3GBLA

Crystal structure of grass carp beta2-microglobulin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
97
structure length
97
Chain Sequence
KVSSPKIQVYSHYPGEYGKENTLICYVSGFHPPDISIELLKNGEVIADAQQTDLAFEKGWQFHLTKSVSFKPEKSDEYSCSVRHMSKTKKIVWESNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta2-microglobulin
publication title Crystal structure of grass carp Beta2-microglobulin
rcsb
molecule tags Immune system
total genus 15
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2009-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gblA00
4ZSOA 5T3ZD 1MWAA 2Q1EA 1SBSL 5C09E 1AHWA 2D7MA 4ERSL 2A9NH 2CDEA 3OWEA 3IU3A 1FZOA 4G7VH 4MA3A 1KIUA 1L7IL 3E2HB 4PJXA 4NRXA 4LSRH 4Q74A 1NGWB 5HGAA 3ULUL 1IC1A 3Q1SL 4FMFA 5ID0B 1UM6H 4TVSa 2ZCKH 5ICYA 1WC7B 3KR3L 5A1AA 2RQ8A 1TTUA 4U7SA 4XMKH 4QCIA 3DX6B 1K4DB 5JOEA 1WSST 3OPZL 1RUAH 1W0VB 1A1NB 1JF5A 1NC2B 4APQB 3HUJB 1QP1A 3OSKA 2I9LB 4CMHB 3HFMH 1NLBL 4P5TD 3O3DA 4P5TC 3G6DH 2GITA 3KPPB 4R90H 4YEEA 4QRUA 3C87A 4Q7DA 4JKPH 1Q0XH 4V1DB 4W6YB 5IB1A 2NTSP 3VGDA 1CCZA 4LCCB 3S5LB 2G60L 1HYRC 2YZ8A 3QAZB 1C5DB 1KXTB 1ZHKA 3NCYS 1JGEA 1A2YA 2FHBA 3MSPA 4MJID 1RVFH 2YC1A 4M48L 3OR7A 4S1DD 1T03H 1RQ5A 3RDTD 5GHWH 2FCBA 2PNDA 3VXSA 3RDTC 3SO3C 3PGCB 3RU8L 2ZUVA 2WWMC 3GI8H 4JGUA 1J1XL 3TZVB 3QO1A 4L29B 1ZA6B 3AS0A 1KJ3H 4LRNH 1EFXB 1NEZG 4OKDA 1YC8A 4LLQA 2HLAB 2YD1A 4PJIF 5D7LD 1KIPA 3VA2C 1U8KB 1CD0A 2XY2A 2J8UE 1IQWH 4RBPK 1NBYA 4HG4K 4U1JA 3TN0B 1AXSB 3MBXH 5J06A 5I18L 3FQUA 5EOQL 4D8PB 5DVLA 3O41B 3ZHKA 4MSWA 2R2BB 4J23A 1DQLL 2X1QA 4UIMB 1AO7A 2O26U 3HI5H 4GUPA 2CGRL 3D69A 4BSWB 2DL2A 1JNLH 2D7TH 3DIFA 1DLHB 1J0KA 3GMOB 1T1XB 5F1IB 2DYPA 1BGXH 3CVHH 3T3PF 4JFDE 2EH8H 2CLVA 1KNOA 3QUYC 1CXKA 3PABB 4JN2A 3L3IB 3WFEH 5IMKA 5KVMC 3P4MA 4NKMA 2VJXA 2DIBA 5JPNA 4RA3A 4OGZA 1P2CA 1N59A 3UTQA 1DEEB 4F7PB 1KXQE 3M45A 3F7QA 3WFBL 2EE9A 3BEVA 2CMRL 4M7ZC 2WINA 4LLWB 4R97B 4YHZL 3CXHJ 3MLSL 4PJ5D 3U82B 5EZJA 3KG5A 3CH1B 3D5OF 3QQNA 2YD7A 4LQFH 3GRWH 2MQ3A 5I1HL 5C0BA 4PG2A 1KCVH 3UTTD 2OZ4H 1IILE 3WHE0 1EDQA 4WFGD 3BYYA 4PS4H 4Z0BL 4KDTC 5SWZE 3QDGD 2IBZX 1W8NA 2XRAL 1FVDB 4WW1B 3RAJH 4XP6H 1XAUA 2V17H 2A6DA 2YK1L 5F7NC 2PYED 3G9AB 3FO2A 5EU5B 4FFYL 5DGQA 1UZ8A 4IRJA 2EDHA 5K9QI 5D2LA 5HVFB 3IAGC 4H1LH 2XTJD 2XTJC 4XXDA 5HHQA 4GRLB 3KPRE 5IW1B 2IWGA 4GRWB 4QRSA 5TE6H 2FYYA 3IDXH 4BJLA 3LKNB 4U6TA 1UB5B 4LVEA 4KTEL 1EBAA 1HHIB 3PXHA 5D70H 3FT2A 2B7DT 4NKDA 5HHMB 4ZG1A 2ZPKH 3MZTA 1J18A 1ZMYA 4MA1C 4RRPG 2PTVA 3TJHD 4O4YH 3JSSA 5T3XL 3PGFL 1S9WB 2EDWA 1EEZA 4OUUA 4YHIB 5DK0B 3OBAA 3QCVH 3G04B 3KHOA 4DVRH 5INDA 1VKXA 43C9B 4XRCB 5CFHA 5JHDA 2DQJL 3RWJB 3RVXD 4PJ9B 3RVXC 1G7IB 1MFBH 3IXAB 3HMWL 2FBJH 5EA0L 3T2OA 5MENB 2XY1A 3SDCA 4W70A 4XP9L 4U6HB 2IALA 4PJHE 2OXHA 4NO3B 3ZO0A 1TCMA 1H3VA 3RKPA 3RZWA 2R56L 5EU7C 5FYKH 4BM7A 3DV6B 1N26A 2A74A 4F80A 1SBBA 3WN5A 5DEFA 4X0KA 1ND0A 2OQJB 3TYFB 3FB6A 2AXFA 1A0QL 3IJHA 3CSBA 1ZK9A 2NY1B 1L7IH 5I1JL 4PJAF 4QXTA 1XIWC 4KV5E 1OAQH 2BMKB 2X7LB 4KVCH 1Q9KB 5FIEA 4YXHH 4C59B 4LLUA 2R0WL 4M6NL 2Y07H 5MERB 1S3KL 4ETQB 2FX8L 3IFLL 1G0XA 3FOMA 2E9JA 4CMMA 3BDYL 5HDOA 1P7QD 3QJHB 1YNTA 2WBJA 3NZHH 2FZ3A 3HZYA 1WFUA 5F7UA 3VXRA 1H0DB 3C09B 1NLBH 1X7QA 3KYOA 2VQUA 1MIML 4NGHH 2BOCA 4X8XA 5T1MA 4PJGF 4ZXBD 5CINL 4ZXBC 4XPAH 1KB5A 4HIJB 3U9UA 1X5IA 3MRMB 3U4EA 1MWAH 2E3VA 1SM3L 3FB7B 3AS1A 1SJEB 4GXUN 2AK4E 3FQXA 3ZKMD 2ADJA 3ZKMC 2Y7QA 2JF1A 3RL2B 4UDUA 1W72B 1PEWA 2FRGP 4HJJL 4YC2C 1CDCA 1FV1A 4G43B 1A1MA 1MCQA 1T83C 3U0TB 3DSNA 4RGNB 4KFZC 5ICZB 3G6JE 5ID1A 1HSBB 4Z95H 5F6IC 5JIPA 4LHUA 3LN5A 5FYKD 1P6FA 2VDNL 3VFMB 4Z6AT 2P45B 3STZA 3UJTL 3TVMA 1PZUB 5T1KA 4AIZA 1FQ9C 4OCRH 4J1UB 1KLUA 5JUEL 2ESVA 3SKUD 3OX8B 4G6JL 1D5BA 5I18H 5IBUG 1JE6A 5GZOC 4GW5B 3TA3D 4X5LA 2H2PD 3TA3C 2NY2D 2G5BB 2NY2C 4QWWC 4MXWL 1VFAB 2E7LC 2LVCA 3FCTB 4Q6IC 3UTOA 1TITA 5L88H 1RJZB 3MRDA 4ZO7A 5F88B 2ID5A 4X9IA 2YA2A 1NGWA 1AXTH 1JIBA 2CGRH 4K8RL 3C8DA 4YQXH 2GAZB 5C0AB 1FO0H 1GHFL 5ID0A 3BI9X 5D7SH 1IKNA 3VMOA 3MODH 2L0DA 4QXGL 1WC7A 1J7VR 5ALBH 5I19L 2PW1B 3DX6A 1FVEB 1CR9L 1K4DA 5D6DA 1YMMD 1UA6L 1H8SA 1W0VA 3GMMB 1A1NA 2PKDA 5KSUB 2C3XA 3QUMB 1NC2A 1RJLB 1VFBB 4OI9A 3WNPA 4APQA 3HUJA 4J7RA 2I9LA 1QLEH 4K7PX 4U1NB 1AHWC 1CN4A 3KPPA 3OKLB 2AEWA 