3GAZA

Crystal structure of an alcohol dehydrogenase superfamily protein from novosphingobium aromaticivorans
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
331
structure length
331
Chain Sequence
PTMIAAVVEEANGPFVLRKLARPQPAPGQVLVQIEASGTNPLDAKIRAGEAPHAQQPLPAILGMDLAGTVVAVGPEVDSFRVGDAVFGLTGGVGGLQGTHAQFAAVDARLLASKPAALTMRQASVLPLVFITAWEGLVDRAQVQDGQTVLIQGGGGGVGHVAIQIALARGARVFATARGSDLEYVRDLGATPIDASREPEDYAAEHTAGQGFDLVYDTLGGPVLDASFSAVKRFGHVVSCLGWGTHKLAPLSFKQATYSGVFTLHTLLANEGLAHFGEMLREADALVQTGKLAPRLDPRTFSIAEIGSAYDAVLGRNDVPRQRGKIAITVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alcohol dehydrogenase superfamily protein
publication title Crystal structure of alcohol dehydrogenase superfamily protein from Novosphingobium aromaticivorans
rcsb
source organism Novosphingobium aromaticivorans
molecule tags Oxidoreductase
total genus 100
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gazA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3gazA01
1I01A 3X2EA 4W7IA 4PLWA 3NT2A 3PHLA 1AXGA 1JA9A 2DKNA 3AW9A 4WCFC 3LF2A 4WLFA 5J23A 1NVGA 3ZWMA 1LLQA 3AUUA 3B1JA 1N8KA 1E1NA 4RLSA 5HM8A 3TZKA 5IZCA 1BHSA 3A06A 4MVJG 1R15A 4KUEA 3ZWOA 3U4CA 1X13A 3DR3A 4R41A 1ULUA 1Y8RA 2WEKA 4M1QA 3F5SA 3PJEA 2WYUA 3JQFC 3GT0A 4WKGA 3RSHA 4L76A 1PJBA 1BTOA 3VZRA 4CV0A 3OA0A 1KETA 2B4RO 2Y0EA 3WMXA 5CDSA 2EW2A 1BG6A 4HNHA 4Z9YA 2V6FA 1AUPA 2P9EA 1Y9EA 4NDNE 4B4VA 5C3MA 1A27A 1LDYA 2O4UX 3PZBA 1HL3A 1LDNA 4HWKA 2B5WA 2FHSA 3GLQA 3FBTA 5L40A 3TZHA 3H5AA 2OUIA 5L7WA 3EC7A 1MV8A 3RBXA 4RF4A 3HHPA 3PWKA 1PL7A 3U4HA 1ZJZA 4N7RA 1DXYA 4PZDA 4R51A 1Y5MA 4U0JA 1GPDG 5JSFA 2H63A 2O2SA 3I1JA 5FI5A 4DREA 4EUFA 1C0PA 2VZ8A 1VKOA 4KUGA 1JQBA 1EQUA 3Q11A 3G79A 3S2GA 1NVTA 3OJFA 1UAGA 3EDMA 4Q3CA 4O6VA 5HWSA 2YV2A 1U28A 2VHZA 2EWMA 2RAFA 2PZKA 3GHYA 3I4FA 4IJKA 1V35A 3F3SA 3AOGA 4IIUA 2X23A 3MTGA 3S2EA 2YV3A 3AY3A 4R69A 3BTUA 2JFFA 3TZCA 4E5NA 1JAXA 2NV6A 1D1TA 3ASUA 2ZTMA 1O0SA 1U4SA 1P1FA 1Q7GA 4PVCA 3O8QB 4BNNA 1Y6JA 3WG9A 4F3YA 4PFJA 2LDBA 1W8DA 3ZHZA 2JAPA 2WM3A 3PHGA 2EW8A 1BRMA 2NVWA 3QY9A 3WTBA 1NVMB 1NFFA 4EEXA 1CF2O 1RKXA 4ZQEA 5IZCC 5IDWA 1FDVA 3H5RA 3EZLA 3D4PA 4TKLA 4Z3KA 2W2KA 3TSCA 3HFSA 5G0UA 4HADA 3ORFA 1OC2A 2OXIA 3A1NA 3RBVA 3WJ7A 2PZJA 3PJFA 1XIVA 1HE5A 4BO5A 5IFLA 3H9EO 2RHRA 2PH5A 3ZWVA 1GY8A 4IDBA 3AY6A 4TMFA 5A3VA 1HDYA 1ZUD1 1V3UA 3SEFA 3H7AA 4XQ9A 2EG9A 3DZKA 3TN7A 1R16A 1EVIA 4E2ZA 4TSKA 1TLTA 3DL2A 2JJYA 4II3A 2DTDA 4J7XA 4O59O 1VKNA 4DPMA 3LC7O 4EYEA 1K89A 4F6CA 4WCDA 4D0SA 1C1DB 1LUAA 3BA1A 4BNYA 1QYWA 5IAAA 3QVOA 4OOEA 4G2NA 1PJLA 4YAJA 1W6UA 1GQ2A 4GGPA 2VUTA 2IYPA 1XR3A 1B15A 1I32A 4E3ZA 4XX0A 3DMYA 3WFJA 2OOSA 1FDTA 2QX7A 4J43A 4JBHA 1ARZA 1GZ6A 3INGA 3IKTA 2ZCUA 3DWFA 1UP7A 4BNJA 2D5CA 1R4MB 5T8KA 3FN4A 2DUWA 5JDIA 4IDAA 1UJMA 4AJ1A 4RZIA 3UKOA 2D3TA 2QRLA 3BHJA 1R4NB 3RC7A 1H9AA 3GGOA 5ADHA 4TRRA 1DAPA 2NTNA 1PS9A 2X0NA 1IHXA 4IDGA 1BSVA 3UCFA 3O38A 3GOHA 3QE3A 4NQZA 1MXHA 2P4QA 4A7PA 3RUFA 3WWYA 3I6QA 2Y99A 1VRWA 5T5QA 1ZCJA 2Z5LA 3QWFA 3GRKA 3D0OA 4EEZA 4CM8B 1A5ZA 4ALNA 4KTVE 1OOEA 4NBTA 1HYGA 4WECA 4DC1A 5B1YA 3WGHA 1FJHA 2WSBA 2EP7A 3K6JA 1YGYA 2X8LA 3O8QA 1HSOA 4IZIA 3E5MA 1IZ0A 1ZNQO 3H6KA 5BNTA 5IF3A 1QRRA 3H2ZA 4UULA 1RM5A 2CNBA 2A94A 1VI2A 3PQEA 4GSKA 4BHTA 2PK3A 4AJHA 4WNIA 5FYDA 1UZMA 2G1UA 4N18A 1WXDA 2JHGA 1P44A 4JJGA 5A9TA 3UN1A 1NM5A 1ZKMA 4NU5A 4E6PA 4IQ8A 3DFUA 4MINA 4GBJA 5EL0A 4P4NA 1HDXA 5JC1A 3PDJA 1HE2A 3UH1A 4OKNA 4Z0HO 4ILKA 4BNLA 1DIGA 4FS3A 3JD3A 4E5MA 2OP1A 1MUUA 1JAYA 4CMJA 2PKRA 4RVUA 2A92A 5EQFA 3RJ5A 1OBFO 3ROPA 4YEDA 3ON5A 5EIOA 4M8SA 4D41A 4J0EA 3UAGA 5KKAA 4XA8A 3BMCB 2I99A 4Y98A 2NACA 2VNAA 3SJUA 3ZU3A 4BNVA 1Z74A 4A03A 2AW5A 4D3DA 3HJAA 2ZTLA 5CG1A 5BSGA 4ROSA 2QIOA 1C1DA 2CDBA 1PJ2A 5IDYA 3LT0A 5DF1A 1X0XA 3ADPA 4YJHB 2OMEA 3MEQA 5TT0A 2HAEA 3BZUA 4MKZA 3QWBA 4IDEA 2YZ7A 3ZCXA 3FWZA 1GV1A 2GSDA 2B5VA 5I9NA 3AM4A 3ZHBA 3ZU5A 3FNGA 1R4MA 3AOEC 4B3JA 3L9XA 1DRWA 1R4NA 1CIVA 1LDBA 2I5PO 2P5UA 2CDCA 3RFTA 3HDJA 3HDQA 3GMSA 4Q3AA 4XKJA 1L7DA 4RZHA 4PZCA 2QYSA 3R0IA 2HUNA 4NBWA 4JGBA 4P4LA 4Y6SA 5EQDA 4NH4A 3QSGA 3F9IA 1VM6A 1LEHA 2PR2A 1DOHA 4YRAA 1N7GA 3PWSA 3MZ0A 1QLJA 2B69A 2VYND 1A9YA 4DIOA 3SLKA 3LC1O 1D8AA 1EE9A 3C7AA 2R2GA 1SC6A 4CM8A 2PD6A 1M76A 5KNLA 3NV9A 1C14A 2YY7A 1RPNA 3GK3A 3AI1A 4FFPA 4R3WA 4W4TA 4LMRA 1KVUA 4MVJP 4LCJA 4H16A 1LNQA 2E37A 3JTMA 2YW9A 1LSOA 1IYZA 1V3VA 2CD9A 3MJTA 1KC1A 4AL4A 1DC3A 4AJIA 1YB5A 4CM4B 1EFLA 3F5QA 4HP8A 4XCVA 4XQGA 2POQX 4WJZA 2O23A 3MTJA 4F6LA 1JDJA 1OAAA 1XU9A 3R3SA 3B20A 2OHXA 4A27A 3V1YA 1XGKA 1XWFA 4CUJA 2P68A 4A10A 2C2YA 2IXBA 2O2YA 2PLAA 3AY7A 3G1UA 5G4LA 3KRTA 4BNGA 4R3NA 4ND4A 1KEPA 1KEUA 5JAZA 2JL1A 2I66A 3EVTA 4GVLA 1PJTA 4JLWA 1IOLA 3INRA 2VUSA 6ADHA 3NT4A 3WX0A 1U4OA 1OMOA 3DEYX 5TS3A 5AQ1A 1YB4A 2OGUA 3D64A 1YS4A 2EJVA 3A9WA 3BMCA 4TZTA 1P3DA 5GZ1A 4YJFB 4U8GA 4J49A 1QR6A 1T2EA 1ZO8A 3GNTA 4AG3A 2W8ZA 4KMSA 2GZ3A 4XR9A 3GFGA 3PHIA 5IN5A 4YJHA 1GD1O 1GZ4A 4DLLA 3K2EA 2AEMA 4IS2A 3ZI0A 1VE9A 1HSZA 4FD3A 2BGLA 3TNLA 3K8ZA 4BNXA 4PG8A 2Y1DA 4UUNA 2JHFA 5CDGA 3CPSA 4L75A 3C8MA 3WB9A 3GZNA 4FJ0A 