3GB9A

Human purine nucleoside phosphorylase double mutant e201q,n243d complexed with 2-fluoroadenine
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
283
structure length
283
Chain Sequence
b'NGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFQTVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITDKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
molecule tags Transferase
source organism Homo sapiens
publication title Structure of a mutant human purine nucleoside phosphorylase with the prodrug, 2-fluoro-2'-deoxyadenosine and the cytotoxic drug, 2-fluoroadenine.
pubmed doi rcsb
total genus 88
structure length 283
sequence length 283
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2009-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3gb9A00
3OZCA 3FB1A 4MCHA 1B8NA 3DP9A 1PR1A 5F7ZA 4LDNA 5CCDA 4IP0A 2QSUA 2ISCA 2AC7A 4OGKA 4MARA 3F8WA 4DA8A 3PNSA 1VHWA 3EUEA 5KB3A 1RCTE 1OUMA 4TS3A 5F76A 1QE5A 2AI1A 1A9OA 1RXUA 1A9TA 1JDZA 1PR5A 1T8YA 1YRYE 4M1EA 1OV6A 1U1DA 4WKBA 5F7OA 1V48A 4WKOA 5EUBA 2P4SA 2AI3A 4UC0A 5IFKA 4L5CA 1RFGE 3KVYA 3DDOA 1YQQA 1A9RA 2A0XA 3SCZA 5F78A 4QEZA 3FAZA 4D8YA 2OECA 5F77A 1JDUA 4G8JA 4TTIA 1JE1A 1XE3A 4TXLA 2QTGA 4MCIA 1ODKA 3KVVA 4QATA 4NSNA 3EMVA 4DARA 1TD1A 4D8VA 3BL6A 4YJKA 3GB9A 5B7QA 4QASA 4G41A 1Z38A 1FXUA 2B94A 4R31A 4JP5A 1Z35A 4DAEA 4BMXA 3TL6A 4GLFA 3OZEA 4R2WA 3C74A 4TTAA 2QPLA 2QTTA 1RR6A 3FOWA 4M7WA 5DK6A 4RJ2A 1JDVA 4DA6A 1JE0A 4D98A 1N3IA 1ULBA 1YR3A 1C3XA 4D8XA 1PR6A 3KVRA 3NBQA 4LNHA 1I80A 4D9HA 3UAXA 4OF4A 1JDSA 4PNPA 2H8GA 3DPSA 3ENZA 3KUKA 4R2XA 2OC4A 1Y1RA 3K8QA 3EUFA 1Z36A 4L5AA 4P54A 1PR0A 1CB0A 1PKEA 4WKCA 3K8OE 5JPCA 3GGSA 4TXJA 1RXCA 1Z5PA 1WTAA 2HWUA 1T8RA 1OVGA 4OEHA 1PK7A 3U40A 1NW4A 1OU4A 2PGAA 4F2PA 1JPVA 1K3FA 3KU4A 1Y1SA 4LZWA 2A0WA 5K1ZA 3T94A 1V3QE 1TGVA 1A9PA 3FWPA 4LKRA 4NS1A 1OTXA 1LX7A 4OGLA 3NM6B 4YO8A 1Q1GA 1VFNA 1PR4A 4EARA 1RSZA 3UAWA 1YQUA 2ON6A 5C80A 4WKNA 1ODLA 4BMYA 4F3KA 3P0FA 5CYFA 1NC3A 3O6VA 4DANA 2A0YA 1PW7A 2I8AA 4BN0A 4L0MA 3P0EA 2QDKA 4TTJA 4I2VA 4ECEA 1JP7A 4DA0A 4GLJA 1ODIA 1Z5OA 3O4VA 2XRFA 4BMZA 1U1FA 3NM4A 1Z5NA 4WKPA 3OPVA 1M73E 1A9SA 1A69A 3PHCA 3DF9A 1CG6A 4PR3A 1RXSA 3IEXA 1V2HE 4LNAA 1SD2A 5ETJA 1B8OA 3BGSA 3OOHA 4L6IA 4TXMA 3EEIA 5B7PA 2OC9A 1NC1A 1VMKA 5B7GA 3E9ZA 2RJ3A 3D1VA 4TXHA 5F7XA 3OCCA 3QPBA 5CCEA 1ODJA 1A9QA 3PHBE 4YNBA 1U1CA 1V45E 1LV8A 2HN9A 4GKAA 3ODGA 4DA7A 1Z33A 5CYGA 4F1WA 1JDTA 3FUCA 3KHSA 3UAZA 5B7NA 2AI2A 3BJEA 3LGSA 4TXNA 1U1EA 5CXSA 3NM5A 1YBFA 4OY3A 4DAOA 4G89A 3UAYA 1V41E 5I3CA 5EFOA 3DJFA 1SJ9A 4L5YA 2Q7OE 1TGYA 4M3NA 4JWTA 4E1VA 4TS9A 3INYA 1PR2A 1ECPA 1SD1A 4JOSA 4QAQA 3PNPA 1PBNA 5IU6A 5F7JA 1U1GA 1SQ6A 3IOMA 1Y1TA 1PK9A 1TCVA 4DABA 1ZL2A 1K27A 1PF7E 1OTYA 3E0QA 4F3CA 1Z37A 4FFSA 1Z34A 3E9RA 4GMHA 1ZOSA 4EB8A 4H1TA 1G2OA 3OF3A 1PWYE 1T0UA 3LA8A 1Y6RA 1V4NA 2HSWA 4TYMA 4QFBA 1T8SA 1Y1QA 1RT9A 1T8WA 4YMLA 2GUWA 4X24A 3ONVA 1Y6QA 3OZBA 3MMSA 3UT6A 3OOEA 1K9SA 4NY1A 2IQ5A 3FNQA 3OZDA 5CXQA 4QARA 1VHJA 5FAKA 2BSXA 1JYSA 1RXYA 1RYZA 1LVUA 1Z39A 2OXFA 4KN5A 2I4TA 2HRDA 5EPUA 2A8YA 1TCUA 4U2KA 4OJTA 3BSFA 3MB8A 5F73A 3UAVA 4K6OA 3LBAA 4F2WA 1ULAA
chains in the Genus database with same CATH superfamily
2GN9A 2ZBQA 5D8DA 3H1TA 1C81A 3H5WA 1W73A 3WBJA 1BROA 1G9XA 1P81A 1REQB 2PSHA 1JXOA 1YZYA 5EEGA 1L9KA 2ANCA 4AP5A 1FVOA 1E0DA 1PQYA 1SQSA 4X8MA 3DTTA 3EUAA 5KX5B 1RJ9B 3QV2A 3EXEB 4KE9A 3V2HA 2BI7A 5KIAA 2ENUA 3AVWA 4LJKA 4DZZA 2FU5C 3ZU4A 1FUUA 1KYWA 3R3JA 3FXAA 4I4NA 3FWYA 3K8ZA 4MW7A 4Y9RA 1NN1A 5GONA 1ATZA 3MFQA 4IGKA 2OHVA 4QUJA 3EHDA 3T3GA 5HJ5A 2VZ0A 5A4IS 1GQSA 3MTDA 4PYNA 4MQFB 1ZXLA 3RH0A 3VZDA 1ZX1A 4RADA 1QYDA 1T4DA 3Q4GA 4PTYA 1YVDA 1MX3A 2Z4RA 5FOTA 4B2YA 1BXZA 1CR6A 2EZ9A 1P5HA 2F6RA 1A9OA 1XXHA 1GNPA 1A9TA 1TQHA 3KEOA 4D9MA 3DSRA 3WLAA 1F0YA 1C9JA 5DASA 1T36B 3JZAA 4J1NA 3W5JA 2P9YA 4PGGA 4MS1A 5L45A 4DC0A 1GZ7A 2GKSA 3CX7A 5DEIA 1WA5A 2WLSA 3H75A 1R4NB 5HGXA 3I2HA 5GGXA 4EYSA 4UVEA 3PLNA 3AR7A 3OQPA 1K7FB 2OFOA 4W5HA 4YQZA 3H9QA 5HE9A 4B7XA 1P2VA 4UVGA 5JSQA 2FI1A 1IUKA 1RFGE 1DLIA 2VHVA 1S2GA 3BEOA 2W6IA 3PR1A 2ATXA 4P08A 3IQIX 3DKKA 4W8OA 2UVQA 4O6VA 4XTRA 4EI9A 2Q1UA 4IJMA 1JF8A 1NVGA 4OOFA 5F3RA 4CCAA 4OGWA 4KSYA 1DO2A 4CMEC 3UJAA 3MGCA 1YS7A 1XXLA 2C61A 2P1DA 3M34A 1UFRA 3HNOA 2PMKA 3DM9B 2ETVA 2MYPA 5BRNA 2DGDA 4DYDA 5HVNA 2R6R1 4S0XA 4FX5A 2VYND 3WZMA 4QQ8A 4MHOA 1LVHA 4BZPA 3QU9A 5EUCA 4P53A 4U7DA 2I76A 2XVXA 3K09A 2VCEA 2R44A 2AR0A 4KRYA 2QTGA 2ZSJA 1IPFA 1EU1A 1GD1O 3EIFA 4CQNA 5KS2A 1WD7A 2R62A 3VMFA 4UPEA 4MCJA 4BZXA 4BV3A 4DC1A 2B2XA 3P96A 1OILA 2WFLA 2Q5QA 1NVUQ 3OLCX 3S1AB 5KWJA 3K5HA 3HKBB 5JS6A 2UAGA 3QVGA 2AVDA 1SY7A 2YJGA 1ESNA 1ZVVA 2BJWA 4LC9A 4PIMA 3OQIB 3VI4B 3MT0A 3S1LA 3MTEA 4J7XA 1DXHA 3WS7A 5CNJA 4GXTA 3GNLA 3LA6A 1L8AA 3G02A 1ZK2A 3LECA 5JI3E 1GP2A 2F8LA 4K5QA 1SAYA 4TPKA 5AM3A 2CDBA 1NULA 3QVUA 3ERCA 5EJ2A 4DW8A 3FDZA 3R41A 4TTAA 1DUVG 2X5KO 3ACCA 1JQBA 3UHPA 1VCIA 1QJ4A 1LC3A 1CR0A 1YS4A 2FRVA 1JKFA 3WNBA 1F3LA 4QYTA 1UIRA 1O97C 4J3JA 4KFTA 3Q5EA 1JXMA 5L3ZA 4A4DA 1M83A 1SOMA 