3GB9A

Human purine nucleoside phosphorylase double mutant e201q,n243d complexed with 2-fluoroadenine
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
283
structure length
283
Chain Sequence
NGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFQTVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITDKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a mutant human purine nucleoside phosphorylase with the prodrug, 2-fluoro-2'-deoxyadenosine and the cytotoxic drug, 2-fluoroadenine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase
total genus 88
structure length 283
sequence length 283
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2009-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3gb9A00
3OPVA 3P0FA 1PR6A 1JDTA 3EUEA 1M73E 3FWPA 1XE3A 4YJKA 4EARA 1SD1A 2I8AA 2OECA 3DP9A 4GMHA 4TS3A 4H1TA 2OXFA 4DAOA 4D8VA 2IQ5A 1Y6RA 1RT9A 4EB8A 5B7GA 1JP7A 1C3XA 1PKEA 4MCIA 3KHSA 3MB8A 1U1CA 4L6IA 1TCUA 1PR4A 2PGAA 3PNSA 1NW4A 5B7QA 1OVGA 1PWYE 3NBQA 5CYFA 4R2XA 4D9HA 1V4NA 3PHBE 3FB1A 1PF7E 1TGVA 4NS1A 4BMZA 5F7JA 2P4SA 1ZOSA 4DA6A 1FXUA 5F73A 1RXCA 1RXSA 3D1VA 5F77A 3FAZA 5CCEA 1Z5NA 3GGSA 3BJEA 5F7XA 3GB9A 2A0XA 4L0MA 2I4TA 1K27A 4GLJA 4DARA 1RXUA 1CB0A 4DAEA 1VHWA 3KUKA 2H8GA 4X24A 1ULAA 3OZEA 1ODJA 2RJ3A 3UAXA 4QARA 3UAVA 1U1FA 5DK6A 3KVRA 1VHJA 3TL6A 3F8WA 3ENZA 4OGKA 1ODIA 4JWTA 4R31A 3T94A 4OF4A 2QTGA 4OY3A 4TXMA 1T8RA 1RR6A 4P54A 4GKAA 1RCTE 1TD1A 2Q7OE 1K9SA 2HSWA 1VMKA 1YQUA 4JOSA 3KVYA 3OZCA 3ONVA 1T0UA 4TTJA 4PR3A 1T8SA 5F7OA 4YMLA 4QASA 1V48A 5IU6A 5CYGA 1ODLA 1OTXA 3E0QA 4L5YA 4MARA 3NM5A 2BSXA 3SCZA 3OZDA 1N3IA 1U1GA 4M7WA 3EEIA 4LNHA 4BN0A 2ISCA 1V45E 5B7NA 2QSUA 1Q1GA 1T8WA 3UAWA 3DDOA 4F2PA 1PR0A 5I3CA 1OTYA 4QEZA 4L5CA 1A9SA 4TXHA 1JE0A 1JDUA 2A0WA 1QE5A 4OJTA 1Z37A 3E9ZA 1OUMA 4M1EA 1Y1TA 1Z5OA 5EUBA 1ULBA 4KN5A 1B8NA 3K8QA 1JYSA 4QAQA 4UC0A 1YBFA 5F78A 4GLFA 3BL6A 4DABA 1PR2A 3K8OE 4D8XA 1LV8A 3BGSA 3UAYA 4I2VA 1LVUA 4TXLA 1JDVA 1YRYE 2B94A 4R2WA 1OU4A 1PBNA 4LDNA 3ODGA 2AI3A 5K1ZA 5F76A 4DA0A 1TCVA 4FFSA 3UAZA 1A9QA 2HN9A 1Y1SA 1JDZA 3UT6A 4BMYA 1U1DA 1V3QE 3KU4A 3KVVA 5CCDA 1Z36A 1K3FA 4U2KA 2OC9A 4PNPA 2A8YA 5F7ZA 5CXSA 5EFOA 5C80A 4WKNA 1SJ9A 2GUWA 4WKBA 3OZBA 4WKOA 1B8OA 1RFGE 3OCCA 4WKPA 1A9OA 5EPUA 1LX7A 4F2WA 1ECPA 4IP0A 1Z5PA 3LA8A 2AC7A 1V41E 3LGSA 1PW7A 4TYMA 4F1WA 1NC3A 1I80A 2QTTA 4K6OA 3DF9A 3BSFA 1A9PA 1A9RA 3FOWA 1JDSA 5CXQA 3NM4A 1SQ6A 4NSNA 3NM6B 3IEXA 2QPLA 4F3KA 1PR1A 5JPCA 4ECEA 1T8YA 4TS9A 4DA8A 3INYA 4NY1A 1ZL2A 3LBAA 2QDKA 2HWUA 4WKCA 3O4VA 1YR3A 1A69A 4JP5A 3IOMA 4OEHA 4RJ2A 1Y1RA 1A9TA 1OV6A 3FUCA 1PK7A 1CG6A 3OF3A 4LNAA 3PHCA 4MCHA 1PR5A 4E1VA 5FAKA 1TGYA 5KB3A 2ON6A 4TTAA 5IFKA 1Z33A 4D8YA 5B7PA 4BMXA 3OOHA 3DPSA 3P0EA 4D98A 5ETJA 3OOEA 3QPBA 1V2HE 4L5AA 1NC1A 3PNPA 2HRDA 1Z35A 4TXNA 1U1EA 1RXYA 1SD2A 1ODKA 4LKRA 4DANA 1RSZA 3EUFA 3DJFA 2A0YA 4G89A 2AI1A 3MMSA 4TTIA 1Z34A 2AI2A 1JPVA 4F3CA 3U40A 3O6VA 4OGLA 4TXJA 3FNQA 1Z39A 4QATA 1RYZA 1WTAA 3E9RA 2XRFA 1YQQA 4QFBA 3C74A 4YNBA 4LZWA 1G2OA 1VFNA 2OC4A 1Z38A 4M3NA 4DA7A 3EMVA 1Y1QA 4G41A 1JE1A 4G8JA 1PK9A 4YO8A 1Y6QA
chains in the Genus database with same CATH superfamily
2EFJA 1SQGA 3I01A 1XCLA 3CH5A 4YJ2F 1RHKA 5KIAA 3Q3CA 1UEJA 1OVMA 1JDTA 1W73A 3FYTA 2G82A 1A2OA 1ZGGA 2C77A 3HWRA 1MF7A 1Z0DA 4HAWA 2DUJA 4JLBA 4PLTA 5DFAA 1J22A 1XVLA 4YJKA 1P73A 5CMLA 2CV2A 2CDCA 2YDXA 1QS0B 3AM1A 3EIUA 3Q8WA 3AZOA 1VBKA 4U2CA 3TB6A 3GGOA 1HQYE 1QIKA 3LNCA 2O6LA 4DCTA 4FT2A 2PKXA 2XDYA 5KWEA 1DCKA 1JG6A 3DP9A 3PXUA 4EO4A 4ZK6A 4TM8A 4MTLA 2PEZA 4JJZA 3RYFA 4AROA 4H4EA 4DTIA 4Z7OB 1HWYA 3O1LA 4E2XA 1T36B 3VVBA 1BVHA 3JQ9A 1Z4QA 3MJDA 4EHFA 3EEFA 3A9VA 5EP1A 3NPMA 1DAFA 1V11B 1UADA 2QRHA 1B0AA 2G4LA 5B2EA 1AV6A 2MIIA 1ULZA 1G3UA 4HC4A 4DB4A 3Q8KA 2BH9A 4X61A 5I7HA 1GQ2A 2G72A 3WP1B 4HDNA 4FE7A 4ZHQA 4RJJA 3KZ1E 3IEMA 1OREA 3AQIA 1ZDMA 5IPFA 3R3SA 1SVUA 3L8GA 3S44A 3UMSA 4D0SA 1ZNYA 2J6HA 3UCFA 2EEPA 2Q4DA 3A37A 1CQIB 5IDVA 4BZPA 3GUCA 3PX3A 8GPBA 1RYFA 2OV2A 4YP7A 4FYWA 5I4KA 4R9SA 2WJ6A 3BK2A 4IDBA 1AS3A 2BR4A 3LOQA 5EJIA 2OBYA 3SXUA 1ONPA 1QPGA 3PS9A 2PUTA 4JY7A 4JQSA 3B48A 5IK2A 2HW8A 1ZKMA 1Y7PA 2VDMB 1T43A 1IG0A 3SZLA 1N36B 3FB1A 3CJQA 2PL9A 2XA1A 4NS1A 1JAXA 1YU6A 2VPYA 3EEBA 5ALKA 2QR3A 3KNZA 2ECKA 4RK4A 3T35A 2C3UA 1CULC 5CJ2A 3HDQA 5HKKD 1AKTA 3TJZA 3L0ZA 4KXQA 5J58A 1T9ZA 2GXAA 1LBTA 2P4SA 4PBTA 2AR7A 1RQ2A 1O95C 2EEZA 4HG2A 5IAGA 2RC5A 3VTAA 4R9NA 3TLAA 4YH1A 3GZ4A 1IHXA 2F8TA 1RXCA 3K5IA 1QOPB 1RXSA 1VPTA 4IIDA 1CYEA 1CNEA 4C4RA 3QSGA 5DU2A 4B85A 5EE3A 3AVPA 1GV1A 2WEKA 2KI5A 1HT2E 4IOLA 2H06A 4L8LA 1DB3A 1P0IA 2P5UA 2IPOA 2ZEJA 3BTOA 1G9TA 1YVDA 4LNUB 4NOKA 4P8RA 1MKYA 1QG0A 4XD7A 2WY2D 2A0XA 5C1PA 5IWAB 4FQ7A 4G9GA 1NRXA 1WWKA 1HGXA 3WL8A 5L6MB 1FFYA 1A8PA 3CHYA 1MC1A 3QFSA 4ZAVA 2A58A 3S7ZA 1YHZA 2GJKA 2ZYAA 3HUEA 2QF7A 1J6UA 3H3FA 1L2TA 4W9NA 4HDOB 4UASA 3ZWOA 4ZTUB 3IIIA 1ETHA 1VCNA 3C8HA 2IFTA 2GEFA 3KWFA 3OBBA 2J6BA 3U7QA 3QUAA 1AB5A 1IQUA 4HYTA 3T1QA 1FMLA 3DOIA 4V1CB 1NT2A 1BMFA 1QHHB 4POAA 3GELA 3T9FA 4DCPA 4O6VA 2ZWPA 1BHJA 5A2GA 