2BI8A 1HTBA 1KBZA 3FPCA 3TWOA 3QRWA 4HFNA 1UAYA 4DLBA 4Q3BA 3Q3CA 3NRCA 1LSSA 5JE8A 2B4TO 4BIIA 4CV2A 5EN4A 3ZW9A 4DPLA 5K6AC 2BH9A 1Q0HA 1VC2A 2FOIA 4YT8A 2GN8A 2D59A 2R00C 3U0BA 5A1TA 5BNIA 4YR9A 1E3IA 3PXXA 4D43A 4F45A 4OIMA 4QFDA 4MP8A 5DN9A 3CH6A 4CM9D 3ZWBA 4E30A 2V6BA 3LVFO 2X0IA 1ADCA 1HETA 4OO3A 1ZZEA 3DC2A 4CQMA 3U4IA 1K3TA 2GGSA 5I7EA 3SX2A 3C3XA 3ST7A 4WLOA 3UCXA 1V8BA 1P33A 3FHLA 1YL6A 2ZQZA 3GH3A 3WGYA 1PX0A 2CFCA 2DTEA 2X5KO 3OMLA 3R3JA 4CR6A 4CM4A 1GUZA 1I8TA 4J2HA 1HE3A 1U5AA 3ZU4A 4NK5A 2VCYA 2WE7A 2ZK7A 3HADA 2Q99A 4WLUA 4KTTE 1I3NA 2RH8A 4BQRA 5CDTA 3C85A 3ENNA 1PZGA 1SEPA 4B7XA 3GVXA 4FW8A 4EJ6A 3LLSA 3H9UA 4QX6A 4PLHA 4XGKA 2BD0A 3FBGA 4DA9A 2AE1A 1X7GA 3FCOA 1DC6A 2O7SA 3PFWO 4W6ZA 1B0AA 3IKVA 4LISA 1E6EA 1ISIA 4FFLA 1F12A 1B16A 1LQTA 1UP6A 1Z7EA 4NU6A 3VAZA 2O3QA 2C59A 1TA4A 1NNUA 1Q7CA 2ZKLA 2V6MA 3CZMA 3KEOA 4YJFA 5CPBA 5EINA 5KIAA 1ULSA 4JQCA 3JYLA 4RGBA 4C7JA 5JLAA 4CV1A 4ZRMA 1I24A 4YT4A 4NPCA 4A73A 3UF0A 4RJTA 3HNPA 1ZSVA 1OZAA 3LLVA 4HKTA 4KZPA 2HJRA 3DBHA 1T24A 3Q1LA 4UUMA 5B4TA 3P7MA 3B6ZA 1I0ZA 3I9LA 4PGFA 1V9LA 2HMVA 4CLEA 1U7HA 3V1UA 4PLPA 1PL8A 2JD1A 4BNFA 3Q2IA 2HMWA 1B2LA 3EGOA 3LC2O 1UZNA 3OJEA 2IEBA 2I65A 2O3TA 4ND1A 4NBUA 4I1IA 2VQ3A 3KSZO 2C29D 3BTOA 1LQUA 4FGWA 4Z3DA 5KTKA 4Q3DA 2ZIZA 4RDIA 3PYLA 4W82A 1ISJA 3IP3A 2PKQP 3PLRA 4E33A 5CEJA 1KVRA 2OBYA 5DOZA 3E03A 3P2YA 1GTMA 4M55A 3WQSB 5JMWA 5IDQA 3JQBC 3L6EA 4IZHA 3F4LA 3ANLA 3U62A 4BS9A 4E12A 2JFHA 1C0IA 3PRJA 3LT2A 3DMTA 4NHEA 1SOWA 3BMOB 4W99A 3AUAA 3WMWA 4XZ3A 4BGVA 2BHLA 2IE0A 4XIJA 4GVXA 4NJMB 2NWQA 2VWHA 1X0VA 4OSPA 3HE3A 3P2OA 5HS4A 1SEVA 3Q9NA 2XOXA 4P4GA 4WCFA 3D4NA 4DL9A 1A72A 1IPEA 4MVJD 1LRLA 4NFSA 4L74A 2RCYA 2DAPA 3QWIA 4MVJF 4D3SA 2Y1OA 1E7MA 1ZK2A 3I9KA 3EK2A 1BVUA 2EIHA 3JYOA 1F0YA 1M67A 9LDTA 1JVSA 3CMCO 3ROMA 3FD8A 1NPTO 1E7WA 4LVUA 1J0XO 2YDXA 4RPJA 5HTOA 5DT9A 1RYEA 2F1KA 3HB5X 1U3TA 1HDZA 4BKOA 1EQ2A 4TRMA 1X15A 3L6OO 2O3UA 6LDHA 5KOIA 3AI3A 1GPJA 2X6TA 3WS7A 4Q9NA 1R12A 1V3TA 1O5IA 1TXGA 2GO1A 3RKUA 2PWZA 4BKQA 3GA0A 2AQIA 1QV7A 2BFOA 4MVJE 2Q3EA 3K73O 1YBMA 3ITDA 5CEEA 4UUOA 1B8PA 4AVYA 3DZGA 4EJ0A 4Z6KA 3GFBA 4BGIA 1SZJG 2BRUA 4GMGA 4BB6A 3VZSA 2X9VA 1ID1A 3L4BC 4NK4A 3JQ9A 3GN1A 3PHHA 4YJDA 4DRYA 1NR1A 1I2BA 1ENOA 2WYWA 3GC6A 3AFMA 4B4UA 2YHUA 1VJTA 1N2SA 4FJ1A 4E2WA 1Y9AA 5B37A 1ZEJA 2IYOA 2GNAA 1H2BA 3W8DA 4CMCA 2XXJA 1PL6A 4E0BA 5LCXA 4HFRA 1E3JA 3NT5A 3WIEA 3WBFA 4U5QA 3NTQA 1E0DA 3P19A 5F5NA 3LT1A 4U6SA 3KB6A 2YFQA 5EESA 2VRBA 3VDQA 5KVCA 1ZW1A 4TVBA 4WASA 5IG2A 2G82A 4IXTA 4RPHA 4L0QA 4WK6A 4BNWA 1O95A 4YTEA 2Q1SA 3DMTC 3BMOA 2ET6A 3DZBA 1Y8QB 4RPKA 2C7GA 1EMDA 1L7EA 4NJMA 1YRLA 1BDBA 2IEDA 4MVJI 4OH1A 2HCTA 5TT1A 1K0UA 2Y05A 3ZWCA 3JQAB 3OIGA 3QLJA 1XYGA 3QHAA 3PIDA 5CAEA 3VPXA 1H0KA 1PSDA 4OGWA 5EMHA 2DBRA 3OEWA 3VPGA 2ZJ1A 2ZTVA 1DC4A 1ZSNA 5H81A 1R0KA 1NTOA 1UDAA 3FPLA 4FB5A 5TF4A 2DPGA 4PG5A 3D5QA 4PRKA 4YAIA 4WNCA 3T7CA 3U4DA 4RF3A 1YKFA 1D3AA 1DEHA 3NYWA 2EGHA 4UEKA 2C07A 2J5QA 1JWAB 2EP5A 5AXCA 2O3RA 1HDCA 4ZJUA 5A05A 1HZJA 4BO9A 1QKIA 4W7HA 1LSJA 4HX5A 4CODB 1PR3A 1Y7TA 3QIVA 3PVZA 1IPFA 4EI2A 1NQTA 2UAGA 1LRKA 3VH1A 1KY4A 3FTNA 4PLZA 1UZLA 1NAIA 2NU6A 3ONFA 5EJ2A 2VT3A 3TZ6A 1CQJA 1QLHA 5FFFA 3FF4A 2QZZA 3SBOA 4D46A 1N7HA 3NJ8A 1R66A 5A3JA 4GSLA 3R6DA 1FXSA 2J5KA 2CVOA 5L7TA 1UXKA 1LU9A 1IY8A 2NTJA 3GQVA 3JQ9C 1ZK1A 4R1TA 5F1KA 3TFQA 3ZDFA 4CPDA 2DBVO 3DAGA 5ILOA 5AXBA 4YAKA 3BTSA 5U4QA 3I9NA 4B4OA 3N7UA 3RUEA 2NUAA 5C7OO 1SAYA 4CMKA 5DCUA 3T7EA 2WJPA 2Y93A 2B4QA 2OBNA 4PVDA 4RVGA 5AYVA 2YQ4A 3EUWA 2BFMA 2NU7A 3A28A 4FJ2A 1H94A 4BNMA 5BNFA 2CF6A 1RWBA 5U1PA 1I36A 4BMNA 3I5MA 2ZB4A 4MVJM 2H5LA 3QWAA 2OP0A 2DBZA 3ULKA 3EW7A 1M6HA 2UV8A 4FSHA 1UDCA 5TX7A 1E3SA 4OOFA 1HDRA 1Y8QA 2VYNA 4X54A 3OBBA 1JWBB 4Z0TA 4PLGA 5I7FA 1WWKA 2C5EA 1JLLA 4PLFA 3GEGA 3UVEA 2YDYA 1QG6A 1FDSA 2GN9A 3DTYA 3MJEA 3U9LA 3FNEA 3KSUA 4U6QA 1I3KA 3JQAA 3OP4A 2Q2QA 3ABIA 3RASA 5JFOA 3VPFA 4PCVA 4D79A 3DDNA 3ENKA 4N5LA 3I52A 4IPTA 3IOYA 2XAAA 5KJEA 1NHGA 3BIOA 2F00A 2DTXA 2QRJA 4RV9A 5C7IO 1SPXA 3ZWPA 4Z9XA 5G4KB 4AICA 3K31A 1ZH8A 5L53A 2DPHA 2CUKA 3GVIA 4DIBA 4ND3A 2EXXA 5KJFA 1DIHA 2PH3A 4ND5A 3CINA 1ZXLA 4J1NA 3GVCA 2AXQA 4Q39A 1W4ZA 1EDZA 2J3IA 1JVBA 4IQ0A 1CJCA 1AE1A 3GRPA 4LW8A 1WDLA 1YOVB 3NKLA 4XRRA 1YL7A 5GZ3A 2VN8A 1SBYA 3IJPA 1JTVA 4J2OA 2PA3A 4ZVVA 1B3BA 1ENYA 5JAQA 4TWRA 5HS6A 1KOLA 4XYGA 2UUPA 4XYLA 1JKJA 1GEGA 3WYCA 1ML3A 1K6XA 1T4BA 4Q3EA 4G65A 4GL4A 2VOJA 4Q3NA 4B4WA 4BO0A 5A06A 4IS3A 3ZGYA 1FDUA 1EDOA 4DTIA 3DZHA 3RUDA 5JAIA 3GDOA 1HXHA 3ZWYA 2JAHA 4CMEA 1GYRA 3U09A 1DJQA 4PRLA 3ONEA 2H9IA 4KUHA 3AOEA 4ALJA 4YAGA 2J3JA 1GV0A 1S6YA 1T1SA 3DBLB 2AHRA 5ILGA 1A4UA 3BHIA 4ITUA 3RD5A 1GDHA 1U2DA 3PGJA 3H65A 1BWSA 3DOJA 4J9VA 4R1SA 3TDKA 1WDMA 5DDIP 2BF7A 3ZNPA 1QYVA 2PGJA 1WDKA 3W8FA 2IZ0A 2WD8A 4DPKA 4E13A 4MKXA 4G81A 5A9SB 2VTDA 3ROQA 1B8UA 5HRUA 3W4IA 1EE2A 3L4SO 1Z75A 4CM9A 2P9GA 1K5HA 1MB4A 1MFPA 5I8ZA 2EEZA 2EKLA 3FNFA 3JCZA 2X9GA 1XSEA 3UFXA 2J5RA 3CKYA 2CZCA 2BLLA 4NFYA 2NNLD 5F5LA 3C1AA 2FN7A 5I7VA 1PEDA 2BMAA 5G0TA 2X58A 1P31A 4W9NC 1U1IA 2RIRA 4UUPA 