4YY3B 1NUTA 2QUHA 1E2DA 3G88A 1RRFA 2J4DA 3GP3A 1BDIA 1KO1A 4YP5A 4INJA 5LP6B 2BV3A 2C9OA 4DT1B 5BURA 3MWGA 4HEHA 2I22A 3WWDA 2Z6VA 4BKUA 1VECA 1C3XA 3LP6A 4D8XA 3ZWNA 3GU3A 4OUDA 1DARA 1S4QA 2ONYA 5EMLA 5JIBA 2A14A 4U3JA 2EL7A 3A2NA 5FAXA 3DE1X 4CW7A 3FAKA 5IPFA 1QF9A 4DKXA 4BO0A 3AQ4A 5K4GA 1G5FA 4WDQA 2EEZA 3LBHA 4LZAA 1I5OA 5L7YA 1OVMA 5ED4A 2GUGA 3N7TA 1CNEA 2HMWA 1K88A 3L3BA 3OE7A 1Y42X 1G5TA 3NI2A 5A1JA 1W36C 2XKBA 1ZM3A 1ESEA 4DOMA 5AW7A 1UT5A 2FZEA 2PSEA 4P54A 1FZTA 4P93A 5A7GA 4HQFA 4MOWA 2P35A 2NZJA 2YXLA 4JX9A 1MNQA 4C7KA 1U1IA 2W22A 3GT0A 2W2OA 2RG1A 4LX0A 4NONA 3JALA 1CT9A 3R24A 1WEKA 1SB9A 1AK2A 4KYTA 3OTWA 3Q0IA 4BN5A 3R3ZA 1Z29A 3PGJA 4KR7A 4ENUA 4L5BA 4PINA 1A71A 2ZRCA 5DSZA 4QTZA 2MWMA 3A31A 3IEPA 3O2SB 5J40A 3F3MA 4P4NA 5DTQA 1IZ9A 1E1RA 3WQQA 1I6MA 1A5TA 1JIXA 1ZAKA 4LXUA 2WJZB 3DAHA 4TTTS 1AT1A 5FYQA 5LQRA 2FSIA 2X15A 4L4XA 5A04A 3ADCA 1S2MA 4C2UA 2ZIXA 3MZ0A 2SKCA 2GO7A 4FNMA 3UXHA 3ZQJA 2PXAA 3VNQA 4C7VA 1F2VA 4EG8A 5BMVF 3R3HA 1E9VA 1E5VA 1SXJD 2CHVA 3I04A 4B1FA 2HU5A 5E9AA 1CQZA 3FWHA 4WK6A 3CF6R 2F1OA 1C8VB 3FCUB 4ZRNA 4F85A 4MS3B 4Y6RA 3HSYA 1ZSYA 1QF7A 3IX7A 1AN0A 4EFMA 4DY6A 4JJGA 1D3AA 1MFZA 2X6TA 1V3TA 4MW5A 4NXNB 3V4LA 2IYTA 1SCQA 3NJ8A 5TR9A 3UB3A 3WTBA 1NUAA 5TY0A 4DLBA 4F6LA 4YV1A 1AH2A 1VM6A 4MR7B 1I1OA 3BBLA 4QDOA 4EEZA 1UDBA 2HMYB 3HBMA 4UU8A 3U62A 2RGRA 2HA4A 2IU4A 5M3BA 2VAPA 3STHA 4US0R 4FX2A 4H7IA 1L7BA 1OT5A 4LZNA 4G0MA 4NH0A 2AOTA 1ZGZA 4R69A 5CK4A 3RB8A 4EFLA 1VKRA 2KW5A 3FCXA 4JOBA 1D1PA 2DKFA 1N7HA 4W8HA 3VYSB 3CNBA 4UDOA 4ZZ1A 4HTFB 4AKSA 3ANXA 4GPEA 3PPXA 5JADA 2C78A 3TIFA 2Y67A 3IB3A 3UFBA 1E99A 2WABA 2XQIA 3R7WB 1K5DA 3GRAA 7GPBA 2RB4A 2Y66A 3R77A 5LDDC 1FMJA 2JI6A 3TS1A 1NVWQ 3OM0A 4XVCA 4ZCTA 4ND1A 2FEPA 1IB0A 4Z1OA 5CBPB 4OLJA 1FJGB 2Y27A 1VLHA 1L5OA 3T5BA 5B4TA 4M76B 1HETA 3B3QA 4LZJA 5JH7B 1AKVA 1H0HA 2AFHE 1IC6A 1WF3A 3P0EA 4R8LA 4QZVA 3PDHA 1QIDA 1SVOA 3CY6A 2PUBA 4DCMA 2WAXA 2ZAOA 1RPTA 4S1TA 2AW5A 1CUDA 3BTUA 2PRJA 4KV9A 3DFKA 1AM4D 1BDBA 4FHGA 1W25A 4LHXA 5IULC 4I1PA 1KYXA 3LO8A 1KEZA 1OFUA 5JSZB 4Q18A 4ECEA 2HHJA 2RSLA 1V1RB 1ML3A 1NQAO 2SCUA 5CVUA 4C4OA 2JDID 2YIJA 2ZRLA 4Z3OA 4MW4A 3JARA 2Z5FA 4PTZA 3AP1A 2WIDA 2YUIA 3VKFA 5JS7A 1TPZA 2OAEA 1FMTA 3VU0A 1P39A 6ABPA 2AEMA 4QT4A 1WV0A 4D4MA 2YDYA 4B6GA 1NVMB 2JFBA 3ZNNA 1FRNA 1P1CA 2JIPA 3NG1A 1GADO 3VTZA 4X3CA 2Z8YM 3CZPA 2FEWB 2QM7A 1NXOA 4ZK2A 2BFCA 1XVAA 1N1DA 3EVTA 1DV1A 1OI3A 4MRAA 1HH4A 3QVSA 4JBLA 4L3VA 4NABA 1YL7A 3RSHA 2O05A 1MQAA 4B3IA 4COKA 1Z63A 1WETA 4CFZA 3CZ5A 1R8QA 3PD0A 4MROA 1L5HA 4BNVA 2COUA 1RFLA 2ZETA 4Q3AA 5FOWA 3IP9A 3KB1A 3BXGA 3RI3A 1VSQA 2WQZA 4TXMA 4YRTA 4RGYA 4Z0TA 3DKIA 4D3FA 4YUYA 2B5OA 3C5CA 5JSHA 1BVHA 1ZGJA 4M46A 1B0AA 2WJYA 3K2IA 3F7TA 3LBIA 1YXMA 4JC4A 1XF1A 3MMNA 1QWSA 5JS2A 5DGDA 3DYIA 1I6WA 1I3NA 2NOAA 2Q2WA 3GZNB 1XP8A 4PSCA 821PA 3K1JA 2YMLA 3L07A 5FL7D 3SQXA 2AOUB 1COWD 2O7RA 1YHNA 2K87A 3QPBA 4U2BA 3WJ2A 1E9AA 4KDRA 4MS1B 4MUIA 1E4OA 1O6CA 2XBLA 4JWKA 2FW8A 2HN9A 2R8OA 3PU6A 4OHFA 3AR4A 5FTJA 3IDAA 4L74A 4C1BA 2FB9A 2G0NA 2O1EA 2X7JA 3BJRA 3PC8C 4JLNA 4Q4HA 3TKYA 1DQZA 3I23A 4MITA 4D4JA 4E70A 3RSSA 3W5UA 1BA3A 1I5RA 1S2IA 2QD5A 1BYIA 4ZV4A 1CETA 3GYBA 4CFSA 2H29A 2O8DB 4I19A 1G17A 3ESBA 5I3ZA 2YFKA 5EIEA 1H94A 4JT8A 2ZRDA 4XB2A 3HPQA 4NTZA 5JVDB 5HKBA 2H00A 1VPWA 1IXYA 4RBNA 1UAAA 2WD7B 3WIBA 2EHJA 1PP4A 4MWCA 4D9IA 2OCYC 3TO5A 1JEYA 4EJ0A 1K5PA 2JHAA 1J56A 4OL0A 1O0CA 1OXSC 3JQ9C 3WYCA 3G0HA 3PX2A 1VL1A 3IELA 1R9JA 3FVTA 1T1EA 2FUNB 3QK7A 1VJRA 4L27A 1G5RA 3QIAA 2MINA 1GT6A 3JZMA 4ZA2A 2EGUA 3E7XA 5JO0A 1V7CA 4JLWA 4KKVA 1Y81A 3A0UA 2BF4A 3F6RA 3INYA 1YFKA 1PR2A 2FR8A 2I99A 2XIJA 5BYJA 2UXBB 1XMJA 2BWJA 1SXGA 2XNJA 1PBNA 4OFWA 1WXWA 4K6MA 3TUIC 2RCYA 5DIFA 1Q0RA 2CNWD 2G77B 1N6PA 2PUDA 1VL2A 3V80A 4HDNB 4PN7A 2HIHA 3T41A 2PO5A 3WAGA 2OG1A 1XZQA 1D0SA 5JAUA 5BWMA 1UT6A 3O84A 1UKAA 2G6BA 1RWQA 3IQFA 1PK8A 3O9VA 1ZL2A 2UYGA 3S40A 3SDBA 1NQWA 4FCTA 3UMRA 1VJ0A 4RA9B 3E0QA 4U2CA 2PJZA 1UANA 1EK6A 1FFXA 4X45A 4PBSA 3OH8A 1G4HA 1Z34A 3HZZA 3DVAB 2V0GA 1UKZA 2OMEA 4CQMB 5TJ9A 5LBTA 3OPYI 3ADBA 3GRUA 2VYQA 2ZVDA 3FLEA 3LZCA 2J07A 4X3OA 4BU1A 1IMJA 1SHKA 1G2OA 2Q62A 1Y9ZA 4UTZA 2QUZA 3IVMA 5FHRA 1R0YA 1DIHA 4OGGA 3JQ6A 3VH1A 2KBEA 2QUBA 2VAXA 4JEIA 4BDSA 3GUUA 4PHHA 1T9AA 2AV6A 5G0TA 4B9AA 2FE4A 2DR3A 4MLDA 4U5QA 2QNBA 2FX2A 1L6IA 1L1FA 1A8QA 3DB2A 2VRWA 3JV7A 1XAIA 4BLQA 5CM9C 3N53A 1KP3A 2HK8A 2J59A 1DXQA 1V8DA 1ZK4A 2VK2A 4AZVA 1TM2A 1EVEA 5DGHA 1K9SA 5FO1A 5FI0B 1G38A 1YL5A 4WNAA 3ETGA 1R00A 1SCUB 1KA9H 5BPFA 2OAP1 3KYDB 3J80A 3IR5A 5D7NA 3UOWA 4I36A 3E2PA 3OQHA 4MUJA 2YIVX 4R41A 5FBWB 3KXKA 4QGHA 4HL6A 3IVGA 1K3UB 4UHJA 4B09A 3FSGD 4HYEA 1MO5A 4MI6A 5IBQA 5HFNA 2WTAA 1E3QA 5KSOA 2JVKA 3DVRX 1U3DA 5EWJB 4AJ4A 4B43A 5JHGB 5ESDA 4I7EA 4M9CA 1UPBA 3ZQ6A 1TRKA 1N75A 1XQVA 1ZHOA 3SSAA 2CJYA 3D2LA 2MSLA 4HAXA 4NS4A 5TX7A 4FMDB 2W42A 1N2SA 1CUHA 4R98A 3LCUA 5CXUA 1JJIA 1IBLB 2FWIA 1LNZA 4X93A 3WNZA 4F93B 2C07A 2CHFA 2G28A 3CSDA 4JLJA 4PSAA 5LLSA 2HRDA 2AN9A 1IDOA 3PT9A 4GDMA 5IS2A 3AJEA 4Q1EA 1KJ9A 1LTHR 1M2KA 5C3UA 