZA 4G81A 4KIGA 2JHGA 3VHXB 5C53B 3U4QB 4M55A 3I8XA 2ZDHA 2C9BA 1PQWA 1Y7HA 3HB5X 5K8TA 2CL7X 1PT8A 4UEJA 2DULA 4O4HF 4CF7A 1P7YA 3HN2A 3FAKA 1G9SA 4WLNA 2KM1A 4G1EB 3MOIA 3LT2A 5CLIA 4ETWA 3GZJA 4BJ6A 4FN4A 4CU2A 3RQSA 3QLEA 2AJTA 2NZXA 1N1EA 2AB0A 2ZYWX 3EGDB 1GILA 1ZH4A 2JIQA 4EJFA 2IEGA 1N9ZA 1XCBA 4Z4HA 1VYUA 2G17A 2I6GA 1B3RA 2J3QA 2VTEA 1K6EA 2VBFA 4OQ4A 5CXSA 3PEFA 1JAZA 2Z04A 2QEQA 2WR8A 3GJRA 4W9NA 3FPBA 5A06A 1MH1A 2BPOA 1NRXA 4JCOA 4U02A 1N77A 4AKIA 1NWHA 3SYLA 5TGZA 4CL8A 1NNLA 2CCJA 3EOZA 4XDHA 2HT6A 3TZLA 8GPBA 3QVOA 1M2HA 1E92A 1DOZA 4A16A 1GITA 4RCYA 2FMUA 1UP7A 2C61A 5T4HA 4FFNA 1XZLA 3UW3A 1AGXA 1HY3A 2FW1A 3ITNA 1E3TA 4J1QA 4P9NA 4XARA 4YS6A 4EHDA 2COKA 5JZMA 1AA6A 1H5UA 1BU5A 4EUNA 5CDHA 2A0KA 1E2PA 1BRMA 3HJUA 4AJ2A 1PV2A 2TYSB 3GGJA 3GN2A 4PHTA 3DEFA 4CKWA 5JJKA 3EVZA 2LNDA 3FRHA 2QK4A 2BDUA 1C9JA 2PH1A 3DTTA 3LWNA 3UC5A 3AVTA 1TGVA 4L3OA 4PSDA 5KYTA 1QYVA 3S0JA 4BO9A 1DX6A 1DO2A 4YWJA 3UEOA 3I5XA 3PGJA 1XL1A 4GRIA 2X9LA 1N6NA 1VJ5A 3FR7A 3N7AA 4U3JA 3V2IA 1T2VA 2H0AA 3BRWD 1FDRA 2HA5A 3CH6A 3RW9A 3FFTA 4KOAA 4UATA 2Z2IA 1Y5LA 4XWTA 3OIUA 1TVCA 1A4RA 3D1VA 1V8ZA 4EG3A 4ER0A 1VXRA 1MIOA 5JLAA 4BWFB 2W6IA 4BX9A 1XK7A 2QI9F 2H85A 4WN9A 3IPYA 5E6UA 4PYOA 2PXHA 4Z1MA 4CM9D 1Y8RB 2CNOA 5KYWB 4WBXC 1OYOA 2P4SA 4ASUD 4DBLC 1RKBA 2XCSB 1M1YA 1GVNB 1VL8A 1EVIA 1D3AA 3D8RA 4OK3A 4C5AA 2D5BA 4L9RA 4S2UA 2QMZA 5TQ0B 1PJ2A 5I4KA 3BIJA 4LISA 5IC6A 4B40A 2BEWB 3HA3A 4Q9NA 1A2OA 4QTTB 1V8FA 1J56A 4M38A 2G67A 4WERA 1Z5OA 4JI4B 3MJRA 4CRWB 2B7LA 3E03A 4MW0A 2PYIA 2CHEA 2RHLA 1YZUA 4YB8A 4CHTA 3A4TA 4K26A 4F2DA 1OH6A 3VTFA 4AVYA 1O95D 1OMOA 3WLLA 2CFSA 3K9WA 3RVLA 5LPNA 3ZDFA 3NBXX 3QU2A 1GUFA 3QWBA 1SVKA 1SIBE 3AQIA 3QJ5A 1OLUA 4JGIA 4N7BA 5JE8A 2ZB7A 4PTLA 1R4MB 1CEXA 1ZQ9A 2I1QA 2YY7A 3A9TA 3IODA 3L7MA 3DB2A 3LQKA 