4YDRA 3AU9A 3NTOA 4YRDA 2Q1UA 4N5MA 3H5NA 1GEEA 3DHYA 1MG0A 2JD2A 4DC0A 4ZGWA 3H9QA 5DCYA 2WWRA 5L9AA 4QTZA 4PN3A 2GN6A 5T64A 3VKVA 4ZQGA 3G1TA 4NIMA 4XYEA 1UXGA 1VL0A 1BXGB 1PWXA 5FEUA 5DOVA 3E6AA 1K6JA 1U8XX 4OM8A 1NXQA 5DCWA 2D4AA 3PYXA 4IINA 3C1TA 1C1XB 1YOVA 1C0LA 4E4YA 3HN7A 5C37A 2C20A 1ADBA 1X14A 4XDYA 1GQQA 4BO4A 4EJMA 2VWQA 4PLTA 2QQ5A 1HKUA 4JX8A 2AQKA 2X7HA 4RVHA 4BO2A 4HY3A 2WMDA 1IUKA 4IM7A 1DIAA 1H93A 3AUTA 3IP1A 3WGGA 4BNZA 1G0NA 1CERA 2NSDA 5CP8A 5G0VA 2GLXA 3G3EA 3WR5A 4TVOA 4CMEC 4LSMA 3LQFA 4CUKA 1WW8A 3RUAA 1N92A 1LC3A 2CSUA 3QVTA 1LDGA 4R4JA 4E2YA 3F1LA 1ZBQA 4FGSA 3GUYA 1LDEA 4QO7A 1EVZA 3HFGA 3JQ8B 3QVSA 4U0KA 5K6AA 2DQ4A 4ESOA 4BNUA 1KEVA 3ASVA 3PDUA 5L45A 1NFRA 1P1RA 1VL8A 2Q45A 3ZV5A 2R00A 3AK4A 2CVQA 3ETEA 1QYDA 2Y0CA 4XD2A 4DWVA 1EEHA 2I3AA 1IULA 2A35A 4PLYA 1E7SA 2PD3A 2UYYA 3E82A 1O8CA 2D0IA 5A9SA 1EK6A 1GYQA 3EVNA 4J9UE 5DBIA 1P74A 1E5QA 3ROKA 3JQAD 4JROA 1HYEA 4IDFA 1KY5A 3CE6A 4J3FA 1MFZA 4JN6B 1PQWA 5CPFA 3RQSA 5DNAA 3PJGA 3WTCA 1E3EA 1M2WA 1P45A 2EF1A 4GKVA 4OQYA 5ER9A 1HLPA 5JAMA 3B70A 2V7PA 1NBOA 3IMFA 2IDZA 3BXXA 3MJVA 4IY1A 5JY1A 4KDFA 4OMUA 2H6EA 1Q0LA 2X22A 4OYRA 3I9OA 4LK3A 2YQ5A 2B83A 3OSUA 1Q7BA 3PLNA 5JBIA 3AM3A 5EERA 2Y1CA 4MVJA 2G0TA 3KHUA 2G76A 3FWNA 4GLLA 2CVZA 4FDAA 3S2FA 3NTRA 1NPDA 4NBRA 3SVTA 4KWIA 4BNKA 3UOGA 1RM0A 1I33A 1G0OA 4AJLA 3K2BA 2DFDA 3PEFA 1J5PA 4YVFA 2TMDA 5L4SA 4BKPA 2LDXA 3IJRA 4CMIB 4MP6A 5CDUA 1A9ZA 1C1XA 4J90A 3KBOA 1ZFNA 4O0LA 4B3IA 1FDWA 1SCUA 4O1MA 3HB4X 1ISMA 1MLDA 4M54A 1ISHA 1OC4A 4K1LA 4QSMA 1ZVMA 1YBAA 2GRAA 2GZ2A 3I4CA 3NX4A 3WGTA 3TQHA 3CMMA 1KC3A 3ETDA 1QORA 1X7HA 4R5HA 2PZLA 1LI4A 1QXSA 2ZTUA 4PIVA 4XDZA 5JXWA 3H3JA 3K30A 3P5SA 4INAA 1T4DA 1G1AA 3OQ1A 4J1SA 2NLOA 2IODA 2G17A 2DC1A 2WYVA 1LLUA 1LRJA 4I5FA 2A9FA 1BXKA 2FR0A 4BO6A 5JNLA 2FRDA 4OAQA 1TT7A 1T25A 2FR8A 3DFZA 1FF9A 2O3SA 3DBRB 4A5OA 3MOGA 3JQ8A 2DFVA 3RROA 4DQVA 1DSSG 1E7RA 2WTBA 5HA5A 4LRSB 4CUZA 3RC1A 1XU7A 1J4AA 2OFPA 3GGPA 1RJWA 2P5YA 4WUVA 1KEWA 1H6AA 1YDEA 3BHMA 3LU1A 3DB2A 4FC6A 3JQBA 1NPYA 2TMGA 1GFSA 3G49A 3TOXA 3O4RA 3DONA 4K26A 1ZIDA 1K2WA 5BSFA 5KJ6A 4WE3A 3E9MA 3SC4A 3B1KA 2VHVA 4MVJH 1AHHA 3PWZA 1TVEA 1ONPA 2HDHA 3LK7A 4YPOA 1SNYA 2X0RA 3KTDA 3JYQA 2HK9A 2PGLA 4MOWA 3WIDA 4D7AA 3E48A 4CM6A 4S1VA 1CQIA 1AGNA 2BGMA 4I9HA 3T4XA 3ZNNA 3TL2A 1NFQA 1KVTA 2V65A 1EVJA 4MPDA 4BMVA 4HV4A 5BQFA 1PR9A 2AA3A 4BNIA 2Z95A 3TPCA 2O7QA 4PG7A 4RDHA 3ZWWA 2O50A 4DMMA 2ZQYA 3ANNA 4PG6A 3WNVA 3OM9A 3GEDA 2CDAA 5CG2A 4NG5A 3VH2A 1E1LA 3GVPA 2ZB3A 4BGUA 3PZRA 3VPHA 4QQRA 2UDPA 4JJFA 4CM5A 3JQ6A 2I3GA 4FR5A 1P1IA 3GDGA 1U3WA 2YFHA 1UXJA 1HDGO 4TKMA 3KZVA 4J4BA 4J7UA 4IDDA 5IXYA 1HE4A 3L4BA 1U8FO 4ALLA 3D1LA 1PJSA 3JD0A 1LA2A 4WLNA 4YJGB 5ENVA 2GYYA 3PI7A 1K6IA 3CUKA 2E6UX 4ZQBA 1LLCA 1XELA 2NVBA 1CETA 4GWKA 4JK3A 3DBRA 5JC8A 2A4KA 1BDMA 1GZ3A 2E4AA 2Y68A 3QV1A 5KVQA 2X5OA 2YV1A 3CZRA 1DHTA 3Q2KA 3UICA 1YWGO 3ZNOA 3TOZA 1EBFA 1QMGA 3KLPX 4FOOA 3D5TA 4EDFA 3JD2A 1IHYA 3C7DB 3EY4A 5JDCC 3FNHA 3S2IA 2DBQA 5K1SA 4C7KA 2NU9A 4II2A 3K9QO 4DYDA 3W1VA 4BV8A 1NQ5A 2NQ8A 3MJCA 3VVCA 1VSUA 2C7VA 4R5MA 5ITVA 3OETA 4CMHA 2VZ0A 4GX2A 3RC2A 1NHWA 3OQ6A 3V2GA 1DIRA 1KYQA 2D8AA 4L73A 2W98A 1X1TA 5IN4A 4BO7A 5ITWA 4A0SA 1I10A 1E3LA 4IMRA 4Y6RA 4JIGA 4IBOA 3IUPA 3TRIA 3FI9A 3FRJA 2B37A 4ZN6A 3KEQA 4UREA 1PZFA 3DQPA 2BI7A 2BELA 1RM3A 4TROA 1PGQA 3RUHA 1QYCA 4UVIA 4FFMA 2Q46A 1JN0A 3D7LA 2NM0A 3NGLA 1BGVA 3VKUA 4DGSA 3HN2A 1F8GA 3VH3A 3RCBA 3GVHA 5CFZA 4OQZA 1UDBA 3I9MA 3CIFA 4ZQHA 3SJ7A 1U3VA 4I9NA 4IDCA 1L1FA 1UXHA 5I8WA 3M2TA 1X1EA 1YQXA 9LDBA 4EGFA 5JY6A 3VDRA 1PGPA 4RLHA 3ZHYA 1ZSYA 5KVVA 1ISGA 1PU2A 5TLSA 3E9NA 3OIDA 3WLFA 1GADO 4AJ4A 3CSDA 4B79A 2ZYGA 1IE3A 1MGOA 4R68A 1Y8RB 4RORA 3V2HA 5AOVA 3VTFA 2GASA 4WLVA 1ADFA 2VHWA 4CLOB 1WP4A 2HKIA 3LYLA 4HNGA 3WYBA 2QYTA 3TF5A 2EKPA 1B7GO 3WGOA 3T4EA 2FSVA 4XIYA 4YJGA 3NDJA 4XWYA 5DP2A 1X7DA 4ID9A 1PS0A 3ZWAA 1P77A 4DYVA 7MDHA 1XEAA 2OL4A 2I67A 2ILTA 5FWNA 1C3VA 3PQFA 5T67A 2HO5A 3FTPA 3JYNA 4JP2A 4JXKA 3ZV3A 3KYBA 4GWGA 3H3FA 3OIFA 3DOCA 3MOIA 3G0OA 2Z1NA 4D3FA 2CMDA 3OICA 1E3WB 1T1RA 5G0WA 5TGDA 4OJNA 1M75A 2WE8A 3K5PA 4IJUA 1PGNA 1EZ4A 3VPSA 8LDHA 2VOEA 5DULA 2C54A 2X0JA 3HG7A 3D3EA 3KOUA 2GPTA 1Q0QA 1QSGA 2VUUA 5ES3A 5TRTA 3DHEA 2X86A 3VZQA 3MJ4A 3GUCA 2Q49A 1GU7A 3K92A 4BNHA 1EUCA 1P1KA 4WEOA 4LGVA 1F06A 2VYVD 3NDRA 1R6DA 4FFNA 2UVDA 3AM5A 4QECA 3C7CB 3GHHA 1NWCA 2VRCA 3QVXA 4N5NA 4XGIA 2P91A 2Q1WA 4CL8A 1LLDA 3IL2A 2B36A 3L07A 4JBIA 1P1HA 1FMCA 2FPPA 5B4VA 3RI3A 3WGIA 3VHRA 3ZV6A 3KVOA 3CEAA 1EBUA 4PLVA 1TB4A 2D1YA 2J3KA 3DOOA 3S8MA 3V5NA 2IZ1A 3LZ6A 3F46A 1HLDA 4OSOA 3I23A 1PJ3A 5CEFA 5JYDA 3IQDB 3ADOA 3KSDO 4E5PA 4D44A 3WNQA 4ZA2A 4CR7A 2EGGA 1DFGA 2FZEA 2GUGA 4EITA 4ZHSA 2DT5A 3Q6IA 2BFPA 4A26A 4C4OA 4L4RA 2I6TA 5ICSA 2BGKA 2EHDA 3C24A 4FIZA 5F21A 1KS9A 2HU2A 2HQ1A 1RYDA 2W2KB 2ZB7A 3FR8A 3H2SA 3ZWNA 2IZZA 5DP1A 4MIYA 5T6BA 1LC0A 1E6UA 3QQPA 4BB5A 2YHIB 4YT2A 2GZ1A 1PJQA 2CY0A 2O4CA 3DZFA 4IGEA 4CLOA 2RBEA 5U9CA 1Z7BA 4XB2A 3OJ0A 2YUTA 4URFA 5L3ZA 3RWBA 2B35A 4WGGA 1YB1A 3ZV4A 5BT9A 1NQOA 4IXWA 1DRUA 5G2OA 