4B4VA 1D6SA 1MNQA 3HGTA 3E05A 1N5JA 2ZUTA 3OUTA 4O1MA 4G07A 1MLDA 1QGDA 3UHJA 5JNRA 3CWCA 1NGSA 4EG8A 4CIBA 1MJGA 4HFNA 4OHBA 2QVXX 1JEQB 1TJPB 2DFTA 1USVA 2OOSA 3D5EA 3H1FA 3HCWA 4QARA 1J49A 2ZKIA 4BX3A 4ZQGA 5HK8A 2JARA 1SVIA 2J8ZA 3HDHA 2BL4A 5FO0A 5B1EA 1BDIA 2B0CA 4ZV9A 3G88A 4GM0A 3GLFA 2GGSA 5CH8A 2REXB 1GL6A 3IPYA 1MGOA 2C7BA 4NK5A 1QONA 3CY6A 5JWRA 2WQ6A 1C9MA 5KTMA 2IU3A 4HN4B 5AIBA 3EBLA 3SJCA 3RKRA 2REBA 1NQOA 1VPVA 2FWPA 3V2GA 2YIDA 2AN5A 5CAEA 2D7DA 3BK1A 4GP7A 4IDHA 5GJCA 5JH7F 2IS4A 3QWIA 5I6DA 2H48A 1T1IA 1W49A 2Q9UA 4BE7B 5ICCA 3D6UA 4JHXA 4QRHA 4O1IA 4YPVA 2I6UA 3CN9A 2MYPA 2I7DA 2TSYB 2VRWA 1T5IA 2HQSA 2IX9A 3AU9A 3NDPA 4I1UA 4OI0A 1ZVQA 3PA8A 1KFEB 3F7TA 4HGPA 4KN8A 4BMCA 1EWKA 5C8VA 5H83A 5IM5A 4DA4A 1VFPA 1P61B 2ZRBA 1NDUA 2V5UA 2PD4A 1Z47A 3P96A 5DNWA 1RZ3A 5REQA 4BX0A 4R1TA 3CR7A 2ABWA 4CM5A 3QY0A 3WGGA 1VLLA 4B4WA 2QT9A 4JC0A 4EI2A 1ELOA 1Q3TA 1YJAA 5ELXA 1T8SA 3L1UA 1JHZA 3SEQA 4OHPA 4LDPA 2C04A 2WYHA 3TLJA 1ESMA 2QZPA 3A3PA 3UHFA 3V55A 2Q3MA 3O92A 2E89A 1ZZGA 2N3ZA 5CIQA 1N2CA 3TMKA 4PZDA 2I55A 2CKDA 2I67A 5CBPA 5WRFA 2BSXA 1EGAA 5LBTA 2PFSA 3ILSA 4OP1A 4TQUS 1U04A 3PC4A 4M7WA 3A7EA 1LS1A 3HDJA 3EUWA 1FSGA 1S02A 3K1AB 4OSOA 4ZAGA 2OV4A 1FTNA 3ZXUB 3ETLA 3O03A 3HVKA 4YCMA 3ZK8A 3BXOA 1WCV1 5ALSA 4F8YA 1C3VA 3DQZA 1Q0TA 4Q02A 4A16A 1N6HA 1K6XA 2V96A 4L95C 2H16A 2RGXA 3FI9A 1ADCA 1NFRA 5T67A 2QQ0A 2XCTB 2VFAA 4NZNA 4EZIA 2FQXA 4ZOAA 2BFCB 4QEZA 2WYIA 3W06A 5A3JA 3I0MA 4FNMA 3WO0A 5AD1A 4C7VA 5JC8A 1Y4SA 2OVBA 3DD5A 3DZHA 2XSZD 3E2IA 1DO2A 3DE7X 2XKJE 2Q5OA 4LSZA 2WHPA 3AETB 5BSRA 1VE1A 1JHXA 1UCFA 4IJMA 3TLEA 4BHTA 3NNNA 1F0YA 3ZD8A 1C4OA 2ZB8A 3E22B 2L69A 2V98A 4JXJA 1ZRMA 3ZIAA 2FMUA 3MPUA 2QRGA 1DJLA 1B8NA 1M2GA 4FZJA 3GJ6A 1X1BA 3AR8A 4CF4A 3RVMA 5CG1A 3A0RB 1CUGA 2JJQA 3D8TA 3JX9A 3LYLA 4YS6A 1C7QA 2XQVA 2V6JA 2KE5A 2P69A 3FMVA 4DABA 1TLLA 1BCSB 1CR2A 4W8GA 3FVQA 4ICIA 5JO9A 3TCXB 4DM7A 5I47A 2YHIB 5I7EA 5LQCA 1K63A 5TQ2B 4OUKX 4EECA 1QHXA 2WTXA 1FQOA 3AF0A 4FUTA 4PZEA 1UDCA 2CF6A 1OPXA 1CWUA 1RKVA 4K5QA 2P41A 4O2AA 1JDVA 4CLOB 2AOXA 4XJSA 3KRTA 3AERA 4KODA 4YYEA 1FDIA 1IEXA 2PUCA 2PZ8A 4BFVA 1T4CA 2VTVA 1H6AA 2KW5A 4C5AA 3IV9A 4L57A 4LDNA 3I1YA 3NVAA 4UAJA 3HEMA 4O2AF 4WXPA 1AA6A 5KO2A 5FKJA 3SE7A 5TPWB 4D8UA 3N6RA 1JGTA 2UV8A 1U90A 1ACLA 4LVCA 3UMGA 5IVHA 1M0SA 2JCGA 2QUBA 2ZE6A 1O95A 1VDMA 3IRVA 4WJKB 3M8KA 1ZUIA 5DK4A 3UYLA 4BDSA 1Y63A 2AD1A 4IGAA 4XI9A 4ER7A 4KPYA 3NEYA 4TUYA 1NSFA 2XADA 3UQYS 2JH8A 3K15A 2NUPA 3M6AA 3N87A 1E1DA 5C53B 4QVIA 5ALIA 3CSDA 4I9UA 3RRMA 4JI4B 3Q9LA 3IULA 2JHAA 3LBYA 4IW3B 1VSVA 3GFTA 3M82A 4EQZA 2W6ZA 4XPIA 3A31A 5BT9A 3KVVA 4RJTA 5JZSA 2JNWA 1H6CA 4MWZA 3W5IA 3O93A 4BLWA 3GVPA 2X41A 3K2EA 2FZ5A 4M9CA 2IE8A 1EA5A 3QHPA 1J99A 2Q2VA 2QLFA 4LEIA 1KEWA 3FCCA 3WLIA 3PUKA 3L8HA 4Z9BA 1EEXB 1TIKA 2G7ZA 1DUIA 1RPJA 1IQRA 1KC1A 3JD2A 3SFZA 4AO6A 4AN4A 5CBKA 4QYIB 4PLFA 3SKYA 3DHNA 1AKNA 3B6KA 1ADGA 4LVUA 3HFGA 1XMIA 5IKXA 3RS5A 3THYB 2RSLA 2WKQA 2WZCA 4ZYUA 5IC4A 3K1TA 2HV8A 1U3DA 2EJBA 2V6FA 1CP2A 2V6GA 3KXLA 1E0KA 4UEQA 3RBAA 3Q7QA 4G01B 5KYUA 2BIFA 4U39A 5DTMA 4AP9A 3M4YA 1NOJA 2YMLA 3HB1A 4LYYA 4UD6A 5TMBA 2R65A 3K8ZA 3TXXA 3WMEA 1L7RA 5KSZA 3T7KA 4TWIA 3FZEA 2P4UA 2Q3HA 3V4RA 1F2DA 4PSAA 1RAAA 3W2HA 3CF4G 3PZBA 4C20A 2QTTA 3IP6A 4MNTA 1AKEA 2ZRAA 4P5DA 4ACAA 3D0RA 4JFRA 1A9RA 1IFXA 2MCFA 1DFGA 1UBMS 3AR5A 4KI0A 1T2EA 3LC2O 4XWOA 5F1YA 5FUVA 1XYYA 3GGDA 2OT3B 1ZK3A 5CA0F 1WO8A 5FOSA 3T7DA 2EJUA 2AVDA 1M6WA 1Z18A 1D7AA 3KK0A 3PRJA 3R77A 4HH0A 5DYNA 4DLLA 1BMQA 2YWHA 2VK1A 2HZBA 4YAEA 5IZCA 3OPXA 1EFKA 1RTTA 2LVBA 3NEPX 1JSRA 1ZQ1A 3FJOA 3KL4A 3L49A 1OA0A 4P7FA 3CLRC 4A82A 4DC0A 1I7DA 4JYCA 1AZWA 4XB6B 1AK1A 2RK4A 4GNKA 4O4LB 2ZI5A 2J46A 5FWYB 4DA8A 4EG0A 2H8KA 1QO0A 2P0AA 3V7FA 4HADA 4MP6A 1K08A 1OT5A 1X7XA 2GQ0A 2J5BA 2HWUA 3BD6A 3DGFC 3FHCB 2QA5A 4J07A 4GD3Q 4LRSB 2J3DA 3KQWA 1F3OA 3CT6A 4WXHA 2XUOA 1STOA 1YR3A 2R8XA 3NBAA 2ODEA 3PR2B 4RHEA 1YC5A 2QVBA 5LJIA 2QUAA 4RFVA 3HXTA 4CCYB 4Q03A 2H9AA 3T3MB 1OBOA 3P2JA 2EHDA 1THZA 3DZBA 2Z9DA 1BCRA 1D5CA 2EJTA 1KJNA 1Y6JA 5K03A 2Y0PA 1RWMA 2AOVA 2AW3A 2JJ2D 1F8YA 3F6CA 4HEJA 4RBNA 5D6OA 2ZSKA 2JA2A 4ZT3A 4B73A 4PQFA 4BTLA 3NRCA 2Y1KA 1WF3A 4HAIA 1AC5A 3B3AA 3FPBA 4XGRA 2MSWA 2DHDA 2G63A 3C15C 1DADA 1WPRA 2NU8B 1GSHA 2NO0A 2ODBA 4S3MA 3HMQA 2WWVD 1VRVA 3OQBA 2A88A 1CRLA 2C20A 5JDCA 3GR6A 4QAJA 3R7WB 4NMMA 1UPXA 5T6BA 3HUDA 2CLDX 4JODA 4D8YA 1ZC3A 2G76A 1EE2A 2HSEA 3ENKA 4FCWA 3WYDA 3A1CA 3WA6A 1QU2A 6YASA 1E18A 3UBMA 4KLZA 2XQFA 2XLBA 1P0QA 3DZIA 4WV3A 1WB9A 3AHHA 4UTNA 4L3WA 3SYMA 1EM8B 5CCXA 3CZAA 1LPOA 5HIIA 4CM8B 5H8WA 4RKEA 4XRRA 3W1VA 3TQSA 1NATA 3NNSA 2I6QA 1X7XB 2C07A 4JOQA 4DLBA 4B3DA 2DUWA 2J3LA 1P4GA 3U3RA 5GJVC 3B1XA 1UAYA 3C3JA 3HJBA 1NLYA 1OF1A 3PNMA 4S2EA 4WESB 2J09A 5FL7D 2WTUA 5L7WA 1DDGA 1QHFA 3LUJA 4LKRA 4QUDA 3VPSA 3W8NA 4OHYA 3KKQA 5HZKA 3AF4A 1LRKA 3D1LA 4KQGA 3VFDA 2W6CX 5FOXA 2BFPA 2P9JA 2Q41A 3G2MA 2R60A 2A0YA 1H9BA 4LOIA 1W5BA 1EESA 1S1CA 5A1JA 2CJPA 5BR1A 1B0UA 1FUEA 3X1DA 4R2JA 1AGXA 1BQ3A 1CE8B 3INRA 5FR2A 3W5DA 1FQWA 