3WDMA 2B94A 4UE2A 4WZBA 3TJRA 3WL4A 1U0NA 3WG9A 4KXNA 3CR7A 1Z9BA 1QZTA 2PIDA 1YO6A 3INRA 5MFZA 3TECE 1LPSA 4J4TA 4L5AA 3UH1A 2Q9BA 4E13A 2GN8A 2X41A 5DMXA 3CX7A 3NYRA 5FBZA 3WO0A 1R5JA 2FN9A 3GFRA 3MLEA 2J3HA 1PWHA 1AHPA 1KVSA 2Z8ZA 1V7CA 3S2GA 3E7XA 2ODPA 3JRXA 4X6LA 3LE8A 4G26A 1Y6ZA 1EUCA 4HGQA 2WHQA 1OI4A 3AHJA 3E3LA 1TU4A 3H9GA 2VHUA 4RD0A 4XUGB 4AS3A 3KOYA 3I5YA 1KSHA 5EIBC 4ZVUA 5ALRA 3W77A 3K9QO 3QEJA 1U2ZA 3R5KA 2JJ2A 4PBRA 3IOYA 2C9DA 1KI4A 1KMIY 2HREA 3OD1A 1N3LA 2Z9BA 1EFKA 1I7DA 1CUBA 2QTAA 4TUYA 5JUWA 1EUCB 4IIBA 2B8TA 2P2NA 1QIJA 4JC5A 3M0EA 4L0CA 4ZHQA 1DAEA 1LJ8A 1M1YE 1XZFA 1L3IA 2OV6A 3JY6A 3N05A 1HMYA 4OLFA 5K3BA 2AVDA 2GO7A 2V45A 5P8WA 3ACCA 5EPEA 4MW7A 1NMZA 1ZBQA 1RQNA 4OHOA 4YMSA 3U4HA 3Q41A 3WBFA 2P30A 2HV9A 2B7BA 4TL9A 4B7CA 4N8DA 1RKVA 5FCDA 3AHIA 3IP6A 2CHVA 1PT5A 2R6R1 4BECA 1M72A 3IP9A 3D6AA 4R0VA 2YMMA 2XZPA 3EBOA 4EKYA 4YY3B 2JGKA 4KQKA 3CW9A 5EIWA 3ONFA 1USIA 3PNYA 1X15A 3OPYB 4U7HA 4UAGA 2QOEA 3S4YA 4CI9A 1KK3A 2J31A 2EEPA 2X8WA 5FUWA 2JIOA 3DHEA 4GC9A 5FOTA 2JLWA 2B8NA 1RTTA 5KNBD 1G20E 3KV3O 3ILYA 3N39C 4RPKA 4LE1A 3S8MA 1OE0A 4QM7A 2QZSA 3EDMA 3LLUA 1F4VA 2AFIE 3C15C 4G8CA 5BNWA 1NKSA 2NZUG 1IVYA 3OY2A 1UFQA 5IM4A 4RY0A 5LYJF 4HZUB 4P38A 3PG5A 1YKGA 5DT9A 5K5EA 1BTOA 3I12A 4ARAA 1FS4A 1JQLB 1EQUA 3LUCA 4J3NA 4AY4A 4JQSA 1G8GA 4PYIA 1IN8A 2JFYA 4GPAA 4OOEA 4M0PA 4QPJC 3X44A 4IBOA 1IUNA 1HDZA 2CWDA 2WJJA 1WEHA 2C2OA 2YRFA 1DAGA 4IH9A 2HMYB 3B1JA 3MTQA 4LYEA 5T4FA 1M5TA 1TLTA 1XXHB 3P9IA 3A1EA 1PD0A 1RJ9A 2CNDA 3E1GA 1YONA 2JKVA 3AB7A 1I7LA 3GJ6A 3IQIX 5FV7A 1T10A 3ZC3A 4CTJA 4ERNA 3DTYA 3E6AA 1KE2A 1MIOB 5HGXA 4Y6GB 5JAHA 1XCPA 4EB3A 3RLFA 1FYDA 3C24A 4HFMA 1O5IA 2G63A 3MFQA 3RYIB 1UAGA 1EB9A 5DPMA 1N3YA 1IWOA 2ZQZA 1YK0A 3IAAA 5GM2A 3VTKA 3K1ZA 4B8WA 3N8DA 1II8B 1SUFA 4AMVA 2GRJA 4LW8A 