3JQGB 3W4KA 5A04A 4BO1A 1M66A 3M1AA 5EPOA 1WPQA 4L4SA 4WOJA 3GY0A 4YA6A 2P2SA 1SB8A 2Y1EA 5KCZA 5LDHA 3GZ4A 1LDMA 1EVYA 2W2LA 3NDIA 4DBZA 1Y5RA 1SB9A 3WBBA 3IC5A 4LRTB 1E7QA 4I5DA 3RJ9A 3STHA 1E3WA 2NADA 1A7AA 4K6FA 1EK5A 5JO0A 3D3WB 3FR7A 1Y81A 3JQCA 1R37A 2VHXA 5FF9A 4J1TA 5THKA 3RUCA 2PD4A 3PYMA 3JD4A 4M89A 2CF5A 3L9WA 4J7CA 4U7WA 3KM0A 4D0RA 1EUDA 3M1LA 4CJXA 3OH8A 5THQA 4YAEA 2AQHA 1QP8A 1DO8A 1D7OA 2X1HA 5K9ZA 1B8VA 2GF2A 4N54A 2PNFA 1U7TA 2W4QA 3HUDA 3ICPA 4GX1A 4IQGA 5I9LA 2NTVA 1GUFA 3LDHA 4BQPA 4UVGA 4W9NA 3GAFA 3MWDB 4B3HA 1MXFA 1YJ8A 1CRWG 5C7LO 2FMUA 1PZEA 3NJ4A 5B12A 5TIIA 2Y0DA 3WICA 3LSYA 3OHSX 2HRBA 3GN2A 1GAEO 1H5QA 2D2IA 3HDYA 1VJ0A 2NQTA 4M49A 5MGBA 4XJTA 1F17A 3WQQA 4LN1A 5A5FA 4CLRB 2YJZA 2I76A 5G0SA 3TJRA 1S7CA 1MX3A 2BKAA 5JW6A 4CV3A 4DBVO 3L6DA 4H3VA 1GR0A 4GX0A 4WOKA 4UVEA 4H7PA 4J91A 1ZK3A 1KVSA 1Z45A 2RH4A 3HQ4O 3WSVA 5L7YA 3GNQA 2YHIA 4YQZA 3SXPA 4RCVA 1AHIA 2G5CA 5AVOA 2XF8A 5A4DA 5I9MA 2FP4A 4GPD1 4AJJA 1I2CA 3INTA 1O9BA 1KVQA 1UP4A 2X4GA 4I8XA 3VTZA 2FY8A 2HLPA 4AJKA 3RU7A 4ONEA 3JQGA 4MKRA 1BMDA 1D4FA 1KERA 1WMAA 4M86A 4QUKA 4BKUA 4CM1A 4E2XA 1PIWA 4R1UA 4YXFA 5A9RA 3ZHXA 2Y1GA 4I5EA 1LX6A 1SOVA 1XQ1A 1HEUA 3EHEA 4M87A 3L77A 3MCVA 4HFJA 2GR9A 4FCCA 1R0SA 2GD1O 3NGXA 3KXDA 1Z73A 4DQXA 1I3MA 1HDOA 3AWDA 3D3WA 5I7SA 3D4OA 5LC1A 3KO8A 3DZJA 3ZH2A 3WGQA 3KLMX 1XKQA 3NUGA 7ADHA 3JV7A 8ADHA 2PGDA 3EYWA 5AXDA 4AJNA 4BMSA 4MO2A 3AI2A 4WPGA 1PJ4A 1WNTA 1NAHA 2WD7B 2QZ9A 2VRCD 3EAGA 4YCAA 3DTTA 4K6CA 3WWZA 3N58A 4GQAA 4CLHA 5L95A 1PZHA 3OA2A 1PTJA 3AFNA 1UUFA 2Q2VA 3EZYA 3SLGA 1IZ9A 1XG5A 3GF4A 3DZIA 4DIFA 3H4VA 2AE2A 3GMDA 3HWRA 4QEDA 1T26A 4BNTA 1DHRA 2Y1FA 1R0LA 5G4KA 1DLJA 5ENDA 1E7YA 2EKQA 2FWMX 3DHNA 3F4BA 1ZXBA 1E1KA 1ORRA 2O3JA 1H9BA 1ISFA 1HRDA 2X5JO 1OFGA 3UHAA 3DAFA 4PLCA 4GH5A 4CLRA 2HMTA 1UR5A 2DM6A 1DDOA 4LCEA 1SMKA 4XYBA 1WZIA 1O89A 1ADGA 3NEPX 2AEJA 4KQWA 4OHUA 2H1SA 4YRBA 4E32A 1CEQA 3HDHA 3QWHA 3CTMA 3ZW8A 3JQEA 3WGZA 4G5HA 2NU8A 1VLLA 3H9GA 1DRVA 4YYZA 4OL9A 3TZQA 1JKIA 3W4JA 2J6IA 1W73A 4P22A 3GG9A 4J4TA 3U49A 4BKRA 2HMUA 1JKFA 4I9UA 1WMBA 2PY6A 4RVFA 1ONOA 1U3UA 3KV3O 3O03A 4XGNA 1D1SA 1B26A 2AG5A 3RFXA 4B8WA 2W2LD 1GQYA 4DMLA 2GDZA 3GG2A 4UEJA 4ND2A 4A2CA 4IJWA 3UCEA 4IMPA 2FPGA 2OZPA 1U2GA 3F6YA 5KJ1A 4BV9A 5MDHA 4R54A 1TI7A 1BW9B 4J6FA 4RF2A 3DBLA 4RO0A 5TSDA 4J16A 3WLEA 4MP3A 1T2FA 3I83A 4BL5A 3DO5A 3VZPA 5L51A 3L0DA 3ZN2A 3M6IA 3KYCB 2PTGA 1YBVA 1MA0A 3BMNB 2JKVA 4BUCA 1NR7A 4IJVA 5IJZA 2Q2WA 4YB8A 4I08A 3PK0A 4EZBA 5FI3A 4CLXA 5F1OA 1YQDA 5DBFA 4Y9DA 5TJ9A 3GZNB 4XQCA 5T8KC 5JDIC 2HK7A 2WD7A 4UVHA 1DFHA 1T2DA 4Y67A 3F1KA 4R01A 3WFIA 4OXNA 4P8RA 1N1GA 2WDZA 3PP8A 5A03A 5KKCA 1BXZA 1OI7A 2P9CA 2QRKA 3COSA 1DBVO 2VZ9A 1Z6ZA 4QXMA 3BMQB 1U9JA 5ER6A 5LDGA 1YJQA 4GKBA 1ENZA 4DQUA 2QHXA 3RIHA 4F46A 3FSRA 3VC7A 4CM7A 3U3XA 1XLTA 2X9NA 1LXCA 4XR4A 3E5RA 2J3HA 1JU9A 4B8ZA 5KWEA 3KYDB 5ICMA 3A14A 1V6AA 5KVSA 4MIEA 2E49A 4JBGA 4MIOA 4L8VA 3PJDA 1VJ1A 1B14A 3AJRA 4CQMB 4WLEA 4XJSA 3V1TC 1VPDA 4DLAA 2VNSA 4B7UA 4NNJA 4JJIA 4O63O 4EUHA 1IB6A 4NBVA 1BXGA 3AUSA 5COAA 3IUSA 5T57A 3VOSA 4UAGA 5TJHA 5IXSA 1N5DA 5KJCA 1MC4A 1WZEA 2B0JA 3EMKA 3B1FA 4OKIA 3WOHA 4CM3A 1I3LA 1DC5A 4LSWA 3JQ7B 4R1NA 3V8BA 3O9ZA 1NQAO 2JD0A 1ZK0A 4E5KA 4HFMA 4J0FA 4DVJA 4ZU3A 1CYDA 3HZZA 4CMAA 1EUZA 3PHJA 3OFSA 2VHYA 3ANMA 4B7CA 3O26A 1N1EA 4CLDA 3ETGA 4FN4A 1LBEA 1P0FA 1NP3A 1W0CA 1I5RA 1DLIA 4RQUA 3ZWXA 4BOYA 3IIEA 4FFRA 4RF5A 1E5LA 1DIBA 2EJWA 1TEHA 2DVMA 4RVDA 1N9GB 3WQRA 5A02A 5COBA 1LJ8A 4BO8A 3JSAA 4AJ2A 1V0JA 1BW9A 3ZNQA 4YWJA 1AN9A 3I6IA 4QT0A 4R9SA 1NWHA 2I9PA 4CR8A 4Y8VA 3ZZNA 1NYTA 1P1JA 4TRNA 5BR7A 3PIIA 5L4NA 3KYCA 4TRJA 4H15A 3BMNA 2FPIA 4MDHA 3DBHB 1U5CA 5JDCA 3AU8A 5IDXA 5H83A 5L4LA 4K9DA 3E1KA 4CQLB 1J6UA 1DAOA 1WAMA 1WLYA 4ZQFA 1KIFA 2RHCA 1P9LA 3SC6A 3WSWA 5C5IA 1H6BA 1PQPA 4GI2A 3C1OA 4CL3A 3H8VA 3JYPA 4JNKA 3E8XA 3V2UA 2HSDA 4GLOA 3QP9A 2V6GA 3OJOA 1F14A 1DPGA 1O6ZA 2XXBA 4RPGA 3W8EA 4XQEA 1UXIA 1Z82A 3RBZA 3PGXA 1M6WA 1HT0A 1ZK4A 2PFGA 4FPXA 3BMQA 2BFAA 1TT5B 1PGOA 2YYYA 3UUWA 2DUUA 1ENPA 2AMFA 2VYVA 4KOAA 2E82A 2AQ8A 3OECA 4YT5A 3N74A 1H6DA 1GL3A 1XQ6A 4K28A 3KYDA 2GERA 4KP7A 2HK8A 5AXAA 1PJCA 2Y67A 2ZATA 2Q1TA 2ZB8A 3DBVO 3RFVA 1GCUA 4IUYA 4NMHA 5HBRA 4DUPA 4AJEA 3WJAA 4RL6A 4PZEA 1PQUA 2FR1A 4LVCA 4FFOA 1UH5A 2OO5A 3G17A 4HXYA 1XCBA 4AFNA 3GR6A 5JCJA 2UUOA 4WCFB 2Y66A 1I30A 4HBGA 1A7KA 4NZ9A 1VSVA 2Z1MA 3W6ZA 1WVGA 3JQ7A 4MJLA 4CMIA 3WDSA 3ITKA 2DLDA 3GAZA 4ZICA 4RPLA 3K96A 2NVUB 5JPIA 2P4HX 1CDOA 4RQTA 4E31A 2VWPA 4IGFA 1PGJA 4Z0PA 3GEMA 3BTVA 5BSHA 3OQBA 2D5AA 1YDWA 3I9JA 4ZD6A 3A4VA 5CHEA 2EV9A 4OXYA 2J8ZA 3GPDG 4ALMA 3TFOA 2SCUA 5DBGA 4YQYA 5F1PA 3HSKA 1N9GA 2Q4BA 1I2ZA 2AG8A 4IIVA 2R6JA 1PS8A 1HZZA 3VH4A 5IZ4A 3WYEA 3M2PA 1HYHA 2HMSA 3MWEB 3TL3A 4FBGA 3E18A 3H9JA 4L4XA 4OXKA 1XDWA 3F47A 4L9RA 1QYXA 1B3RA 3QW2A 1T2AA 4R9RA 5TNXA 4J4HA 1C0KA 4GX5A 1A71A 1YQGA 1LSUA 3ONDA 3IS3A 1P0CA 3QA9A 3E9QA 4Y6PA 4CQLA 4YACA 1GCOA 1CWUA 4HUJA 5JCXA 3DXFA 4KWHA 5TQVA 4E5YA 4EUEA 1ZEMA 4NI5A 4R16A 2PKQO 1LTHR 3IDSA 1E92A 4BVAA 1PWZA 5TC4A 4D45A 5F3RA 5BSEA 