2BUCA 4RA6A 2CLIB 4L9AA 1IU9A 1ZI6A 1KOLA 2O3QA 4FFBA 1A27A 3NHZA 3T15A 4QUEA 1G42A 3QSGA 4MS4B 3U0VA 4DIBA 4YMHA 2C00A 2QK4A 4OYHA 1N4AA 5LIPA 4MZDA 1UK8A 4OH1A 1XFAA 4BZQA 1HSZA 5EMJA 5J4KA 3D6FA 1NY6A 3MC1A 1DT3A 2PUFA 3GNTA 5AT1A 3UAVA 2EGGA 2ZS8A 4WV3A 1NF3A 5DKFA 1JG3A 1P80A 2X76A 2FLKA 2R8EA 2VTBA 1M1NB 5F35A 2DSNA 4F2WA 1JVSA 5C7OO 3FDJA 1GL6A 1XVTA 3H2BA 3GFRA 3MD0A 4HX9A 4UE3S 2X6RA 2XYRA 3QKIA 2Y4OA 3LM8A 4OHBA 4X8HA 3TLKA 1PSWA 5A3JA 4A2QA 4D6PA 4EGAA 2O8FB 2EP8A 3A6KA 1GGMA 2QD3A 2QTWB 4V38A 2J6BA 4ZAXA 3NWPA 1ZMTA 5TGTA 3UK2A 2JFVA 4D4GA 2YMPA 3RE1A 1ZU4A 1RD4A 2CLSA 4JJ7A 4MB6A 5M04A 2VHZA 2HDNB 1U28C 3KQTA 1ISRA 3K9GA 2R79A 3VVBA 3K6SB 3VGJA 1Y6ZA 4QOIA 3NRBA 3TIVA 1O7JA 2ONZA 4ARZA 4XH9B 2I80A 2PKRA 3AVOA 3HC7A 1NUHA 2FFHA 4EDHA 2ZZKA 3KKMA 3IGFA 4YRQA 4D80A 3E8MA 1HQCA 2V4MA 1E1YA 2H4FA 3FKQA 4LXXA 1D2GA 2Q5IA 1DE0A 3C6QA 4IJUA 2UYQA 4LGYA 1X9IA 1Y8CA 4M7RA 3HCCA 3ZJYA 4FM9A 1U80A 2OHIA 2PYIA 4HPXB 3WGZA 4H3HB 3A7EA 3GVIA 5IKXA 5JTTA 4KUEA 3BF7A 5FPQA 5IK2A 4CLHA 3PNSA 4Z8XA 5HUHA 3EUEA 2C0QA 1NJ1A 4FYHA 3K09C 4CM5A 4M8NE 2HHLA 1T4GA 2QLMA 1TA4A 2W4IA 2QV7A 1KI7A 3CSSA 4K28A 1RXUA 3L0YA 4Y0AA 1WLYA 1B74A 1HZJA 2CNOA 3TTWA 4WERA 2PXCA 5C1DA 1OV6A 2BGJA 2B34A 1C30B 3TG2A 3K72B 3QPUA 3M4XA 4GOKA 1Z73A 4R6XA 3B1JA 3USCS 4EB3A 1WZ2A 4PAQA 1DC3A 4FILA 1PG0A 2HMVA 1CUFA 3AJAA 4OLHA 3A32A 4DLZA 3A4MA 1PJSA 2XLBA 1SNYA 2ZM5A 3TZKA 2QI9C 4ZAGA 1CZNA 1B3RA 4KQGA 1OLUB 5TXGA 2AI3A 1EPUA 1E62A 4HAZA 1BXRA 2FVXA 1QLHA 2GAIA 3AHEA 3PUKA 3PWTA 4UM5A 1DQYA 3GJ4A 2XIQA 2ZB4A 4R8MA 1ZN2A 2O4CA 4K40A 5CURA 1JJ7A 5KNLA 4PLVA 1UKBA 4ALMA 2V5AA 1O1YA 3BS4A 1TF2A 1ZUNA 2QDXA 3NR2A 5HBRA 2PCJA 1RKUA 1W8DA 2PWZA 4TKZA 1S8AA 2QVXX 4MTLA 4I6GA 3D4LA 3SU8A 3AI3A 3X1ZA 3OZVA 5H3CA 1E18A 3TIGA 3VNUA 1G59A 1Z56C 2QLJA 3UANA 1W2GA 3ZJVA 3MCUA 1F14A 1PCXA 1P4GA 2I2AA 2OV2A 3Q3HA 5A7FA 2AMVA 4LQ4A 1BCSA 4RS4A 2IOFK 5H4HA 3ULKA 4TQ9A 4CTJA 3L79A 4X5OA 1VE6A 3EULA 1BE1A 1KZ9A 3IKMB 4JYPA 3LQYA 4P2GA 4LQCA 1FDTA 2ACVA 5LP6C 1XCLA 2NZYA 3LZ6A 1NG1A 5TMEA 4CIWA 3TF5A 4EY4A 1R0LA 3GJXC 2FA9A 3HFSA 2AN3A 2XMBA 1GTJ1 2ZRPA 2DPGA 2ZGVA 3BL5A 3C5EA 4GLBA 4Q82A 5HXAA 1Z6YA 2JK1A 3M6AA 1IL0A 3D64A 1E1CB 3B6JA 1Z3CA 2DFDA 3RC1A 1RP7A 3TLXA 4B17A 1YQDA 4BRZA 2BIFA 2AFHA 4I66A 3FI0A 4JP8A 1NGSA 4V1CA 1C3EA 1Z62A 1DEKA 1RU3A 3OZEA 5D85A 1QH1B 5F1PA 4XYEA 2ZBFA 3FHCB 3E3LA 3TTSA 3UOGA 4DR3B 4FGKA 3GIWA 3FKJA 8LDHA 4XRGA 3LC0A 2K5UA 2WYHA 1MJFA 4PLFA 1XQ1A 2WSYB 5DBIA 3NEPX 3E15A 1FVHA 2CSUA 3ROTA 2PX0A 2X4GA 4ML3A 4BB9A 4NE9A 2ACKA 2Q50A 4UULA 1YGPA 4G85A 3AJDA 4IG4A 1YTLA 4O33A 1CR1A 1NQVA 3MWJA 2N0SA 1VJTA 4JT4A 1I4TD 1S8OA 1I6LA 2BW0A 3PF9A 2ZYVX 4IHJB 3AHJA 1XPRA 3KFLA 2I34A 4I5GA 5LJLA 2W48A 2I33A 5D5PA 2WJ6A 2XT0A 4YONB 2FUG1 2RMKA 4UHEA 4QYSA 3G9QA 4XGKA 4B3TB 1N2OA 1OTHA 4MQLA 2VEDA 4M53A 3WDMA 2YY6A 2MSWA 2W58A 5HK9A 1WCIA 4WBNA 3CUVA 2LE0A 3LFTA 1CJKC 1JDJA 4PZDA 3IJ5A 4WK4B 4ZD6A 1K6IA 4X00A 2ZJ8A 1FZQA 4I4TA 4IUBS 1UBMS 3CMCO 2C7VA 4A0QA 4EGSA 2JLQA 2W71A 4G8DA 5EHGA 1XD8A 2VAMA 3ZWOA 1BWPA 3K0CC 4UCWA 1CB0A 1JLLB 3A0RB 1TKCA 3FTEA 1JKJA 2FMXA 4RY2A 1T8PA 3EIHA 3TTYA 2GPBA 1EGAA 4HATA 4A0GA 4BC0A 4JFRA 3OPYB 3RS4A 1FLAA 4YP7A 4DQLA 4ENWA 2BUAA 2VTDA 1Z6GA 1DADA 2J3MA 4QBGB 4B79A 1E5QA 1KVQA 1Y1PA 1OLXB 2AE1A 4H18A 1JECA 4C7XA 5H7XA 2HA5A 1QQ6A 2AN4A 4REQB 1L0BA 1H2HA 2QRQA 5K0BA 1XAJA 3B3GA 2ODEA 1AQLA 3F46A 2WV9A 2NNWB 2YVLA 4G36A 2BMWA 4GG1A 4MRVA 5DLDA 4AKTA 4GOJA 3GUHA 3TEJA 4D57A 3EC1A 3QI7A 1NW4A 4DG9A 2ZAYA 3KQVA 4PGAA 4FFVA 3ABSB 4C43A 3HY3A 4YUWA 4LZWA 3R0QA 5IJ0A 4RANA 4IJVA 1KQ3A 5JZOA 1PFVA 4TV8B 1U8AA 2ZJ0A 2NXJA 1WLSA 3MUNA 3L4SO 4G0PA 2I6UA 4PZ9A 3TNJA 3VR4H 3JQFC 2WW8A 1I7SB 2XD9A 1FY2A 4H9GA 5JNLA 1UP6A 4ZWNA 4TZKA 1FFYA 1J2YA 2FEOA 3QLJA 5DGTA 2ZWOA 1BWRA 3LC1O 4Y9SA 4XX0B 4QXAA 2Q3MA 3WDKA 3B6ZA 4RVSA 5D6OA 1IG0A 2ECQA 3BXZA 1Z82A 3ZV5A 4NRDA 4KPFC 5IUNC 4NARA 1ECLA 2PANA 4S1OA 4EARA 2ERXA 4AT1A 4DIMA 3TUZC 4TKUB 3W77A 1W36D 2NSYA 2Z2ZA 3BSWA 5DHPA 2ZBVA 4LFCB 3V1YA 5DNUA 3ZGXA 3VYRB 1NMZA 2A1UA 1ZM9A 3K9FC 2XZTA 3R40A 3RS8A 1QHHB 1NXQA 1SVMA 1JFSA 2F8TA 3RJMA 1A50B 2AUMA 4Q4LA 4HB4A 1CVIA 2X0DA 5A4JA 5IJ9A 1XDWA 1XRNA 3CUYA 2ZFUA 4L8FA 2O5EA 2FW7A 1Z6TA 2WTEA 3LDAA 4JR2A 1AQUA 2WIAA 1TK3A 5KKAA 4BX8A 2OV1A 4Q93A 4JVLA 4B5KA 5JZBA 1RJDA 3MWDB 4LOAA 5BO5A 3F71A 3QLTA 1N5KA 4DV5B 3EVAA 3RUAA 3H6KA 2DPXA 4G86A 2J6CA 2CFIA 4OREX 4U02A 2FX5A 3W6NA 2LNDA 4M0MA 5KI6A 1SIBE 2WE8A 2BGRA 4XWKA 2VJMA 3F6PA 1UBCA 1F2UB 3D31A 4LC1A 3FFXA 1FP2A 1ORHA 1ZNWA 2PEZA 2RH8A 3GCDA 4FDTA 4LOJA 1Z45A 1YZGA 4OHXA 4ZT4A 3V7FA 4E09A 4BE9A 3W3AD 3ZWYA 2OG2A 3FI9A 4H7HA 4Q4AB 1Q1EA 1ECCA 3VR0A 2VT7A 4OUKX 1K6JA 2AEJA 4RMGA 3T38A 3VM6A 4JXXA 3AKEA 1U1FA 4DJDC 3NDJA 4HDCA 3QLUC 5LA6B 3V4OA 4DLYA 3FNEA 4RK6A 2N46A 1SU4A 3OFVA 1NMSA 4NENA 3NH9A 1UP7A 1NPYA 3H8VA 5I4IA 2VP0A 2NUAB 2PH1A 3VU3A 5ITWA 1EP2B 1G63A 1X86B 2ZJBA 4LDJA 2WG1A 4O1IA 4P0QB 1SUSA 1ABEA 4ZU1X 3CC8A 4QECA 3V1UA 4P1ZA 5AI6A 1IIBA 3A14A 3VKWA 4YIKA 4ZTUB 2OCPA 4GFDA 2VXOA 2A4KA 2NVBA 2Q0QA 5T4HA 4U6QA 1MUUA 2H0QA 1VKZA 