3S1SA 3DTVA 4UE6A 5E6SA 4D0SA 3RU3A 2JATA 3IC5A 3M9WA 5IZCC 3BF7A 3K4HA 1JU9A 1M0SA 1ULHA 1FTSA 4ZU3A 4YX9A 2O2EA 1C14A 2ZYIA 5EEGA 4BB0A 4XM1A 4KIWA 4DWJA 2IP1A 3WRXA 4E2ZA 3HKDA 4R1MA 3KXPA 2TMKA 4XUEA 5BQFA 3LWZA 4BX0A 2Y67A 1EVLA 1XU9A 1CEYA 2W8ZA 1Z5ZA 1XWWA 1N9GB 2LKDA 3BGWA 5F51A 4OHZA 3QLVA 4ZDIA 2OOSA 1JI0A 2J48A 3NRJA 2PH7A 3U44B 5J5AA 1NT4A 1SU7A 2O3SA 2WNSA 3L9WA 4U6QA 5CGQB 5JDCC 4A6XA 2VG8A 3OC0A 4RBNA 1QH0A 1XTPA 3HLKA 3DO5A 1OH7A 1FMFA 4DCUA 4UTZA 4B5LA 3OOJA 2VK4A 2XA9A 3D3EA 1Z4OA 2PN1A 3L7NA 1Y82A 1QKJA 2H9IA 1KOFA 2XRMA 5HBGA 5JROA 4JKYA 4P58A 3ICVA 1JYSA 5B7QA 3G2IA 1C9KA 3RK4A 2GZHA 3PNMA 4N0MA 1GFZA 1A9ZA 1K88A 1SUBA 5AVJA 3IT0A 4Y18A 1R8YA 4NMWA 2QP9X 1NDUA 3SIWA 4R16A 3RRZA 3FSRA 3ICQB 2PJDA 1UT6A 4P0TA 2WG1A 3SMQA 5ADWA 1O96B 1WNTA 3AUSA 3MS7A 1D8TA 2CVQA 5HFJA 3P0IA 1XAJA 2CXXA 3G9ZA 2WP0A 1GU1A 1M7HA 3L0DA 2WU8A 2PL5A 4XUDA 4NIMA 1DXYA 3TXXA 1GZ6A 4ZU1X 4UARA 2HSZA 3JASB 3OZVA 1XJ5A 1MHPA 2H7XA 3GJYA 3H17A 3N8KA 2QTFA 3AYZB 2Q2VA 3QKTA 4XAQA 4EA9A 1T6XA 2WINI 1QCZA 1I0ZA 2WIFA 2IUSA 3A4YA 2OA0A 4FVTA 3ROTA 4CV1A 4QULA 2VPZA 1AO3A 3A6KA 4RXMA 1M5UA 3IBYA 3E3NA 1IN7A 1H2YA 1M2KA 2G0AA 3P9SA 1KGSA 3TK1A 1U3WA 4HUTA 2EFEB 3GJSA 1ZA1A 4TMXA 3LIPA 4BVFA 2QRPA 4YRBA 3DDNA 1F4LA 2X5JO 3ZXSA 3UUEA 1A7AA 1LU9A 4V0LA 4I36A 3HEAA 3D6UA 2G9NA 2DY0A 5A2QA 1OXKB 4GOLD 1RMQA 2RCNA 1DQSA 4QGSA 1I1NA 2WMDA 5KKAA 1U8YA 1QH8A 2MHCA 3AJEA 2BFNA 1MBZA 2RFLA 3IAS1 4P6VF 4QYSA 5DEIA 3U3JA 1WB9A 4JV5B 1TZMA 3RREA 3UMYA 3L01A 1FNCA 4R1PA 2C4NA 4FNMA 5A5DA 1XDZA 1CKEA 1O2DA 1UBHS 1W85B 2H5IA 2QW0X 2D74A 3IBTA 1OC2A 4LPSA 4QARA 5EP1A 4XIGS 1VLLA 4D8WA 5KC8A 4KODA 5GVSA 2WJHA 1Y8CA 4O4LA 2WM2A 3OBBA 4N1AA 2OCPA 5ALYA 4Z6KA 1USGA 4G5XA 1SNYA 3KEGA 1NZJA 3U6BA 3PDIA 1E5DA 4MVJI 5JNWA 1JYEA 3LVBA 1HDCA 4YMHA 4WX2B 1V47A 4H6PA 