4KDEA 1DB3A 3MJSA 4NR0A 4GGOA 4S3MA 2C2XA 1YH3A 3RVDA 4AJPA 2XPCA 1G6KA 1TT5A 3GDFA 4FOSA 3UGKA 4JP3A 1MP0A 4XYMA 5H82A 2GN4A 1F8FA 3UXYA 3UW3A 4KQXA 4CMBA 2EERA 1H2HA 3PPIA 2JFGA 4I5GA 1MC5A 2FZWA 4YBZA 4ALIA 2ZCVA 5K0ZA 3RAJA 4EBFA 3VVBA 2QG4A 3OJLA 4WEQA 5B4UA 1JW9B 3X2FA 4GAEA 4TZKA 3WXBA 3JQDA 5A5EA 4BGEA 2JCVA 2FSSA 4UEOA 5GZ6A 3KETA 1NASA 2HRZA 2O48X 2VWGA 3GPIA 3IAHA 1E77A 3R1IA 3ZU2A 2GCGA 4NFHA 4XEHA 2C0CA 3BYZA 3OEYA 3RC9A 3RU9A 4DXHA 2NVUA 4GMFA 1YONA 1ONNA 1AXEA 1Q1NA 4NJOA 4QFCA 2E48A 2JCXA 4EW6A 3S1LA 4O5OA 1A4IA 4FC7A 4BO3A 1EFKA 1XHLA 1Q2XA 3JQFA 5GY7A 4JCOA 1HF3A 2IRWA 1YE3A 1ZMTA 5GMOA 3W6UA 1ZJYA 1ZMOA 2OORA 4FQ8A 4XRGA 1H6CA 1RM4A 2IXAA 1SO8A 3BAZA 1FK8A 4AJOA 5JS6A 3ICCA 1DFIA 1E6WA 5CDYA 3QVWA 3NAQA 4TQGA 2QW8A 1GUYA 5DZSA 3U5TA 3DAPA 3Q0EA 4UVDA 3RKRA 3S55A 4QO8A 3PFFA 4D42A 1GYPA 1MG5A 3RUIA 3LF1A 1E1MA 3PTZA 3QJ5A 4ALKA 4PG4A 2VTEA 4RVSA 2JCYA 2ZYAA 1VL6A 3OF2A 4ZRNA 1XA0A 3CXRA 5JMPA 2PV7A 3KUXA 4P38A 5COQA 4LMPA 2DU8A 3PQDA 3GGGA 5JYEA 3JD1A 2Q50A 3Q9UA 2PZMA 1NX6A 1YO6A 1IL0A 1HWYA 1YXMA 3I3OA 4J1QA 1YVEI 5JO9A 1O94A 4Z9FA 2AEFA 2HJSA 3LT4A 1BVRA 2W90A 2ZJ0A 4XB1A 1T2CA 4CQMD 2C5AA 2ZYDA 2C82A 4CMGA 1J49A 1QV6A 1DJNA 4E21A 1YL5A 1Y1PA 2Q4EA 2VT2A 5JCJD 3GNSA
chains in the Genus database with same CATH superfamily
2FUKA 1I01A 4W7IA 1LNSA 2CCJA 5IT4A 4PLWA 1G2OA 1YNSA 4IDNA 4Q37A 3T12A 5KI6A 5BOSB 1WZNA 2OBXA 4WCFC 2P2GA 1WDWB 1QP7A 3HK2A 1L7AA 1M2VB 3DDCA 1E4EB 1NVGA 3V1KA 3ZWMA 5IUNC 4MS3B 3AUUA 1N8KA 5GADl 1T15A 4ND7A 1IWPB 5HM8A 3RK4A 1ZVQA 4X60A 5CVJA 3W34A 4BL5A 5KTRA 1W2GA 3VVLA 3GEEA 3U4CA 4OLAA 1X13A 4HQFA 1YA6A 2VJYA 4DV6B 4BGDA 4C3UA 3FYTA 4M1QA 3LE8A 3F5SA 3PEVA 2WYUA 3JQFC 4TLAA 5LQSA 3ROZA 2YJGA 4Z2AA 3KG2A 5GVRA 4HDMB 1PJBA 3TYXA 4FFBB 4RCYA 3VZRA 4Z7NB 5BUZA 1L4NA 1U3GA 3L1KA 2B4RO 4IG4A 5KQPA 3WMXA 4MUXA 4K0RA 2C2KA 3ZR4B 5CDSA 1DQPA 4HNHA 4G84A 2P9EA 1Y9EA 2PX3A 4NDNE 3RR2A 5C3MA 5DM0A 2HADA 2DUMA 5AI4A 3T1HB 4WV3A 3MT0A 1G5IA 4U7DA 1L7OA 3IMCA 3PZBA 3GP8A 1DEOA 3QPVA 1HL3A 3NI2A 2OHJA 4KQIA 3BXFA 2B5WA 3UK6A 5IEBA 4ZO6A 3EPPA 3FBTA 3IERA 3II6X 1XNGA 3TZHA 2HSWA 3M9LA 2OUIA 3GJ3A 3EC7A 5CLQA 2BHTA 2VUIB 3L7YA 1MV8A 5LZ7A 4EARA 3OZRA 1PNOA 1ZM2A 5LNK6 2J3MA 2G08A 2QGFA 5CFLA 3U4HA 1ZJZA 4MH0R 1UKBA 3JAKB 5BNZA 1Y5MA 3ZBQA 1GPDG 4KQJA 5JUWA 2O8BB 1LX7A 1X7YA 1NG9A 1N2CB 5FI5A 4B33A 4BCCA 4D4KA 1ZD9A 4XCXA 3SYMA 1KE2A 3ZIAA 1JQBA 1D0SA 1EQUA 4DDUA 3TLGB 3NHYA 1PW5A 1RCUA 1T3LA 3AHFA 3S2GA 2PX5A 3OJFA 2CUNA 4TXHA 3S99A 1GKYA 3O1IC 4O6VA 5K8CA 1ZD5A 1S0UA 1TU0A 4G07A 4NL4H 2JEZA 4OFZA 4TTJA 5FI1B 5IJ0A 3MLBA 1KJWA 4G0PA 2YFYA 2VP4A 2EWMA 2RAFA 2PZKA 3GHYA 2R60A 4NWIA 2Y3IA 3I4FA 4CIBA 2X23A 3MTGA 2CWDA 2YC4C 2YV3A 3GJ8A 4BRWA 5CXUA 2ID7A 4XCQA 1NULA 3HBMA 2R2AA 3AY3A 3MLEA 3OPYI 5DLDA 4U4AA 4CI0B 5EJEA 1UKYA 1G1MA 4A5SA 3EQ8A 4WY5A 2MYNA 4Q03A 4F2WA 5FO1A 1IXZA 1XJ0A 2AOWA 5DFAA 2R4QA 3NBMA 4TV8A 2YIVX 5FUVA 3ZGXA 1EA7A 1RNLA 4W5JA 1Q7GA 1H5NA 5HKKD 3VZDA 2PIAA 1AB5A 5F1YA 1FUYB 3F5MA 3JQQA 5JVDA 2NW6A 1II9A 1NMQA 1W8DA 2HPHA 3CNHA 1I5EA 3X43A 3CNBA 3ZHZA 3O2SB 3BRWD 3QVMA 2EW8A 4NZYA 4OHWA 3NWJA 2EQBA 2K2QB 1NVMB 1NFFA 1NG1A 5KOYA 1CF2O 2YS7A 3BWVA 1SXJA 3PCTA 4BN4A 5B2FA 1JA0A 4Q1DA 5IZCC 1FDVA 3K1AB 2YZMA 3OLQA 3WK7A 3EZLA 2DQKA 4UCWA 5EJ9A 3KSBC 5D2CA 3G5LA 1BQ3A 3G9QA 4M88A 3Q10A 4GEGA 3VDMA 5IASA 4NYMQ 4MMZB 4RY8A 1Z5VA 3T3HA 1G2IA 2C8JA 1UF9A 3G13A 4GL2A 4DG5A 1UWKA 1T4CB 4KDRA 1Z2CA 1QGOA 3PJFA 1TPZA 2Q4DA 1D9ZA 3EDCA 4ZKEA 5IFLA 3H9EO 1WJGA 3AY0A 3ZWVA 4FD2A 3H5LA 4XWTA 3FCEA 2OAQ1 2GD2A 2B0CA 1J9EA 2W7TA 2WWTA 1HDYA 1YDFA 1ODIA 3RHFA 3TN7A 5L3SB 4D26A 1R16A 3NIGB 4BAGA 4E2ZA 2A5LA 5DU2A 3ZV7A 4J94A 2VCEA 2DTDA 4II3A 3EGCA 4RABA 4DPMA 2IUFA 2AJDA 2ZJZA 1AZTA 2OZLA 3LRTA 3KUUA 3OIUA 4ZT7A 3U9SA 4F84A 5B7PA 4TTIA 1SQ6A 4KAAA 4NTZA 4YJ3F 5B7GA 1PEAA 4Y1RA 2KB0A 3R5TA 3N7AA 4ZI7F 3ZE2B 3E15A 2I54A 4LEIA 1W6UA 1JLRA 4NABA 2QM3A 4Q4AA 3A3YA 4OHVA 2DB3A 1J7KA 1I32A 3IV7A 1X8XA 1XVIA 4P83A 3MIZA 3KJHA 3WHLA 3EMBA 4GPZA 1UWVA 1UBUS 1FDTA 4HNQA 5CX1A 4BYGA 4JBHA 3KX2A 1COWD 1GZ6A 3INGA 5FTKA 4EHKA 3TLXA 2G1PA 2DY0A 5A7HA 2QZPA 5DASA 4N6NA 1S9DA 4RZIA 3H05A 1Y4SA 1KRWA 3BX1A 2H59A 2FQ1A 3WA7A 4BBZA 4GKKB 1R88A 3B3GA 3BL6A 2NZVG 5I9BA 4RU1A 1G7SA 3I28A 1U98A 4IDGA 2YV4A 3UQZA 2H2DA 3O38A 4P3XA 1G5PA 5FUBA 1PFWA 5KS2A 4TN1A 3TE7A 3RUFA 1RWKA 2FEKA 2G72A 4ZVRA 2QRVA 5T5QA 3MWDA 2BCGY 4L28A 3QEAZ 1ZCJA 3UYKA 4IP0A 3D0OA 1AA9A 2F4NA 1A50B 1WXFA 4CM8B 3M4NA 3HL0A 4Y18A 3OVMA 4YDHB 4WECA 3ND7A 5SICE 4B2IA 4QHSA 1ZNXA 4MULA 2PUFA 1FJHA 2XE8A 1F2DA 3EDOA 1MORA 3SI7A 2Z8XA 2M1ZA 3E5MA 1RZVA 4Q18A 5BNTA 1QRRA 2PVCA 4AK9A 2R8RA 1GGMA 5JNWA 3TAHA 1LTQA 4WNAB 1BXRA 4WNIA 5FYDA 2GEFA 2PCLA 4QDOA 2R6ZA 4HAZA 4JJGA 5LJLA 1NM5A 4ZTZB 2PXXA 2C0QA 4Z1OA 4L6IA 5CLHA 4YHBA 3TRDA 4GBJA 4RDCA 2BE9A 1QHYA 3DT6A 3WAGA 4P4NA 3EPLA 3FMGA 1QG2A 2EF0A 2XQGA 2X0FA 3U4QA 3R9WA 3K15A 1E9VA 1D03A 3O84A 4PPGA 1RI2A 4FS3A 5ALHA 1DMSA 4ECEA 2ZSAA 3K9CA 2CHQA 2F3SA 2OP1A 3CF6R 3RRFA 4ZMRA 2CZQA 4H17A 4RZ3A 3RSCA 3GCWA 3GRYA 2EFEB 5HE8A 3D6TB 3CISA 1DG9A 3OM1A 4GI5A 4M8SA 2OUKA 