4O4HB 4UUQA 4DDMA 1YVRA 2I62A 1JIUA 4OHMA 3HABA 4JENA 3W9UA 2X0FA 4EL5A 3BA1A 5EIXA 2GFQA 2PK3A 5LQAA 5FLXA 2AH5A 4PYRA 5INTA 3RAEC 1A4IA 1HE4A 2C2GA 3UTDA 3V7UA 1MC5A 3H97A 4MPJA 4MR8B 4RQAA 4WLUA 5ENDA 1IBKB 3UMVA 4WECA 1X77A 3C5WP 3DOUA 3GA0A 2J09A 3E58A 3I9KA 3JPYA 4Y2GA 5DNAA 4ND7A 4YRPA 5KWEA 4QICA 5WRFA 2AT1A 4Y0NA 2O0MA 2EIXA 4MS4A 1LV8A 1F8YA 1TUBB 3TL2A 2PPLA 5BSGA 1F2DA 4Q47A 2QUIA 1CQWA 3JASA 3LUFA 2A86A 2HA2A 2VTVA 1Q15A 1Y3FE 2Q21A 2FVYA 3H4VA 2BTOA 2VKQA 2D5IA 4EUKA 3E9YA 4WACA 3R7BA 1Z5ZA 1OT3A 1QGED 4MW1A 2C2BA 1XL1A 2WAOA 3LUAA 3MELA 4HX5A 1CWUA 4OM8A 1CTQA 3WSTA 4ARCA 2JC3A 4ZOAA 3U3DA 3O1LA 1YV9A 2REQA 1II8A 4BNHA 1RJFA 4LY6A 4N8DA 3ZCQA 1QKIA 3F4LA 5KOHA 4HQOA 3G9UA 3NV7A 5ALVA 3PHIA 2OVBA 4LBVA 4MVJI 5EVCA 5I7SA 1NLFA 3GLTA 2I7CA 5CLLA 9MHTA 3L9XA 4HFNA 3KOUA 4E3WA 1GTRA 3LQFA 4QHYA 2GD1O 4JI3B 1HURA 4OY3A 4P80A 3LLCA 1ND6A 1XU4A 2HXYA 3AV3A 4EZBA 1YI0A 4JI8B 1AC5A 1RS0A 4KRFA 3WYDA 1KI1A 1YRAA 3KUUA 4RVNA 1T6ZA 2HA7A 4OQ4A 4DA9A 3OJLA 5ITVA 1EA7A 1ZUWA 3HVRA 2HK7A 5H8WA 1JH9A 1KPIA 2XLCA 3PQ2A 1YBHA 1MEOA 2O8NA 4JUCA 4PPFA 3JD2A 4R6WA 1Z68A 3SFZA 1VMIA 3VI3B 3VO2A 4R0MA 1TGYA 5GAJA 5KNCD 1EYZA 4E1VA 1HX7A 2F1RA 3IQGX 4UFPA 1K7YA 2GZ1A 3GFOA 4NYMQ 3ZZTA 5JNSA 3WWOA 1UZLA 3DOEA 5E4TA 5EZYA 4QU5A 4AUEA 4L3OA 3I8SA 4BKPA 3TD9A 1YC5A 4YRIA 3EW7A 3WICA 1AQ6A 1NI5A 1W88B 1YBAA 4LS3A 4PPYA 4UQLA 2JVJA 4TM8A 3U81A 1BMQA 1A95A 1FQJA 4FS3A 1EG2A 1X14A 2EKPA 3IXQA 3TIIA 5JS8A 4JI7B 5FULA 4B3DA 5LUAA 4J07A 2WWXA 3IAEA 3WHLA 1AIPA 4QLBA 5HM6A 4O2BB 2ZRJA 2ZI3A 1R5BA 4L73A 3RFFA 1GY8A 3OOYA 1KIAA 1E2FA 2JHPA 3TSYA 4A91A 1ZSNA 2N1MA 1WXXA 3D4NA 4UHFA 4ZAFA 1GTSA 4GAEA 1C2YA 1Z37A 3KKZA 3MCAA 4XD7A 1X7WB 2J67A 1M0WA 4GPTA 1R18A 3ZXSA 2A1UB 2HZBA 3CB2A 1X1CA 1EFVB 3GJ3A 1IBRA 4WZBB 4Z5XA 4LPKA 4C0QC 4D3SA 3ZGLA 1ZXBA 2Z58A 4KPEC 1QR6A 3O8QB 1PDOA 2AXQA 3E9DA 2LVBA 3K8YA 4TS1A 4EUSA 3U6KA 1XTTA 2GJKA 1HV8A 3NO4A 4NU6A 3VR4D 2JGMA 4EQZA 5BRJA 4TYMA 3PPVA 2FPIB 4Z54A 2R3SA 3ICOA 1I4LD 4RZ2A 1XJWA 1HYEA 3KYJB 2GUWA 4MJ7A 4RYDA 5BSRA 4ERXA 4GBGA 5K5EA 2XAUA 2F3RA 2EATA 4OK3A 5K03A 1D7AA 1F8FA 2DZDA 2QM8A 2WWRA 4IWXA 5FI1B 4ACBA 3OM9A 1R5OA 4EQ6A 3GLRA 5J47A 3MMSA 5BQXA 4M1QA 2RGCA 1JKJB 1PT9A 1RXIA 3G7UA 4FZJA 4PCLA 4YBRA 4YCNA 5KWVA 1A88A 3GFQA 3OFNA 3U31A 1KZ6A 5CXQA 1C0KA 1QSGA 4J0GA 3WGNA 3ZE2B 2J3KA 4J29A 4DDHA 1ADBA 1IQPA 3AF5A 3U7QB 2BHTA 1GRVA 4BMDA 2O9JA 1Z4LA 4RL4A 3A3KA 1M2EA 2EZUA 3CRMA 3WIUA 1V1MB 3A9CA 4N18A 2X2EA 1X3LA 1RI2A 2PD3A 2YRWA 2E49A 3H9UA 2Q45A 1SQ5A 3P2YA 5AK6A 3VVLA 1DL5A 5LQSA 5DTJA 4Y67A 1ZZGA 1YZ3A 3G8DA 2ZR0A 3JQAA 3VPSA 3GLGE 1NTOA 1LPPA 1WXEA 1TO2E 2O07A 2Y1EA 1P7PA 1MT0A 5ALQA 2X5NA 4OK5A 4A8PA 4DQKA 3GARA 4RZ3A 4XGRA 4EG0A 2KLHA 5JCZA 1J2EA 3BGWA 2RBKA 2Z98A 2VHJA 4XE5A 4LF6B 4MV3A 1K5HA 1AURA 1S3IA 1ZYUA 2I1QA 2QAGB 1DBIA 3JQGB 3VPAA 3AM4A 4YPFA 1BOOA 1QNFA 4MJXA 1BWQA 4LCEA 4BHTA 5EJ6A 5F1OA 3ZV3A 5JTUA 3HCEA 3R0ZA 2P41A 4D3DA 1JU4A 2PTHA 1Z47A 2EAUA 2X1LA 3OU7A 1EGVB 2ZTLA 4KWCA 2EZ4A 1FDOA 4Z99A 3OTHA 3EEOA 1PD0A 2B5WA 4PAOA 2JAWA 2EKLA 3FGOA 3I6IA 2QGFA 2WQ7A 2I67A 4FHEA 1A9XA 2AOVA 1R88A 3MRVA 4EIWA 3KOWA 5BN3A 2BMEA 2E89A 3IYLW 2H9IA 1MU0A 3IO3A 3WLIA 1MAWA 2W90A 2VDMB 4OYYA 5B4VA 1GZ6A 2HK9A 3WHPA 3SQNA 4ZKDA 3G2JA 3K92A 4KQEA 3H5LA 1MG5A 2A7QA 3AEQA 4L8VA 3WHKA 3RTBA 3QOYA 1DKMA 3ETCA 2GTPA 5A1TA 1OZ0A 3O5AA 1OWMA 1WSDA 4I5EA 4UM7A 5EJGA 3OQJA 2YL2A 3C8UA 4R2HA 4AB1A 1GR1A 2K7ZA 3D9QX 4GM0A 5L3QA 1NF2A 2Q4OA 1US8A 1GITA 2AFHB 4M1KA 4TWBA 1L5WA 3KTFA 3OSZA 1TF7A 4LJ4A 4RCVA 3T7SA 2GCNA 9LDTA 1BQ4A 1YOVB 3ZEIA 2JBWA 2J4CA 3DMNA 3D8TA 5AUOB 3FPLA 4LTMA 4ZI7F 3INGA 1WW2A 4LSZA 3NOVA 2O0LA 1ZDMA 1B2RA 1Q22A 3IAS1 1SC4A 3LX5A 2J6HA 2EP5A 1HZZA 2IEZA 4R81A 2ZKIA 3ZZ1A 4DXHA 3A4VA 1EVYA 1UOPA 1YVUA 3PDUA 3T5PA 4C2TA 1B4DA 4EG7A 1GZHB 1ZUD1 1RM4A 3TBHA 5DNEA 4B6PA 5HM8A 4XJVA 4MP8A 1QVWA 3D6HA 4CKXA 4LYYA 5CT6A 4TLMB 3HCDA 3R9KA 1HA3A 4W63A 3EWSA 3HDYA 4KMRA 4OHZA 4GL2A 4CKWA 1WKVA 1LQ2A 1WCWA 3TRKA 2HFJA 4Q3OA 4X8LA 3ZDAA 1QPGA 2VA8A 3WGLA 4JNKA 1V4VA 5CH5A 2NUPB 4HRAA 3O8OB 4DA4A 4RHEA 5T6BA 1QPZA 1N36B 1U7PA 4HC4A 1WULS 5I7RA 2RHDA 1K98A 3DKPA 4G8JA 3LVFO 1U0EA 4GI2A 3CWCA 1MQ9A 3LY7A 2QN9A 4AF6A 2YXPX 2DYKA 3D6MA 4PQEA 3PKJA 3P9XA 3U3KA 4FJ0A 2UUOA 4LRXA 4A8JA 4BJ5A 1XE3A 2IXAA 5AVUA 2JBAA 4IIGA 3T7JA 4BKMA 4D1YA 2DVMA 4CL3A 5BWLA 1SHTX 3VU1A 2YJ4A 3F6EX 4UU0A 2Q4TA 4G63A 1H4QA 2PL5A 3KVVA 4QATA 4DUYB 4NSNA 3J7AC 4ZC1A 2NU6B 3EMVA 2X2PA 5KU7A 2IUTA 4CM8B 3EH1A 1EFVA 1GGKA 2WVJA 2V5VA 3EVEA 4JHLA 4U4AA 4RELA 4PLZA 3CQ9A 3T7TA 1AGPA 2GK4A 4R84A 5TPWA 1P2TA 5J1TB 3A28A 4EBBA 3PNMA 4M8LA 3DL0A 4WK0B 4BNXA 2WU3A 4F7WA 4Q7LA 4BQPA 2XCQA 1AGYA 1PAUA 2IYOA 4YLYA 1E1RD 4L8WB 3ZY6A 1EGMB 3IUYA 4DDVA 1PJZA 1NZJA 1R0BA 1NYRA 2W2PA 2XA1A 5D3QA 1PS9A 3C74A 5FL3A 2WZCA 2P79A 2ZULA 4XDHA 5KOHB 5IN5A 1B42A 1KU0A 3A26A 1GUFA 1RAHA 3NOXA 4HXYA 4W9NC 1OH7A 1T35A 1UM8A 2QPLA 1E6KA 2JLZA 1D2EA 1RWWA 2FUCA 3QWIA 4OYRA 4XJTA 2WB2A 2C5HA 1NNSA 4DM4A 1NURA 5ICSA 2VJYA 4FR5A 1R0RE 4YJGB 3DQZA 4GLOA 3SFTA 4B80A 1JDVA 1YF3A 1G3RA 5DHTA 3KFVA 5I47A 