3OWXA 3UPUA 2GCIA 1IATA 2ZJBA 1Q0TA 5FJJA 2P2GA 3GDWA 4X85A 5E8JA 3NS7A 4LXQA 3VZRA 3PFWO 3E0QA 2K7ZA 2VF8A 3I9KA 3UAVA 2PT7A 2QGFA 3X1DA 2PD4A 2HZBA 4D4LA 3W9BA 3IPRA 4H18A 2IGTA 1ZN7A 3EAGA 1D2MA 1WCIA 2VF4X 3I53A 3PGLA 3WGYA 4MYTA 4ZAXA 3CUKA 3MT7A 5HKLA 5K1ZA 4DF3A 2HCFA 2AMYA 2VQSA 4QFCA 2AG5A 4OO3A 3QBVA 2WKRA 4TKVB 5CP8A 1GZSA 2GEBA 3D3NA 1JVNA 1J0CA 1UPTA 2FRXA 4RJLA 3M6MD 2WUDA 2XE4A 1UMKA 4RD6A 1D5WA 1FRVA 1WDLA 2HHAA 4L6CA 2GCOB 2XUOA 2HM7A 2Z98A 4OK6A 1WZEA 4CODB 1SUEA 1TIPA 1ADCA 1Z3CA 2DWQA 5D3MA 2X0KA 1JX6A 1RHMA 2C5GA 2PR7A 4H1WA 1OWMA 1VIMA 4UXJA 4CF6A 2FZCA 1ECBA 1XAHA 5C2JB 4OKSA 3LWBA 1I13A 1OFHA 3OPVA 1SRRA 4MEAA 2QTCA 4DXDA 1XTKA 1JG4A 1SBHA 4V02A 3RTAA 5A2GA 4H31A 4A7PA 4PX9A 1Q0LA 1IRIA 4OJMX 3JPYA 5L8VA 2V7VA 3C3EA 1T4BA 3CT4A 4QSMA 5AVKA 1XTBA 1E77A 4MWBA 3L0BA 1WS6A 4E0BA 1GSIA 3QM1A 4J2TA 4XJSA 3W0LB 3E5NA 1HFKA 2KI5A 3AINA 3UVEA 4HAWA 3VPAA 4ZGBA 2E1PA 2RC6A 4PNEA 4C6HA 4R1NA 4RANA 5KOIA 1GZUA 3EFEA 5J47A 2JH8A 3Q9LA 5KKNB 1NW4A 3QF7A 4HWRA 4AZ3A 2B0CA 2REOA 1XNHA 1NWCA 2ZI4A 3CXRA 1YA6A 1KDRA 3F1LA 1CJUC 2YHUA 1AA9A 3ZTYA 4GS5A 1ZSNA 3K0FA 1FBTA 3UXEA 3TTWA 2C78A 3ETLA 1U9YA 2FRDA 3WLIA 3K0KA 3O8DA 5FI0B 4P86A 1ULSA 3VR3D 1L5ZA 3TW8A 5AQ1A 1GRRA 4BO2A 1QZZA 3HEMA 3K53A 3RUEA 1QJCA 2NUTB 3FDJA 5F1KA 3K9HA 1OGYA 3AL3A 4EKNB 1T0UA 4NPAA 1VSTA 5C35A 4CXMA 5C8ZA 3LQ1A 1RLUA 2DT5A 5GONA 4QGAA 5U1PA 2FDCA 3ELDA 4FHCA 1UXKA 1C50A 3ORYA 4KPYA 2I6SA 4W9RA 4C4XA 3DWGA 1GNVA 4HLDA 4NAUA 3VR6H 1ZZEA 1SVWA 2DBZA 4Q02A 2BBOA 3SEAA 1C7IA 3PFBA 3UYKA 4RETA 3GFBA 4IPTA 5JZSA 1X7ZA 2R84A 3BSSA 4PXSA 3DVAB 2AXPA 5C8YB 2AQ8A 4NE2A 3IMEA 3SLKA 3ASVA 4WFJA 2XT9A 1E4EB 2D0IA 4GFDA 4B76A 4EO4A 4AF6A 3ESXA 1T0BA 2L19A 2FW8A 5LQCA 4G41A 4EUSA 1X0VA 1W75A 2X2PA 1W30A 3KLMX 2GLUA 5JD5A 1IZZA 1XZDA 3DJFA 4YRZA 1BJTA 5F4ZA 