3CLHA 3LFUA 3QJGA 5BW4A 4MRVA 2R62A 1P91A 1NI5A 2Q07A 2IXAA 2WMYA 4ND5A 4W1SA 1E9FA 4QD3A 3GGJA 5AICA 2OCXA 1P4HA 2O14A 2YCBA 4F86A 1TF5A 2NPOA 2X77A 5TJ9A 2AXPA 1XFDA 4IDEA 3WIOA 1N3LA 3S2UA 3ML1A 5D87A 5E1DA 1YZLA 2CMDA 1HYQA 4QEKA 4DR3B 3GY0A 3CXUA 1QQBA 4J8PA 4RESA 2PU5A 1CY0A 2FPIB 3N58A 4MVJM 1FY2A 1L7MA 1LPNA 1VCHA 2GK7A 2GXQA 2W58A 2FPKA 3DO5A 4DWVA 3AF6A 2AZXA 2P2DA 2A9OA 5BSWA 3N5CA 2Q3EA 2WF5A 2P0YA 3PFKA 5IVIA 1HG1A 4O5AA 4KQ6A 1Y5IA 2VQEB 4G0WA 3L9XA 3I4FA 4I55B 1OZ0A 5DT2A 3OIFA 4AURA 1S2NA 1WE2A 3S5UA 1EBUA 2CE2X 4US0R 4WXRA 2QN7A 2FW0A 3QWHA 1F14A 2DOKA 4PSUA 4H2DA 4G1EB 3PC6A 5K0BA 3B6IA 4N5DA 3A10A 5FEUA 3E7FA 3R9XA 3AIKA 3ZV5A 4F5EA 4JP1A 2RFLA 2RHGB 3OPVA 6REQB 4ZDKA 1GU7A 1ZONA 2JEZA 2OWDA 4XUCA 4MUAA 3O83A 4B4OA 2P11A 2R1VB 3OT1B 1J8YF 1HA3A 2NPIA 4J1TC 4NNJA 1VSUA 1BE8A 3FZGA 5FBZA 1ZIPA 4BX9A 1LRLA 2K4MA 3BMXA 3L1VA 4R05A 4B2YA 2H7XA 3CVVA 3JQ7A 3RVNA 3H17A 3RG2A 3U60B 1W9MA 2BKVA 5C7LO 1GSOA 1K6JA 1YA4A 2WWWA 4QPPA 4TL8A 3RTBA 2XW6A 3T4XA 1SBYA 4MJ3A 1WVGA 4IQGA 5EYPB 3UJ3X 2B1IA 2FF7A 2F2TA 4TUYB 1D03A 5AJHA 1NMXA 2QIPA 5AXAA 5KOYA 4FGSA 4CEIB 2UZIR 4FEYA 1UKCA 2XUPA 2CNBA 4MP3A 1A7JA 1UL1X 3L3BA 1P60A 1VSTA 1C1DA 1B41A 2GA9A 2Z56A 5B7GA 1AF7A 1U7WA 3FCAA 2BH2A 4KNWA 4O4HA 5AHWA 1XC7A 3OJXA 4KUGA 1ZD8A 3UPDA 3K6KA 5KU1A 2PRJA 2ZT6A 3DH0A 1ZXXA 2WJVA 4FLEA 2F9MA 1D0VA 2HDWA 2VDRB 4Q7MB 2I4RA 3UMBA 5I7FA 2H00A 1N0HA 2J30A 4D45A 3HXMA 3HLYA 4UATA 4H6VA 1SVKA 2PGLA 1N6PA 3G8BA 3R20A 4RPCA 1P8AA 2P6UA 2WTMA 3IOCA 3OF2A 3QA3E 4QREA 3H0CA 3WNDA 1K6MA 2W4QA 3M6XA 3GFVA 4CL3A 2F67A 4LCEA 4WEQA 3JQFC 3ES9A 3H4VA 4Q19A 5ELMA 4DMMA 4N49A 5C8DA 5IJ0A 4UOEA 2ZIEA 2OL4A 5DISB 1SRQA 2VJPA 5EJ2A 5DGTA 3ZU5A 2V1UA 1VRCA 2LV8A 2QMHA 2IUSA 4MDYA 4WXMA 4NBSA 4DPMA 1Q1AA 4HWGA 2WSSD 4REQB 3HKDB 1SCJA 1USIA 3NAMA 1M1NB 4FYIA 3S28A 1J8VA 1N2CE 4HGZA 4P5EA 3LK6A 4CETA 5D7NA 1P2SA 2C7GA 2H07A 1R0CA 1AA9A 3NBFA 4HWSA 4MEAA 1MOPA 5A62A 1Z07A 1KSJA 4KL8S 4QU5A 3Q3GE 3GLHA 3IAAA 2JVJA 3D1VA 4WKCA 5CK5A 2EYUA 3NBMA 2Q2NA 5JQWA 4MQ6A 5H1YA 1RZVA 3NKLA 4J9UE 1YK1A 3Q9UA 1D2CA 4HSEA 2PD3A 3N3AC 4GOKA 4MS4A 1TTTA 3GGSA 3BJEA 3H9CA 1CW2B 2BBWA 2VDNB 4ZU3A 2Z3VA 4ZT6A 4D4LA 5CB6A 5BRJA 2XNDD 5C81A 3CCCA 3G17A 1QZZA 2DWUA 3OTHA 4US1R 5FV7A 5IF9A 1NR1A 1EUCA 2ZJ8A 2G70A 4JOBA 4OU5A 3UHAA 2GETA 2ORED 1PFVA 3SC3A 2XEDA 5DI9A 2H0RA 2XNHA 4PS1A 4DARA 1O0CA 3N2GA 1BHSA 3CCFA 4IDDA 4ZJZA 3MQ2A 3WTBA 4N18A 3UYKA 4U0JA 4NZPA 5AJWA 1X39A 3NBYC 2J08A 4J2HA 4RLQA 2HBZA 1KYQA 2H3HA 1KDOA 4TN5A 2QV0A 2E4YA 4NH0A 5C0OE 4B8ZA 3KSMA 3HVHA 4X24A 1P1JA 1XFAA 2JFOA 4AZVA 3ICQB 3IDQA 4P4UA 1JLLA 3CUEF 1N9GB 3DE6X 4ZU6X 1MJNA 1ODJA 3OOSA 2QTLA 3UAXA 1BAPA 1Y4AE 1QH9A 1E5LA 2D1SA 4UNPA 2XT9A 3DVQX 3UB3A 5TQ0A 5EJ8A 2QSJA 1LI7A 4ZQCB 4RAOA 3D0KA 4ZO7A 1NF9A 3LDGA 4JLSA 4FFPA 2P6PA 1GUYA 3HA5A 4CCAA 3NHAA 2MINA 2QE7A 3F8WA 1T0BA 4LYFA 3MJRA 1Z7BA 3ENZA 4FUQA 4V24A 4AXXA 1NVUQ 1MZPA 4ZAXA 2HBRA 1ZISA 1MCZA 3ZDZB 3DCJA 1VJDA 4XYMA 1CVRA 1KF0A 3KSBC 3R5TA 4MQ5A 4R6XA 5LU9A 4KREA 4WK6A 4AG5A 4EFKA 3NJ8A 1WD5A 3V7NA 1PL0A 2QTMA 1X1RA 4JB8A 4HUTA 2NO7A 3AZPA 5IZ4A 2B82A 2Y4NA 3I58A 4QXRA 5G02A 1GKIA 3UXEA 1WKCA 1PQWA 4IQ4A 1YHNA 1XMJA 5HF6A 1RE0A 5B1YA 1V7CA 3RT7A 1QF7A 2JW5A 4CMEA 1TLFA 1AXEA 2YJNA 3OTQA 5KOJB 2CE7A 3DFFA 1G4HA 3KQLA 3GPBA 2Z4RA 1WZIA 3HWSA 2HSWA 4HWOA 3QUSA 1YQUA 5ALYA 3BHMA 5LCXA 4F85A 2HA0A 1KP9A 4G09A 4V0LA 3SBEA 4X5OA 1SBIA 3QP9A 3QHAA 5FI1B 1RBMA 3IP9A 4ZMBA 3IV7A 3KAJA 4B17A 2Q3LA 1RP7A 4XYGA 3QE9Y 4Y6OA 4IIGA 2GPBA 3GLQA 4P08A 2PO7A 4M37A 2ID9A 4Q3CA 3S1LA 1LY1A 2C0PA 4K9LA 5BYBA 4BVBA 4UM9B 3GFBA 3FIJA 2YHUA 5F3DA 4URXR 3AV0B 1AQJA 3ZS8A 5IU6A 2YRFA 3EC1A 3MHPA 5BV1A 5BSGA 3M83A 4NE7A 3CKKA 1NZJA 4Y6LA 4QTYA 4KPUA 4G5XA 4IJVA 3B1VA 1UFRA 3K16A 4KVZA 5KVQA 3HXOA 4FC6A 4GSLA 5LLSA 1CSEE 4YXFA 2DX7A 1EVZA 3D8RA 3FR8A 1BS1A 3FVWA 3RYHB 1Q0LA 1R4NB 4R2IA 2IS6A 3MM4A 2ATEA 3L7NA 1UEXC 3KO8A 2WSLA 2OHJA 2YBDA 3FPEA 5JH7B 2QSUA 1VYVA 4KLAA 1FBNA 1T8WA 4LMAA 4JI1B 3M3DA 1W6RA 1C9JA 1B4DA 2HK8A 3UV3A 4ALMA 3AKDA 1W0KD 4N40A 2X1VA 5IARA 2ZREA 1FDRA 4GHWA 2GASA 5I45A 5KTPA 1NURA 2VK4A 5HIKA 2XYQA 2Z3WA 3F2VA 2HQOA 2FWJA 2Z5LA 3FDFA 4IR7A 5EIBC 3DDHA 3DOEA 1MOSA 3I9KA 5EWJA 4RIFA 1XZIA 1Z22A 5FBQB 3KOUA 5CNJA 5SZJA 2A7QA 3VPHA 5DW3A 4I4NA 3SQOA 3SHOA 1DX4A 3ITNA 4D5GA 4LMPA 5IANA 3FPCA 2HU2A 2WG1A 5JSQA 1WUKS 3RC8A 2J9RA 4IYRA 3EEQA 1FDOA 1N5KA 3PKJA 4DDUA 5J1SB 2WHQA 4M1EA 1Y1TA 5TGZA 3L0BA 2BP7B 2QD5A 1ZCAA 2QPTA 2WF8A 3U1TA 4B6RA 1XTKA 2AJCA 1JYSA 5EKSA 3U4DA 2ECFA 1A5BB 1V1JA 4XW2A 4LC0A 4MIEA 2IRWA 2AZDA 2ZB4A 3AETA 3Q1LA 4Q7JB 4RZHA 3ZWBA 1R0XA 2PSSA 4IQFA 3RTEA 4DGSA 2R2AA 4UTXA 3QLEA 2E5WA 2Z6AA 4DREA 2WT8A 4P7JA 5KNBH 5K0LA 1DHRA 1P7ZA 1WS6A 1A50B 2EX0A 1W5SA 2R48A 4G9EA 1JLMA 1JHMA 2IEZA 4RVSA 2OB2A 1H2ZA 4LYEA 3DTVB 4YIKA 1LDGA 1ZBQA 1NVFA 3PLNA 4BB5A 2ACKA 2OG2A 1ZOOA 4NFLA 3JAKA 2X42A 4YK7A 3KETA 1T0HB 2PLRA 5CLLA 2JF0A 2JAHA 1EXNA 2YR0A 3P26A 4FEGA 3PNQA 4GFDA 3JATB 4C4OA 5DN9A 1BKYA 4X6LA 4OSPA 2FUG1 1PZHA 2F3TA 3OT4A 3E7WA 4I5GA 4RKFA 4LBZA 1JW9B 1Q7EA 4LJ6A 2IZZA 