1FTSA 2NZXA 3A6PC 5EN4A 1CE8A 4PZYA 5TQVA 1TU3A 5KTSA 4G1UC 2OYSA 1QRSA 1TQDA 3O4FA 3UNXA 4QUIA 3FYUB 2BEWB 2JHFA 3IEUA 2IUUA 1NLMA 4UZFA 2O3TA 1JPUA 3F6YA 2FPKA 3H7AA 3KLPX 2H2HA 2YOFA 1M7HA 3L2OB 1O6GA 4V0LA 1OBFO 2JJQA 3LHDA 4GMGA 1UZNA 1QG6A 3A11A 4TRRA 3HR8A 3OURA 4MIEA 2IKSA 2IOHA 3CB4A 3UT5B 4CT4B 4QTYA 2VNSA 2HREA 4GEKA 2AJLI 4KYIB 4ZEMA 3M82A 4KXLA 5L6MB 3ABRB 3BIXA 4UNPA 1I3MA 4UTNA 1OFIA 2MYNA 1ZJJA 1QAOA 3GOHA 3IP8A 4IJKA 5B1IA 1SXHA 4RV4A 5GVRA 4OMCA 3THYB 4RSMA 3PGXA 1Y7IA 2IIVA 4MULA 4XM2A 1QZTA 4WESB 1J20A 2WYWA 1X7ZB 2XVMA 4HTFA 3C48A 3N9IA 4CQMD 3UF0A 3WA7A 3M89A 1IZ8A 1XVLA 4XWAA 4MJLA 4QGGA 3I5XA 2ZKLA 4FI3F 2QLLA 1K8YB 1ZNYA 4LFAB 1ZOPA 3WGVA 1EQAA 1C4XA 4OXXA 3RNLA 4DMGA 1Q84A 4R1OA 2HV8A 4JD5A 2ZJOA 1Z5PA 4JJ8A 2JZNA 3IP1A 2L0XA 1TW2A 3VU9B 5JC1A 1VP3A 3LI2A 4AY2A 9GPBA 1M66A 2DPYA 4AI6A 1ADGA 5DNYB 1IG3A 2AD5A 4HPJB 3U40A 2HUPA 4P98A 4G67A 1KAQA 1RWXA 1OU4A 3O4RA 4LNUB 4QJ4A 3OM8A 5AI4A 2X4LA 4M36A 3RHTA 3ESRA 4ENQA 4WN9A 1JG4A 1JFLA 3E81A 3LRPA 1IAVA 4PW0A 5HBGA 1LS1A 3H19A 1DWQA 1V71A 1FFXB 3T6KA 5HCNA 1BXGA 1NBME 1SVUA 1DBVO 2OKGA 3H8WA 4UUBA 4UARA 1IEQA 2I2XB 16PKA 3GR6A 2WP8J 2HA3A 1E1DA 2O2CA 3GFTA 3QG5A 4OAOA 2WJHA 4EGQA 2ZUUA 4NZYA 1Z7WA 3EUWA 4KYVA 3VJKA 4J4HA 2HJRA 5I8WA 1RLTA 2RAFA 1H2WA 2P6MA 3IXMA 5EYPA 2FJUA 2R68A 4PG8A 1QG4A 2VYNA 4O1MA 3UICA 3FYTA 2O2YA 2EKQA 1WW8A 2X7HA 1FSPA 1V11B 3N2GB 3Q6IA 3W3AA 3RM3A 2ATVA 3C3EA 2OV4A 1W8IA 1Q7EA 3IMKA 1VCOA 3U7QA 3CZAA 2BHRA 2VT2A 4FHDA 4HFMA 2GJ8A 5E38A 2EQBA 4TUYB 1Y89A 4YCAA 2P6NA 3ZDCA 2GBGA 3FBWA 2AN1A 1OX4B 5LA6A 3TTXA 1LI4A 3V5NA 4P22A 1UK9A 1JFTA 1YS6A 2OCDA 1T4MA 2VPIA 3BRSA 1NBEA 3R8FA 3FLAA 4IIEA 3CXRA 3FSRA 421PA 5AM2A 4IDEA 5D51S 1EK0A 1YZLA 1ZIDA 2R8YA 4LMBA 3OI7A 3FVVA 3OCWA 3OMLA 4WEOA 5GZ1A 2LV8A 5P21A 2WICA 2FX3A 2H48A 3JRXA 1EUDB 3QWBA 4D9BA 1YR6A 1JV2B 3ORYA 4TTSA 4YRKA 1DXOA 2ZUCA 1Z5WA 1LDYA 3ZDBA 2OZVA 3T7RA 4NNOA 4LHYA 4LW8A 1YB1A 4L78A 3MHTA 3UMBA 4MUNA 4ENTA 5I8PA 5F1YA 1AKNA 3MBOA 3I4FA 2XA2A 2VOJA 4JI6B 3LUJA 1KH2A 3FOAA 4K6CA 5C8YA 4OJYA 4IG9A 3WRYC 3WL7A 4Q39A 4DJFC 1QTQA 2C3UA 5ALZA 2MU1A 2HBQA 2ZAMA 4M1ZA 2I1LA 4KXXA 5IVDA 2Q41A 3K35A 2DY1A 4NNPA 4Y9UA 1FUIA 4R1MA 4JN6B 1RHKA 1VLVA 3QVOA 2C2YA 3G2OA 3EIXA 2ZR9A 1A5SB 1BD3A 4M9UA 4PHGA 2JEYA 3PQDA 1UBFA 4F97A 3NZEA 2WZQA 1MOQA 3PRKE 4FN5A 3BZBA 3VR1A 3VZSA 4A6DA 4RPKA 2VDRB 1E7WA 2XQKA 4YV7A 4KOAA 1RQNA 5DTEA 1YR8A 4ZZ0A 2VNAA 3VFDA 4BQSA 2H92A 4O8ZA 4EPYA 3S8YA 3L84A 5H3LA 4IMRA 1EEXB 3UHOA 2REQB 3AUSA 1KDOA 3I42A 1DAFA 3SE0A 2WR8A 4UTRA 3PDIA 4F8YA 1ZD8A 4LF8B 1BGXT 1J9ZA 3AC0A 4KFUA 1E7SA 1Z0DA 4QPJC 3DWGA 2QRPA 2Q3FA 2V3VA 3NT2A 4CR8A 3U09A 2G7ZA 1ENYA 1LLFA 3L4BC 1YZNA 4F6RA 4JEUA 1CW2B 3LXMA 4OK6A 3Q8WA 3TKAA 4CF5A 5J1SB 3MTQA 5H68A 1CY2A 1FNDA 4O02B 3OCXA 2HQOA 2Q1YA 4N3CA 3ZGVA 3I39X 3DOCA 4CUJA 5C9ZA 3A1NA 1W4RA 1RMTA 1A9QA 2PZJA 3I5AA 3I73A 3IALA 5BN4A 1QHHA 4DIDA 5EJ5A 5TIIA 1V4BA 3NBFA 1G7RA 1MXFA 2BFCB 4MUYA 3DL4A 1JNYA 3GWGA 4TL7A 3ZIAD 1U2DC 3WHIA 4E11A 2ZSHA 2POCA 1W35A 3IUMA 3KWFA 1ZD1A 3GRZA 3PRJA 3K9CA 4RF3A 1JDTA 1EWYA 3IBCA 4RH1A 2WWWA 3IV7A 4K2HA 4UU1A 1GA4A 5HKAA 4EMBA 1YMUA 3VPFA 2PTGA 3LJKA 1SUPA 5LZ2A 1GQQA 3EZ7A 3W1VA 1MC8A 1DS6A 3DBRB 4C4TA 4L0DA 4TVBA 2HLNA 2KPOA 1O3YA 1J39A 2EGHA 4R2MA 2GD6A 3PPYA 1BD4A 4B85A 2B1RA 1GSIA 2ZPTX 2QYTA 4I2NA 4B7AA 3AKZA 2B21A 2FWMX 2QJOA 5A0VA 1U9IA 1XEWX 2OBFA 2QW1A 3SF8A 2FPUA 1QH9A 4NXMB 1CJSA 1JLHA 1U94A 2BMFA 4LX8A 3UJ9A 1KK2A 1OD6A 1LFAA 4WCVA 2QU8A 1OLSB 1N7GA 1XCOA 1Z12A 1QFMA 3ZGOA 3CJTA 3UK6A 3DO6A 2AMFA 3B78A 4UVHA 2V0CA 2ZIZA 3D4OA 1BHJA 4N6OA 5J3JA 2WQ6A 4JI2B 2FSUA 4EI2A 2BFNA 5EMHA 1NE2A 3EW9A 4FLMA 4TS9A 2ZBDA 3LPCA 5EP1A 2WY2D 2H1LA 4HFJA 2BI8A 1Z0IA 5FNVB 3SD7A 1SD1A 3IQHX 3PLRA 5HRAA 1LI5A 1H2EA 4XIFA 5G53C 5G0WA 2YDXA 5FR1A 3F67A 3GFVA 5AVZA 1RKVA 2IDKA 2PMWB 2VF2A 2Q2NA 4UUAA 2EHDA 1AZWA 4K9RA 4JELA 4HDSA 3IOMA 4XR9A 1GCGA 2GAJA 3DT6A 4GMKA 3RHSA 4C0HA 4G09A 5CLFA 4X20A 4LJRA 4HF7A 3IMFA 2C5AA 1O95C 4MYUA 4OLAA 2WF7A 2QG6A 3T4PA 3SQWA 3A6EA 4KR0A 3VPXA 2NO0A 3TCNA 2BH9A 2KWIA 1FNMA 4ILKA 3CT4A 1WPRA 1CE8B 3OUZA 2ZJ2A 4F3CA 3ZLBA 1I1QB 3PVCA 1Y9AA 3KD3A 3E18A 3FCAA 2WU4A 4J3NA 1QO0A 3KZMA 4RZHA 3NXSA 1NVFA 1G7TA 1U5BA 3FBTA 2B83A 1RWKA 3DAYA 3IUSA 1PGQA 4IDAA 3FCSB 2QLNA 3I5MA 3PJFA 1T0UA 4TZ0A 5CEJA 2ZYUX 3OCUA 2FETA 1NQOA 2C9CA 2BC9A 3CURA 5DBHX 3DD1A 4BVEA 4L7QA 3R7DA 3VKHA 4MDYA 5E8RA 4EMUA 1W30A 4YMLA 3SSNA 5KNDD 1YB7A 3DBVO 1QQBA 3SOZA 1IOZA 4FWTA 3EFOB 1UK6A 1N8TA 3AHIA 3NUQA 3NC4A 3IAS6 2VWQA 1O97D 3E70C 1RLJA 4HYTA 1YZUA 4JB8A 4LHWA 4QUDA 4AP6A 4TMFA 2O0HA 4RIGA 5CDHA 3T52A 1GPYA 4HAVA 4DIUA 3B7GA 1H6CA 1FK8A 5SY4A 3PI6A 4C7JA 1EFLA 1FE8A 1G8AA 2E5FA 3AESA 4P5PA 4PC1A 5C1OA 5FAKA 4NMLA 2BSXA 4BP1A 4MGZR 5CTJA 5IK2D 3OU2A 1K4KA 3VR2D 2ZZNA 1Y4DE 1CZHA 1PEAA 1W0JD 3H4IA 3WWYA 4QGSA 4NI5A 3VXKA 4NBTA 4QBHA 4RLHA 1TVCA 2YMQA 4YRFA 5ALUA 5LZ8A 4CFYA 4D5GA 4Q03A 1N2JA 1Z39A 4FNAA 5M5BA 1YA6A 1Q1NA 2E7ZA 2YICA 4KAJA 5AHXA 4EQ6B 2YNMA 9ABPA 3RD5A 3GPBA 1UCFA 1T3TA 5AI0A 1P75A 1T8UA 1TCUA 2A8YA 1DOHA 1G291 1BXGB 