3CLFL 4ZO9A 4MCYB 4V1DA 3C08L 3NCFB 4OLYL 5J3HC 3RIFF 3S5LA 1C5DA 4XCNB 3TJEH 5FGRA 3ILPB 1V7MH 3TP4A 4AG4H 5F89B 2A9ML 2F58H 4PGEB 1BX2B 4M1GH 3N1QC 3PGCA 4U2ZA 1MIEH 2D0GA 3MLSH 1V8HA 1U8LB 4HGMA 5CGYC 4PGCB 4F8QA 4L29A 5HXMA 1EFXA 1MREH 1NFKA 3TFKD 3EJYC 4Y16D 3TFKC 2HH0H 4Y16C 2HLAA 3RVWD 1U8KA 5ISZB 3RVWC 3DXAD 1FE8L 4KKBC 3PQYA 4M3KB 4KZEH 1DBKH 4N0YL 3TN0A 1AXSA 4MAUL 5DWUH 2YK1H 5JIHA 3RGVA 4D8PA 2J8UF 3O41A 2R2BA 3CK0H 3DVGB 3ZKQD 1H8OA 4UIMA 3UZQA 1LO2H 3VXSD 2ZP0T 4HWEH 3LEYH 4BSWA 4I0KA 4HFUH 5IHUL 1DLHA 2EICA 2MWCA 1T1XA 3GMOA 2IFFH 3LH2H 4GW4B 1DVFB 4JLRB 1KN2H 5C0JB 4PJ8B 2WZPD 1UCBL 4HF5H 1B3JA 1CE6B 3KPSD 5F1IA 1A14L 1LVEA 3SO5A 3QXUA 4JHAL 2F54B 4JKLA 4ZS7H 1I3UA 1CT8B 1D5IH 5IB3A 4HPYL 1U93A 4HWNA 1SJVA 1S5IL 3ZE2E 3PABA 1GJIA 1GOFA 3L3IA 5E2WH 5C08E 4ZTOL 1EEUA 1AO7D 2V6HA 3T0ED 3O45A 4YNYB 4MA7H 1I7TB 4KROD 1EAJA 2ZSVA 4KROC 2V9TA 3BESR 4KK6C 5GSVB 4PFEA 1DEEA 3WDJA 1E4XH 4K3DH 5EA0H 3NIDE 3ARBA 3MUZ1 1QKZL 3MLVH 4Z7VB 1ZGLP 3F65A 4RAVA 4GKZB 4XBGB 4XVSL 4LSSH 4EQ3A 3GJFK 3CH1A 2NR6C 1IKFH 2X41A 3OGOE 2IBZY 3I6LD 4H26B 5JOPD 2X4QB 2VE6B 5I73B 1NANI 1SEBB 4M5ZH 1I1YB 1FYHB 1FVDA 4HBCH 1IM9B 4WW1A 5AEAA 1ADQL 1A7OL 4LK4A 5EU5A 3QEQD 4F7TA 5B4MD 2R0WH 2R23B 3BUTA 5E1AB 3RKDC 1A6VH 2YXFA 1SJHA 3UTSB 4JQVA 2EH7L 4LVOC 3GBMH 4GRLA 4NZDA 2AI0L 5IW1A 2P8PB 5C0BD 3DBXB 4Z0XA 3LKNA 5E2TL 4PG2C 5HI5D 5LAXA 3SJVB 1UB5A 4UT7L 5I30L 5LKNA 2PYFA 1HHIA 2GUOB 1EIBA 5HBBA 3QDJE 4PUBL 5C7XL 1DBMH 4IOIB 3MCLH 4XMPL 2VYRE 1XH3B 4OB5H 4L8SB 3WXWL 1L9MA 2M8XA 5EOTB 5I6XB 1S9WA 4XCFH 5DD0H 1A6UL 4IRJC 1DQMH 4YHIA 5DK0A 3QIWA 3C60B 5GIRB 3G04A 1IGYB 43C9A 4UBDD 4XRCA 1EGJL 2GTZB 3RWJA 1M4KA 3SGJA 5F7YC 4PJ9A 5BRZD 1G7IA 3HC4H 3IXAA 1XGUB 4UU9B 2DLEA 5MENA 3V7AE 3IF1B 4S1RH 2ICWB 5AYUL 1JUFB 4U6HA 3D87B 3LEVH 1KB9J 4LCYB 5FKPA 2HRPH 3L7FB 1KCSL 4B7LA 1KIQB 1EH9A 2VZVA 3DV6A 4PJHF 4P2QE 4N1HB 2W59A 2OQJA 3TYFA 3E3QE 2VXTH 5DYOB 3WKML 4R4FH 2KH2B 3QHFL 1KB5H 4XPTH 4ONGH 5JHDD 1TXKA 3K80A 5A2LH 1BEYL 2BMKA 2X7LA 3ALWA 1J12A 1HXYB 1Q9KA 3DURB 3OB0H 1V7NL 4K7PH 4UV4H 4XBEH 2BJMH 3SDCD 5JZ7D 5MERA 4KV5F 4ZAKB 3SDCC 5JZ7C 1JI2A 3CU7A 1T7VA 3QJHA 2DLFL 3PG2A 4LSTL 4E9LA 3QXAB 4LEXL 4XX1E 1H0DA 3WN5C 3V95A 3MRLB 3BJLA 4JCMA 5C07D 1VGEH 4HIJA 3QDGE 1T2QL 4RMSA 3MRMA 1DFBH 3MA7A 1TTFA 3O6KH 4X7CC 3FB7A 1TQCB 2PYEE 1ZE3C 1A3QA 2NY0D 1W72A 2NY0C 5ESVB 5JHLH 4G43A 4M9OA 1FNGA 3U0TA 2O5XH 4NP4H 5ICZA 1HSBA 4UOJA 3O6FB 5E2VL 2WBJC 5EZIL 1JHLL 1NQBA 5SX5K 3VFMA 3VXRD 3LQAL 5MP6H 3G6JF 3DHJA 3VG0H 5I1KL 3LKSA 3DVFA 1INDH 4J1UA 4GG6B 1KJ2B 4EEEA 2C26A 1YEJL 4D0BB 5D7JA 3VFTB 3OX8A 4X98B 3BAEL 5HHXH 4P2RD 5GRJH 1HSAA 4GW5A 3E0GA 2G5BA 3ZT6A 1VFAA 3FCTA 1QBBA 3B2VL 1RJZA 5F88A 1AJ7L 1X3DA 1GGBH 4XC3H 2GAZA 5C0AA 3VDBA 5I8KH 2C4FU 4XWGL 4JFEB 1HZHL 4LHUD 4TPRH 4QHMB 2VZUA 4LSPL 3EAKA 3ZKND 3QPXL 1NAMB 2PW1A 4Y2DD 5T1KD 3TVMC 3ZKNC 1FVEA 3EYQD 4LRIA 3EYQC 1NAKL 3EYVB 4ZOAA 1QA9B 5J8OA 5GS0L 3D6GA 3DHMA 2RBLA 1QBLH 2ESVD 3GMMA 2YRLA 5IBTH 5KSUA 3QUMA 4K7PY 1RJLA 2J6EA 1VFBA 3Q6GH 1RZFL 4MDJB 3INUL 3FOLB 4LMQE 2VLJE 4U1NA 3OKLA 4MCYA 1KPVB 3K2UL 5IT2L 1Z0MA 3E2HC 5A43C 4XCNA 2VLMD 4QHKJ 1QBML 3ILPA 5DK2B 2AJ3B 4QF1B 1PYWA 5F89A 1DUZB 4G8GB 2IBBA 4J2XA 1IKNC 4PGEA 1C8PA 1BX2A 3RIFK 1I1AB 1UEYA 4EIZC 4DN4L 3IFPB 4G5ZL 2FECL 5JR1H 5D6DC 5KVEH 1U8LA 3O9WD 3GM8A 1TETL 1GC1L 2HKHH 5EBGA 5FHBH 4O9HH 4PGCA 1NC2D 2E7HA 4W81A 2VAJA 4APQC 2DQIH 4IRSB 3VWKA 4CMHC 1OAUH 3CLEL 5FUCE 3T0BA 5ISZA 3ARYA 3ROLB 2VXVH 4LGSB 4HEME 3BKCL 3A6CL 5CIPH 3FAWA 4LCCC 3O0RH 2CDGB 3QAZC 2UY7A 4JR9L 1K9TA 1A9BA 1OL0A 3GIZL 1FCCA 3WBDA 3DVGA 4PRPE 4BQCA 4S1QL 3C9NB 2LE9A 1T5WB 1WFTA 4J6RH 1N2RB 3TZVD 3TZVC 1EFXD 1CL7H 3S9DB 1NCDL 4GW4A 5BO1H 3IU4H 1DVFA 1OQOA 4HUNB 4JDTH 5C0JA 2W1NA 1VSCA 4PJ8A 5DVKA 1CE6A 5KSAB 3AUVA 5C9JB 4XHQA 2F54A 3TN0D 4DCQB 3TN0C 1CT8A 1JI1A 4YHOH 1C5CL 4JFOB 1A6ZB 2Y36H 3RGVC 4KH2A 5HPMB 5IMMB 3FT4B 3Q5YA 1QACA 3N06B 4YNYA 5EIIB 4UNUA 1I7TA 4D9LH 1MHHB 3ZE2F 1CE1L 2QKIB 2HT4D 3GEWB 3MRCB 2HT4C 1N0XH 5JQ6L 5GSVA 35C8H 2Q3ZA 3NPZB 4OGYL 3ZTNH 3QDMA 2X89A 2BNQE 1TVHB 3TT1H 4Z7VA 3MGTB 4JJ5B 2R0ZH 4GKZA 3A67H 4XBGA 1FH5L 1YYML 4N0UB 4ZFGH 3VFSB 3SKMB 3NIDF 4GRWH 4X6BB 5TF0A 1MHPH 1WAAA 2XQBL 2BC4A 3THMH 2PR4H 4FS0A 2NY4D 3BPLB 