3PVCA 2VSFA 2FPKA 4XA8A 4IH4A 1G6Q1 5T4FA 4CIAA 2I99A 4BNVA 3QOWA 3SJUA 4HNRA 2HRQA 2QN1A 4D3DA 2ZTLA 2FHPA 4KE6A 5B3JA 2WU1A 3RVMA 4D9KA 2IWHA 2XGOA 5BSGA 3TGWA 1U1GA 2HGZA 1EKXA 2O1EA 4WDRA 3H8JA 2NOAA 4G4GA 3UQYS 1OPXA 2Q21A 3ADPA 3NJRA 4YJHB 2OMEA 4F7WA 3TM4A 2P1ZA 3MEQA 2YWJA 3BZUA 3AIIA 1RLUA 2YZ7A 4NJEA 1QBKC 3U9TA 1WIWA 2JEYA 3FWZA 2GSDA 4IDPA 2B5VA 1TUIA 1DARA 2YMPA 5I9NA 4R0VA 4H6WA 2FQWA 3PRKE 2W6IA 5MF6A 1M10A 3AO0B 4KRGA 3K9WA 4G26A 2VYFA 3FNGA 4GMXA 1TQHA 1TVMA 3L9XA 3BICA 1DRWA 3QHQA 4X97A 4KFCA 1R4NA 2QUJA 1C9EA 3GQBA 2QR3A 2CDCA 1O5TA 3D0QA 1RAGA 3EGDB 1GKLA 3HDQA 4HEA6 3RFTA 3PGMA 4LMBA 4PZCA 2QYSA 3RVOA 2HUNA 4N6OA 4EFNA 4F5EA 2ZW9A 4JGBA 4Y6SA 3QSGA 4CIDA 1Z26A 1LEHA 5CNJA 1DOHA 1Y98A 1N7GA 3PWSA 4HOYA 3R9XA 1QLJA 5A3QA 2XA2A 2VYND 1KPHA 4DIOA 4E22A 4GLFA 4F8JA 3J81k 1EFVB 4EG3A 3PHBE 5REQA 4LXUA 3WLHA 1FUEA 4AB1A 5CA0B 4I55B 5KNLA 5EVCA 4O8CA 1SHJA 2YY7A 3O73A 3O2JA 4HATA 4MMYB 2DPLA 4A2QA 1JT9A 4JUFA 4EELA 4I1PA 4IRUB 4HQRA 4LMRA 4MUAA 1G5FA 2YZKA 2XUAA 4H1HA 4EABA 1LNQA 3N07A 1MX1A 1V1RB 1ISRA 1DAIA 4RK7A 2Q0XA 1IYZA 1V3VA 2DMRA 2CD9A 4WOPA 2GM3A 4PW0A 4FT4A 3COJA 3AEZA 4BLRA 3ED5A 5HHTA 1QOPB 2JK1A 5DNDA 1DC3A 1S5PA 4KMMA 3R5XA 4CM4B 2HLDD 2W2QA 3F5QA 4PZAA 4XCVA 4WJZA 2ZE7A 2WF5A 1I1OA 1YCHA 3EVCA 3HP4A 4MWZA 4EH1A 2VP0A 4E7PA 3FG9A 1O03A 2A1UB 4WJLA 3MMXA 3A7EA 2IX3A 4B3RB 3R7NA 1FU4A 2PT7A 3FSGD 4CUJA 3EXG2 1ZBDA 2C2YA 2CXSA 2K2WA 3AY7A 2PLAA 1AC5A 2VPYA 3NEJA 5AVVA 2DEUA 1BFKA 3E3NA 4NNPA 1YZGA 5G4LA 1JFSA 4YRRA 1KDTA 1ICEA 4DV5B 3JASA 2JGFA 2JL1A 3LUDA 4LUCA 1JU3A 2F8TA 1GHTA 4F4FA 1XDUA 4FLFA 1PJTA 2CNLA 2RBGA 1ZPDA 2WMNB 2ZJ4A 4R7ZA 3VHXB 3CJTA 2AUNA 3WKCA 1UFQA 4Q16A 1DTWA 4XLTA 1OMOA 4BLTA 3T7DA 3DEYX 4WKBA 1YB4A 2RSLA 5AVJA 3TOVA 3P9PA 4BP9A 3WWCA 1YS4A 4MVXA 1GGVA 3FLMA 4MQFB 4G85A 3CCFA 2IXGA 2V1UA 5D3MB 3UB4A 5BVHA 5M29A 1K9SA 1T2EA 3UMRA 1MX5A 3GNTA 1PI3A 3HKBB 3KQNA 5ALGA 5C4MA 2QDKA 2GZ3A 4G97A 4XR9A 5G1OA 2B1QA 2OY0A 1R0BA 5ITSA 2G9NA 4N40A 5IN5A 4F3RA 4DQLA 2C2BA 3DD1A 5GONB 3W9BA 4DLLA 3CX3A 3HXKA 1VE9A 3LPMA 2CKDA 1HSZA 4FD3A 4BNXA 2R25B 3N5CA 4F4HA 4Y6LA 2Y1DA 4UUNA 1JLKA 3GV0A 3WLLA 1IPHA 3GZNA 1KU6A 4UMEA 4EVQA 1P2UA 3ELDA 5KTSA 1KBZA 5AKIA 3PUZA 4JFAA 4Q3BA 3Q3CA 4JLVA 4ISBA 1JEYA 2B4TO 4CF6A 5CNIA 3OESA 3PNLA 3GMTA 2H92A 2J7PA 5M7EA 4N12A 3HKCB 1M2NA 2GN8A 4ZDWA 4COOA 3QOYA 3U0BA 2B34A 4KZKA 3L1HA 3UW1A 1EVQA 5J63A 1QK3A 4IZ6A 2R47A 1H8ED 5DN9A 3OZEA 1IIBA 1UIRA 3U16A 4CM9D 3NHWA 4CTKA 1QGUB 1AS3A 2PMEA 4UPVA 3KQPA 3WL4A 3EARA 3R8CA 3WK8A 4MS1B 4PQFA 1ZZEA 2FEMA 5E1BA 1CZOA 5I7EA 5JQGF 1O87A 1QIIA 1A2QA 1P33A 1V8BA 1QF7A 2FQYA 3FHLA 4EI8A 1F3LA 1K0FA 3WGYA 2QR2A 3JWPA 2OFWA 3IPCA 1WA5A 4GUDA 1XMOB 3K35A 2DTEA 3C15C 2X5KO 3SICE 1GUZA 1WXQA 2D2EA 3BDIA 4NK5A 4ZJPA 1QAMA 2ZK7A 3HBFA 3LH5A 1JDSA 2AYYA 1CQZA 2PWPA 3IDZA 1VCNA 4AN4A 1CUCA 1GQFA 4JJ8A 5CDTA 2QLLA 4C22A 3AGPA 3C0KA 1FRQA 3F2IA 5D01A 2RGAA 2W2NA 1GZSA 3BJRA 1FU7A 3EDQA 3H9UA 5DGIA 5IX8A 5CXXA 4PLHA 1EJ0A 4BU1A 3C74A 1UFKA 2BD0A 3NM4A 4LZOA 5C32A 5C4IA 3HJFA 5T4BA 1YVUA 1YHZA 1K5PA 1RKUA 2GRUA 3VKWA 1RMYA 1X7GA 2WKWA 3FCOA 1N0VC 4TV9A 2PBFA 4K9MA 3RKSA 4C7XA 3AVVA 2ZR0A 3PFWO 2WHEA 4YUAA 4B34A 1B0AA 1NN0A 4MB6A 3RADC 3AUKA 1DQSA 4NU6A 1YACA 2QVBA 3LX4A 5IVPA 2H1IA 1W36B 1Q3TA 2GA9A 2UZ3A 4C6TB 3BEDA 1OX6A 1U8AA 3HCRA 1M0SA 3TEJA 1OWLA 3TH5A 2DWQA 3VTAA 1ULSA 3A4NA 3B9RA 1DKQA 3ZHCA 6AT1A 1DP4A 4ZKDA 4Y0VA 4ZRMA 5KYWA 1I24A 1XA4A 1A5SB 4A73A 2ZAOA 3UF0A 1Z15A 2GZMA 1WW3A 3HNPA 1OX4A 4K6GA 3S2FA 1EB8A 1T24A 1L4MA 1GRQA 3A6JA 3B6ZA 1ZH0A 1W5BA 2W6JD 1K1EA 5IVDA 1B6GA 4AXXA 4PGFA 4KHPB 1GXSB 1U7HA 1SHUX 4DQKA 4EG0A 1XKXA 2OSBA 3E22B 5BUSA 3Q2IA 2QUAA 1KRXA 3V97A 3DULA 2QVXX 3EGOA 3LC2O 2F1HA 3CLSD 2HBYA 4OUKX 2IEBA 3DM9B 2V45A 2C29D 3BTOA 1ZMXA 2AR0A 2Y77A 1FNMA 3BGOS 3VMMA 6GPBA 2CJXA 3G2MA 4O4JF 2JHAA 1RHJA 5HIKA 3U3OA 3R3ZA 1W49A 4FGWA 4Y30A 2NO0A 2ZIZA 4D0GA 2Q5IA 1HX7A 3WRXA 5SYAA 3FCSB 1TPYA 1QZXA 2ETVA 3H2HA 3N05A 5CB4A 3P2YA 2FSHA 4RMGA 4F3KA 2D62A 3LUPA 3VR3D 4M9CA 2HT1A 5FBHA 4DLUA 5BW8A 4UEWA 2O6LA 2ZUSA 2FKAA 3C5VA 4AMUA 1UQTA 2JFHA 3PRJA 4KREA 1CJBA 3DMTA 4DT1A 1YB6A 3QMPA 1OILA 2IE0A 3HWX1 4OJMX 1EAMA 4NJMB 3FRHA 2HDWA 3SCZA 4NU0A 3S29A 1JEDA 1LH0A 1X0VA 3AJEA 4A8HA 3K0BA 1ZN7A 3EVEA 4IHJA 5HS4A 2W6MA 3THWB 3OZWA 4IGKA 2OD2A 4M21A 4P4GA 4QGAA 1JG6A 3D4NA 4RKWA 4DVGA 5HKKA 4M7PA 5K2OA 2ZBGA 3A1SA 1IPEA 3EOBI 1LRLA 1MB2A 2AN5A 4GOXA 4MVJD 4NFSA 4ZREA 3G2LA 3LK6A 4B32A 3BRWA 4PZPA 5IAKA 3VR0A 4GM4A 5FOSA 1O6FA 4V2UA 5ALQA 3K70C 3JYOA 1CUXA 1F0YA 1M67A 2Z3VA 3EQ7A 2WNSA 3CMCO 3WK4A 3HO1A 1M8FA 4LVUA 1LVGA 1FSZA 3AVWA 1TQ2A 4C76A 4WFKA 5DT9A 1KS2A 1X6VA 1ZUNA 4CNBA 2HJHA 4LXTA 4B6PA 2F1KA 3L7DA 5C5CA 1MPXA 2DFKB 4TRMA 1X15A 2UVPB 4LXXA 3IVCA 2E1PA 1WLSA 4W5RA 3WS7A 2VPQA 3FUWA 4NQRA 2R5FA 4BQQA 2Q9UA 4OL0A 1J22A 3EODA 1MJNA 1BRTA 4K9NA 4OYYA 3RKUA 3T3MB 4US2R 2WOOA 2C4MA 3KKPA 4KX3A 4AWAA 1UBMS 3VNAA 2FN9A 1EX6A 1FNDA 1QV7A 2AQIA 1YR2A 3FPAA 4N3AA 1G4HA 4O4IF 3A1DA 1CQJB 4J6EA 1B8PA 4UUOA 1AN0A 3DZGA 3M6WA 5DI9A 2JFBA 2IP2A 4FZRA 1EP2B 2JBAA 4NVRA 3W9YA 1E2BA 1CUDA 