5AHOA 3F9IA 3F73A 4CG1A 4DV1B 1FXSA 3PYXA 1DWOA 1E3WA 1FSSA 1SK8A 4QD3A 1B00A 2CVPA 1JU3A 1U02A 1UC9A 2H54A 2NU7B 3TVYA 5J5VA 5B12A 4YAUA 3A1DA 2X8BA 4X85A 3K32A 3GCZA 3DL2A 5EJEA 3CF4A 1QHGA 2CLMB 3PDJA 5ICCA 1KK0A 5CLJA 2PZEA 1XZIA 4B40A 4DIKA 4CMEA 3DEKA 3HO8A 3LBAA 3RFXA 3BFPA 2UUPA 3H4TA 1JQDA 4NIMA 4AJHA 5ICMA 1MMFB 5IYZB 4HLQB 2W8BB 4LN1A 4HHEA 3GLIB 1Y37A 2Y71A 1GPH1 2BH2A 4N5DA 3AM5A 4PYMA 5JBNA 3KTOA 1LQUA 4HDMA 3FWKA 1GJRA 2CSXA 2HLDD 1VHDA 5CB4B 1T0BA 2VWHA 1OGYA 2IDZA 4WZAB 3T9EA 4CPDA 1MAHA 4LWOA 1GL9B 4NCXA 1ZAYA 2P9ZA 4I46A 4ZEOA 1P7WA 1CY1A 1QOPB 3E27A 3TM4A 1UMCB 4O4HF 1A77A 2P91A 3HN2A 5BR1A 1NUSA 4DEVA 2TS1A 4TUYA 1WOMA 2D6FA 3R6TA 1E9SA 1IEWA 2V0NA 1CUVA 4LBZA 5BSEA 1XQYA 2GEVA 4Q24A 1E8MA 3TLBA 3PE4A 4CLOA 1QYWA 2J3HA 2HBYA 5B3JA 4Z4IA 3ABOB 4LEIA 3WRYA 5MHTA 4ZHQF 1W34A 3Q15C 3MN1A 1CUSA 4ZVOA 4EW3A 5JHHB 3BD7A 1QE5A 3PD1A 3PXUA 1U28A 1YE3A 1PWZA 2O8CA 1Y5IA 3ENNA 4TT3A 2GEBA 2LGJA 2JFUA 3NDIA 1I2CA 2RKOA 4LUCA 1OWLA 1IM2A 3ESQA 5IZCC 3G2IA 1X0VA 1ECJA 2AK3A 3AERB 1MQSA 3P9CA 1Z7EA 4KV7A 2RARA 3JYLA 3QMPA 2E4UA 4ENPA 3M5WA 1ISSA 5CAEB 3TZLA 1VYUA 2CXPA 2CNBA 4WGFA 1CP3A 4P4SB 2Q5CA 5DV9A 4X63A 3M3DA 1G1AA 2IXGA 4UAJA 4C88A 3OIUA 2NXEA 3KXDA 4HLCA 4ARIA 2ZSAA 3UWMA 3IAFA 4J1TC 2C96A 3QOWA 4TRMA 1MO6A 1YU6A 4HY3A 2CL0X 1JVNA 2ONCA 3C4QA 3KB2A 3QBVA 1QUFA 3SCZA 1RC8A 3U80A 4RJIA 3E9NA 2BELA 3L8HA 1AKEA 1CF9A 1MPXA 4EF5A 1SVIA 4G0ZA 4PCUA 2PN1A 2H1WA 1CQIB 4H59A 1PJLA 4JGGA 1Q95A 5ECDA 4YTEA 2V3CC 3HO1A 4ZPXA 2FE1A 2Z2YA 4UJ3A 3DE0X 3DPIA 2VDJA 1ZH6A 3HP7A 4JYCA 4REQA 2XBMA 2WV7A 2VDVE 2XEXA 4GP9A 1UDWA 2DWUA 3BWVA 1GILA 2H4XA 4BP9A 4XI9A 1KJZA 3EHEA 1TFUA 4JH0A 2B69A 2BF7A 1E2GA 4WASA 2QUKA 1BZYA 1RQPA 2EQ5A 4KAFA 2OY0A 5IVIA 2PX2A 4QULA 3DW1X 3L7KA 3F9CA 3P8ZA 4URHA 4TWAA 1YL6A 1XV5A 1WXQA 3BRWD 3D7KA 3ID6C 2C5FA 2YWGA 1VJGA 2V7XA 4N8EA 4ZCPA 4OHWA 1AQNA 4EM6A 4ILEA 4BMXA 1V3VA 3ND7A 4FHFA 1R0KA 2FHPA 3VR2A 1VCMA 4CM9A 5J2TB 1XKLA 5CDYA 4V0NA 5JNVA 4O63O 1T1SA 2CXHA 4QUBA 2ZUSA 1SU7A 4WOCA 1PL8A 4G0XA 3Q8XB 4K7JA 3GLHB 1HL7A 1AHPA 3AKCA 3JWHA 4GYJA 3K1AA 2FK8A 4I55B 2JIZD 3FNRA 4BBJA 1P9RA 2OGWA 5MN6A 2GPAA 3I76A 4FSHA 4DA6A 3R9XA 3HGQA 3OT1A 4JJAA 2QR3A 1AMOA 1ZC4A 1ULBA 1QDLB 1UJ5A 2BMDA 1PVDA 4M2LA 3HTXA 3LG2A 1TK2A 1YRBA 3IUEA 3GL9A 3KVRA 4RK4A 4O59O 5JYDA 2IVFA 3ZXUB 4HNUA 1GFWA 1R0ZA 2GKOA 1VIMA 4R4JA 1I80A 3Q7SA 4L51A 4UBMA 4KW7A 3WDLA 4FGJA 4U7WA 4UU7A 4EJMA 3EVGA 2NU9B 2IOYA 5DHQA 1U7ZA 1TT5B 3DS8A 5CDTA 5JPDA 2XYQA 2I2BA 3JXEA 4MUHA 2P3OA 4B4UA 1HC7A 3KU1A 4TTPA 4YMIA 5C52B 1ZIXA 2WA1A 1EFAA 1EG7A 1HNZB 3KSUA 2HU2A 3FR7A 3PWZA 3TM5A 3K8QA 5FBKA 4EB0A 2O6HA 4J90A 4L3WA 5KYUB 4P8RA 2ABWA 2HRBA 2P0EA 3CRRA 3OG9A 3SX2A 4FBMA 3OAAD 2GBLA 2HIAA 1N6RA 1ISMA 4LRWA 5THKA 1Z22A 3CX3A 1NI4B 3P9YA 5IASA 2QZZA 2CZQA 3L82B 3TJZA 2J3JA 1AKYA 3J7TA 1G3IA 3AHCA 4AZ0B 3ADPA 4AKGA 1HYBA 3ILYA 3IMEA 4I08A 5J2UB 5LJIA 1OXMA 4B48A 4X62B 1J2JA 1XNHA 2RH5A 4K9NA 4XKJA 5JMPA 1KH1A 1S4MA 1MP0A 2GOYA 1EQUA 4OEHA 2AZDA 4RK7A 1JKMA 4INZA 1YE8A 2O6LA 3DWEX 2FNAA 2C77A 2I7XA 4TV8F 4DPMA 4TGLA 3TVTA 5J4HA 5DXJA 1R9GA 3BJMA 1R0SA 1JPVA 4ER5A 1ZKMA 2R7MA 3B3JA 3NT4A 3ZXIA 4JL5A 1O5TA 1V26A 1IUOA 4MAMA 2H08A 1EDBA 1LDBA 4BNTA 1H8ED 4C22A 3KPVA 4KO3S 4KNYA 2G72A 2O8CB 5DN9A 5CITA 4EUNA 3KELA 3ZDXB 1S89A 1BN7A 4N5IX 4IH4A 3FTFA 1DZ3A 2LIVA 2LW7A 3LUGA 2WEKA 3Q3JB 3FCOA 4FD3A 5FQNA 4EL0A 4F45A 1GQYA 1X7YB 4BB0A 4TV9F 2YJNA 4Q3EA 4E33A 3RQSA 4XWYA 1U4OA 2XB4A 5LQDA 1J1UA 3D6UA 1FW6A 2HSDA 1KI6A 4HZIA 2G8LA 3DZIA 1QK5A 1EXWA 3RVNA 1GIAA 4JB3A 3KDAA 5EESA 4H7JA 5ITZB 1C1XA 2EL9A 3B70A 3UCFA 4KWTA 3ZCSA 5K09A 3HXKA 5DDIP 5EJAA 5SZHB 4EYGA 2BI4A 5CT4A 3TCKA 4GM1A 1L7OA 5REQB 2JLYA 4FKMA 2XUGA 5LSAA 2J9YB 4NV3A 3PFNA 4O2BF 2YZGA 4L8YA 4GL4A 1GLGA 2QUAA 3D6JA 1EWRA 2PEYA 4ECAA 1QFJA 3WLEA 1WCYA 3RRNA 5LOVA 5SZKB 4W1PA 2I8AA 5HDBB 3DLAA 1YIOA 1LWOA 4WXPA 4W5OA 3WB9A 2QYSA 3DZCA 4EO4A 1NP6A 4IEFB 3P9NA 2PRSA 1XOIA 5KTNA 1NQXA 2PIAA 3B12A 3HG7A 2CV1A 3T3HA 1E69A 1ZM4A 1FXWF 3JD1A 2CZGA 3CH6A 2ATCA 4YGXB 5E0KB 3VR5D 4ZQGA 4FMDF 4GRIA 4FNOA 4B0PA 1YK1A 3WV4A 2ZANA 1TM5E 1HE8B 3JATB 4DR2B 4XYLA 1H8HD 1I2MA 3GCGA 3E0XA 3O4HA 4IX1A 4PAWA 4AYXA 5KPJA 2L2QA 2H2IA 3L6OO 3P0HA 1G1MA 1K75A 4BEVA 1XXHE 2AEEA 2ORVA 3NHAA 2AFVA 5KU1A 2Q4BA 4S05A 5A4AA 1EP1B 1X74A 3O4VA 3GXBA 5J4VA 2CJXA 4JLDA 5L3RA 2C58A 1PTKA 2HF7A 3OSUA 4Q12A 2P27A 4LCJA 1P91A 1JIQA 5TRTA 2OESA 4B6QA 2ZRFA 1XFDA 1SBNE 4CKBB 2ERYA 1T9GS 3FZNA 1Z7YA 1C9MA 1DJPA 1N6NA 2PX4A 1A69A 3M4ZA 1HE1C 3CPSA 4ZAYA 4IF6A 1QP4A 2B92A 3BMNB 3DYBA 3LQ4A 2B20A 4WFJA 1V7QA 1XPUA 1G8GA 4HDNA 5F23A 1KARA 2FR8C 2QVYX 3ZCUA 3JWEA 1FMLA 2GVZC 4C5CA 3PUXA 1U7HA 2VNIA 4NDZA 1HDIA 3OBBA 4GVPA 5IC5A 1TTTA 3TB6A 1YB2A 2FZKA 4ISCA 2Y92A 4J0DA 1LLDA 5CCXA 2HRZA 3EXG2 1U0OC 1UC5B 4FGZA 4M1YA 1G5IA 4X41A 4TL6A 3TK1A 4A0SA 1W44A 4HDRB 3IEVA 1NWCA 2PLRA 2HWKA 3CVJA 4RFSA 1A4XA 1O96A 3KB8A 3OA2A 5EP3A 2Z6QA 4I3HA 2QLFA 1YWGO 3NEAA 4Q9DA 3MOIA 5BSFA 3O9MA 3TLEA 1H1TA 1XHFA 2OVFA 1LBSA 1T3LA 1YUMA 2CXRA 3K0KA 1WXGA 3ZKAA 4FIZA 4JQSA 1FNNA 2GPSA 3JD0A 5CT8A 