4ZYKB 1J5OL 4C56D 4H26A 2X4QA 2VE6A 4FZEL 3NFSH 4I77H 1SEBA 1I1YA 3BDBA 5F6HI 1IM9A 4HH8A 3O8XD 2F5BL 1HH6B 4DOHE 1BEYH 1WQVT 4PP2B 3BISA 1BIHA 2R23A 5E1AA 1CIUA 2X40A 3UTSA 3O3EB 4R97C 1RIUL 5L6YH 4L8CB 1GZQB 5DHVB 1IC7H 4YO0B 4OIIL 4OUOA 4MDIB 2P8PA 1ROWA 3DBXA 3GJEB 4TSCL 5DJ6B 1RFDH 4LEXH 3SJVA 4IS6B 1WV7T 1Q1JL 5DUMH 5LXGH 1N7ML 1UKTA 2CLRB 3GM0A 4IOIA 1XH3A 4KRPB 5T5FL 1Y6KR 2CSPA 4L8SA 4FFZH 1OM3L 5EOTA 3IRPX 3C60A 5GIRA 5KJRH 4JQVC 4YFLF 4OQTA 2GTZA 1BJ1H 4GRLC 1EX0A 4LNRB 4M02A 1UYWL 4ODTL 4DUWA 2IQAB 1XGUA 4UU9A 4LLAA 2HYMA 2CKBL 2ICWA 5DC9B 5B8CB 1JUFA 4LCYA 2ITCB 2MTPA 3L7FA 3DNKA 1KIQA 3KPSE 4I0PD 4ODSH 1ZLSL 1HK6A 1MCIA 2RB8A 3GNMH 1BQHG 1E4WL 1ZLVH 5DYOA 3UP1A 4O00A 4KDVA 4FQLH 3LN9A 2ADFL 3JBG7 1YNLL 3T0EE 1E6JL 1ETZB 2X4TB 5A2IH 2ZCHH 4ZUSB 1JZ2A 1GOGA 4PJ9D 3SGJC 3OZ9L 1HXYA 4PJ9C 5A2FA 3LAFA 5IFHH 3DURA 4WFED 1W72H 5MEND 2G9HB 5LGKA 4LASL 4ZAKA 1CK0L 1D5MB 1I1FB 4OQTL 4ZD3H 1X4XA 4Z5RB 1GPOL 2BSED 3VFOB 1MCPH 1N8ZB 4CW1B 3TNNB 2NW3B 4NQEB 3QG7L 1JZ6A 3DO3A 3EW3B 4G9FE 3QG6B 3MRLA 4HK0A 5E1HB 3K2UH 5DA0B 1HIML 1F58H 2NY1D 1DSFL 1MCOH 2NY1C 4NUJB 3FRPA 1FC1A 1OARH 1K6QH 1U8IB 3QQ4B 1X5YA 4HDIB 1R5VB 3C2AL 1P84J 2XYCA 5I1LB 2DQHL 3QEQE 4BZYA 5ESVA 4DN4H 4MJ5A 4WI5A 4ZUWB 3LQAC 1MCHA 1R3IH 3O6FA 1CDJA 2J5LB 3QISA 4XPGL 5EC2B 1INEH 5DQDL 3U9PH 3F7YA 4HV8B 3T4YB 4JY6B 1S9XB 3C09C 3R0NA 3HNSL 1VCAA 1YPZE 4GG6A 4DZ8B 1KJ2A 3HA0A 1C7SA 1KELL 3WUWA 3QUMH 3D48R 4TSBL 4D0BA 2J6EH 4Q9RL 3VFTA 3A6CH 4X98A 4WEUD 3RA7H 5CZVL 4V2CB 1IBGL 3WIHH 5F71A 4X7SL 1V5JA 3DO7B 3PL6A 2CIIB 3H0TB 3ARWA 1N6UA 1JF1B 4S1QH 4JANB 1QHPA 5ANME 2MNUA 3S34H 4RGND 3WL9B 3L1OH 4RGNC 5E6YA 3DX7B 4JFEA 3ZYJA 3V8CA 4QHMA 4WTXA 5BRZE 5HHVL 1T7ZA 3ECBB 4XB8A 3EYVA 1QA9A 1RZ7L 3ESUF 3RVVC 5KAQG 3MJ9H 4MDJA 1O7VA 2OR8A 2YMXL 3MOAH 1NLDL 3FOLA 2IAMB 1QFWI 4M93B 3U30B 2VR4A 3EHBD 3KYKL 3BMWA 3D0VB 2Q3AA 1KPVA 3L5IA 1UC6A 4X5XB 4M62H 3MV8B 3TBWA 4I9WD 4JKMA 4TTDC 3PP4L 1R5WB 1HKFA 4U1SB 4HWBA 5C0AD 1OCWH 2K9UA 4JN1H 1OB1B 2W9DL 5DK2A 1SMOA 3CGTA 4OZGB 4QF1A 2X2YA 1DUZA 4G8GA 5GGVH 4KKAD 1I1AA 1CICB 2ENSA 3ISWA 3KPMB 5C0DB 1PEZA 3IFPA 5D6CB 3P9LB 3PDGA 1NSNH 4LRIC 5IM7B 5AZEH 4NQUA 4FQJL 4WJ5B 1YZZA 3MRBB 4LCWD 4NM4H 1PDKA 4IRSA 4TTGA 4U6YB 4P5MB 2X4RB 5J9PB 2VDQL 1DP0A 4FZEH 4KHXH 1M05B 3ROLA 4AL8H 4LPYA 5D1QB 3HAEB 3OL2A 4JM2F 4RISH 3PUCA 2DF3A 5DO2D 5C07E 1P1ZB 2CDGA 4WY7H 5C2BH 5JDJA 2A73B 2VDOH 4TRPL 1DLFH 3EZJB 4HIHA 1X5XA 4XNYH 4K2UL 3KXFD 3C9NA 4HWBL 1IT9L 1T5WA 4LDOB 1GGCL 3CMOL 1DTUA 1N2RA 3OKEB 3NABL 4Y19B 1EEQA 4OIIH 5DVMA 1GRWA 1DBAL 4OCWH 1F4XH 1T6VN 4JRYE 2FIKB 2LU7A 1KTLB 3OR6B 3V5DB 5ISZD 3QNXB 9CGTA 3FFCD 1N7MH 4IRZL 4UT9H 5C9JA 4RMTA 3HE6B 4JO4H 2P44B 4IM8A 3STBA 4DCQA 1PSKH 4JFOA 1A6ZA 2P47B 4ZUVB 4P2RE 4OBSA 4HFWB 5HPMA 5IMMA 3FT4A 1UB6B 1MAML 3TIDB 4GKSB 3U7YH 5KSVB 5EIIA 3QHZL 2MKWA 3T1WA 1MHHA 2QKIA 3BP6B 1GGIL 2YD4A 3MLWH 3MRCA 4QRQB 3L3OB 3PWVB 4MLSA 1MRCL 4ODTH 2VXSL 1DVFD 1I9IH 5GRYA 3IDNB 1DVFC 1TVHA 3MGTA 3BN3B 4JJ5A 3BZ4A 1T1YB 4PJ8C 43CAB 2P43B 4N0UA 3VFSA 2IMNA 4PJIB 2F54D 3P73B 4X6BA 5I1GL 3OG4B 2WNGA 4OIAA 1MY7A 3CCHB 1XCQB 4IDJL 4ZYKA 3DI2B 2BSSB 3PV6B 4OTXH 3SE8H 4PRAB 4QHLB 5ITFB 2ATKB 1HILB 2GJ6D 5D1XB 4NKIL 4OD2B 3V6OE 2ZG2A 1HH6A 4ZNCD 2ZJSL 4PP2A 4TOYH 2MQ0A 5C3LD 3SGDH 3W0WB 3BN9C 4POZD 3PHQB 3O3EA 3W81A 4L8CA 2YKLL 1GZQA 4ZO6A 1GIGL 5CJQL 4YO0A 4JJHA 1CFSB 2D03H 4MDIA 3GJEA 1RZGB 1AE6H 3QNZA 3V4UL 2Y06H 2MPAL 2LU3A 5F7EH 1X5JA 1FN4B 3IJYB 3LEXB 2FBOJ 3R4DA 5F3BB 5J7CC 1OTUD 1QSFD 1BZ7B 4I3RH 1AKJA 3B6SB 2CLRA 1UFUA 4U33A 3VA6A 1BP3B 4I4WB 5FAAA 2VZ1A 3NH7L 3WNKA 3MRGB 5TH2A 3MNVB 3OKNB 5I1IH 4LPXA 5ADPL 4KK5D 3Q48A 2YN3A 1CXLA 4KK5C 1J0JA 2E6PA 3UTSD 4OCYH 2B2XL 25C8L 4MNGB 4G9DB 3UTZB 3UC0L 3L7EB 4LNRA 1FSKB 2J1KA 4GXVH 3BVNB 2IC2A 4RGOH 2IQAA 4OM0H 1KBGH 4CUCA 4X99B 5FCUL 1EZVY 3N1GC 4HIIB 4YDIL 2ITCA 1V3KA 1EHLH 2GYSA 4GOSA 4DAGH 2XFXB 4YK4B 3OXSB 5I1EH 1CGTA 3EIFA 2ZKHH 4L8SC 4X7SH 4HGWB 5IVXE 4M7JL 3V6FB 5I6XC 3PWPD 3NTCH 1MCWW 2YUXA 3C60C 1KEML 5DUBB 4B7IA 3TO2B 4BQBA 1ETZA 1WZ1H 2X4TA 4ZUSA 3JUYA 4NPYB 4BSJA 1GCFA 4GAGL 1NCAL 2G9HA 3VFNB 4FZ8L 5EU6B 1D5MA 1I1FA 5F7LB 3K7UA 1UGNA 4ORGB 2CUMA 1NBVL 2NMSA 4Z5RA 1RJYB 2AJSL 1LE9B 3VFOA 1N8ZA 2VDKH 3QUZD 3U0WL 4LKXB 