3ROQA 4IAOA 2G0AA 4DBVO 3TIIA 1DLJA 4K9RA 1DSSG 1ZUNB 4RMJA 3VSAA 1P4AA 2Z2IA 4FYJA 3I01M 2TMDA 5FJIA 4CUJA 4EEKA 1YQ9A 2JGFA 5C3MA 3PRKE 1E4EA 1NVMB 2HGSA 2HMUA 3FPAA 3H19A 1U1DA 1K2VN 1C4KA 1G5PA 1ZUD1 4YCNA 2G71A 2X22A 3ANSA 4IZ6A 5CLFA 1ATIA 2AG0A 3SZ3A 1Z36A 5CEEA 5JVDA 4PTYA 1E2EA 2XMQA 5FPYA 4S04A 1WRBA 1SBZA 3IQHX 1PT7A 1B6GA 3PPXA 3UNXA 4A10A 2VPXA 1C8LA 4NEHB 1MHPA 1P19A 4BFCA 2EKZA 1WUIS 1S3FA 1Q16A 3EDCA 2HXGA 4AMVA 2WAYA 2ZIUB 2GUWA 1Y1KE 1IN6A 3OA2A 2CXPA 2ZUDA 3MCTA 4D79A 1P33A 2OV3A 3HR8A 1IZ0A 4RZSA 2VJNA 3HDYA 4JB0A 4F2DA 1NN3A 3VYWA 1M1YE 3JASA 1E1RA 3SYNA 3EZFA 3L7JA 1NL3A 2PGIA 3IALA 3PJDA 3DTVA 1F5SA 3OP1A 1SUCA 3QVLA 1SCUA 1EQUA 4MUKA 5AW3A 2BN4A 3H04A 2NVUB 3KE9A 2Y1CA 1YJXA 4BB6A 1CD5A 4WFQA 2OD9A 3DVLA 5E6RA 3PYXA 4RHXA 4GSKA 3SXJA 3OM8A 5TPWA 4I8DA 4LPSA 2P7HA 3E70C 4BBJA 4C4TA 4DGQA 2PMBA 4IQ8A 4HOYA 1PZNA 1JJFA 1TQ4A 3DT8A 4NU5A 5K3DA 4G1BA 4A92A 3PGJA 1XPUA 2GCOB 1U0GA 2SKCA 2A33A 3N28A 1M2KA 4H6XA 3BERA 1S9DA 1OC4A 3NUZA 4I0WB 2NXNA 4R9RA 3WGJA 1B6TA 4L0QA 2GEDA 2XMPA 1NAIA 4H7EA 2GD2A 3BOSA 3BMQA 5LWHA 5KPJA 1NBIA 1QIDA 2W43A 3NWPA 4G63A 3GEEA 2HTFA 5AVSA 5L45A 3UXYA 3I6IA 4WA7A 1I3KA 1Y5MA 2W6QA 3OPQA 3ORQA 1T8YA 2FSUA 4BN5A 4Z53A 2VQ6A 3ESRA 3LZ6A 2B1RA 1OTHA 3HXPA 4NY1A 3AEUA 3UKJA 4E0BA 5F12A 1SIOA 2EJCA 2IYRA 4PZAA 5K2OA 1HZZA 1VPEA 1PL6A 1Z3CA 5JTTA 4DNOA 5KHLB 4QHSA 1GQQA 5DIZA 5LXTF 3TZ6A 5CFNA 3S81A 2JIOA 5THXA 4G8BA 2ZBQA 1M5RA 1USKA 2YWDA 5B3AA 2PE5A 1AURA 1NW8A 3AR9A 1HMPA 3Q4GA 1XL0A 4UU0A 3TZLA 4BBAA 3LM8A 4E5DA 2XXBA 2V59A 3QTLA 1PK7A 3CSUA 2AC4A 4LIPD 1O0BA 1CG6A 1TC1A 1IVSA 1SXJA 2ZB7A 5IAJA 3UC9A 2ECOA 4K6KA 4DMLA 4ZI7A 1G6KA 3JQ6A 2ZTHA 4PG5A 3ZJ4A 4YJ2A 5H9WA 4Y67A 4PS0A 1FMTA 1Z08A 4NU8X 2JHGA 4AY3A 2CJWB 2JI7A 5JLJA 1E2DA 4GBJA 4Z2YA 1Z6QA 4EY5A 1L5KA 1WOYA 1IZ7A 2I3BA 3K0AB 3PNLA 3EHDA 3LL4A 1MJFA 3FKQA 4D3XA 3WQQA 1KAMA 1GLVA 4QDTA 4XWWA 1AQ6A 4QGBA 3EULA 2ZYTX 5DHFA 2JPDA 1VMAA 2LP4Y 1GFIA 2HCBA 2V7QA 2X1MA 3KEQA 3S6JA 4Z1MD 3V6MA 1P2DA 2UVPA 5E95A 4IIJF 3COYA 2PD6A 4HDMA 1ZX1A 2AFIB 3Q1KA 3RC2A 1A98A 4HNSA 4TXNA 5EQFA 1WDMA 2FCAA 2Q45A 1QBGA 2RKOA 2VDUE 2VP3A 4NDNE 4JFAA 3Q5GA 1YRQA 4A3SA 4YREA 4ZOLF 4NRDA 1JVNA 1QBKC 2BSQA 1K5PA 3VAZA 1X70A 3KTDA 3NC0C 1M6NA 2XODA 2FZEA 4NOLA 4B2PA 4A8JB 4DZZA 5BWNA 1T9DA 3FGOA 1OGIA 4HZIA 1QVAA 1SBTA 2JDID 2O5RA 2OGWA 2ZUBA 1XZGA 1O57A 5AI4A 3PXBA 4B3MB 4G89A 5D51S 3M3PA 4JJ8A 5EIEA 1ZWLA 3TOZA 4HXFB 4GOXA 1R6BX 2CVZA 2IF2A 2HLHA 3G0IA 3O3MB 3OO0A 3V5NA 3WYNA 1I6MA 1RKBA 2F4NA 4DQ0A 3E3OA 2WU4A 1NVKA 3SZOA 4MS1A 1FSZA 3O38A 2P8SA 1WHTA 1GDTA 1XGKA 1MT0A 2F90A 1QZ3A 3F4LA 4OJKA 1XRMA 2PGOA 5HFNA 2OQ2A 4NU6A 1MJGM 2ZJ2A 4RQTA 1UMCB 2P9TA 3IP1A 1RRMA 2R6JA 3PHHA 4F72A 5CFRA 2Y27A 1FDUA 1T2FA 3RRXA 3TYXA 1LTQA 3H5NA 2WLSA 5ALVA 1UP6A 1ZN8A 2FPRA 2QYTA 3IAUA 5AQEA 2CF5A 5KSPA 1UZUA 5AVOA 1A9XA 1MHTA 1SQFA 2FJPA 2C2KA 3NEAA 5JXHA 4P9NA 3U3ZA 2H92A 3V48A 2D5BA 3COJA 1Z2CA 2ODPA 2X6QA 1EZZA 1Z6XA 4D3SA 4RAQA 1ZEJA 5EVJA 4N5LA 1BYUA 1OIXA 1SHJA 2BGIA 2OZLA 3E0XA 5CJJA 3V4OA 4V0SA 1WUTA 1VXRA 4XWAA 2C2HA 4Q9HA 3B12A 3QPUA 3KOWA 2QUKA 3JVVA 4J0GA 5JJIA 4G9BA 1VLHA 1GNRA 2YJ4A 4GKVA 4BIIA 1DVRA 3B5EA 4I4CA 3H4IA 1KEZA 3BFJA 3IT3A 4WK4B 2COUA 4BJHB 1RRGA 2ET6A 3LXUX 4UBLA 1QANA 3M6VA 4D6PA 3HACA 4YVFA 3GZNB 4P7BA 1GSAA 1KP3A 3H1BA 4YO8A 2CVQA 5DHAA 4YT8A 1U8YA 2LPMA 4P3YA 4OHWA 4AN0A 1DCTA 1SO8A 2Z6UA 3NTOA 2M6SA 5AP9A 2SBTA 5HMMA 5J63A 2PMEA 4MS1B 4UNRA 1JMVA 1FYVA 2HCFA 3C3AA 4JJ6A 4LXUA 4L3VA 4WX2B 4ZKDA 5JCXA 4LS3A 5LLDA 2FRXA 3WB1A 2CLOB 1P5RA 3BQNB 4NAVA 2RIPA 2R85A 1UMCA 4KSCA 1DS6A 2DT5A 3GMSA 5ULLA 1YRAA 1ZD3A 3TSAA 1JZQA 2QMZA 3AXSA 4I4IA 3G5LA 3TK1A 1KMNA 4K6GA 5JSYA 1GKUB 3VOSA 4J7XA 5BWBA 4R1UA 5FBVB 2P40A 2CXHA 2HU8A 1OMOA 1B42A 2XAUA 3N1UA 2LCQA 2OP0A 2VSYA 1M1YA 3MELA 4M22A 2OAP1 4IILA 1XL1A 1YL7A 1T9AA 5JH7A 3ANLA 3ISTA 4YP1A 2O54A 4CG1A 4ZQIA 4ALLA 2Y1EA 3EIXA 2BFWA 3L7YA 1KR2A 3Q2OA 4XWTA 5E7JA 4JBHA 3RGWS 1BVUA 4CQMD 5K8TA 4BNZA 3MB8A 4I55F 2QN9A 4CKEB 9MHTA 3MEQA 2CLCX 3MMPA 2Q7XA 1MXFA 1A88A 1DUVG 3KB8A 4EX6A 4RULA 3AMVA 1L5MA 3CRRA 1AO3A 3K09A 4MRSA 4V0QA 1O95D 1K97A 1QR2A 2ZB2A 4MUHA 3RUPA 2IHBA 1ZHFA 3R9XB 2F3SA 4K87A 1K66A 2O8BA 2XGJA 4HLUC 3TOCA 3H2HA 1L4UA 1H69A 3M49A 5BN4A 2YS7A 1Z83A 4AO8A 1B15A 3BIXA 1ZVVA 4HXYA 1OH7A 2OYSA 3D6VA 3T3EA 4N03A 2WQ7A 1ESEA 5A5VA 2ZUEA 4KYUA 3FTFA 3EPKA 2EKPA 4KGXA 5AHKA 2PY6A 1Z8FA 1AS2A 3EDMA 1ZJ6A 3DMNA 3LI2A 1QG2A 4MVYA 1REQB 3EG5A 1CZOA 4UDOA 5BR7A 3RVBA 1BU5A 1HORA 1U7OA 1X8JA 4QJ5A 1PJSA 4MW5A 1MOZA 1ODSA 2CHQA 4C2AA 1H8ED 1NTRA 3JRWA 1TFRA 3GRZA 4GPBA 4HNUA 4OBXA 2JCVA 1OFHA 1U5BA 3VNBA 1D0IA 3VNQA 2NQ2C 1OKKA 1I3OA 1W4LA 3HCCA 4O2AB 4XSHA 1XVAA 2XGGA 4QUBA 1A2KC 1W5TA 1DU4A 1E7WA 1M1YB 4FS3A 4JSTA 4PX3A 4UDNA 2GA8A 2OA0A 4C0AC 3HO8A 1RC1A 2B78A 4G5SA 4F7DA 1T5BA 5BN1A 4EKYA 1JRLA 2LBPA 2NV0A 2PWZA 2XDQB 3BMQB 5FA5A 4GM4A 4URUR 1RYHA 3IVAA 4HLNA 3ZKWB 1Y80A 5EUMA 4I19A 4BPRA 1IE3A 2AE1A 4BGVA 1PJZA 5JMPA 1K27A 1Z0UA 2VPWA 1ZMXA 1I1HA 3AVVA 4F8EA 1AQLA 4Q1AA 4NBLA 1DQSA 4OXRA 4XEUA 1QHSA 2ZAOA 4XYBA 