3TG8A 1RM5A 4IHKA 1B3BA 1XZHA 3IP6A 4DLTA 2ATEA 5JXGA 2FXVA 3BB4A 4L9WA 4YP0A 3BILA 4L4SA 1FP1D 1KVSA 2X1MA 4PXAA 3R3UA 4U2DA 3QKRA 4ITVA 1U3WA 4WOJA 1KFCB 5ALLA 4ROSA 2QZ4A 2XB6A 3D1JA 1QK3A 4QNNA 4PX2A 4NOLA 1LJLA 1ILEA 1EVLA 3PHGA 2WI8A 2PRKA 2QIPA 3GRRA 1ZRHA 1P29A 4U2EA 4BNUA 1T9GR 1U1EA 2WIJA 3BHMA 4G9EA 2JCSA 1YMQA 1Q1AA 5CA0A 2WT4A 3EYAA 2DFNA 3LYAA 5JMTA 3O91A 5L6LB 1E1NA 3C8MA 5JANA 1G66A 2YZ7A 2QENA 2WF6A 3PRHA 4F6CA 4K6HA 4OFZA 2XH8A 4W6ZA 5CJ2A 1VLZA 3EPRA 1RW4A 3QNMA 4QEKA 5TMDA 1JTEA 1PZEA 3C8HA 2XNCA 2K6GA 1YH3A 2ZBRA 4LY9A 1F5NA 1QKJA 2FWBA 2C5LA 2CGEA 4HLDA 4IHQA 5F64A 1KMHA 4X1KA 1KAOA 3HN7A 2VT6A 3K4HA 4MR7A 2WJGA 4HH0A 3VA7A 2ZB8A 1JEQA 3BA6A 3S2FA 4WX2B 4PYLA 1CRLA 4ADSG 3CH4B 1YDMA 4BATA 1LDGA 5F5NA 4PV7A 2FN7A 2XB9A 1F4VA 4L6CA 1F8UA 2WJVA 1P77A 1LWNA 1L8XA 3JU3A 5TQ0B 5FOSA 2C4MA 3HL0A 4NPHA 4PRZA 3TE6A 1JSLA 3DDCA 3S2SA 3BCUA 2E4ZA 2B2NA 1KDRA 1QX4A 1ZGCA 4H6XA 4ZHQA 2Z5LA 1E5TA 5FLKA 3GPIA 4ZOEA 1VSVA 1KZHA 1W46A 1P5JA 4DABA 4CXMA 4YR9A 5BV1A 1KVTA 3ML1A 1OY1A 4Z9AA 2H1CA 3ZR4B 4MR8A 3V33A 5I7UA 3KS9A 4ESEA 2HCBA 4F4DA 1YBVA 2PGNA 3CKMA 5HMLA 4FFSA 5EZ5A 2IXFA 3KWMA 3E9RA 4AWBA 4K03A 4PZPA 1HEIA 2PH7A 3D6VA 1XQ9A 4H60A 4RS3A 4WCFB 1II9A 2W8ZA 4A6PA 1YO6A 1ZMOA 2Y93A 3N8GA 1OIVA 2JFFA 3W0LB 121PA 1N2EA 3FFAA 1QTRA 1WNTA 3MRSA 1V43A 3G6WA 1KC1A 1MAVA 1V1RA 2SCUB 4F3NA 4JVOA 5L3SA 3K2BA 1JT2A 2O52A 2FZ4A 4O29A 4O4JB 5CBPA 1L2TA 3MJFA 4C6SA 3C41J 3S44A 4AJPA 4A2PA 3NVKI 1WCV1 1CJMA 2YYSA 3OAAA 2O59A 2MMGA 4HQ6A 3Q0TA 3RRMA 1O6BA 4GE0A 4ZN6A 5IMSA 2QY9A 3G5LA 3ODPA 3E22A 1Y6QA 1H6DA 4H4EA 2QRHA 3BMCB 3V6LA 2XQJA 5KHAA 3G0CA 5DLQC 2F90A 2X7XA 3T3PB 1AZLA 1DC5A 3O75A 2JAHA 5JC8A 2ARKA 1TMKA 2W2KA 4N7JA 2FLVA 5GONF 5DEOA 2WYUA 4BFUA 4HB0A 5A2QA 1UZAA 2AK2A 2P7IA 3L8CA 4K9SA 1R37A 4DLUA 5GP1A 1KQPA 2JS7A 3HBFA 3Q40A 2KJQA 4XWGA 1EUCA 3HJTA 3ZG6A 2RHBA 1DBSA 1P5RA 2OILA 4C4ZA 2ODBA 4U3JB 4QDXA 3Q7PA 1KMCA 4EP1A 3AFIA 3NHBA 4NCHA 4U2FA 1QYRA 2CB0A 2P75A 2PJDA 1GNSA 4HD8A 5ERGB 2CVZA 1Y3BE 4WBXC 2X0IA 3DR5A 4K3UA 4NK4A 4BRSA 2OPHA 2NQTA 1UBLS 3GD5A 2F1HA 2E9SA 4X7BA 1U2SA 1XNRB 4UVDA 5CHEA 2VPWA 2AG1A 1N8NA 2HF8A 1MJNA 4P81A 3AFOA 1JILA 4MX8A 1W49A 4MV0A 3LUHA 1XCPA 4CCSA 4IQ4A 5ALFA 5L9AA 1T6YA 4OBXA 4YJFA 2ZUFA 3U3XA 1F51E 4I99A 4WNCA 1L1QA 2KX7A 1YQEA 2XDYA 2Y0BA 2YN2A 3OCZA 3U60B 3DBLA 3SDSA 1BX1A 5HS6A 3X0DA 5GJCA 5HJ2A 4BQNA 3T3EA 3C16C 3NIFB 4LI3X 3GRFA 2ZBPA 5DIZA 2FMUA 2EYUA 1HF3A 3IMCA 2QMQA 4Q34A 3U2QA 2JZOA 4G5QA 2OV6A 4D8UA 4LPSA 3ZE1B 4XSHA 1B8NA 5IJXA 4AQDA 3WYNA 3QPWA 3WADA 3VUFA 1H65A 2C99A 3QI2A 2BP7A 1YFLA 2WWGA 4B4OA 1UWVA 3QBDA 2H1RA 2JH3A 3PL1A 4QXOA 2ZI7A 3D8UA 1SG9A 1JIKA 1QH1A 3GGJA 4RYLA 3OKFA 2XHEA 3CINA 1CRZA 1WXDA 1XYYA 3O47A 1CEXA 4HNAB 2VXCA 3DO5A 2BEUB 1J8DA 2NV6A 3C3BA 5DJ5A 2YBDA 2ET6A 3NIDB 2XCLA 4YDQA 3Q88A 3GVHA 4X1KB 4MQUA 3K6SA 1DIOB 3QFSA 4F21A 2WJ3A 4JYAB 3NDRA 1JR2A 2JFZA 5DT2A 1VLJA 2G88A 2WDPA 3CLVA 1U0HC 2XOKA 4QFCA 3X3HA 4DCGA 2C2WA 4TS3A 2PY6A 2CLFB 1R4AA 3PJGA 3UMCA 4CEHA 3QITA 4YJ2B 1YRYE 2D8AA 3K9QO 1MJHA 4XUGB 3SHFA 2CL7X 4LTNA 3V3TA 5DULA 4WKBA 2Z4SA 5JMOA 1V48A 3HR4A 3RJZA 3ZYZA 4Z7QB 1J25A 4UQOA 2RI0A 2B4TO 1UPXA 5KTTA 2WVHA 3AJ8A 3RARA 4Z6KA 1HNNA 1H0KA 3QKWA 1OMOA 4DQUA 2AUTA 4F8EA 1Y8RA 1YFZA 3ER6A 1TUGA 1ZONA 1ST2A 1TEXA 2V59A 5KVCA 3Q3EA 1PNRA 2R9VA 4CLDA 2NVUA 4M1TA 4HTAA 3BWYA 1K2VN 1L5VA 2ZRQA 3MLEA 2EP7A 5FV7A 5ALKA 3B1XA 3I4LA 1JEAA 2DAPA 4WMLA 4RY0A 5IM5A 3PDIB 3ROMA 5CPFA 4DMMA 3ABIA 4OV6B 3OFSA 5JNRA 4C4AA 4G5SA 3W9BA 4G5GA 2Z9CA 5I9NA 3SYKA 1KTVA 2MHCA 1NQ5A 1HFKA 3UGTA 4IJQA 4TXLA 3WZLA 4CT5A 3AM3A 2XZOA 4UBIA 4Q7EA 3U44B 4KR2A 2W4MA 4R51A 3THOA 2ZBUA 1ODKA 2B7BA 5JISA 5KQGA 1A96A 1RPJA 3NHFA 4WY8A 1CUCA 2I66A 3EZYA 4IRMA 3KR1A 2Q3DA 3EG9B 3SIPA 3RAPR 2Y2UA 1JSCA 1K68A 4G4GA 4IJWA 1GNLA 1NSTA 4KLAA 3BTVA 2VA9A 3RYFA 1Y8AA 4FEEA 4RDIA 5B6IA 2BMJA 3RROA 1R10A 2ISSD 4QASA 3IE0A 5AICA 2Z43A 1KEWA 3GG2A 4E51A 4N4AA 2NP7A 2JDIA 1J0BA 3A9VA 2DFTA 3M83A 1L8LA 5F5XA 4TTRA 5IUKC 4MCAA 3GJRA 2RONA 4ZVPA 4DCPA 4CLRB 4BFTA 1E59A 3K3PA 4UBNA 3GNSA 2Z04A 5LYJB 3QYAA 1VYVA 4FD2A 3HXPA 3H18A 5DYGA 1SOAA 2CDRA 4W5QA 1Y5MA 1V35A 4BB6A 2CY0A 2G5CA 1RYMA 5JQGB 2IW3A 1VB5A 2V4UA 4H27A 4RHUA 2CHQA 4XQGA 2FN3A 3UW3A 4C3OB 1AMUA 1U8TA 3DV0B 2F55A 1QZ3A 2BOVA 1E9FA 4Q5IA 2C57A 5B5SA 1MT3A 5E6RB 5IBCA 3ELDA 1OBCA 2FY8A 2ZR8A 5KTPA 3FX2A 2XRYA 4FLEA 1L5RA 3IVXA 1EI9A 1YKGA 1YRLA 4C7OA 3UUEA 2EZTA 4KFSA 4PQFA 3HUFA 2YASA 3KAQA 2D0OB 2JFPA 2ZRMA 1BEZA 1YA8A 1W4AA 1SK9A 3EVDA 4KGXA 4MQBA 4P3YA 2H11A 3G1WA 4YAWA 1IBMB 1WO8A 3DVLA 2CN1A 3A6HA 2H4ZA 3RC2A 1DX9A 3NYWA 1XR3A 4X1YA 3T7KA 2GTHA 2BBOA 4OF4A 3B20A 2H7YA 1J90A 2Q5JA 5K99A 3D8NA 1S6YA 2PMCA 4KIUA 1II0A 1YS2X 2BN4A 1T13A 1TJ3A 1F38A 1J22A 2F64A 2ROQA 1J09A 3MB5A 4RK0A 4R8RA 1Y6FA 3R9WA 1V5IA 3C14C 5JRZA 4XD7D 2QE7A 3F3YA 4U6NA 5LQJA 3NVMB 1EX7A 4NOKA 3LT0A 4AW9A 4L5AA 5LZ5A 1I3KA 2QA5A 2ZYAA 4RL6A 3O94A 4POAA 1XD2A 3LO5A 5K8VA 1YZKA 3FROA 4HEQA 1NW5A 1Q0TA 3V1TC 4Z7JA 4QXMA 1KJWA 1WP4A 2V98A 3GGSA 4YR7A 1H5NA 5LOVB 1CRQA 2QMZA 1EVIA 4GPBA 4V03A 