4GAYB 4YFLI 3TNNA 2NW3A 2LU4A 2FHCA 4EI5B 1YQ2A 1AFVH 4NQEA 3S36L 4FFVD 1KJ2H 3WS6A 3KYMB 2I60H 3TBSB 4C56E 3ZL4L 3Q3GB 3QG6A 2VXUH 3BWAA 4GMTL 4NUJA 4NN5B 5J13B 3MBEB 1NDGB 1RU9H 3QQ4A 4JFFD 5JPMB 4HDIA 1R5VA 1L6XA 3GUTB 2JELH 4I3SL 5I1LA 3W5NA 3UJJL 5C3TA 2VRAA 2W0KA 3SDDD 3WXVL 3B8YA 4ZAKC 1F6FB 4ZUWA 4LCIH 5C86A 3Q5OA 4FTVB 1JPSH 1N6VA 1CZ8H 4XC1H 3KPLB 4HD9A 3SPVB 1UH4A 4P4KB 5EC2A 4DEPB 4HV8A 1NAMH 1PVHA 3T4YA 1IC4H 4JY6A 1S9XA 3GI9L 1K4CB 3NACH 4DZ8A 3EYUL 1MNUH 4K71B 4HMDA 1YPZF 2CK0H 5CP3H 3UYRL 1TQCC 1WIUA 4PJAB 4PGDB 4PLJD 3DO7A 4PLJC 3QZWB 2CIIA 3H0TA 2ZUUA 1JF1A 4UUJB 4JANA 4WFHE 1NCBL 4N8CL 4HWBH 2X9WA 2AEIT 2VQ1B 5AZ2H 1EJOH 3DX7A 3OAZH 3MLTB 3O6FD 5F96H 3MJ8B 3ULUD 3O6FC 1U91A 3MLYH 3O4LD 2FO1A 3WFDH 2GTWB 3ECBA 4ZDHB 1EMTL 3NIGE 4UINH 1ZTXL 3GGWA 4XVUD 5GJTL 4DVBB 4G6MH 3VD5A 4PJGB 1OP3K 1CD9B 2IAMA 4NUGH 2Q7NA 2A6KB 1UADC 5DMIH 4LPUA 2B20A 2YPVL 3PL6C 1QFPA 1WK0A 1RMFH 4X5XA 3MV8A 5HYSB 4MNQE 1TJIL 3UO1L 3WIIL 3CD4A 1BM3H 2VL5B 4YEFA 1R5WA 4U1SA 3DTXB 1OB1A 5GGSY 1WTGT 2WV3A 4OZGA 4N9GA 3U1SH 1UWXK 3TPUB 1CICA 3DLQR 3KPMA 4WFEE 5C0DA 4OLXH 1WZMA 5D6CA 3P9LA 4GQ9L 1G1CA 2FGWH 5IM7A 1F3RB 4D0CB 4WJ5A 1XF2B 3MRBA 1SY6A 1KF9B 5DJ8B 4U6YA 4IDJH 4P5MA 3CSPA 2X4RA 4M8QB 5J9PA 1M05A 1JNHB 4YE4L 5FYLL 5D1QA 3KWWA 3HI6L 3HAEA 3UPCA 1FNSH 3QA3B 1P1ZA 5HVHB 5JXEA 3NOIA 4KK9C 4Z9KB 5C09B 5HDQH 2DS4A 1IGFH 5E2UL 1HOCA 4OSUH 4OZFG 1I1AC 5HD8C 3ME0A 1XR9B 3OKEA 2OJZH 4LMQI 5ICXB 4Y19A 3EYSL 1R3KB 1LE5B 4KK8D 4WHTB 2N7BA 4KK8C 3EOAB 4IRSC 4QXUH 1KTLA 3MOQA 3HR6A 3OR6A 3V5DA 4RBPH 3GKWL 4OF7A 4XPHH 5EUOE 3QNXA 3HE6A 4QHUB 1F4WL 3JWOL 2ORBH 3DSFL 4WEBL 2HFGL 4ZUVA 3NH7H 2VISB 3OKYA 5D93B 4F15B 2A1WL 4HFWA 3FN3A 1UB6A 4PLKD 5EULV 3TIDA 2NTFB 4GKSA 4PLKC 5KSVA 1F02I 4H0IA 2H8PB 2AXHA 3BP6A 3UC0H 3L3OA 4HJ0D 3PWVA 4X83A 2FJHB 1FLRH 4U6VH 4Z8FH 4JO2H 8CGTA 5F7KC 1HI6B 4LEOB 3O3BB 3OGCB 3IDNA 3M07A 3ELAT 1A7RH 1IRAY 1MUJA 5EZOH 4B0MM 5JORB 1LDPH 2F19H 1T1YA 3IDIA 5KSAD 1F3DH 5CJOH 5DHVH 43CAA 3MLZL 5KSAC 5D96B 1Z9OA 4PJIA 4LARL 1H9VA 3P73A 4JFQB 5D72H 1U3HA 2OL3B 4JO3L 4NM8H 3CCHA 1XCQA 5ACLA 3OJDB 4XP4L 5LVEA 2BSSA 3PV6A 5B38B 3OXRB 4PRAA 4QHLA 5ITFA 2J8UB 4XAWL 2IADB 3L5XL 1HILA 2ATKA 1LO4L 3ROOB 3TT3H 1R24B 2UZXB 5D1XA 3ZTJH 4OD2A 4I9WE 3JTTB 2Z8WC 3B5TA 2EZ0D 4FFWD 2EZ0C 4P49A 2PTTB 5SWSE 3NVQA 3LKRA 2EDTA 3W0WA 5B39B 1KGCD 1CFQA 3I50L 3QXDB 2IH1B 4G6AD 1DBBH 4G6AC 1CFSA 1RZGA 1FPTH 4OLWL 4W6WB 1RIHH 4LCWE 5I8EB 3BPLC 3LEXA 1FN4A 1KC5L 2NZIA 4N5EC 4XNXL 5F3BA 1BZ7A 5J57B 1HHGB 3WD5H 5C71A 1P4LB 4D3CH 1QG3A 3MOBH 3B6SA 3MNZB 4I4WA 4NCC1 2CD0A 1MH5B 4QRRD 4JFDB 4YGAB 3MNVA 3OKNA 4R4NC 1Z5LB 4LLYB 3GO1L 4ETYA 3MFGB 4J4PA 4P9HL 1RIVH 4LU5H 2IQ9H 3BZFB 3KXFE 2GQHA 4G9DA 4MNGA 4WHCA 1JRHI 3CX5K 3UTZA 5E8DL 4E42B 3L7EA 3BVNA 2B0SL 1P6AB 1K85A 4X99A 3ZDXE 1FHGA 3GI9H 4IOFD 1HINH 4HIIA 4NQDD 1I9JL 3QIUB 1A8JH 3FFCE 2X70B 3D85B 2XFXA 5DGRA 3OXSA 2FGZA 2WIMA 3D3VE 4KRPD 3B8SA 4KRPC 1FZMB 5DC4B 4NZRH 2QHLA 5SWZB 3ZZ1A 4HGWA 1AD0B 3TCLB 2JJSA 2W07A 3GSNL 4JO1L 5DUBA 2AEQL 3TO2A 4ZO8A 4CU7A 5BV7B 3M8OH 5IVXF 4NPYA 4O2FB 3O2DA 4JQIH 4A6YA 3UXFA 3PWLB 4Y5VB 1BD2D 3VFNA 5EU6A 3GHEL 4AEHH 4NN6B 2AJYL 4ORGA 3KPRB 1RJYA 1LE9A 4U1MB 5DJ2B 1BVKB 4UDTB 2ADGB 4S0SD 4LKXA 4GAYA 1IGJB 4EI5A 4F7MB 5CUSL 5TDPB 3LVEA 3EFDH 2GKIA 3KYMA 3TBSA 2XZCH 3Q3GA 4J8RB 1ZVYA 1S7QB 2EEBA 3A6BH 5TE7H 1EO8L 3MBEA 4PRIE 1NDGA 2R8SH 2GJ6E 4GKOA 3GUTA 4I2XE 4MCZB 3GBLA 1XGYL 1LP9E 4MGXA 4JY4B 1OAZL 3S4SB 1QOKA 3S88H 5DRWA 1A6TB 1YY8B 4HAFA 4M7LL 4FTVA 2BFVL 3CFDB 4MHHG 1CLZL 2Z31B 3O2DL 3OAUH 1UM5L 4L4JA 3KPLA 3SPVA 1P4BH 4A6YL 4P4KA 3MXVL 4KZDH 5FV1L 3HHRB 1E6OH 2ICWJ 1QLFB 4HLZH 1OPGH 3B3IB 1K4CA 1B4JH 2MCPH 3Q0HA 4PJHB 3WS6C 2CJUL 2FX7L 4JDVB 4NFBA 1QSFE 4LGRB 5DHYB 3VGGA 1A5FL 5GGRA 3WJJA 2WWKO 3E8UL 5KZCB 3WUWG 3FMGH 5I1CH 4PGDA 4PJAA 1V05A 2JK5B 2C4FT 1BJMA 3QZWA 3WDHA 1OAXL 4PREB 1P7HL 4UUJA 2VQ1A 1TJHL 4PJCE 5LBSL 3MLTA 4M9PA 1T7YA 3MJ8A 2Q87A 2J5LC 4WCYH 5TPWH 5HSFA 5TDOB 5FGSA 2GTWA 4FQIH 3F7VB 1A3LH 1D3CA 4DVBA 1F2XK 1SY6H 4DKFL 3QUXB 4PJGA 3NIGF 1JPFB 2JB5H 3X3GH 2A6KA 1HHHB 5F1OB 2P8MB 2A1WH 5JW3H 3GK8H 3HAEH 4Q9QL 5HYSA 3PWPE 2VL5A 4TNVK 3IETB 3GBNL 5DI8A 1EK3A 3DTXA 3QRGL 5FUZH 2AK4B 3ZSTA 2DKSA 3AC0A 4X6DE 1OAKL 