2OCXA 2GRJA 3ZQJA 1CJUC 4K9SA 1VYVA 4EYOA 3QYPA 1WKVA 3TD2A 2R7NA 1FTWA 6PFKA 1WMEA 4H08A 4W1PA 1VA4A 3DHWC 1F9EA 2EGUA 3ASZA 3GN1A 4LOKA 1V2HE 1NR1A 3DE2X 1Y7LA 4EKYA 5DH9A 4E2WA 4NKRA 4RX1A 1THTA 2RKOA 5F7ZA 2CXNA 3R0JA 1E3QA 2NUAB 4EQZA 2X19A 4FYPA 3Q4GA 4Q34A 3ZK7A 1O96A 2PT6A 3EVAA 4IYRA 2OG1A 1CUSA 3F7TA 1DQNA 2P11A 4HFRA 1X1CA 1COWA 1QCZA 1UPFA 2AI3A 2VL7A 4UHCA 3RF7A 4DMHA 1UK7A 3OCWA 1VFNA 1YD7A 4MV0A 4KNYA 3EGEA 5AKEA 4G0QA 3O31A 2I1VB 2DPYA 1GZHB 1Y42X 3NTVA 2DULA 1ZW1A 2WJVA 5EIFA 3VSDA 5KVCA 4GLJA 4G9EA 2P9HA 2A9PA 4O2RA 3SIXA 5JCPA 1T6BY 2PTHA 4IXTA 4RPHA 3FUUA 4U2FA 3S7ZA 3VR6H 1GRVA 2QF7A 4WK6A 3WZMA 5JZ9A 3QPAA 1XDBA 3BMOA 3FDIA 2F67A 1XRNA 4IRMA 2P1DA 3AUFA 2KM1A 1GM5A 1YRLA 4XX1A 3KB2A 2IEDA 3DOHA 4OQNA 1AVTA 4OH1A 2HCTA 3WFZA 2ONCA 1VP3A 4QELA 4I0WB 5CT5A 4UTNA 3ZWCA 4CEIB 3QLJA 4HZUA 1PSDA 2Q41A 1XXHE 1T10A 3A26A 2DBRA 3ANXA 3BUSA 2ZJ1A 3DCJA 3DH0A 3LZCA 1ZSNA 4QGHA 2RKWA 4L78A 1H4SA 3FTFA 4JQOA 1Q0UA 4MWCA 4H7EA 1QOZA 3OLWA 4AS1A 4F72A 2QAGA 3OCVA 4PG5A 5TF4A 3D5QA 5IULC 3BB1A 3FMFA 3KNZA 4YRTA 2UXCB 4ZEVA 3SQOA 1M1YE 4JL5A 4G25A 4MQ6A 5MN6A 3SF8A 4EAAA 1XPOA 4Q47A 3GRUA 1MDBA 1D3AA 1DBSA 5ELMA 3VC1A 1RTKA 1VMEA 2H17A 2EGHA 3K6RA 5DMXA 2C1ZA 3H75A 2C07A 2WKRA 1UKAA 4AYXA 4PHTA 1U7DA 3A6PC 3JWIA 1X1BA 1M5RA 4BO9A 1Y4AE 3RWOA 1QKIA 4B75A 5DBEX 1E1QD 1KQGA 2B8JA 3PVZA 5I7WA 2RGRA 2GCOA 1I6WA 1F6BA 3LTNC 3N2LA 3NLLA 5BWCA 5I7UA 1EG7A 4FNAA 1ZY2A 2NU6A 2WZBA 2VT3A 2OV1A 3E2IA 4KO2S 3T06B 5A1JA 1QLHA 2OD7A 4H60A 2ZPAA 3NHFA 1U2EA 3STWA 4EHBA 3F8TA 1GA6A 1QS0B 1UFRA 2J5KA 1EH5A 2JIBA 4ZWNA 1UXKA 4R0NA 1JKJB 4YMVA 3GRVA 4R1TA 1ZK1A 4O1IA 3ZDFA 4CPDA 2FPRA 2DBVO 3B52X 4RTNA 1YRAA 1FDOA 5U4QA 2I4MA 2WWWA 4IAOA 4FDVA 1NONA 1C3OB 3RUEA 5IWCA 2LE0A 1ESZA 4NECA 2HU7A 1WXIA 1C2YA 2JI6A 1UZAA 2NO9A 3N2ZB 1RRCA 3G0GA 5DCUA 1DNPA 5AM5A 5A2GA 5TMPA 3OI7A 2IF0A 4PVDA 5AICA 1WY5A 1YTLA 2ZAMA 5E0OA 1ST2A 2HMYB 5AYVA 1Z0DA 4GOOD 3ZE6A 1AIPA 4DDVA 1CFZA 4HYTA 1UMCA 3HYNA 3KXPA 4YPFA 4BNMA 2CF6A 4GD3Q 1RWBA 3SR0A 3I1FA 1I36A 5AJUA 3TX6A 1M34A 3A25A 3RUHA 1USGA 4ZDIA 3WHKA 3RRXA 1RI3A 2PMCA 1A9OA 3DKVA 2XV1A 4JUCA 5HIMA 1JTFA 5EEHA 4OLBA 2EKDA 3RIYA 1O95C 3FUCA 5FFNA 5ALSA 1K7EB 1HURA 1NA5A 3KBBA 2VYNA 2FZLA 4CE6A 4FMBB 2YRWA 3DNPA 1HNNA 4PLGA 2C5EA 2EG5A 2OHIA 2VJQA 4WH0A 4B5KA 1GCAA 2H2GA 3GEGA 4Z9BA 4BQOA 2PUJA 4AURA 1V8FA 4BRZA 3E53A 3O1HB 4K9PA 4ZVMA 3IH5A 1Y3CE 2Z4SA 3JQAA 1N8NA 4OJYA 2E5LB 1KI3A 3UFXB 4B48A 1BWRA 2A5DA 4PCVA 4D79A 4CTOA 3CRZA 3I52A 4IPTA 1E4EA 3REQB 2CEAA 5KOHB 2P6UA 3FX2A 5KJEA 4BVEA 2QWXA 2GAOA 3VDNB 4WERA 1RHKA 3RJMA 3V6LA 3R5SA 4YCBA 2XMGA 2VQFB 4RV9A 5J43A 4K8RB 4ZOLF 3HB1A 1RWOA 5TQ2B 5K45A 1OFIA 2HLDA 3JAWA 4M99A 5EG5A 5BW4A 1KE1A 1QJ4A 1C1YA 3DQZA 4KXNA 3MQ4A 4MXDA 2HREA 1DIHA 5I7RA 4NBKA 4UZEA 4DR2B 3IOCA 3B36A 4ND5A 4BASA 3FSGA 2CMHA 3GVCA 4LC0A 4V38A 3CUSA 4KBFA 5DRYA 4C04A 4YRMA 1ZR4A 3ORQA 2AXQA 3TIFA 1TIKA 3D8RA 4K6MA 1VSTA 5CJPA 4DY4A 3CRQA 1RXEA 1GPH1 3D6UA 1YFKA 2R6FA 5CURA 4QODA 1W4ZA 5AKYA 2FKNA 2D74A 3NHBA 1EDZA 2B99A 1FX1A 3U44B 1L5ZA 1JVBA 4IQ0A 4Y2VA 1CJCA 3GRPA 4LW8A 1WHTA 1JBQA 1PHRA 1WDLA 3LC0A 4MTCA 4XRRA 4AZ3A 1YL7A 4LV6A 2VN8A 2JG3A 4AG5A 3PGKA 2HNKA 2X40A 1M1ZA 2JS7A 3LP5A 1E89A 4G5QA 2ENWA 4ZVVA 4C0XA 2A33A 2QRHA 3IDOA 5JAQA 5HS6A 4XYGA 2UUPA 3K9LA 3D6NB 3TIGA 2B9EA 3ZYZA 5BR1A 3ID6C 5KYUB 1U9IA 2CCKA 2HCFA 1II0A 2GO7A 5DSXA 1Y3IA 3K4QA 4GL4A 2VOJA 1W85B 3ELUA 3N8NA 4B4WA 4BO0A 4IS3A 1RW4A 4GQIA 2W70A 4DTIA 2H1WA 4FCWA 3KZXA 1HXHA 1FXUA 1N8TA 3WAKA 2R1ZA 2Z08A 5DHFA 3TFWA 2JAHA 4URYR 2C2HA 3CF4G 3SY8A 1I7QB 4LJ7A 4ZAFA 1KQNA 2H9IA 1IMJA 4KIJA 3T61A 3TLJA 4CHTA 3THXA 1ZJWA 2P6NA 3RS4A 4ALJA 4V0NA 4RZ2A 1T1SA 3EZNA 2HQBA 1PWEA 3EZ7A 2XT6A 4ESEA 4XQ0A 3QNWA 2PQ0A 5KYVA 5CX4A 4P6VF 5JANA 4J1TC 1GAWA 4G3XA 3OWXA 3RHTA 4J9VA 5CG1A 3TDKA 5IABA 4M0PA 2C95A 2ZJFA 4H4DA 4C4TA 2HR1A 1WDKA 1XFDA 2IZ0A 2WD8A 4DPKA 4E13A 2Z98A 2WUVA 4G81A 3AEKB 5AJVB 4R0MA 1IZZA 1B8UA 3H2YA 4X5OA 4AI6A 5TY0A 3EDRA 4CM9A 3FCYA 3K9GA 4KRXA 1KMQA 4BUJA 2FZVA 3BOSA 4UCFA 5AHWA 1Q1ZA 2CZCA 4IIFA 1IWBB 1JFLA 2OCIA 1QCDA 2NNLD 3C1AA 5FUWA 2GOYA 4O1HA 5I7VA 3KFLA 1HV8A 3M4ZA 5DNCA 3B12A 3KQUA 1FP2A 1U3DA 2APJA 3GLFB 1NW4A 1I4OA 3AU9A 3NTOA 2R84A 1E20A 2QRGA 4AN0A 2FSUA 1U0HC 2Q1UA 5CFNA 2FW8A 3AF2A 2E4UA 4DC0A 4ZGWA 3GJRA 5EMNA 3H9QA 1NZFA 5FCDA 3MYYA 4OHPA 1JQEA 1L1EA 1LPOA 1P1CA 4B3DA 3CQ9A 4DBLC 1FLDA 4EYQA 5A4KA 3RUPA 4K6HA 3VKVA 2LCIA 3QBJA 4ZQGA 3BCHA 5DMHA 1I3CA 1VL0A 2AS0A 1PWXA 2YVUA 4TTPA 4WXPA 3UO8B 3WRVA 3ZK8A 2DRIA 3MIIA 5DOVA 1E99A 1K6JA 2YN2A 4L4YA 1FJ2A 4PICA 3UA4A 2DUJA 1KIMA 5B58C 2E4VA 4OUDA 1NXSA 2XGJA 3PYXA 4IINA 4W8OA 5C31A 1B0ZA 1TX4B 3BBPA 4GSYA 1YOVA 4DLZA 4Y2PA 1SCUB 3ZD8A 1ATZA 4WESA 4B6QA 1KMNA 1M2FA 3I1YA 2VWQA 2WAYA 3OTHA 3OTGA 2BDUA 2QQ5A 2ZETA 4RQBA 4UHKA 2NTYC 4JX8A 4NHOA 2QY6A 4I50F 3RVKA 2A0KA 2AXNA 4RACA 4XE5A 3SVZA 1IUKA 4QUJA 1KORA 2WUDA 3IP1A 4YRGA 5EWLA 3SX4A 1EM8A 5BXQC 4M7OA 5DX8A 3SHVA 1D04A 1KDPA 1NMZA 2V4UA 3QU4A 3G3EA 4WK4B 2NSLA 3WC4A 3LQFA 2H8GA 1SIBE 2BGIA 2W6JA 2HHAA 3L93A 5CA1F 1ESMA 4OBEA 4R4JA 2YVAA 4EM6A 5KPJA 