4LN1A 5K51A 4UUPA 5ADHA 1WG8A 4UTOA 3VJMA 4NOLA 3ABIA 3BWXA 1RXYA 4Q7EA 1TEHA 3LFUA 2P5UA 1YXMA 5ALVA 1Q15A 4Q05A 3VMMA 3CVVA 2ZKIA 3AUXA 1XQ6A 4HEA1 4O1MA 3W5SA 3ZZTA 2YBEA 3AEUA 4F3NA 3Q7QA 5LLTA 2PUHA 4DLTA 1TK2A 4KQ1A 1ZVVA 1O94D 5FEMA 4C05A 2W2PA 2GTIA 2WF6A 4DYVA 2C7QA 4NU0A 3HFSA 4YR9A 4YMIA 4UHKA 3EY4A 1L8OA 4KU4A 1WA5A 4MRAA 1KY2A 1UT8A 3O03A 1N0VC 1HF3A 4JJ8A 5DLPA 4QXPA 4P3KA 4JB8A 4IHQA 2ZBQA 3WGHA 1ZK2A 3AM3A 5CLLA 1MQ9A 1W5SA 1DBQA 1E7YA 2VUTA 4GM4A 3E9MA 5LOVB 3HDQA 4MW6A 1QDUA 3VU8A 5IKPA 2A1IA 1MJNA 3ZVRA 4ND8B 5FUYA 1JHMA 1JKXA 2IEIA 4JB0A 4ZODA 3SQMA 4CV2A 1KY4A 3QLUA 1PLLA 5HS4A 1F8YA 1IC6A 2Q2WA 3C8ZA 3R0XA 4KIFA 3F5SA 4Q21A 2PS0A 2DUMA 3IDZA 2G8NA 4B3FX 1SD2A 2F67A 4Z1MD 4ENVA 5JQGB 3WFJA 2HXGA 2YWJA 3BTSA 5ECDA 4E07A 1X38A 2VJMA 3FGPA 4IWYA 1FK8A 1Y1RA 3C14C 3QW4B 4JJ6A 3K8ZA 4P33A 3H2JA 4QJ3A 3RSLA 4C7VA 5L95A 4NMHA 2VSXA 3B1WA 1E0SA 1W34A 3JWHA 5TC4A 1IFXA 3LG2A 3TS1A 5JNSA 4L5IA 3ZVNA 5IVKA 3M5WA 2XSZA 5IVDA 4XWYA 3TPCA 1L3CA 4Q4DA 5B57C 3EOAI 3PQ2A 5I48A 1LS6A 1RWKA 3AEZA 4ZA2A 4UU0A 2F4NA 3ADOA 3JD1A 5A7GA 3F6EX 2YWRA 1LWNA 2V0CA 3FJOA 1ZKMA 4HRAA 3SPXA 1QVWA 3MWEA 3SKXA 4EYGA 4DDVA 3P2YA 1JL3A 4YRNA 5EVCA 1GZ3A 1KZ9A 5KOYA 3MUFA 1G5FA 3EWNA 4HWGA 2O8DB 2QN2A 1MJFA 2D1RA 2OILA 3B2QA 2NXCA 1QE5A 3SBDA 2QVGA 2UVPB 2Z3VA 5FI5A 5HXAA 4JLBA 2D2XA 1YH3A 3IJ5A 4C29A 4M98A 1HE5A 1KTVA 3ZE0B 2HLNA 3FYSA 1LUAA 2ETVA 4YLEA 1M2JA 1THZA 2BFCA 1WSDA 2J7PA 4Q4HB 3F1KA 3SG0A 3ECCA 5LDHA 3FMOB 5CVTA 1J25A 2GN9A 3QEMB 2VR1A 4AZTA 4D2IA 4P2BA 1DCMA 1JT2A 5CMLA 1V3VA 2I8AA 1OASA 3AEUB 4MAAA 5ICMA 3CNEA 4RTQA 4NKRA 5KUTA 3GEMA 1UWVA 2VHCA 4N5IX 2XMQA 1RKUA 4EFDA 2OC4A 3BSWA 1I1HA 1NZFA 1J21A 1SBZA 3QLJA 4DRXB 1U2GC 3H3FA 2W6ZA 1RWNA 3UGJA 2WSMA 3QXHA 4FCCA 4WXYB 1MX5A 2GUWA 5JWHA 4II3A 2NU6A 1XJ0A 2WI8A 3V42A 