3MWGA 1AKMA 3IPCA 5DTQA 5GP1A 3BWCA 4ESEA 3O7WA 2XZTA 2HF8A 3A9SA 3W6PA 1GU0A 5LDDC 4LTNA 3H2IA 1W46A 1ETUA 3K1YA 3LRTA 1FFDA 2DFKB 3R0VA 3VV2A 2HF9A 4BVHA 2FMTA 2IKQA 2NO4A 1JIKA 1SPXA 4A7PA 4EA9A 1FYEA 1SCQA 3P32A 2DVMA 4LQ4A 3OI7A 5A3SA 4AY6A 5J43A 3E35A 4AIIA 3UAVA 5EQJB 5BY2A 5I7VA 4O3MA 3A6JA 1I9CA 2HADA 4FILA 3RAJA 1FVXA 4E94A 3KLPX 4QYTA 1XRSB 3N05A 4JVSB 2A9RA 5TARA 4JASB 2YXDA 2E1RA 1U99A 2BAGA 3AUYA 3OZIA 4UNNA 3R3WA 5EP2A 1HETA 1OXSC 4AWAA 3AHCA 3JPWA 4O4IA 2W2PA 3DL2A 3ZLJA 2FDXA 1E2HA 2B4QA 3MWYW 4AJPA 5C1DA 2PGJA 3LOPA 3I3OA 4E03A 1RLUA 2E4WA 2WHXA 3OCJA 2OB1A 4QPZA 4FMPA 1JKIA 4GXQA 3IQGX 2J33A 4FLFA 3STUA 2GSDA 2G5TA 1JAYA 2PDAA 1XRQA 2KM1A 4YFYA 1PX2A 1YU9A 2AJBA 3CUSA 5FAXA 1YJ8A 3B9BA 4IJ5A 2XQGA 4K81B 1KO1A 3FWNA 4CV3A 5I4CA 1IY0A 1RWQA 2G6BA 2GZ1A 3SIRA 3ZW9A 4KACA 2B35A 3HGQA 3O5AA 1W581 2WR8A 2C31A 5IM4F 2GRAA 3CX8A 2PZJA 3ME5A 1B76A 2O2HA 3OZCA 2FZKA 2G88A 1MIOB 2VHJA 1E61A 3TLMA 1U0HC 3KFLA 4BVGA 2QI9F 1D2GA 3SMVA 1Z8DA 3I6MA 2HLPA 4D9JA 2K5UA 5KYWB 4L72A 1R1DA 1ZKDA 4BTEA 3BB1A 3LO8A 2ZSDA 2O5EA 1O54A 1OTXA 3EZYA 5P8WA 2C99A 4CT5A 4QTTB 4DILA 1ICIA 3P2EA 2NU9B 4EMUA 3NH6A 4K0RA 5BUZA 3RSQA 7MHTA 2JGLA 1W93A 1G21A 3IR6A 4BNGA 3AM3A 4J75A 4F5WA 2VBFA 5BV0A 1XZHA 1ZI9A 3WRWA 4GE3A 4RXMA 1X2EA 2HM7A 3T1OA 2CXOA 5ANRB 3IP8A 1Z0SA 3QMMA 2NVWA 1IPHA 3JQAB 2AIRA 1SVNA 3A3KA 3DUFA 2ISCA 1QVZA 4HD8A 4LNHA 4UM9D 2IK8A 4LHVA 1RJEA 1VE7A 1KR5A 1P1BA 4OK6A 3ETHA 4Y2GA 5DRTA 5H68A 5IXJA 1SB9A 4KGZA 3FYDA 1M1UA 4PN3A 4KSYA 1WXDA 5CLIA 1BXGB 2J9FB 1BHO1 4Q05A 3WJ2A 4H08A 2ZSAA 4CTMA 5KOJA 4IV8A 1B0PA 3CG4A 1W4BA 5E8RA 4Q6WA 3Q11A 4B43A 2I4OA 3BZBA 1ZBDA 5FPHA 2PU7A 2QD1A 4WOJA 4C88A 3NTXA 3UN1A 4MQEA 1JE0A 2Q99A 4EK9A 4Z0NA 4ND7A 3KKMA 1OXTA 1QE5A 2CDBA 2EF0A 2J0UB 2G83A 3IVMA 3PGA1 4GPD1 2AH5A 1QYIA 3X3HA 2G9RA 5DLYA 5M7EA 2D0DA 3WOHA 4KAXA 1YKFA 1VJ5A 3RFXA 1TM4E 3AR3A 5EWJB 5LQDA 1TKBA 1ULBA 1OHHA 1U3FA 1ZN9A 2HA4A 4INZA 3ZWQA 4B8YA 1PJAA 1Z26A 2QUJA 4P92A 3VVCA 4GLFA 4JBXA 1E3JA 3RYTC 5E4YA 1I33A 2WJZB 4QXMA 3F47A 3IT0A 3O9ZA 4P32A 2JL1A 4LW8A 5B1DA 3TKYA 5HXAA 1HDRA 3M34A 5AKGA 1IN1A 4G81A 1ZESA 1NHGA 2ODNA 2Z5VA 2CXXA 3O84A 3L06A 3AEYA 3B13B 2NT3A 4O8CA 5C1IA 2QDXA 2KLBA 3UGTA 3QBTA 2OO5C 4MW2A 3HKEA 1UBLS 1YRYE 2IHJA 4NK4A 4QULA 1I0LA 4OHZA 1HE1C 2JAUA 3DMTA 3MQFA 1CB7A 1H0RA 3EGDB 3RE1A 2FF5A 5DHSA 3EOAI 3ZZ1A 1IM8A 1TVCA 1YTUA 1I8TA 3N0RA 4CLRB 4R3UC 1NJSA 3H5TA 2AI3A 2WQZA 4X8HA 2WKRA 2GZ3A 3ER6A 4V2IA 2D2IA 2P9QA 3OURA 2CMHA 1K7EB 1NZDA 1QYRA 2DUNA 2AF3C 3I34X 2NG1A 1WPXA 1A9QA 1HNXB 1FXSA 2AUNA 2Q1TA 4PG8A 2JJYA 4V0KA 5LU8A 2LUOA 5ESXA 1MX9A 4RH3A 3VO2A 1E9EA 2VHTA 2VUHB 4M0DA 1XCJA 2RB4A 1O94A 4YGYA 5AKYA 5F33A 4V0ME 1FW8A 3G3EA 2YWXA 1XUOA 3P20A 1ECCA 2HWKA 3Q0TA 2A1UA 4XR9A 2OC9A 2IV7A 4Z7JA 4M0FA 3ZK7A 3DAGA 4J1QA 4B46A 3H9GA 4C1NA 1XTRA 1EFLA 2UYOA 4RTMA 4ROSA 3EMBA 2OSVA 3BD9A 3AKEA 4FI3F 4YDSA 4RGBA 3WG9A 1SJ9A 3B52X 1CYDA 3A32A 3DTYA 4P58A 5C3UA 1P3JA 5ICSA 4MH0R 3HHPA 1QLWA 1P39A 2IXFA 3NCHA 1H05A 3QYJA 4FBMA 4H0NA 1A9OA 3OUUA 2BFMA 2GYUA 4N0EA 2C82A 5DHTA 4GRIA 4L8GA 4DT1B 4L8VA 3VRHA 4K03A 3DULA 1I4DD 1R74A 4EG3A 1KYIA 2J07A 4QJBA 2BTEA 1JV2B 3QKSB 4YYZA 3WVNA 3O47A 1G0OA 4B7UA 2QXYA 2B6HA 1O5TA 1XTZA 2SECE 4Q37A 1EG7A 4KW7A 1LBHA 3O8OA 2IP1A 4TTQA 1GOTA 2DHQA 4ZC1A 1KVQA 4P0TA 2ZRQA 3FN4A 3AW9A 1EE1A 1ORWA 2VQDA 4G5FA 5K0ZA 4I8XA 1U2DA 4JSRA 4B6SA 1FOEB 4MYDA 1C30A 1VYHA 3BSFA 4IRUB 1DP4A 1XEWX 2XNJA 4QQRA 1PZFA 1AK2A 4GMXA 4GT1A 3ZW7A 1Q0RA 1UJMA 3RV3A 4BFLA 2RKBA 2Z0MA 2OORA 1FC0A 3FLAA 3NTLA 4J6EA 1C0IA 1R64A 3VPXA 3UJNA 1P2BA 1V3TA 3JWGA 3B38A 5GGXA 1X7GA 4H7PA 2VF5X 2Y6UA 3EGWA 1KAHA 3MTQA 5DHRA 5H16A 3VU0A 4KXVA 5HRUA 2ZP1A 3D8NA 5EYPA 3R9IA 1ZN2A 3UAGA 3CZ4A 2IW1A 4EY3A 2DBRA 2AMVA 2LE0A 3HB4X 3PGMA 5JY1A 1S2GA 3K71B 1NXQA 4JV5B 2DYKA 1VIMA 1VECA 4P2BA 2CEKA 2O9JA 2RK6A 3LCCA 1CNMA 3WBFA 1XQVA 2WJ3A 1NUQA 2YL2A 1JKFA 2RBEA 1CIVA 2VXCA 1FW6A 1PJTA 1W85B 3E4DA 3E84A 4IJQA 3V46A 4I2NA 5FTMA 2XV1A 4BFWA 1B6SA 4L8YA 3D4NA 3FMPB 2XZLA 4F04A 1YMVA 3KOYA 1YBAA 1FVFA 1G4UR 1G4AE 4AS2A 5HZMA 3KSAC 4IDPA 1G5QA 1OV6A 1PV1A 2NZYA 4CKCA 4DIOA 3P9RA 3MQ4A 4G4IA 4K2AA 4QOFA 4TRNA 1WEKA 1J2UA 2QN6A 5JALA 4PPYA 2ZIVB 3LOUA 5DP2A 1YZHA 2DR2A 4Q01A 2AWNA 2I8CA 4UOZA 3S5JA 3U56A 3A06A 4WUVA 2YV4A 1SVOA 4FHCA 2C7OA 3JZMA 3GGCA 1C9EA 1IEWA 1CS0A 5T4FA 2ON6A 4DM3A 4WAUA 1HQCA 4OAOA 4EY6A 4FC7A 4JHLA 5KCZA 4EKGA 5LKRA 3KKOA 4DR2B 2IYYA 3PDIA 1RWNA 5AI0A 3FVRA 1BEEA 1XMXA 2AXEA 2WIJA 1NMZA 4BZWA 4B87A 4ZI3A 3RRBA 4N5IX 5CU7A 2OAEA 4Q9AA 4BMXA 3O91A 4HQLA 4CF5A 4F9TA 1OX6A 4XM1A 1ACJA 4YJ3A 5HWSA 3OOEA 1XTIA 3AY6A 1UXJA 3LBFA 2IH5A 2HQRA 1I4TD 1IM5A 3K9CA 3F73A 3MBOA 1KSFX 2J6CA 2D5AA 1EP3B 4M9QA 4E31A 4WZBE 4YJ3F 1GITA 3UATA 5BQXA 1YXMA 4MMYB 1WBBA 3QEMB 1XMOB 4KITB 1L4YA 4CR7A 1P0CA 3W9UA 5L4SA 3L0YA 1ABEA 1ZN7A 5EN4A 1R66A 3AJEA 1MFZA 4BATA 1DBIA 1SD2A 3QU4A 1OD6A 2VO1A 3H18A 3LMKA 4ZVRA 3U16A 3K8YA 1VHQA 2P3QA 2PT7A 5CX4A 1KJIA 3ABOB 3NDRA 5ER6A 5K8CA 2NXEA 1DJNA 2I1WA 1JIUA 1PS0A 2ZT8A 2Y1DA 5KNDD 1F06A 2W6IA 4NOJA 2P4EA 3DONA 1IUNA 