4FGSA 1YB2A 3GUYA 1LDEA 1EVZA 2HA4A 1QFXA 3V32A 4BMOB 3QX3A 1O57A 2AN1A 3WDLA 3S1SA 4E5UA 2DQ4A 5K6AA 1U2DC 4E4RA 4YASA 4BN0A 4ESOA 2VXBA 5ICGA 2AN4A 1KEVA 5L45A 1NFRA 1VL8A 2Q45A 4MS4B 1U1CA 4U2DA 2OOKA 4DWVA 2Y0CA 4IX1A 4PLYA 3RYHA 1E7SA 1TUBB 2UYYA 2P65A 2WIGA 2GJ8A 1N57A 1AHNA 1E2DA 1W5EA 2V7UA 2XSZD 3S5JA 4FHDA 4ME6A 3TQTA 2KSQA 4IO1A 1EK6A 5A9SA 2IEZA 3ZGVA 1VQ1A 3VNUA 1BA3A 5J3JA 3PI6A 1U8UA 3FWPA 3I58A 3QUTA 1B41A 2OQ2A 4OHBA 1KY5A 1N3BA 3CE6A 3L79A 1NF2A 3UJ9A 1PQWA 3VR3A 2B8NA 2J9FB 5DNAA 2D0PB 2CZGA 2Q4TA 3MGBA 1E0SA 3VKFA 1YIAA 4ZGGA 4GR4A 4BMYA 1ZCZA 1OYVA 4MPTA 4OQEA 2V7PA 4R71A 4C7OB 3SSMA 4WNAA 4LDJA 1Q1AA 5C34B 1N7IA 5EJ7A 4GOMD 1V8OA 3R5FA 3GFOA 3I9OA 3BE6A 5K51A 3BRCA 1SCAA 3ZHUA 1UJ4A 1QBGA 2V58A 3DPIA 3GLSA 3PLNA 1QU3A 3HVHA 4L51A 5EERA 1L8AA 1CQIB 4MVJA 3HVKA 3KJIA 4OQXA 2K87A 1DKOA 3FWNA 1A9TA 5B6IA 1FMLA 5FT9A 3QSYA 2PCJA 4NV1A 4QTTB 3NTRA 1NPDA 4HC4A 3JTEA 1JIVA 4L2IB 3TUIC 4Z7JA 3IQIX 3T35A 4ZMSA 3EJWA 3AJAA 5KDOA 3LX6A 3RGGA 1TQDA 4HVLA 4IYJA 3VNVA 2YVQA 3K2BA 1QQBA 4I4TA 2GZDA 1NVXQ 1VGVA 4YVFA 1WB4A 3A6FA 2RGWA 2FMXA 3A1EA 1WPXA 2LDXA 1PL0A 1LPBB 2QD1A 4LOHA 1YCGA 5E8JA 2QDXA 2H5JA 3EMDA 4J3JA 4CMIB 5CDUA 4YP6A 2ERXA 1C1XA 2HWKA 3HYTA 5BRNA 4C6SA 4AKTA 1PFKA 4YROA 3FGZA 1QTRA 1FDWA 2XIQA 2M6SA 3L7JA 4O5AA 4O1MA 4A92A 4B3IA 1EXVA 1ISMA 1U04A 5AWFC 2IU3A 4ZYVA 1MZPA 3WGTA 2ZWVA 1ZIXA 1IC6A 3NX4A 4ZI2A 2ANBA 4LJAA 1NUTA 3TQHA 1WSAA 4YECA 1KC3A 1X7HA 2R8XA 4HB3A 1P4AA 1UPTA 1QXSA 2PZLA 2P7HA 2ZTUA 3GIDA 4R5HA 3CR3C 2B3DA 3P5SA 1PDOA 2IIPA 3PIRA 2D1SA 1T4DA 2IZ7A 3OQ1A 1SVWA 4INAA 4QLAA 4X7BA 2IODA 5EIBC 1XZJA 3SZOA 4LOLA 3CT6A 1CNEA 1LLUA 4QFMA 3EXHA 3TG8A 2FR0A 1KZ6A 3S40A 2IUTA 3OTWA 2C8VA 4U7HA 5JNLA 2FRDA 4JBLA 4PCAA 1FF9A 2O3SA 1ZUIA 1UBRS 3DBRB 3G59A 5AJTA 1D2HA 3BD8A 3MOGA 3QKRA 4ZAYA 3VU0A 3JQ8A 3QUCA 4L5IA 3RROA 4LHYA 3ML1A 4MARA 4C1BA 4DQVA 1DSSG 1E7RA 2HU8A 3IEIA 2O0KA 1BNCA 4EHDA 4LF4B 4KLCA 4LRSB 1L5OA 4KJXA 5F2EA 2QJTA 5A71A 4HS4A 3L7OA 2NV2B 1J9GA 5LLDA 1XU7A 1E9EA 2E4XA 5IK2D 3GEHA 2C4UA 1C4WA 4DG9A 3Q88A 2AJTA 3ICVA 4WUVA 1H6AA 4D3YA 1MHTA 4UMDA 2I6UA 2ID9A 1E96A 3ET5A 2NU9B 4A9AA 1RYZA 3IB3A 1KBOA 1GOTA 4YV1A 2CXPA 3PC8A 3BSFA 2IYWA 521PA 2FJ0A 4X3CA 4K26A 5EWJB 3NTUA 4G09A 1G66A 1CY4A 1NMSA 1ZIDA 1K2WA 1RWVA 1J39A 2P0YA 3EF3A 4FXPA 3I2JA 4QA9A 3OE1A 1EA5A 3COYA 3B1KA 4N3NA 2VHVA 4M60A 4CKBA 3OPMA 5JPDA 4FHEA 1YUNA 1NJ1A 3G2NA 1TVEA 3W8RA 3RYCB 1M9NA 3K5HA 3TB6A 2X0RA 4HAWA 4ZGBA 3KTDA 3KKLA 1RPZA 1D2AA 3AZPA 2JIMA 2Q5LA 3E1GA 3WNDA 4DHWA 2GYVA 2HA0A 1J8FA 2H0QA 2FDXA 2R5NA 3D8NA 5C53B 1GVHA 1O5OA 4D7AA 4QT4A 5CLIA 1ESEA 3N8KA 5CVCA 5THXA 4YP5A 3G2OA 3FTEA 5JQWA 2D6FA 2CK3D 1KEZA 4HQKA 2BTQA 4I9HA 5BRJA 4GQBA 2WA2A 3FMVA 2GJSA 4CKEB 2HQRA 4CN9A 4WA7A 3HR4A 3OU7A 3DTVB 5LWHA 2CVPA 3LBFA 4BMVA 2AA3A 1XLVA 2VXCA 4D8UA 3C3BA 2WIKA 1H65A 2BZGA 1OU0A 2GAFA 2VJDA 2PX2A 4J76A 3OTIA 4KYVA 1V1MA 3WNVA 1MVNA 2QGZA 1UANA 4G1FA 1M8PA 1L5SA 1UPUA 5BPHA 1N32B 1YCDA 4PGGA 1GSAA 3BGSA 2GM9A 5DM2A 1E1QA 2PVSA 3PZRA 3VPHA 4JJFA 1M5TA 4ND8B 5BN3B 2PHZA 3KE8A 3UV7A 1KY3A 1F20A 1XC7A 4FGKA 2SNIE 3FKSD 3PXBA 2RGXA 1R1DA 1HDGO 2VEDA 3LBIA 4B7ZA 4G0VA 2GPJA 3VKGA 4I6JA 5ECYA 3KZVA 2WV9A 1QH8A 5FR1A 4AS3A 2XH8A 3DSRA 1PR0A 2WQ7A 3ZZTA 3V4RA 1FP4B 5I9TA 3U4MA 1RI5A 3D1LA 1PJSA 1YIDA 1LA2A 1OIWA 1GZUA 4EB0A 4YMWA 2B21A 3CUKA 1LLCA 4DCOA 2P8JA 4F6LA 1YDHA 4F9GA 4FZJA 2LBPA 2ZP1A 3SNKA 2X13A 1RMTA 4WXRA 3W2TA 3QV1A 4P82A 5KVQA 1RBYA 1TQ6A 4QASA 1SU6A 4ARIA 1DAEA 3K09A 5LM3A 3G0DA 4US0R 5DN6D 4QUGA 1TDJA 2VA9A 3A3KA 1YS1X 4GMDA 1TECE 2KHZA 4AS2A 4JC5A 1UFVA 3IUBA 1TGVA 4C7KA 1I51A 2CHVA 3KOOA 1GAJA 2CJWA 4I6GA 1RBZA 1X38A 2NQ8A 2C7VA 3AF3A 1NI4B 1XMPA 4LPSA 4R5MA 3LQRA 3MLAA 3R0XA 4CMHA 5ICCA 3G8YA 3RC2A 5HJ2A 3ILSA 1NHWA 1QZZA 4TWZA 1XEFA 4L73A 4MS1A 1YAJA 2W98A 1X1TA 3N86A 4GPEA 3OKCA 4A0SA 4IMRA 1E3LA 1YJBA 2XRMA 4PU0A 4Y6RA 2RD2A 3L0PA 3E81A 2JK0A 4M6WA 2ZJOA 3OZIA 3TRIA 3FI9A 3FRJA 1OBHA 1UC4B 2JVKA 3UAWA 3G2HA 3HUEA 4F5YA 1ZU4A 1VLHA 1E2NA 3Q7PA 4UNNA 4WXEA 1N0UA 1Z56C 4KXMA 1G6HA 2JDID 1FQOA 4L5BA 1FXWF 4G8BA 4MGHA 3D7LA 4C20A 4OPMA 4DGSA 2FPPB 3MRTA 3HN2A 1F8GA 2GFQA 3P8ZA 3VH3A 4AYTA 5ADWA 5LZ9A 1UAAA 4TYWA 1M2GA 1T9KA 1VB3A 4ARCA 3GVHA 4ARAA 1W88A 4QD3A 2ZWOA 1H2RS 4JEHA 2XUPA 4BXOA 1UDBA 2LWIA 3ODGA 4ZQHA 1C81A 1G5QA 1U3VA 1L1FA 1UXHA 4M0CA 1AUOA 4YRZA 1L4UA 4DFDA 4YV2A 1N5KA 3EIHA 3D54D 3V3KA 4DILA 5I01A 3N2KA 4I2NA 5EI5A 5LYJB 2QMHA 3MWFA 3OZGA 3VDRA 3HA3A 3CVVA 3IBFA 1W94A 2Z8ZA 2R96A 1ZSYA 2BC9A 1PU2A 2XVYA 4Z4EA 1CUIA 4RTMA 2G06A 2V3VA 1PKEA 2BGGA 2LKCA 1D6JA 4TWJA 3WLFA 3CNOA 2XITA 1MO2A 1Z8FA 2YHAA 3WZLA 3HYLA 3EEFA 1MGOA 1Q50A 3EIEA 4R68A 1SK8A 3D2AA 1NV9A 4C07A 4FGLA 2A5YB 2TYSB 3SJZA 3G2QA 1ZW6A 1N6PA 1ZVJA 2ZM6B 1F3OA 1WP4A 3FHJA 2HKIA 4HNGA 4LE2A 1FBNA 3NM5A 3P97A 2W58A 1T6XA 3H6GA 2QGNA 3KHTA 1NW5A 3EA0A 4QDXA 4O4HA 4RHCA 3RREA 2DCUA 5CITA 3BFJA 5JXHA 4YJGA 1TCVA 1L5RA 3NDJA 4HG2A 5DP2A 1X7DA 4ID9A 2RHTA 1E5TA 1RWXA 1RJDA 1XEAA 4QBTA 5KZMB 2I67A 2PXAA 2ILTA 3PQFA 3JYNA 3OC0A 2COUA 4LZAA 1VMAA 3GFTA 4GP9A 4LYJA 4WJKB 4EHHA 1AV7A 4PPFA 4GWGA