3O0DA 3D0QA 2V7PA 4Z4EA 1V9LA 1T5LA 1MJHA 2DKFA 4JSYA 5C8YA 2G08A 1Y3FE 2VHZA 2ZUVA 3U3OA 3VPHA 3LXUX 4JT9A 3VTZA 4B3RB 1II0A 1C3JA 1GG2A 5BN3A 4R3UC 3HH8A 1W87A 2QTGA 1G3UA 3KL2A 4LXHA 2FF7A 2XCTB 1E98A 4S1NA 2C2BA 3V7FA 1YS1X 4KXYA 5FTKA 1OIVA 3UWPA 5GONB 4MR7A 1QQAA 1TD1A 2BR4A 1KNXA 2IXTA 1KMNA 3BDIA 3ZU4A 4EW2A 3CVYA 3S2IA 3P32A 2M98A 1AXEA 5DGXA 2EZ8A 1P8AA 4L4YA 1EWKA 2AD5A 3TYXA 5BURA 3KSAC 1VLJA 1KXJA 1RYEA 4TSRA 3HV2A 3OOEA 3T7TA 1ECCA 2GS9A 4RTMA 2RAPA 1T2FA 1X7YB 3EG5A 4RE6A 4WEQA 1P1RA 1VKRA 3DEJA 3K0FB 4CV0A 1H65A 3VO2A 1T9BA 5G4KA 3IVCA 3H4IA 4ARZB 5CFPA 4UEKA 3D2LA 4OGWA 3TQRA 3EC1A 3L2OB 4NY1A 2QD5A 3UA4A 4QUJA 1HOXA 5BWNA 3VVBA 1FE8A 1VPLA 1JTEA 3IUPA 4KAXA 2QRMA 4PPFA 5KTTA 2R6GA 4RQAA 5M29A 1EA5A 1ZG3A 5ALKA 3B8HA 1NUAA 2I3GA 4K87A 1P1IA 3UMMA 2YUIA 3KC2A 4KE7A 5IM4F 2ZI7A 3ULKA 4MCAA 5TXGA 4XIIA 2OQ2A 1JSZA 5C31A 4H7PA 3RV3A 3TMKA 1LBTA 1NM5C 4UM5A 1KAOA 3IVAA 3LUPA 2X0NA 2ZS8A 2OZVA 5ENDA 3I6QA 4S0ZA 1LBSA 2QBYA 2V0GA 3TRHA 1B2LA 4HH0A 5F2NA 4X6XA 4ARCA 3PL5A 1QVRA 1HEIA 4KJZA 4LGCA 4MA5A 5AP9A 2G40A 3BGDA 3VOBA 2FUNB 2C7OA 3QPUA 2ADOA 2WSBA 3FLAA 4BLUA 3PXXA 3MWJA 3ZCPA 2PUFA 4GQIA 2ALJA 1GPNA 4W63A 5K0FA 5BY2A 1GAWA 1P1JA 1VRWA 3HMQA 5C4IA 5J4VA 3R3XA 3O8RA 2CXHA 4DUPA 3RC9A 4CQLA 4GG1A 3ZQKA 3AZQA 4JIMA 2P1DA 1RLOA 1H0KA 3AJ8A 2ZUCA 3QMVA 4UHHA 2IV2X 1KAHA 5K09A 5K8LA 2KS6A 1W36B 4J07A 3UWMA 3ZI4A 3PX7A 4WUVA 3LT4A 1A82A 4B5KA 4BNYA 1XZGA 1S2LA 2W2VA 1SN7A 4GPD1 4PLWA 1IMOA 2ZFUA 3SJ7A 4AJ1A 4TKVA 4HQNA 4WOKA 2H1VA 2J3MA 2FUKA 1M6HA 1TRKA 2JBWA 3B9QA 2I7XA 3O9MA 3DBHA 4ZCTA 3CE6A 1DAKA 3ELYA 5H81A 3STXA 1A5TA 3LUKA 4YCSA 3H2KA 3FKSA 2VDOB 1Z08A 1AXRA 4XGQA 3AB3A 2AW3A 1WMFA 2NPFA 3P2JA 1ZXBA 1O5OA 2QS9A 5ALSA 4OGGA 3VZBA 2VDNB 3M4XA 3MT0A 4KXXA 5HX7A 4QC2A 3EXHB 1JHZA 3I8SA 1AQUA 4H0FA 3DV2A 2XA1A 