3H6KA 1P3DA 1E2LA 3HLTA 3BTUA 4LZPA 4NBRA 1EWVA 3VJMA 3DVAB 3DVRX 1YUMA 3NI2A 4RY0A 3AXTA 1P5HA 3LQYA 3Q7EA 1YTLA 3LTEA 3K0CC 3WGIA 1NPDA 1KY4A 2E9SA 4A27A 1QTRA 3ESXA 2BKXA 5C1BA 3SEAA 2XMSA 1XDBA 3F5QA 2B3TA 1A82A 1PHPA 3G7UA 4HXGA 1AUVA 3FPFA 3HBLA 5ES4B 4QDOA 5DWQA 3C24A 1TVKB 4IDAA 1RYZA 2GHQA 1NQWA 1JG2A 1KAEA 1T36A 1FSFA 4TLEA 5G0VA 5K8IA 1P72A 4IPTA 4PHFA 2RG1A 4CODB 1YQQA 4FI3C 4L75A 5LPNA 5ECGC 3A6HA 3TXAA 2ZIXA 2GESA 4D0RA 4ED9A 1DBRA 1X6VA 2W2NA 3AR2A 4S12A 5G0UA 2XH8A 1P6XA 3O75A 4QFBA 4U2BA 2VXYA 3CLTD 3WL6A 3WLKX 2XQJA 4C0KA 4YNBA 1I24A 3BJIC 5A71A 3GVXA 1JR2A 1KMHB 4N1AA 1G2OA 1BSVA 2ZXUA 2O7QA 4ZOEA 2Y1LA 4KMOA 4R7TA 3PF8A 4PO3X 3LC1O 4CF3A 1DTEA 2Y4OA 1Y8RB 1CEEA 1M2FA 3KZXA 3H3JA 3U5ZB 2CFOA 3IDOA 3H16A 4H7HA 4IMRA 1K75A 2J4DA 3ONNA 3PNKA 3TRFA 5LNK6 2G25A 4O2BB 4YR7A 2I7XA 2IA5A 2EP8A 1PBTA 4GZ3A 5FBKA 2AUTA 2Y67A 5IC5A 1EUZA 1GO2A 4B8WA 1Y6QA 4BQEA 2DPMA 4FS8A 1JFSA 5KKNB 1G59A 2OCIA 3IELA 3P0FA 5IAAA 2C5LA 2K2WA 3PK0A 1P7CA 2DTDA 2HT6A 2OGTA 3F5FA 1UT5A 3KQVA 4TKUB 3FZQA 3CVUA 4W5WA 1RIIA 1CUJA 4AY5A 3GUVA 5K3FB 2NQTA 1GRQA 4OFWA 3RS8A 4K8RB 3HABA 1JWBB 3OIVA 1XCMA 4G3XA 3G8AA 3TZHA 2JAPA 4EG5A 1QPBA 1JQ5A 2B61A 4G0QA 3VYVA 4FT4A 4MRRA 4L7QA 3FFXA 2OK7A 1P18A 4KIFA 2C4VA 3RHTA 2HLDA 2W0MA 4ZVLA 3KT8A 3H2ZA 4Z3KA 3A9RA 4E08A 1RABA 3OM9A 2PTHA 4JMPA 3W79A 4NONA 1AKRA 3I9MA 1R9JA 2ZQYA 3FM9A 2F9LA 1NT4A 2PPVA 5FOQA 2IOYA 4KH1A 2OZLB 2IYOA 3FCYA 2HIMA 3JAMA 1QRUA 1KYTA 2MMGA 2O0LA 3VZRA 1FFBA 1TCUA 1BKDR 2FDRA 4LE1A 3OM0A 1XMSA 1GAXA 4BO6A 2ES4A 2XECA 1NN1A 2GO7A 4XWKA 5BP7A 1G5RA 3SF8A 2FWRA 4Y9UA 4ZOCA 5EKTA 3FETA 4HWRA 4TYNA 2CNWD 4P6VF 1R5NA 1W1WA 3FOFC 1D4AA 4AYTA 5IM4A 4C5BA 4II3A 3BHJA 3GLGE 3KWJA 1YI1A 2XMBA 2FLVA 1KY2A 2H1WA 3QWBA 4TZ0A 1BZYA 1EB9A 1KH3A 3HDTA 4OQZA 1QFYA 3R0IA 4F71A 1MN6A 2O7VA 2JFZA 4KUEA 1OAOA 1C41A 2UYCA 2ENWA 2IBMA 3OT5A 2IP4A 3DLBA 4BMZA 1N0IA 4C0SA 4XGIA 3I9JA 4LXYA 3FDXA 4NCIA 1BDJA 3DQPA 3MZ0A 4IWYA 1JKJA 4BNIA 2W6PA 3A2NA 1B2LA 1BFKA 3IBCA 4W1QA 1R8JA 2IH4A 4NECA 4U2FA 1SN7A 4Q9IA 3SS8A 5DCUA 1N2XA 4P80A 4YMVA 1DBSA 1DAPA 1O4WA 4RVDA 4UHCA 2I71A 3VC7A 1DXQA 1RM3A 1ZJJA 4IGEA 1L5LA 5AVWA 1SUFA 2BBOA 3U7QB 1G20E 2I3DA 2OHIA 1U0TA 1TPYA 3DBRA 1WDTA 2DGDA 1SC1A 1ZY2A 1O8CA 4OJMX 4BQSA 3H6HA 5TVGA 4Y2XA 3W5AA 1QHHA 5DNUA 3TE7A 2P2YA 2R7LA 3MIIA 5BSHA 1MAWA 3OO1A 3EFOA 2QYOA 1IK4A 1G55A 2NSJA 4JJFA 4YDHB 4DUYB 3G59A 1IZZA 2AKAB 2ODTX 3W9SA 4QIHA 3PFHA 2UYYA 4WOKA 2XCRB 5FF9A 3LY9A 4J90A 5JD4A 3F5SA 1JWAB 3LDFA 4MEJA 2CXSA 4OQFA 4CRWB 4ETWA 2W2TA 1L7PA 1TIBA 4RFSB 3D7KA 4KQFA 2WF9A 2G1KA 3NHLA 4JNKA 3R7NA 2MJLA 3UM9A 1WMSA 4I9GA 3ETGA 4RD4A 3W2FA 1INLA 2PUFA 3I0NA 1JF8A 3D3WB 4S1PA 5CDFE 5HMLA 1GILA 3UPTA 1X94A 1HFWA 3NHYA 1HDEA 5F64A 4HMQA 1H2YA 2H31A 1O6BA 1E3SA 2H65A 4KTVE 1C7FA 1VHJA 3IERA 5DTJA 3ZUPA 5A9TA 2DKNA 2I4IA 4JP8A 1VKRA 1MA3A 1ZRSA 2QLLA 2ZSEA 4RGQA 3QX7A 5DYYA 4CR8A 3GRPA 2FFBA 3UXHA 5AW8A 5K09A 4KEAA 1ZLXA 2XWBF 2H6EA 1NFQA 2W37A 4UPDA 2KBEA 4YB8A 4DG5A 5KNCA 1KPGA 3AR4A 3CS3A 3K0CA 4W5JA 4A8TA 4NG5A 3G79A 2HV9A 1M2JA 4L22A 1GYQA 3PEUA 1KXJA 2KHZA 4F21A 1XNRB 2JHPA 2Q6KA 4ANFA 2O23A 1TEVA 3SKVA 1GHTA 3NHPA 4UUOA 5I7OA 3AZQA 1RPNA 4DJDC 1KI9A 3T3PB 1QVRA 4KJXA 5E7IA 1HX7A 4X91A 4O59O 4B48A 6PFKA 2JGRA 3O26A 2D0IA 1JVSA 5D84A 4LOHA 1Q91A 3U1VA 1NXXA 3PJFA 4NFYA 2DETA 2UUCB 3WWDA 3W5BA 3VNAA 2VA9A 1L4FA 2Z1NA 3IJ5A 4CMIA 4OVKA 1GXSB 4HQOA 4NYJQ 1TJ3A 1KZ7B 1RWWA 3QMWA 1Y1PA 2FEPA 2VTEA 3GV0A 4X71A 5LM3A 4LSWA 3DD1A 3W6UA 4CTOA 3PQ5A 2QE6A 3HKCA 1L4LA 2C3YA 3O4IA 2X7XA 3ETEA 5I9MA 4BKRA 3ADPA 2I2XB 4FCCA 4TMFA 3VR6H 1RZRD 1V48A 3R8FA 2GM4A 3N8IA 2O2GA 4PY2A 3REOA 3LS2A 3GGPA 2XVZA 1DZIA 3LUCA 3NM5A 1F4LA 1QQTA 2AQ8A 4OXXA 4TPKA 1UZNA 2FR8A 1BOFA 2C5AA 4S2UA 4WINA 1HPLA 5DGXA 1JLSA 3UAOA 1G1AA 3RAEC 4KQXA 1AB6A 1X7WA 2Q8NA 2GOYA 1DIOB 1WV0A 4WADA 4YT2A 5A3QA 1TMOA 4QSMA 4ASUA 3KELA 4FGZA 2VT7A 4CLOA 1GTSA 4JYZA 1KC3A 1ZVJA 2AOTB 3FYUB 4B4KA 2W9XA 1N25A 5HKAA 1KIFA 1FTGA 1ZIXA 2ZGVA 5JDIC 3QRWA 3UCEA 3UJ7A 1XN4A 5EJEA 4XPZA 4HPWA 2SKDA 2VDJA 1MH1A 4AZTA 5CA0B 4DXHA 2YXEA 2QS9A 4NBKA 2Q6OA 2QP9X 2X1LA 1SU4A 2ZUWA 3E22A 3DDNA 2Y77A 2P8JA 1E60A 1ZOIA 2JZCA 3Q88A 4M55A 4WNIA 3GP5A 1T1GA 2XBUA 4UTZA 5KMGB 1CRQA 2A0KA 2IIBA 4RLSA 3OCWA 4MPRA 1U31A 1EM6A 1HV8A 4IHKA 4CVNA 1FRVA 2ZUVA 3F8TA 2CDRA 2QX7A 4RQUA 4C7JA 4DLYA 3L1KA 4IF6A 1GN9A 4JYMA 4DDKA 1Y3FE 2EQ5A 1WQ4A 2OENG 4KGVA 4X1KA 4MI3A 4UUNA 4A5SA 4CF7A 3IPLA 2P79A 4XASA 1EFPA 3UENA 3NOVA 5KHAA 4Q21A 2FGJA 1DXYA 5JS8A 1DELA 2QX4A 3EZ7A 4KN5A 4DG8A 1WW8A 5AOCA 4G37A 2NW6A 1WP4A 2FRDC 2YZ7A 1SOMA 3QH4A 4JLVA 4TT8A 3UWPA 3N8DA 4HWTA 1IJBA 4JVOA 4WERA 3CBGA 4H16A 3V4ZA 4AJLA 3JATA 3JRNA 4UHJA 4BVFA 3MD0A 2YOFA 1GGFA 4BP1A 2H3EA 3NW9A 3RUHA 3UAYA 3HKBA 2NSDA 1L4KA 2B2XA 3BMNA 2Y2UA 4TXLA 1Z15A 3OIWA 4MR9A 4XR4A 5AVVA 3ZTTA 4BLUA 2P9HA 3B7PA 3B8HA 3EK2A 4EHDA 1L6RA 4U4AA 4D9KA 2B94A 2IZ7A 2R1VA 3B5JA 3OT1A 3RS9A 4C6RA 6AT1A 1C3OB 4BU1A 3DG9A 2FPOA 1PBNA 1ZGJA 1ZH8A 4UNQA 5F2KA 2JGMA 5HGXA 2XA2A 2H4ZA 3RABA 1BDBA 1KO7A 1BFUA 2CMKA 4WOPA 3KG2A 1AHIA 