1XF5B 4FXGB 3B9VA 1BIIB 2PN5A 3DGCR 2ZG1A 4WFFE 3MRPB 4ZFOL 4BSVB 2YA0A 5DUPH 4O51B 4BQ9A 4D0CA 1YEKH 3G6JB 2KQNA 1XF2A 4WGWB 3I6KB 1L9NA 2GK0B 5CEZE 3I2CH 2NXYB 3NCJL 4WUUE 2IAMC 4M93C 4M8QA 1H5BB 4YH6A 1Z0NA 3U30C 2I26N 1JNHA 4B53A 4FHBD 3BH9B 1BOGB 4XAWH 1V3MA 2OYPA 3QA3A 2E6QA 5C09A 4JFFE 3U4BH 12E8L 4X4ZA 1U3YA 2XA8L 1Z9MA 2VUYA 1A21A 4UIKL 1CICC 5H2BB 1NMAH 3NFNB 3NFPB 4LQ1A 4K94H 3QO0B 1XR9A 3QEHB 3EJZD 3UPRB 3EJZC 4TQEH 5ICXA 1R3KA 1LE5A 4WHTA 3WCYA 3JWOC 3TWCL 2C3VB 5DF0A 5HDLA 3JUZA 1L6ZA 4TUOB 5D1QD 4MQTB 4P4RB 1BFVL 2NY7H 3QR2A 5D1QC 3CFCH 4LPVA 4QHUA 3GMNB 1RZKL 4KWUA 1JFQL 5EUOF 3MGAA 1IEBB 5JXED 4OZHE 5A3IC 5JXEC 4X80H 2VISA 3OKMA 4KGJA 4PBXA 1RZJL 4Y5YB 4YX2H 4JKKA 2NTFA 2H8PA 4OAWB 3RI5K 2QSCL 1IAII 4Y19D 2FJHA 3VD7A 3B43A 2JIXB 3AMKA 3L9RB 1HI6A 2W0FB 5GRXG 3ULUE 1BF2A 3O3BA 3OGCA 3TV3H 1DJSA 3O4LE 5JORA 1NANH 3B9KB 4NOFA 4RQQB 3HE6D 5JA8B 3OKKB 3HE6C 4M43L 4JFQA 2OL3A 3MLXH 2CO7B 1EPFA 2XPGB 1BVLB 1EHAA 1QNZL 3OJDA 1D5ZB 3NBNA 5FYKU 1JJUA 1JGVL 2Y25A 3OXRA 5HVGB 3VXTB 2V5TA 5B38A 4PBVC 2YPLD 2J8UA 1U58B 2HP4A 5L8JB 3ROOA 1R24A 2LABA 1FJ1B 3BPNB 4JO1H 3ARVA 4RFOL 1OOAA 5DC0A 5CSZB 1IQDB 5GRVK 5E2JA 3S3JA 5A40E 2PTTA 1HQ4B 1TQBB 5B39A 4LSUL 1W2KT 2I9TB 3CPLB 5IKCB 4D9QD 3LS5L 1XF1A 1JP5A 3QXDA 1FGNH 2IH1A 1WZKA 2AGJH 1IGIH 1RAMA 2BNRE 1YY9C 4RMUA 4EBQL 1FRGL 1U3HC 2WIIB 4LF3B 5I8EA 2R15A 2XKSA 1HHGA 3HMXA 1NFIB 1P4LA 5EWIH 2DQGH 3MNZA 2RGSA 5D1XD 2OL3L 4BK5A 1Q72L 5D1XC 1MH5A 3A0OA 4JFDA 3B9EA 4OCXH 4MQSB 5C0RL 5J56B 2D7NA 3VE0B 1S7TB 1Z5LA 4LLYA 4M7LT 4G7YL 2FATL 3KGRA 5DD3H 5C08B 1EHXA 1ITBB 4MD5B 3BZFA 5E5MB 4KUZH 4U05A 3MRQB 4BZ2L 3SKNB 4RX4D 3VGBA 2DLHA 4EOWH 4LHQB 4CAGA 1KJMA 4YGVB 1SEQL 3EDEA 4XCCH 3CNKA 3QIUA 2WW8A 2XV6B 3ZDXF 1OP5K 1FGVL 2BHYA 2X70A 3V9FA 3D85A 5L7XL 4WUKH 2R2EB 1HNFA 4AMKL 1FZMA 5SWZA 4KAQL 4OGXH 4WI2A 4J4PD 2QTEA 4J4PC 3R06A 3JV6B 3QWRA 5CZKA 3TCLA 2OI9B 4F9LA 5AAWA 3WE6A 4N8VG 4O2FA 3CFIC 4OQ1A 1FSKC 4WI7A 2QSQA 4Y5VA 4EUPB 3EBAA 1DQJB 4OFVA 4NWTH 3N50A 1MJUL 3MROB 1CYGA 3LQMA 3KPRA 3CUPB 3RFZC 2DWEB 4U1MA 5DJ2A 2BZDA 2BY0A 2VZ3A 1BVKA 4UDTA 4WHYG 3CC5B 5JW4N 4Y4KB 2ADGA 4YK4C 1IGJA 2E8YA 4F7MA 4FQ1L 1MQKH 5TDPA 3MACL 5CD5D 4OD1H 3LS4L 1NCCH 4UILL 5CD5C 2DMCA 2AJXH 4J3OC 4L3AA 4J8RA 3QDJB 4JM4L 3F6IA 1FORL 1JYWA 1ZEAH 2VLKD 2ARJQ 1RUML 5J12B 4MYWB 2JJSC 4KKLD 1H3UA 4JFYB 3T0VA 4KKLC 3QRGH 2XTLA 1X5HA 4ODXB 4LFHD 1U2HA 4RSVA 4MCZA 4CADB 3PWJB 4JY4A 1RZIB 1PBYA 5EU6D 3JTSB 3S4SA 1G7QB 1OTSC 1A6TA 1YY8A 2OJEA 3CFDA 2FWOB 1LP9F 2Z31A 3ARUA 1A9EB 3C2SA 4JKWA 1CFVH 3F58L 4NNXA 4JEGB 1I8IB 1QLFA 4NYLB 4EI5C 5K9JL 3TLRA 3B3IA 1M6OB 4PJHA 4Z7UE 1JGUH 2AABH 2EDYA 1MPAH 1MJ7L 4JDVA 3PXJA 3QQ9C 2EDOA 5DHYA 3T09A 4RAHA 1NL0L 3EO9H 3W11D 4NN5C 3NAAH 3W11C 3MBEC 4AIXA 5J13C 4NHUB 4P2QB 4OLZL 4QRRE 4KMLB 2JK5A 4LLVB 2QHRH 3P4OB 4PREA 2X42A 5GGQH 3DROB 3HRPA 1HEZB 5T3XE 2ED8A 1HH9B 4FTVD 5LQBL 3H3PH 3VXUD 3MRIB 1F4YH 4P4KC 5DJCB 1U6AL 3CDCA 3QNYB 3PWUB 3QXWA 4DEPC 3HNVH 4PJCF 5TDOA 4F8TA 3MV9D 1MCNA 4TVPH 3SEPA 4S10A 3F7VA 2VLRE 3IS1X 4WVRA 2A77L 4YAQB 4NQDE 2WQRA 1I4FB 3QUXA 3L95B 1JFQH 4K71C 5GS0D 3WJJC 1MCFA 1JPFA 2AVGA 4K3JL 1HHHA 5DFVD 2X44D 2P8MA 1MFEH 2NY5L 5FECB 2WLYA 2P5ED 5F97E 1GAFL 3QDGB 2IPTL 3IETA 2XNAB 5IF0B 1DDHB 3I9GH 3BSZH 2AK4A 4HS3B 3QEGL 1MAKA 2Y4SA 1ZHNB 2PYEB 5GGRY 1YYLH 4FXGA 1BIIA 2B1HL 3D2UD 3MRPA 5HGGS 5T33L 1BD2E 1GGUA 1A1OB 2ZUXA 4BSVA 5JIKA 1JZ5A 4MA8L 4O51A 4UTAH 4X6DF 5JXAL 3G6JA 3LKPB 4OZFH 3I6KA 2DQCH 2AJVH 4JFZH 3V4VH 4KVNH 5FYJD 4ZNEE 2H2SC 1JGVH 4HX1B 4F58L 1YDPB 3BH9A 1U3ZA 4N68A 1BOGA 5LG1A 4UOW0 1X5LA 3HPLB 1MRDH 1JL8A 1GSMA 3WFCL 3K8KA 1F90L 5GS3A 4R6UA 2GI7A 3I02B 4TULL 2ZUYA 1NMBH 5IB4B 5EH1A 3QXTA 4LSUH 3QULA 5H2BA 4LAQL 3AAZB 3NFNA 3NFPA 5DD1L 2UVFA 2EIBA 3O2WH 3QO0A 4TVPD 5BMFL 5IR1B 3QEHA 3UPRA 1Y0LB 1XT5A 1H3PH 5M7QA 3NA9L 2C3VA 1CLYL 3GIVB 1UWEH 2E9WA 1NGQL 4ODHH 3LMJH 4P4RA 1LK3L 3GMNA 2YD5A 1IEBA 1FIGH 4MVBD 3MUGB 1D6VH 1MLCB 1S8DB 2VLJB 3PHSA 2LV4A 5HVHC 4JREB 3T2NL 2W9EL 4Y5YA 4OZHF 5I76B 5EIQA 1TJGL 1X4ZA 4FQ2H 4OAWA 3S7GA 3SGKA 1KTDB 5F9OL 5KG9B 2JIXA 2D0FA 3L9RA 2W0FA 1CLCA 2BDNH 5FK9B 5BZWB 5I16B 4GW1B 5DTFB 3B9KA 3QCUL 4LIQL 5C0EB 3SQOL 2ZSWB 4RQQA 4AH2B 4ODVL 3BKYH 3ULUF 3OKKA 4N0CD 1P7QB 2YWYA 3LRSB 