2JGDA 1JP7A 3GJZA 4ZRDA 4W7SA 1HEYA 2ATVA 1Y4DE 3TINA 4FX2A 3OCWA 1JAXA 3IP1A 1U8UA 3ZGVA 4O4LF 1OKKA 4LBYA 4EGAA 2BD0A 2JIRA 1JXAA 2MJLA 3EA0A 1LEHA 4UJ5A 1DWQA 4C0JA 1XD8A 3RAEC 2WF5A 4J2OA 2MMGA 1Y6QA 2PJZA 2X2EA 3KB2A 3OMXA 4R84A 3VZPA 1L8XA 3RUDA 3H8WA 5KNCA 4E31A 1QQ6A 2Z43A 3HJTA 2XMSA 1TQ2A 3C3WA 3PQ3A 1QH8B 4L0MA 1LXCA 4R0NA 3R3WA 3M82A 3ZZ0A 4FOTA 3PP8A 4MDEA 4RH0A 1EFDN 2D8AA 3ZUPA 2PU5A 5H02A 2R2GA 1CVLA 1Z8DA 1DRWA 1N6KA 1NYQA 3DFKA 3CXUA 1OFGA 3HDVA 3IHTA 1LX6A 1PVOA 2IHTA 1T3GA 4I55B 4B80A 2SNIE 4LWPA 2ZJ0A 3L4BC 4PE5B 1L5WA 3ZV6A 4RPIA 3CB2A 3GO4A 4OL9A 5BSEA 2B4AA 1SZJG 4R6XA 3U5ZB 2WNHA 5EJ7A 3I6BA 4BYMA 4LEIA 4P3PA 4LXIA 2Z6VA 4I5FA 2OLKA 1A97A 1B43A 2PBZA 4LY0A 2C3OA 1V7ZA 3EIUA 4B0PA 1QR2A 4LZWA 3AYXB 3KYIB 2XRZA 3R9WA 1JEDA 1K3UB 3O73A 4G1UC 4FKMA 3TCNA 3PITA 1JJFA 1A4UA 1CUUA 1XRMA 3H13A 3PQFA 4GPZA 1RLIA 3AY0A 3H9EO 3MJEA 1U4OA 1BX0A 1GADO 2DTEA 1WU8A 1H6AA 4RQUA 5L4NA 3DWIA 4RKFA 2B6HA 3HKCB 3TKYA 1RABA 2AOTA 3F9RA 3ZDXB 3EAQA 2D59A 4ZAYA 1SOWA 1O96A 2PGAA 1E5QA 1WOYA 4Q82A 4WFKA 5HQTA 1USVA 3V8MA 2ZTMA 4RZ2A 3GDFA 2J87A 3HXPA 1JE0A 4M0MA 4PG7A 4DMFA 1H8HA 1USUA 1Y33E 2DF8A 5EIOA 1QG6A 2RHTA 3BQMB 4YO8A 2XVMA 3FJYA 2JIZD 5FKJA 3SC2B 3AIIA 2EX4A 1AVTA 2OO3A 1NATA 5KTYA 4RZIA 4LHZA 3U7JA 4B7ZA 3KYDA 3AF0A 4TZ6A 4AUMA 1CCWA 2IS1A 3ZNNA 3DL0A 1QS0A 2GM5A 4PO1A 4W8OA 1VJDA 3JPWA 4Q4CA 1PJRA 1XNRB 1FFEA 1CUZA 5LSAA 1FNNA 2IU6A 3IAXA 3IAHA 4TROA 4BNTA 1LPNA 1AKTA 1XHFA 1FRFS 5JTTA 4EUKA 5ADUS 1C9MA 1Q5PA 5EC8A 5F1YA 3PXCX 1Q3KA 2R2AA 4IDFA 1UQTA 1FYXA 1TM5E 5KDDA 3HDGA 3DLIA 1CUVA 2PAAA 4B71A 2HHJA 2JFOA 1BH2A 4ZYLA 1XQWA 4KTVE 2UZIR 5K0TA 1W4RA 5K4HA 2XLCA 3I37X 4FDUA 3ANMA 1X92A 2MYPA 1AIPA 4HEA6 3BWVA 4WVFA 4PC6A 4Q9JA 4W5TA 3H5VA 4D8YA 3SX2A 3NIGB 3QNMA 5BVGA 1P5JA 9ABPA 4MHTA 1TYEB 3UJAA 2F3UA 5JU6A 