4CZ2A 4HNTA 3QUQA 2UUAB 1VE3A 1RLTA 1RAGA 2B9VA 3KKKA 5TE9A 3WGOA 3NAZA 4X3CA 2GFQA 1JDZA 4URYR 1Y82A 2UZ1B 2A0FA 1GTMA 1NLMA 3PQ3A 4Y6QA 4GBED 5EJAA 1BQ4A 1CJVC 1N2OA 3TW8B 1M2HA 2DSNA 4MMZB 3PWTA 2C1XA 1CU1A 4FNOA 4F6LA 4AX4A 4QDKA 1TVKA 1WXGA 3QU7A 1T1JA 2ZTVA 5FA6A 4WCFB 4X1YA 1C1XB 2JIDA 2ZSIA 3RSOA 5CVCA 4KO8A 5F7ZA 1F1BA 2IDKA 2YYAA 1NRJB 3ZU6A 1P80A 3K9HA 3A4YA 4FYHA 1RHQA 5ER9A 4ADSG 3MRXA 3AVWA 1CZLA 3NGLA 2ZPTX 4HQ6A 3M5CA 3I45A 1P6QA 4MV6A 3OUZA 1LK7A 1ZGAA 2PN1A 4IXNA 2WD9A 2QLTA 3PV0A 2PGNA 4CM9D 5L8VA 2FMKA 3U4IA 4JJ7A 4LQCA 5EPUA 4ND6A 2QY9A 4X1YB 4O3FA 4Z0HO 4JMLA 1NBMA 1G5HA 3BJMA 3VV3A 3WSTA 3N2KB 4OJQA 1OLUA 1T4CB 2P65A 4CT0A 1IUKA 1DX6A 2ZROA 3WB2A 3KDPA 3WZ2A 1YKSA 1LH0A 2PR7A 4YPOA 3PX7A 5D3MA 2OFFA 1ZUWA 4KOAA 1G3QA 3ZH2A 4QM6A 1ISJA 1QVVA 3EQ2A 1JKJB 1F9AA 2WFMA 4R2KA 4X8LA 4XJTA 2C9OA 4PRKA 2I3ZA 3I8XA 5C8ZA 1GAEO 4UUQA 2OM2A 1VIDA 3I3SR 4KUHA 4KZPA 4LZAA 2TMKA 3VDRA 2Y8EA 3NUGA 2Y0EA 3P45A 4LCJA 3ZLVA 4BZXA 4DG9A 3OCZA 3O8OB 4RPLA 1T24A 4DLAA 3AOEA 3GT4A 2PM8A 5D01A 1BYIA 2LDBA 1L4MA 4F3RA 2GX6A 4LKOA 3FY4A 3IUJA 3GLFB 1Y9EA 4W9MC 2Y68A 2BEWA 3D7NA 4F3KA 2QRKA 4BV3A 3CO0S 1R50A 3WMGA 4C4YA 2JI9A 3KKEA 1C14A 1M2VB 1O77A 2I34A 3OEHA 2P35A 1CY2A 3OFJA 2F64A 1KAGA 2FN8A 1G8SA 1Y34E 2QDKA 3F7OA 1MOQA 2CL5A 3PHLA 1N9GA 2AZTA 3MT9A 1G7RA 1QFSA 3O4VA 4Y18A 3TIXB 5KNCH 3GJ7A 1KI6B 3DZ8A 1AHNA 3OPYI 1YAHA 3NT5A 4JLDA 3L7MA 2E4AA 4LJLA 3E58A 3V2HA 3O95A 3FGNA 3ICEA 3QX8A 4IH9A 4AKSA 3FUCA 4YTEA 5COAA 4OP3A 3PRYA 4EVIA 4B7CA 2ZJAA 2UUPA 4B9EA 3DC2A 4ZXPA 1JQJC 3MJTA 1V0JA 2PBRA 2QN2A 4X97A 4MKHA 2FZWA 4Y3UA 1Z8NA 2GSWA 3LSYA 1JKMA 1HEYA 5DBOA 1ZD1A 4B71A 1XZEA 1IPEA 3T3DA 5AKJA 5TNXA 2P2LA 1P5ZB 2C5HA 1UDXA 2CB0A 2WOOA 3C1AA 3UTCA 3NDBB 1JHRA 3C3XA 2VSOA 1QC5B 4O08A 1BFDA 2ANBA 2A5FA 2FZCA 3KR0A 1XJQA 4L50A 5HIAA 4NQZA 2L2QA 1K3UB 2EBWA 1QIJA 3WDMA 4EFLA 3EBPA 1L7QA 3UK2A 2ZLBA 1NXOA 3DMFA 4NC9A 4NJMB 3AU8A 5ETJA 2AZ4A 2BKUA 3BEDA 3JY6A 2GFIA 4Y6GB 4MCJA 4YRLA 4E22A 2IYUA 2F3PA 3BAZA 2O8FA 1NVWQ 3RVOA 2ZR8A 3NBUA 4QYWA 5FNZA 5AXCA 4CDMA 1AQYA 1JSCA 4MKIA 2PJUA 4NHEA 3OSZA 2BRUC 1G98A 2HUNA 1Z35A 2OBLA 1OT3A 4M36A 4Y0VA 3E15A 5D5PA 5L7TA 2DB3A 4MAFA 1IMOA 3IURA 4A1FA 3CURA 2JBWA 1AGRA 3RVRA 1G8JA 2JFVA 1HLGA 1LS6A 2AK3A 2GHTA 3N07A 3N9IA 1FX0A 5LQAA 4YQYA 4CQNA 3HMKA 4AJOA 5JMTA 2AMLA 2GVNA 1NDHA 1WZEA 4OHVA 1PRYA 4IHJA 1ZYUA 3VR4A 3B3QA 4DYHA 2G9UA 4KPUB 3ZCXA 4JN6B 4FMBB 2GKGA 3GNLA 1U0EA 2HU7A 4LBWA 4PPQA 3SGLA 4JJGA 1KRXA 3O9MA 2JGIA 3BC1A 3GBPA 4H7DA 3MGCA 3JQGA 2EERA 1PSZA 4XDGA 4AKEA 3UEOA 4E5UA 2DPHA 3LKDA 2YZMA 4LF8B 1LPAB 2EKBA 3AKYA 4H15A 4ETIA 3IEIA 1F8FA 2XGSA 3T7TA 5AHOA 5H59A 4BVAA 3U37A 3KV3O 4BQPA 2QWXA 3OZWA 1DWUA 3C5EA 5G40A 3DHVA 5J2TB 4YHHB 3NLLA 1YK0A 4J0EA 3WGYA 4BECA 1AHHA 1YS9A 1XNJA 1AT1A 2A5JA 3ZC3A 4KWEA 1ZSYA 2G08A 4TXJA 3WDSA 4TVKA 1RWPA 2JBHA 1T1EA 4C06A 3B3JA 1KHHA 4IVNA 2IKSA 4JLOA 1LI5A 4ZCRA 1IDOA 1MT3A 1XLVA 1C7ZA 2C2OA 2QYHA 4A8JC 3C4JA 1JH9A 3CEPB 1SG0A 3ZU4A 1WDKA 4ZXFA 3SQXA 3NU1A 3FROA 4Y98A 2O3SA 3THXA 4OL0A 2A5DA 3QEMA 4B84A 3D2AA 1PFQA 1F6BA 3WK5A 5FBLB 2NQ8A 3WLFA 1JQLB 3WA7A 3JZIA 4D57A 5GOTA 3ZU2A 2ODQA 4ZMRA 3FHLA 2ESRA 3I72A 3U0BA 4AKIA 3NETA 1EFDN 3V3KA 3M6FA 5CDSA 1R8YA 2ZYHA 4HB0A 5TPZA 4A2PA 2A57A 3WHIA 1JE1A 2FUNB 5ALWA 1GZ3A 5TQ2A 1MB9A 1PGJA 4D9HA 1E2KA 1DBWA 3JQGB 4IX1A 4JVLA 2XUZA 3PQ8A 4OATA 2XNSA 5AH0A 1AMNA 1NN0A 3ZE1B 4BC0A 3RSZA 2O2DA 4CMEC 5HZHA 5T6MA 1KDPA 2NVBA 5J5CA 4B3RB 1R8XA 4RK6A 4EARA 2GD0A 1B2RA 1XLUA 4ZPJA 3ERCA 1PCXA 1KDYA 3FSRA 1P29A 2Y2VA 3LCUA 3C16C 4TTSA 1CQPA 4KU4A 4MW0A 5HBRA 3GLVA 1FFHA 2FLWA 4TSFA 4KIUA 4F4UA 3EZ2A 1H9AA 5AVZA 3WKDA 3EGCA 4EH1A 1IZ8A 4FW8A 1PGPA 2RHDA 3BXXA 3X1KA 4K9QA 3R7DA 3DMDA 3I12A 3S2ZA 4F4DA 5L7YA 4D9FA 4TLMB 2PMFA 4XUGB 2Q0HA 2WVHA 3CZQA 3UFXB 2GZSA 1AV7A 2G8NA 3ZBTA 4P83A 2JZOA 3GJXC 9ATCA 2GYWA 3V7WA 3CUVA 1Q0UA 1GPLA 2NM0A 2DJIA 4Y2TA 3S3TA 3MGKA 2PKEA 4EJMA 4XIFA 1PKEA 1FVOA 5E7QA 4JI0B 3INGA 3GPLA 4ZK2A 3TW4A 1JSZA 2B36A 2QM8A 1PT6A 2RGNA 3HSSA 3GUHA 4MROA 1T8TA 3UK7A 3CX3A 4L6IA 1TA0A 2ZOSA 1PT5A 4ZO9A 1NX6A 5AM1A 3BFKA 1NR5A 2BONA 4EVSA 1T3TA 1E2UA 3ENWA 5G4KA 3HI6A 4ENRA 3BKXA 2JIRA 2L82A 3TQHA 4CTJA 4FPXA 2PZBA 2ZR0A 1EINA 1JFLA 4U2EA 2KB0A 5B3JC 2QP4A 3GLUA 1QP0A 5A6VA 3I1FA 4RTOA 2OV6A 3I9V6 4FHDA 4DYVA 5C2JB 2X2FA 4LJ5A 3QF4A 3BS4A 1D0SA 1NE2A 1KY5A 2NVUA 4RVGA 1MBZA 2Z98A 2ZS8A 3L04A 4MUBA 4NP6A 4YRJA 2AEMA 4BFXA 1EWQA 2XMDA 2PHZA 2CUTA 3IO3A 4YP5A 4DRXA 1I10A 3RREA 1MUUA 3BCHA 3BDVA 3Q98A 1MAVA 2DF8A 4M46A 4M1KA 4N3NA 2Q4OA 1WZUA 4G1UC 5EKDA 5JCOC 2G67A 3GZTB 3I5YA 2WIDA 3K2BA 4RQAA 1TMYA 1Y81A 1YO6A 4GDMA 3D2LA 3LRPA 1E2JA 2Y0BA 3D81A 3UWSA 3W3AD 6ABPA 2JH9A 4AQYB 3IAFA 1L5FA 4JJKA 1UMBA 2NT4A 2NZXA 3KJQA 4Q4HB 5ARCA 1Y6ZA 5GY7A 2E0IA 4X65B 1H2XA 2R8YA 4TMXA 3V8QA 3U81A 3AERB 2BMVA 1YCDA 3DA8A 3F67A 4KPEC 2Q46A 1E6CA 3UMVA 2I4NA 4ON9A 5IYZF 4O4HB 3L5OA 5HM8A 2UDPA 2I4TA 3IKVA 1HK7A 4GLJA 1H5UA 3ANMA 2ID7A 1ZXBA 4LJYA 4V03A 1UP7A 2Q9CA 3R3XA 4GPIB 2FPPB 5U4QA 1A0OA 5DF1A 3TBKA 5L3QB 4HMPA 1MEOA 1I1NA 1U9ZA 1KI4A 