3V0WL 2XPGA 1REIA 1BVLA 4LSVL 4JM2B 3ZYZA 3RPIB 2OTUB 4KPHH 5D93C 3VXTA 3RRQA 3X11B 4F15C 3HMXH 4ELME 5GRUL 1U58A 3R8BB 1YQVH 4ZOEA 1FJ1A 2CK2A 1PJ9A 5DMJB 3LRGA 5DJYB 5CSZA 1IQDA 1ZLWK 2H45A 3X3FL 5F9JB 4Z76B 5E8PB 4L4TA 3DWTA 4H88L 1WIOA 4JZNB 1HQ4A 3SE9L 4PRPB 1XGQB 2I9TA 2R4RH 5IKCA 1TZIB 4K3EH 2Q8AH 2APFA 1MJUH 2JJVA 2DLIA 3HC3L 4JG1H 3A6OA 5D96C 3VCLB 5FO9B 2G75B 5IFAL 1LO3H 2XZQH 2WIIA 3DJ9A 4OT1H 4LF3A 4LVNB 3ZT5A 4R0LB 3MACH 3MLPA 3RWDB 3FO1B 3EO1B 1NFIA 1LWRA 3MXWL 3VE0A 1Z9SA 5DSCB 1F3JB 5DLMH 1E27B 4GMSH 3O6LL 4NJAH 2BRRH 4TSAL 1CTOA 1DQDL 1J86A 5C08A 2OK0H 3VXOB 2AJUH 1S9YB 5BV7H 4MD5A 1N6QL 4PLNC 1J05B 5E5MA 3WMSA 3MRQA 5D8JL 1RUQH 4LOUD 3SKNA 3FJTA 3KPOB 5I15L 2EYRB 1GVIA 3CXDH 2BNQB 4JB9H 2WBKA 1ZVHA 2FX9H 2IGFL 4HUXB 4YGVA 5L9DH 1DBJL 4P46B 1MLBB 2FD6L 1PG7W 2R2EA 3LKQB 2WBWB 2EC9T 2EDEA 1I3GL 3JV6A 1VESA 5ILTH 1QFUH 4LBEB 3DMMD 4LLDB 3PQYE 5EBMB 1N5AB 5T3ZL 4DOHB 3MA9H 2QSVA 4D9RD 5DT1H 2FJGB 4NKQB 1FNFA 2OBGA 4GXUM 4EUPA 1DQJA 4X4XB 3VFRB 5TFSH 3GHBH 5F7DB 4RWYH 5H37H 3MROA 3LIZL 4XNMB 3QIUC 3CUPA 2DWEA 4U6XB 3D85D 1MELA 3CC5A 4HC1L 4Y4KA 2WUCH 1XF3B 4P9ML 3RY4A 1F97A 1IGTB 3UZVB 3O6MH 3RY6A 3QDJA 3QWRD 3B9AA 5DR5H 5SV4A 3SKJL 2YPLE 3ILQC 4OFYA 2NX5E 4JFYA 5BV7C 1K8IB 1NFDE 4F9LC 4ODXA 1WF5A 1CLOL 1AQKH 3S35L 3KYAA 3PWJA 1RZIA 1FO0B 2R69H 5JMOC 3ULVD 4Y5VC 2B4CL 1II4E 3JTSA 5F1NB 1G7QA 5F44A 2VZTA 2O5ZL 5K9KB 1PX4A 1FL5B 4IDLA 4NN6C 1QRKA 3M1BB 2FWOA 3DARA 3KPRD 1A9EA 2I5YL 3BIBX 1VACB 4UZGA 4KJWD 4KJWC 4N1EA 1I8IA 1BFSA 1WEJL 3BWUC 4NYLA 1YEIL 3K4ZA 1M6OA 3BHBB 2RJMA 2DWDB 5DD5L 4AQ1B 1KCLA 3P30L 3KPSB 2QR0B 4HIXL 1ZANL 3PGDB 4Z7UF 3SCMB 4NHUA 4P2QA 5TQ0L 2EXWD 5LGHL 2EXWC 3QIBD 15C8H 4LLVA 1Q0YH 4KXZI 4X7DC 2A9NL 3C8HA 3DROA 2QV2A 3VFPB 4QRPE 4DGYL 1HEZA 4G7VL 4UQ2B 1HH9A 3T0EB 4I3GA 1FYTD 2Z31D 4PRDB 4LSRL 3MRIA 2Z31C 1FLTX 1KB9K 1AC6A 1QFWH 1S7WB 2P4AB 1MCKA 5DJCA 1UM6L 3QNYA 2ZCKL 3PWUA 4XI5D 1IGMH 1AI1H 2HLFD 1N64H 3T2PA 2HLFC 4KQ3H 1T4KB 4XMKL 3T0DA 2NY5C 4YAQA 1I4FA 3L95A 3BP7A 5ECJE 2YBRB 4X9BA 2X10A 2XKNB 4RCAA 3IDMB 3HFML 5FECA 4G9FB 1KLGB 3T8XB 2DM3A 3G6DL 5AAMA 4R90L 4CBPA 3QDGA 1Q0XL 2XNAA 4JFHD 1C08B 2ZUQB 2EO9A 5IF0A 1DDHA 3TYGH 5JLZB 4HS3A 2CH8A 2EO1A 1CGSH 5IESL 2PYEA 3MRNB 4NRZB 3QEQB 1RVFL 3DUUB 2F9BT 2Y5EA 5IG7B 1T03L 1A1OA 5GHWL 2H32H 2DQEH 4YZFE 3LKPA 1QYGH 3QUXD 4R7DB 3QUXC 5MHSD 3H7LA 1A7NH 4GKNB 2AERT 4LRNL 1KJ3L 4EVNB 2K1MA 2C5DC 5KW9H 1YPZB 4HX1A 4NWUH 4FQPA 1YDPA 1Q9WB 1G6RB 3UZEA 1QLRB 3HPLA 1IQWL 2VLKE 3BFOA 3MBXL 5ITBH 2AK4D 2JJTA 3I02A 1QRNE 2BVTA 5IB4A 3SE9H 3WNLA 5HHOE 1OWWA 5ANMB 1FBIH 4P5KB 4Y5XB 5IR1A 3NGBB 4MZ2A 3HI5L 1Y0LA 4JCLA 2Y1VA 1UENA 1BHGA 5F3HB 2NXYD 2NXYC 1JNLL 2D7TL 5FM5M 5BRZB 1NMCB 2ZNWA 4KJPD 3GIVA 3GRWA 1H5BC 4KJPC 3AMLA 1JZ3A 2OZ4A 4M03A 2DQUH 1CD1B 3DUSB 5H94B 1G9MH 3BMVA 3CVHL 1U3JA 3MUGA 3IKKA 1MLCA 1S8DA 1H3WM 4DK6A 3R8QA 1OF2B 2EH8L 1FZJB 2XKUA 3O6LH 3DX9B 4NO5B 1MAJA 4DUVA 5I76A 1N6QH 1JGDB 1NBZB 3WFEL 1AGBB 1R3HB 5J6GB 3R1GH 4HT1H 1KTDA 3RJDA 5ADOH 3VXUE 5KG9A 3TNMB 2HVKB 3ETBF 3J7HA 1VPOH 4K07A 2KPNA 5FK9A 6CGTA 5BZWA 5I16A 5SWQB 3FAXA 3OJVC 5C0EA 1NJ9B 4H0GA 1SVCP 2ZSWA 4AH2A 3MV9E 1P7QA 2P8LB 3LRSA 3V5HB 3GRWL 4YHPB 4JM2A 5K9OB 4NQTA 3RPIA 2OTUA 2FNBA 3VD3A 2NNAB 3X11A 2OZ4L 3MLUH 4ESKA 4PS4L 2F5AH 5IJVB 4Y5YC 4U1IB 4XMLL 2P5EE 1GZPB 4DN3H 5C07B 5DJYA 3SGKC 4ELMF 3PIQB 5F9JA 3RAJL 1HHJB 1N3NB 4XP6L 2V17L 4MLIA 5E8PA 4Z76A 4RMWA 2JIXD 4JZNA 2HWZH 4PRPA 1XGQA 1KCRH 2LFGA 2O5YH 5KN5B 1TZIA 3B9KC 1PY4A 1L7TH 4CVXB 3CFEB 1S7RB 3VCLA 4NZUH 5FO9A 4JFPB 2G75A 3GSQB 3G5VB 3C6LB 1G9MC 1DL7L 4JRYB 5TE6L 4R0LA 4PIRF 3TBYB 3IDXL 3H2WA 4MD0B 2YUVA 3FO1A 3RWDA 1WFOA 5FYJE 3EO1A 1ODAA 5KOVC 2BNUB 2R0LH 5D70L 3BPNC 5DSCA 1F3JA 1K3IA 2ZPKL 4P2RB 3MRKA 3KDMA 2LVEA 5KAQF 3KNBB 3WSQH 4O4YL 4L3CB 2P42B 3VXOA 1MSPA 1TQBC 1S9YA 1A6AB 2JJWA 2O5ZH 2XWBB 4XTRD 4XTRC 1I9RH 4HUWB 1J05A 3QCVL 4DVRL 3QCTH 3VU2A 4X5WB 2I5YH 3KPOA 4IBLT 4EUPH 2EYRA 1Z6JT 2BNQA 1MFBL 1B2WH 2FBJL 2YA1A 5EO9B 4HUXA 1NH6A 3MV01 2ZWLT 4Y2DB 1CFBA 3Q6FB 1O5DT 3J8F7 5FGCE 4P46A 1MLBA 4C4KO 1YEEH 5GPRA 4F57H 2ADIB 3CZFB 4HUMB 5FYKL 1N5YH 3LKQA 1NCWH 1T2XA 1OTTD 1U2CA 2UWEE 2Y5TB 5C08D 1OTTC 4IOSD 3IXTA 4DGYH 4WHDA 4LBEA 5H8DA 4LLDA 5EBMA 1N5AA 2I24N 3QDAA 