3EVFA 3KE8A 1CF4A 3OCYA 3I9V6 3BCUA 4FR2A 1UBMS 3CJQA 1NQUA 1O57A 1JVBA 1UMBB 2W98A 5TB5A 2LCIA 1O97C 1YDFA 1XXHA 5IUJC 7GPBA 4FWBA 1XEXB 1OI2A 2AFVA 4IH1A 4FKBA 3CVOA 1DL5A 1K7YA 3AR9A 1G8AA 2C0CA 1FU8A 2GTPA 2H07A 2NO4A 3S70A 4BN0A 5CB0A 1ZMRA 3FKJA 2JASA 5JTUA 1B1CA 1L4HA 3IBGA 3IEPA 4L4XA 4MVWA 1TVMA 3T1TA 2CGEA 2YS6A 2MMCA 5IJZA 4BBAA 5FPYA 5LCXA 3E18A 1FLDA 1CY0A 1DKMA 1VL6A 1BS2A 3PD7A 1E2LA 4YHBA 5IX8A 1J2UA 5IJ9B 2UZ4A 3II6X 3OCUA 4GVLA 2HHHB 4QBHA 1D0SA 1DI0A 3FX2A 5BV0A 1UT5A 1ZWLA 2OQRA 4RA9B 2WB4A 4YROA 3OM0A 4S2EA 5J5VA 1CUFA 1OCEA 4J0CA 3FPHA 1KARA 2I6QA 1JEYA 1L5HB 1X7GA 2VYVA 4MJ7A 5DWVA 2P4HX 5GP1A 4EM6A 3W5CA 2FZGA 2B78A 3H16A 4M1EA 3ZV4A 4MROA 2RC5A 2ZZNA 4N0DA 3ROPA 4NCIA 5JDIC 2WP8J 3P5BA 4BNHA 3VR3A 1XZCA 5EGSA 1IOWA 2AF3C 3D6MA 1XRLA 3ZV3A 4OCZA 1GKLA 1N5LA 3VNRA 1GRVA 1U28A 2F59A 4LZJA 5C0OE 4DG9A 4L0DA 1DUIA 1GCOA 4ZV7A 3TF5A 1TU0A 2REQB 3DUFA 1UC4B 1JDZA 4TLLB 1VQ1A 3U9SA 2F64A 5CB4A 4O2AB 4R05A 2AX4A 2C5FA 2QWXA 4KEAA 3QJYA 2ZRAA 1HZZA 3JAWA 4QNMA 1XRPA 2VI5A 3N8NA 5BVHA 4HDOB 3VPFA 2DHEA 2AI3A 4L75A 3SKYA 4B3JA 4DNQA 1HYEA 3K2IA 2QGZA 3P9CA 4D8UA 1E2JA 8LDHA 1SXJB 5CVUA 2TECE 3LBIA 1T6BY 4UZFA 2VHVA 3BRCA 1AUOA 1D6SA 4FZ5A 4H1TA 4GSKA 1W49A 3WGQA 4CW7A 1AQNA 3U7EB 4QU0A 1UDBA 2VDRB 1NUTA 4KAAA 4OQDA 1L2TA 3PD0A 3PFKA 1GTRA 2BHLA 4CKBA 1FJXA 1N2EA 1YZVA 1Z28A 2RKWA 1Q11A 2ADMA 5DYYA 4DA0A 4NBTA 3ANSA 3B48A 1SH7A 3BIFA 4GYWA 1N8SA 4I3HA 3TRKA 3L43A 1D2NA 1T9AA 2ZAYA 3DS8A 4JJGA 5E1BA 4Y0AA 2O0JA 2JF0A 1U1CA 1GR1A 2CXRA 1QCCA 4A8HA 5AM3A 2JD1A 3QFRA 2OMEA 2VKTA 5HKAA 4HPJB 5K03A 4PR0A 4R31A 1OQAA 4EMTA 1OFIA 4D81A 1MNQA 2DU8A 2WLTA 2P6UA 1TF7A 3Q85A 4YR7A 4QU5A 1RPJA 3U56A 4AKGA 1T35A 3DF7A 4NF2A 5A9SA 2AT1A 3NOXA 4GKKB 2PUGA 2O0HA 4O5AA 3A25A 4BNVA 1W0CA 1EINA 1J49A 1GA6A 1R37A 1UPUA 3S5UA 4ZJUA