1Z7EA 3CUUA 1Q7BA 1EXWA 4YJGB 3ECSA 1IB0A 2PRSA 3PI6A 2WPDD 2H5LA 1G60A 3N8HA 2F9FA 2B4RO 2C3MA 3LV8A 4DQXA 3K0EA 3EXHB 3OM1A 4RYLA 2E6KA 1LB1B 1KYYA 3ZIDA 3KVRA 2NZJA 5K3EA 3AJ8A 1M7BA 1Q92A 2EKLA 5A4MS 1JXMA 2K7ZA 1DIAA 4EQ6B 5J2TF 2IBSA 4HN2A 3KKNA 3RB8A 3FNBA 3PQ6A 4BYGA 3VKGA 1E9VA 1L5RA 3ZHTA 2AZMA 2Z1DA 4YUAA 2MSDB 2EL7A 1TYEB 4PGMA 2WU3A 5BR8B 2I1VB 2CWWA 4M60A 4AYXA 1OH8A 4CEJB 4MA5A 4RPGA 4A91A 2HMTA 3KLOA 2QD2A 2B83A 3DL7A 4MPDA 4HO1X 1KI7A 4Z54A 1TO2E 2G5CA 1G6Q1 2I6GA 5HK9A 1IC6A 2P2CA 1CLUA 3IIEA 3NYIA 3OZUA 2BTOA 5CR9A 2WILA 2GZRA 2I5PO 1NSTA 2R87A 5LA6F 1WSBA 3DT6A 4HAYA 1EKXA 4QOGA 4B35A 2D2EA 3OZGA 3WAKA 5HJEA 1JJVA 3HJUA 2X8WA 3P52A 2RH8A 5AXBA 1SVLA 1SUWA 4K9DA 1U3VA 1THMA 3C70A 3EGXB 4ZZ3A 2H17A 4I1YA 4JH0A 4M87A 8MHTA 2HKIA 4H4DA 5DMXA 3A36A 3GZNA 4JOSA 3DC7A 1ESDA 3EYWA 4ZQEA 2ZI7A 4GQBA 3EC7A 3GNTA 2VJLA 4C87A 1GCOA 3TVTA 3ZY5A 4BO9A 4YPFA 4PXYA 4JX8A 2V74B 1X77A 3C1UA 5E9AA 1P6UA 2J7PA 3D3WA 1C80A 4RF3A 1Q7GA 3W8EA 1EVJA 2J9ZB 4C7XA 1KOJA 4MJLA 5K9ZA 5JXGA 1APBA 3UC5A 2PT6A 2QOEA 4NU0A 1VCOA 4PONA 1Y7LA 1M72A 3BSWA 5JR3A 4UVGA 1KMIY 4WZZA 4L5YA 4BQQA 4B3HA 5L51A 3FDZB 5AW4A 4IO0A 1XMPA 1CUHA 4A73A 2CVOA 1XYGA 2EIHA 3CNQS 2J9FA 2YVAA 5DSZA 2ONYA 4PG4A 3BG5A 3LJKA 3AHDA 4I6GA 1WNTA 5ADUS 2YWRA 1Q3HA 2VVTA 2R8OA 1EP9A 5ERXA 4XYLA 5J2TA 4NE9A 3E03A 4Y6SA 1E2BA 1YE8A 3GMIA 3W5SA 1TUBA 1V45E 3I5MA 1QV6A 1QGUA 4MVJF 5JY6A 1GNPA 3VR6A 4OBBA 2R8ZA 4QBIA 4QO8A 5CPFA 3PHJA 4PLWA 1YVPA 3FHTA 5CNKA 3O8DA 1YBHA 3CO5A 4FE3A 3JYLA 5CB4A 3GLIA 1MABB 4UOQA 3GRYA 2JATA 3V1KA 4YRGA 3V8NA 2IOHA 4MR8A 3K94A 1H65A 1L8QA 1SMKA 3Q40A 4J29A 4WJLA 4ZVMA 3IODA 4CCSA 2HYIC 2QLBA 3MT7A 5CCBA 4ZEOA 4TMTA 4A6DA 1JLRA 2G80A 1F2TA 1FXWF 2AC2A 2OCLA 1TM2A 3QV2A 4LCBA 4UE3S 2VR1A 3TLKA 3WO1A 4U2GA 2L0XA 3PE4A 4NPCA 1Y3DE 1ZCJA 2PUVA 1U8XX 4O5OA 4Q3LA 1U9IA 2HMAA 3HRIA 5DPMA 4ER3A 5TVKA 1KOGA 2COEA 1AQNA 1WBDA 3FPKA 3HJGA 4J0DA 3JZFA 1NOIA 3QLVC 4YJ3B 3GJQA 1IEQA 2X0KA 4E2ZA 3QKWA 3SM3A 2FR8C 3MRSA 2NYUA 1H2BA 3ZE8A 3WFZA 4EKDA 5HUQA 1G41A 4PBRA 4Y2YA 3A05A 4UD2A 4EIWA 1T29A 4LRUA 5L3VA 2AJLI 2KQUA 2AL7A 4BAGA 2R0QC 4C4AA 4ZV7A 3DOCA 3HVRA 1WMAA 4F91B 1ZUNA 1ZC4A 2BTQB 2OUIA 2BFFA 4OBEA 3GFQA 3FFWA 1E6MA 1GGEA 3WQRA 1F4PA 2NVOA 3D6AA 4CMKA 2WF7A 2ZJZA 4OQMA 3KHKA 3GF4A 3N74A 4X8MA 4YWHA 4B3XA 4Y2SA 4K1XA 2IL1A 3FPJA 3BMOA 3WR5A 1JX6A 3VR5D 4O4JF 5B4VA 1I7QB 5KX5A 4RIHA 4IJUA 4O4HF 1YD7A 4TV8B 4BASA 4X8OA 4WFKA 2FG7C 5KQRA 1Y1SA 3BB3A 3ZWWA 3MUOA 1MQ8B 3UT6A 1U98A 3FYUC 2R2GA 1I4WA 4HZUB 5ALMA 5ENZA 2YXPX 3EA5A 1P9WA 4JXZA 3A6GA 2HQ1A 1HFKA 1Q50A 3AL3A 4U7PB 4KNVA 5BPHA 4U7WA 3QQPA 1LNSA 4E3ZA 1KS2A 2DLCX 3S2YA 3UMMA 2BW0A 3AR6A 5B2FA 3C5WP 3U7JA 2A59A 3ZXYA 3PDHA 2WWXA 3LBHA 4GRDA 1XRJA 5E2IA 2JAWA 5FPPA 3EFHA 3C48A 4N9QA 2C3PA 3V42A 1CDZA 4WKBA 1THGA 2AEFA 5HS6A 3VYTB 4GYKA 4U6QA 1XWIA 3CLSD 4CIXA 3U4MA 1U0BB 4ALIA 4FZ3A 1I5RA 2ZJOA 1F9EA 2DPGA 1XA4A 2OE2A 4NEQA 3S27A 3TEJA 4EY8A 4FWTA 2FMFA 3NCTA 3DKIA 3UKDA 7REQB 3ZI0A 3IBSA 5HUHA 1KI3A 3FOEC 2Q4RA 1Y8RA 3C45A 1OIWA 1MA0A 4HLQB 3G5TA 3NO4A 1SK8A 3D8HA 1DCFA 2XRMA 3NATA 2HHCA 4MV8A 4GOND 4NCHA 4D4JA 3CVXA 4QYIA 4M38A 4P4SA 3OE7A 3KIPA 2GEBA 2J4CA 4K05A 1CNFA 1DEKA 1K4MA 1KBZA 1QLJA 4UUPA 2Z09A 3ZLBA 1GL3A 4D4GA 4GZ5A 4K6OA 2BFEA 3CMCO 3BA6A 4QJIA 4OIFA 2A9QA 1M8PA 4M1YA 1W8DA 2FJUA 1U8FO 2OBMA 3KQQA 4CMIB 3A6FA 2O20A 4OQLA 2WAMA 5B1HA 1M67A 2CZCA 2XNKA 1IY9A 2DG2A 4CTKA 5LKAA 5E6UB 4A8HA 3HKCB 2OD7A 4FFMA 3PDCA 3HZOA 2MSEB 5DBHX 3VHQA 3HHEA 5JHGB 5DN6D 4NZZA 3H0EA 1Z4NA 4I66A 2CKMA 3OLXA 4TKVB 1KBOA 4UCXA 4BTVA 1KETA 5TIIA 1W7AA 1CQWA 1C1XA 2BZGA 2OGZA 3PL1A 4HBGA 1W25A 5MHTA 4JDUA 2BLLA 2CUZA 4B2LA 3R1IA 1ZIDA 3VPGA 1ZK1A 1D1TA 2E85A 3LA6A 1YDWA 1CVIA 1SXJB 5ICFA 4FD3A 3EIWA 3HJTA 5E6UA 1JA1A 2Y1OA 3JALA 2QX8A 2E7ZA 1UH5A 4RPKA 4YJ2B 3NIGB 1VL2A 3KEOA 2ZYUX 4RJ2A 5NLLA 3D6TB 4B3CA 5LMZA 4ILEA 2G7MC 3VR2D 3BRWD 2B25A 1IVNA 3GW8A 4FR2A 4MV1A 3PSHA 3R5KA 5LP6F 2CZGA 1UFKA 1DQZA 2VYQA 2FEMA 2AG1A 2RONA 5TF0A 2LCIA 5E2AA 5JAPA 1C3JA 2J59A 2VNSA 3FLBA 1DQPA 3V1NA 3A6EA 4BEBA 1L1FA 3VR2A 1PJBA 2WWFA 1P9RA 3P71T 1E3EA 3NMUF 4GX5A 1BWSA 2AR9A 2BELA 1E5DA 2PFGA 3CUYA 3L1HA 3FX2A 1FUKA 5EZYB 3CPJB 1UXKA 4DCMA 1FK8A 3DBLB 3H7AA 2H1FA 1ZHHA 3CRMA 4J49A 1VL1A 1Z6PA 4PZPA 3LVFO 5JCJD 1H8HD 1W5EA 1X1EA 1V7PC 3CEHA 1ZR4A 1YFJA 1GPDG 4D98A 5JC1A 4EW2A 2G0NA 3BWXA 3EY4A 3QPBA 3R40A 2C2GA 3DE5X 3KALA 3IC5A 5ES3A 3AFOA 4DS3A 1GU1A 2HF7A 2W00A 4L9WA 4DV1B 1JMKC 3SIXA 2PJRA 2GAAA 2HRDA 3BE8A 3U4QA 2X15A 2JEYA 4N82A 4NIMA 4CKWB 4MDFA 2HMVA 4RF2A 5IC6A 3TLYA 2CCKA 3ZZMA 5ITWA 3KCQA 2ZFUA 4MR9B 5ESRA 4BKMA 2AKEA 2QRJA 3G1UA 4WCFC 1V71A 5LZ9A 1CUXA 4PXAA 3RBXA 1TU0A 4G5QA 1WXIA 2QG9A 3N8NA 3PD7A 2JC3A 4Z9FA 5KQMA 1W4RA 2QVCA 3FVTA 4Y1GA 1WZ2A 3ASUA 1G6HA 1QH8A 2C0QA 3EUFA 3OMWA 1YASA 2ADFA 4PYRA 4RCZA 3UY4A 3TR6A 1IL0A 1O6FA 4G5RA 2EX1A 4EI8A 3HLKA 1SKBA 1B73A 1Q15A 2RHCA 1EK0A 3ISVA 1VM6A 3B9RA 4J7CA 5T64A 3U0VA 3ABQB 2LNDA 4N65A 1II8A 3ZW8A 2WU0A 3ESDA 3M0EA 3IHLA 3M81A 3SOPA 3ZVKA 1VMDA 1A76A 1NKSA 2OAGA 2OUKA 2TRSB 2TMGA 5KU7A 4TKMA