2UVEA 4QHNB 1OAQL 2FJGA 5CILH 1AIFB 3E1F1 3WJLA 4KVCL 2BVPB 3LPGA 4YXHL 2YD8A 1GL4B 4X4XA 3VFRA 2EC8A 1MCBA 2Y07L 2VDMH 5F7DA 3GSOB 4XNMA 5MEPB 1AH1A 3HC0B 4WTZA 3O9WB 4U6XA 1GXEA 4ONFH 3NZHL 2CXGA 3DOSA 4MD4B 1WISA 3P3YA 4Y16A 2V9QA 1HKLH 2HFEB 1IGTA 4NGHL 2CRYA 3ZYOA 3DXAA 2B4CC 4XPAL 1K8IA 2OI9C 3MNWB 1O7SA 5DJ0B 1MWAL 2BXYA 4GQPH 5IESH 4D94A 1T0MB 5KANG 1FO0A 1NFDF 3W5MA 4PJDE 5F1NA 4PGJA 5K9KA 1BBDH 1FL5A 2DDQH 3GSUB 2YRPA 4S1DC 3M1BA 4X6EB 3VDCA 2QBWA 1J1OH 5DEGB 1VACA 1UKQA 1F8TH 4Y4KD 4Z95L 5IVNA 4Y4KC 3BHBA 3QDME 2DWDA 1LILA 4BA8A 3PV7A 3QDJD 3RY6C 3S3SA 4OCRL 3OTTA 3KPSA 2QR0A 3PGDA 4OFYD 2ZUTA 3N9GH 5J12C 1NEZB 3NCMA 1NGZB 3SCMA 2EDXA 4HUUB 4M6OL 1Z9LA 4EDWH 4XP1H 4YDLB 5IVXB 2M26A 2I07B 3EGSB 3VFPA 4UQ2A 4J3SA 5L88L 3T0EA 4PRDA 1AXTL 1S7WA 2FH8A 4YQXL 5M95B 4WEMB 1FO0L 5ETUB 1P4IH 3CDGB 1WWWX 5D7SL 1LEIB 3HNTL 3MODL 4P99A 3EUUA 4RIRB 4MQXD 4PJBE 4LSQH 4MQXC 5ALBL 2XICA 3MV7D 2F74B 1T4KA 4M1DH 4ZTPH 3WFZA 4RGMB 2E7CA 4LPCA 3BPOB 4YHML 4KI5D 3O2VH 2YBRA 1ZKAA 4P2QD 5CIPB 2XKNA 3IDMA 1IGCL 4Y1AE 1QLEL 3E3QC 4FQQB 2NY4B 4C56B 2X09A 4G9FA 5E5UB 1KLGA 3T8XA 5IJKA 1HCFX 1RD6A 3VGEA 5IROA 2W92A 1C08A 5JLZA 3O8XB 1WWCA 3TJEL 2NXZB 3MRNA 4NRZA 4BZ1H 1V7ML 2QQKH 3QEQA 4AG4L 1UWGH 3QWOB 4D9RE 3DUUA 4OM1H 2F58L 5HYEA 5IG7A 1R3LB 4M1GL 5LWYL 1DN0B 1IARB 3TM6A 1MIEL 2EDFA 5T1LD 3CZJA 3PNWB 4R7DA 4L4VE 4GKNA 2N1KA 1MREL 4YZFF 4ZUTB 1PGRB 1YPZA 5DQ9B 1CGYA 2HH0L 5AWNH 1Q9WA 2OP4H 4HK3N 4B5EA 4XMLH 1QLRA 3ULSA 5C9KA 1KFAH 4L8BA 4KZEL 2YPKA 1DBKL 1FG2B 5CZXD 1WT5A 2V5RA 1CTNA 1UWXH 3IAPA 1A7BA 5DWUL 1BAFL 2E5EA 1XZ0B 4GJTB 3CK0L 5GRWA 1A4JB 5J11B 2Y6SD 5ANMA 2OR9H 4P5KA 3ULVE 2Y6SC 4Y5XA 1EVTC 1LO2L 3WUZA 4HWEL 5E56A 4YDKH 3MLRH 3TIEB 1G7LB 3S37X 1YEDB 3ARSA 1PKQE 5F3HA 3LEYL 2AK1H 4HFUL 1DL7H 5BRZA 3WIFB 1VERA 2IFFL 3LH2L 4HLJA 4XXCA 2X9XA 3BKMH 5CP7B 1KN2L 5TGBB 3VGHA 1CD1A 3DUSA 4HF5L 5H94A 4ZS7L 4I0PB 3D25B 5DHXB 4OJFH 1D5IL 1OF2A 2JJTC 3DX9A 4NO5A 3TJHC 4MNQB 2N7AA 1JGDA 1NBZA 2GY7B 3GZKA 1AGBA 1PLGH 4PB0H 1FZKB 5E2WL 1R3HA 4HHAB 3CFKB 2DB8A 5J6GA 4MA7L 1MRFH 4BFGA 4JY5H 4YPGB 4IJ3B 1FYTE 3H6JA 2WM0A 3TNMA 2HVKA 3BT2H 4UTBH 4JVUA 4DUXA 2IG2H 4ZUUB 1E4XL 4K3DL 5SWQA 1TPXB 4O58H 1NJ9A 3VRLE 1VADB 3MLVL 5ESAB 4OF3A 4LSSL 1G9NH 1UJTA 4JGJA 4U0RB 2FEDD 2P8LA 2XXMB 1B6UA 3AFLA 3V5HA 2VLJD 4YHPA 1IKFL 4JREC 5K9OA 2NNAA 3TBTB 4XHJD 5IJVA 4XHJC 2IF7A 4HUVB 4U1IA 3MYJB 3OB0K 5KSBE 4M5ZL 1GZPA 1YMHB 5C07A 4X9GA 3EOTL 1KEGH 4HBCL 4F33B 2VDPH 5C0FA 1FFQA 3PIQA 1KXVC 2KZ1B 4JFHE 4AZ8A 1HHJA 1N3NA 4ZQKB 2HFTA 2GT9B 3IS0X 4XVJL 5D7KE 5J1AB 4I1NB 3KPQB 5KN5A 4X6FB 5BVPH 1A6VL 4CVXA 3CFEA 1LGVA 1S7RA 5E6ZA 1OGTB 1DZBA 3SDYH 5FOBB 2DD8H 1RULH 4JFPA 3RWCB 3GSQA 2IBGA 3C6LA 3G5VA 3GBML 4S1SH 3ORJA 1J8KA 2DBJA 3UCRA 3M17B 4JRYA 4JM2D 3TBYA 5MHSE 4JM2C 4MAYB 4CKVX 5EUOB 5FUCC 1QSED 1X6NA 1A4KB 2AXJA 2DQDH 4MJ6B 1FL3B 2BNUA 1JRHH 6FABH 2F53D 1OSPH 5TJWK 5BVJB 1DBML 3MCLL 2E7BA 4P2RA 2ZG3A 1MVUB 4OB5L 3KNBA 4L3CA 3H9YA 4PRPD 4JVWA 1A6AA 2MFNA 1DE4B 1I9EA 4XCFL 5DD0L 2XWBA 1DQML 2BX5A 1LO0L 4HUWA 4X5WA 4R26H 5IMLB 4K23H 4UB0H 1G9NC 3FB5B 1TIUA 3DVIA 2CPCA 3HC4L 2H1PH 4LVNC 2J8HA 4R0LC 5EO9A 1IMHC 4S1RL 3UYOD 2A38A 3VFGH 3FFDB 4Y2DA 5EORH 3Q6FA 3LEVL 4Z77B 2YSSB 2HRPL 3C5ZD 5C0ND 1I1RA 1A7PH 4NIKB 2ADIA 3BDXA 3CZFA 4M6OH 3IFNH 2FDBP 4FXLA 5FO7B 3G6AB 2H2PC 2Y5TA 3UROR 4ENED 2FEEL 2VXTL 1CGVA 3LV3B 3SDAD 4R4FL 1YEHH 5BOPA 1KB5L 4XPTL 5I74B 5IBUB 3V6OA 1YEGH 4ONGL 2UWEF 1KCUH 3GSWB 2AKRB 3VRJB 4L3ED 1RSFA 1G84A 4QHNA 4FNLH 5SWSB 1AIFA 3H42H 2BNQD 2BVPA 4AENB 1MCLA 3HNTH 3P0YH 3FO9B 4K7PL 1T0PB 4KJQD 3VW3H 3LCYA 4UV4L 4FXKB 4XBEL 2BJML 3HS0B 1J8HE 4RDQG 3GSOA 4CU8A 5MEPA 4DW2H 3HC0A 4P46D 3O9WA 4YHMH 4P46C 5JNYB 3SBWA 4LCWB 1IGCH 2HFEA 2QSTA 1YECH 1I75A 3FZUD 4G6FD 5FM8A 1UACH 2DLGA 4JPKL 4JQXA 1MI5D 1VGEL 3MNWA 2ARWA 4WTWA 4LCCA 5DJ0A 5EB9A 1DFBL 2VN4A 5C6WH 2KKQA 4QOKD 3O6KL 5D7IE 1AR1D 4WIQA 3WJLC 5EBLB 4PGZA 5JQHC 3ZLQC 4XT1C 4YDJB 4POUB 5JHLL 3KXFB 2EYSB 5LWYH 4X6EA 4GAFB 5DEGA 2PTUA 4PJDF 2O5XL 3UTPE 1YEFH 4XAKE 3UX9B 4NP4L 3BKJH 4R7NB 4E0RB 2EDNA 3TZVA 4R2GD 4DGIH 1ZA6A 2AS5M 3KJ6L 2RHEA 1D7FA 1P7KB 5DRZB 2RCSH 3LY6A 5MP6L 3VG0L 1OD7A 1INDL 5AG9A 3FFCB 2D31B 3STLB 2UZIH 1NEZA 1NGZA 2VTFA 3D3VB 4HUUA 3S37H 5HHXL 