3RSLA 1O6FA 3ZVMA 4RGBA 1LGYA 2FSGA 3MPUA 4ED9A 3V7WA 2A92A 5LPNA 3RUHA 4XX1A 1QQ7A 2BKEA 4UUNA 1D2AA 4BO5A 4G9BA 2QXTA 3E48A 4Q3BA 4B8WA 1KY5A 1Q44A 3I58A 4DY4A 5LN1A 3ME5A 1VTKA 2H5JA 1LC0A 3CLTD 4QHTA 3F8TA 5EWLA 4ALLA 3RAJA 3JWGA 5AVSA 1RHJA 1U9YA 1JSXA 1CYEA 3WQSB 1LBQA 3CWZA 3VYTB 1A72A 1Z26A 5KNCA 3P9KA 4R68A 1KI6B 1W85A 2EFYA 4UREA 2RE8A 4O4JA 3T94A 1ZHHA 3G2KA 3OA0A 1CVLA 4FB5A 1XTVA 4KCGA 2XR1A 1T3HA 4Q19A 1CUXA 4V0RA 2BGMA 1C30A 2ZB3A 3SY8A 2X8WA 5DTIA 4Q7QA 3IFSA 3LPNA 1E5DA 5PNTA 2IY8A 1M3SA 2GPTA 3L7OA 4MINA 4DADA 1PL0A 2ODWA 3EGXB 1O9GA 2IW1A 2YJTD 3MJEA 5BV2P 2P4UA 3F6BX 1LX7A 1M2GA 1UJ6A 2GXSA 2W2VA 1KRHA 1OYYA 3DMTA 3M70A 4L0CA 3RO7A 3RYHA 1SHUX 1VFNA 1DQNA 4MH0R 1TIPA 1EJ2A 2G25A 2N3ZA 1KSGA 1TPYA 5K0EA 5CFPA 4BV9A 2FFAA 3QYPA 5DPMA 2BRUA 2NSHA 4K0RA 1AQJA 1KQGA 2YUTA 1Y80A 4DV0B 1RPNA 1SXIA 3I3SR 2WTNA 3PENA 4KTTE 4Z9YA 3F2VA 1X92A 3L6RA 4J76A 5H70A 4ZTZB 2W6PA 4XIGS 4BNYA 3L7IA 1EZ4A 1ODLA 5GWXA 4F3KA 1VE5A 5AHRA 4DIEA 4JBNA 3T99A 3R23A 4BB5A 2CF5A 2IX3A 3QH4A 1ENOA 2NTVA 1UKVY 3OHSX 1OLUA 3GXOA 1DEOA 3KCQA 4RZQA 1BKSB 1G20E 2ODAA 3R8XA 4BN0A 5GY7A 1T6XA 4JYMA 4AMGA 2YVUA 5C8XA 1VI6A 3NEYA 1QRUA 3TJMA 4P5EA 4KQ2A 3K0SA 2IGBA 1QGZA 3KYIB 4TMTA 3AIIA 5BN5A 4IXMA 4R71A 2A88A 2EX0A 3MINB 3U48A 4TTJA 3L8EA 3MIIA 1BC5A 4ZOBA 4CKCA 3F6SA 4ZQCB 2YJ5A 3DC2A 1T5DX 3BB3A 3PZRA 3ZBPA 5A9SA 4LNUA 3OZGA 2R11A 4QO8A 1IHXA 2M6LA 2A33A 2ZVQX 3JQBC 2PA3A 3FPAA 2XTMA 1IRIA 2B0CA 3I9OA 2JCVA 5E7QA 3M4JA 5FWNA 1NLZA 1QHYA 4N1AA 4WLEA 1Z5OA 3SZUA 3UJNA 3PXAA 3WK4A 5KNBD 1CKEA 1NHWA 5FOQA 4KO4S 1A04A 4I9HA 5CNIA 1G8KA 1F8XA 3PUYA 4NMHA 1Z5NA 1NZFA 5EC8A 4V0OA 3RAFC 4LYDA 1FYEA 3A9WA 3N2KA 4D25A 2O2ZA 3MJ4A 4MYCA 4QC2A 3ZGNA 1GV0A 3BORA 1P9LA 4WFIA 4FBGA 3MTIA 3SE7A 4ZCLA 1BS2A 2XNHA 2FMKA 4QU8A 1TDJA 3HYRA 2NT3A 1L5FA 2NN3C 3IEXA 4A73A 1CEQA 4GVLA 1S2LA 2I7VA 2RGXA 1E7MA 2H06A 2WWIA 3KZNA 3AVPA 2H31A 3RC7A 5U4QA 4KU4A 4BPRA 4UCQA 3UJ7A 1LPBB 1U7DA 1E1QD 4L6IA 4FP9A 1UBOS 3BD6A 4JJEA 1R4MA 3S2ZA 5B7PA 5F9MA 4HGQA 4LF5B 1NWHA 3K16A 1TVEA 2HGSA 4AU1A 3E84A 3USES 4AKHA 2QL9A 3TDMA 3C87A 3AR9A 1DC8A 5CBKA 1V6SA 1Z25A 1S7CA 4TX1A 1HDGO 2R1VA 3T1QA 1XCBA 5CD1A 4MHTA 2HJWA 3GDFA 2ID4A 1N2CB 2PSDA 3QG1A 3DP7A 2XUQA 4FYVA 5AKLA 1GKIA 3OKCA 1E3DA 1U65A 2F9MA 3B52X 1GGHA 2QJTA 1BGWA 2R6HA 3SQLA 1C9NA 4DR6B 4QT0A 4KKXB 1DKPA 3O8LA 1AKRA 5ALDA 4PICA 3G9XA 1XPJA 5MF6A 1IPEA 3BSYA 4ARZB 5JD5A 1PVVA 2JEOA 3K5PA 3RR2A 3H4MA 2ZREA 2P40A 4C14A 2NVUB 1NI3A 3V34A 5A4KA 2VP2A 4MUFA 4DCNA 3LTNC 2I55A 3FKSD 1KOJA 4IO0A 4L9SA 5JRDS 4ONEA 4R5MA 5FWXB 4IVPA 2PS3A 2P3LA 3LW8A 1X7XB 1GPAA 1GAXA 5C0OE 2NM0A 3RREA 1N3BA 5FQOA 5JUWA 3AUKA 3K7EA 1XIVA 1RPAA 1N6KA 4N0DA 3R5HA 4C0JA 1XVIA 3GH1A 3ZHOA 3I2KA 2OOSA 1I3CA 2QTRA 3RBVA 4BZWA 2WJAA 1G19A 3QIVA 1PGOA 3DDZX 4V3CA 5CPBA 4UW9A 1ZITA 1O9BA 2W00A 5AHKA 3KPWA 3OX4A 4LXTA 4C2AA 1PDWA 3WIVA 4UHHA 4F60A 1X80A 2F17A 5T5QA 1MEJA 1EB8A 3FTPA 2JGFA 2UYOA 3JWPA 1MABA 1UXHA 3P4YA 1P6UA 4GP6A 4IHJF 4ZU3A 1J8FA 1JAIA 3GK3A 3OWHA 1GT91 5THXA 3DZGA 4IOKA 4LA4A 1T3GA 4GBMA 1OGIA 4EABA 3B60A 3SLGA 3HGTA 4UUPA 4KOEC 3PUHA 4JKOA 2VHQA 1JHRA 3Q1LA 3QVMA 3TSWA 1T5TA 3EF0A 4Q7KA 2FP4B 3LLVA 3EFOA 2O0JA 3GNQA 2NU7A 3LQKA 1D04A 4KRXA 4NESA 1RHMA 3DUFB 4ZOLF 5JJCA 2A5GA 4ZOQI 1YACA 5KCZA 1RKXA 1XDBA 4LKOA 5K3SA 4AKIA 2JFNA 1I7DA 3LCJA 3R7WA 4JQYA 3HR7A 2Y1XA 1OA0A 4BJ3A 8GPBA 5LBIA 1QUEA 1PF7E 2G36A 3KAPA 1Z7GA 3HWSA 2V8BA 3NV9A 4RXMA 2OAQ1 2B1JA 4QL3A 4DV6B 3GRKA 3T9AA 3BGOS 4B6FA 1KO8A 2I87A 3UATA 1E6EA 3MWFA 4HDMB 1B8UA 1U0JA 1QQAA 1IHOA 3G2QA 3T3MB 3WP0A 3PX7A 3AHFA 4W5WA 3FM9A 2D1YA 3RIXA 3VKGA 3HEAA 3PHJA 3WFJA 3WC4A 4P2BA 2VZ8A 2IZOA 2VJOA 4ENRA 3ONDA 3LA8A 2A0FA 4XYBA 4TN1A 1B8VA 1JZSA 1DOZA 2HSWA 3NTQA 3W4JA 1A2QA 4JK3A 4QUAA 2II6A 4O4LF 3UBTA 4WXEA 1B2LA 3H17A 2H2DA 4M9SA 4TROA 4BNFA 2C9YA 5JH7A 3TQSA 3OY2A 1I14A 4JL8A 4XSVA 4TT8A 4CQMA 4AVYA 4CTOA 2AXNA 3PQEA 2OHGA 4I14A 2O06A 1JHYA 1Q7BA 1BG6A 1DT5A 1E3IA 2Q8PA 1Y5RA 1E2NA 1DJQA 2SHKA 1SKBA 3OUUA 3ICWA 4Q6BA 5CGQB 1VE3A 4V2UA 3UT6A 1GRCA 3E8XA 4MMZB 3UAOA 3VHXA 4EJSC 2OENG 1LUAA 4QOHA 1G6KA 4BNNA 2RGBA 2V7EA 3BXHA 2DH5A 2WU0A 2XOEA 3NC1C 2CUNA 4A92A 1ULUA 4IJ5A 1N1MA 2CBXA 5KC8A 1M5RA 2E87A 2R00A 2Q3CA 3FHOA 4KXUA 4N5NA 4IKEA 5FA6A 4IIJF 3FPJA 4Y2PA 5HILA 3WWEA 3RK4A 4HNAA 4GYWA 1ZK3A 4OP3A 4P7FA 4HV4A 1GSHA 1XJ0A 1O77A 4KE6A 3QA3E 1E5LA 3C6BA 3PUVA 1BRMA 4JASB 2OR3A 2DPLA 5F2KA 3KSDO 1T6NA 1TD9A 4HVLA 4C78A 2YN0A 4MVJH 1SU6A 4ABTA 3CEMA 4ZU6X 3H2GA 4IRXA 3LOQA 2M98A 4XW2A 1AZSC 3LVBA 4V0ME 1U0SY 5DGXA 1RI1A 5NLLA 2F43B 3ZW9A 4YMTA 3W5VA 3L01A 4NG5A 4BLPA 5IAOA 5HMMA 5I9TA 3TSAA 4M38A 4WVFA 2XXJA 2QD2A 5EIBD 5FYDA 2XRZA 4XQCA 2PQ6A 1BHSA 1N3YA 1Q14A 1RQLA 3GF4A 4LY0A 4WXRA 3OCJA 3JQAB 1E3TA 1ZNXA 3LF1A 1L4YA 1MKYA 2CVHA 5FPSA 3ZW7A 2Z95A 2IHNA 3CF4G 2VDPB 3VR3A 3V1MA 3MJVA 3EB9A 4AZWA 2TMKA 3FWNA 1TZJA 3HP1A 3B9BA 4J9UE 3ILHA 2D3WA 3V8NA 3WSWA 3FYUC 1I32A 1K08A 4ZQFA 3DZ8A 2QSJA 2YWXA 1KY4A 3RV3A 5T3YA 4YCLA 2RGUA 1JBEA 3D02A 3K6JA 4LF7B 1EJ0A 4INOA 3W05A 5J23A 3ZI0A 3V9PA 5DH9A 3VISA 2IY7A 2X22A 4L02A