5J4MA 5GRJL 1YNKH 5IVXA 1BAFH 2J4WH 1JNNH 2I07A 3EGSA 1Y6MR 5DQJB 2CIKB 2JJUA 2LQRA 1GGBL 1QTYT 2ARJB 4XC3L 1NGYB 3TO4D 5I8KL 2R0KH 5ETUA 2WUBH 3CDGA 5I8CB 5C92A 1LEIA 3OKOB 2BVEA 4RIRA 4TPRL 1KV3A 2F74A 4WI6A 1XMWA 3FQTB 5BS0D 2C3GA 4PJBF 1QBLL 1FDLH 5IBTL 3U48A 3SCMD 4L9LB 4YPJA 3Q6GL 3SCMC 4QRTB 5CIPA 1MHEB 2V2WB 1CF8H 4JZJB 1X5FA 4FQQA 4W68A 3KLHD 1G6RH 4C56A 3RBSA 5E08L 3KLHC 3BIAX 3AROA 4G8FB 4HWUA 4PRIB 2GJ6B 1NBQA 3T0EC 4JPIB 3O8XA 3IVKB 4I2XB 4ORZC 3KLAB 5AG8A 1YUHB 1LP9B 5CEYB 4O5LH 1QVOB 4HS8H 3QWOA 4F7PA 1D6EB 2IAND 3V4PH 5KS9E 4Y4FB 1R3LA 4BELD 2D7PA 2VB5A 4LLWA 1DN0A 5KVGH 5JR1L 5KVEL 3PNWA 2HKHL 3IAQA 5FHBL 3MJ7B 4O9HL 4HPOH 4M00A 5FB8B 4ZUTA 2DQIL 5DQ9A 5IMOB 4C58B 4G9FD 1H3GA 1OAUL 2NCMA 1E0OB 2ZZUT 3MRFB 1KYOJ 5IJKC 3ARED 1QSFB 2BVOB 2VXVL 3KYNB 5IWLA 1BFOB 5IROC 3EOTH 2UZYB 3JXAA 1FG2A 1C1EH 2ZUQC 1FVCB 3O0RL 1URLA 4ZPVB 3D9AH 1CD8A 4XVJH 3TPKA 4S0TD 1XZ0A 1JNJA 3BGMB 1A4JA 1MF2H 4P48A 5B4MC 1CIDA 2VC2H 4JG0H 4P57B 2NYYD 4PJCB 2GSGB 3FHQA 3TIEA 3I3DA 4J6RL 1G7LA 4Y8AA 1YEDA 2ZNXA 4PJFE 3ULVF 4HXAH 3HCVB 1CL7L 5BO1L 3IU4L 4NO2B 5CP7A 4ZMAT 3L6FB 5HI5C 4JDTL 2VMFA 4X4ME 5TGBA 4DKEH 1IAIH 4XZUB 4I0PA 4J3XA 3D25A 5EN2B 1WT5C 2OTPA 4YHLH 4YHOL 4MJ2A 3UBXG 2Y36L 1ZLUK 2BOBB 3VXPB 3DVNB 1C5BH 2OMNA 1UCTA 4YR6B 3BD5A 3PWPB 1FZKA 1LO0H 2C7UB 4HHAA 3CFKA 4Y5XC 4RRPA 4YPGA 3NGBC 4D9LL 4UBDC 1N0XL 4X6DB 35C8L 1RUPH 3JWDH 4ZUUA 4H1LG 1NMCC 5LCVH 3ZTNL 3T1FB 1MQ8A 2BSRB 4XXCC 4XPFH 1I8LA 1VADA 4DK3A 3TT1L 5HI3D 2EIDA 2R0ZL 4OLVH 5HI3C 3A67L 3FTGB 4NO3A 3MV7E 1ZLVK 4ZFGL 1X5ZA 1YN7B 2ZUSA 4WUUB 3VRLF 1MHPL 4A2LA 3U7WH 4KI5E 3QUZB 3RUGE 3THML 3MZGB 2PR4L 2YUWA 4U3CA 3VH8G 2XN9D 3TBTA 4HUVA 3MYJA 3NFSL 4I77L 1YMHA 1JCKA 4ZFZB 4F33A 1KLFA 5CS7A 3W39B 1FAIH 5TQ2H 4ZQKA 2H9GB 5IGXH 4JFFB 3MYZA 2GT9A 2R9HD 2X05A 5KSBF 5HI4D 2R9HC 5HI4C 5J1AA 2C3WA 4BQ8A 4KMTH 3KPQA 3DV4B 4X6FA 1I7ZB 4PY8I 3V52H 3SDDB 1OGTA 4ETQA 5C6TH 5FOBA 4M7KH 5E9DD 5L6YL 1CXEA 4LKCB 1VGKB 2Q86B 3RWCA 1S7SB 1IC7L 2ICCA 4CVUA 3M17A 4YHNB 1CBVL 1RFDL 4MAYA 5EUOA 3JV4B 4G3YH 1Y6NR 1CWVA 1A4KA 4QTIH 4HXBH 4MJ6A 1FL3A 3VXMD 5DUML 5LXGL 4JPKH 4M6MH 3VI3E 1JGLH 4OZHB 1MVUA 5DRXB 1G9EA 1P69B 1SJEA 1BWMA 4FFZL 3C8KB 5DDHB 4YBLB 1DE4A 1ACYH 2X1WL 3RL2A 2DTSA 3JWDC 2R4SL 5KJRL 4LAJH 1BECA 1F00I 3P9MB 4TYUA 3SE4A 4KQ4L 5IMLA 2WSKA 4PYGA 4O02H 3C6LD 3FB5A 2VDRH 3C6LC 3CAFA 4OF6A 4JRYD 3KJ6H 5C0GB 3O4LB 3FFDA 4L8DB 1ED3B 1JK8B 2P5WE 4Z77A 1P53A 2YSSA 1J0HA 5CWSB 4CDHA 4ODSL 1F4AA 2CDFB 5FO7A 3G6AA 3GNML 4MQ7B 4RFNB 1J11A 5FA4B 3VRIB 4CJ1A 2IMMA 3PHOB 4OBRA 4OF8A 2H3NB 1UEMA 1QSZA 3LV3A 4FQLL 3TEUA 4FQCH 3WO3B 2O61B 3GSWA 2AKRA 3VRJA 5F9DC 5GJSH 4L5FH 2Z8SA 2ZCHL 4RWHA 5SWSA 4AENA 5IFHL 5M94B 3FO9A 1W72L 5CCKH 4FXKA 1OP5H 2APWA 4JHWH 3K2MC 4HGKC 3HS0A 4FQXB 4Y2DC 2ERJB 4KU1A 4ZD3L 2BNRB 1CU4H 5JNYA 4Z78B 1MCPL 4LCWA 1VEPA 2XI9A 4YHYB 5E08H 1KUMA 3KJ4B 3WIHA 4QCIB 3BE1H 1F58L 3I3EA 1MCOL 1CFNB 1JYXA 3V6OC 1OARL 3U36B 1K6QL 1WLHA 1ORSB 2VDLH 2JCCE 4PJEE 5EBLA 5HYJD 3ARFB 4YDJA 1I3VA 3KXFA 4H5SB 5D7IF 2EYSA 5J89A 5IQ7H 2VSCA 3IKCB 5DZLA 3O9WC 1ZHKB 4E0RA 1R3IL 1CGXA 1INEL 2JKXA 1UXSB 3SBWC 3U9PL 1P7KA 3MJ9A 2XWJB 5DRZA 3ZMRA 2VERN 1QSEE 3FFCA 2D31A 4P2OD 1OAYH 1J0YA 3STLA 1CXIA 3QUML 5KOMC 2J6EL 4JQXC 2QQQA 1VHPA 3D3VA 5AUMB 3RA7L 5I66B 2EXYD 2Z8RA 2F53E 2EXYC 4RMRA 3WIHL 4DGVL 3U83A 1TZGH 2D2OA 3L3DB 3V0AC 5F93C 1FG9C 2ZCLH 2FJFB 5DQJA 3PDOB 4NHCH 3S34L 1A22B 1NGYA 4U7KA 3CMGA 3L1OL 1L0QA 4K3HA 3OKOA 5HYFA 4LL9A 2MKLC 4JLRA 2WAHA 1L0XA 3FQTA 3JZ7A 2FB4H 5DJZB 4L9LA 1WTLA 1CQKA 3P0VH 4QRTA 3MJ9L 3MOAL 5TDNB 3ARPA 1MHEA 2V2WA 4JZJA 4YDLC 2X1OA 2VXQL 1IFHH 4G8FA 4M62L 4PRIA 1ZOXA 2GJ6A 2M2DA 4JPIA 2G2RB 4GG8B 3IVKA 1OCWL 4JN1L 3KLAA 4I5BB 1YUHA 2V5SA 4L3EE 1LP9A 5CEYA 1QVOA 5GGVL 1D6EA 5JIIA 3BP5B 3D39E 3H9SD 1NCNA 4RGMC 1NSNL 5AZEL 3BPOC 2VITB 3UDWA 5KS9F 3MJ7A 4NRYB 1MFAH 2VH5L 3IDYB 2J3SA 4NM4L 5FB8A 2HKFH 4DZBB 5IMOA 3JV5A 4Z7UB 5A16B 4DKAA 2NY4C 4Q97A 1L0YA 1JHTB 3MRFA 4KHXL 4Q0XH 1MCEA 1QSFA 2AEPH 2BVOA 4AL8L 5BOZG 3KYNA 5FF6B 1BFOA 1OGAE 4JPWH 4KY1H 4RISL 1FVCA 1MI5E 4QRRB 4WY7L 4ZPVA 5C2BL 3O8XC 1SHMA 2F8VA 4QKXB 2NXZD 5KTEH 2NXZC 2VDOL 4JPVH 1DLFL 4QOKE 3BGMA 3RHWK 1EJ6A 4XNYL 4HQQH 3QPQD 4P57A 3QPQC 4PJCA 1T2JA 4BYHA 4PG9B 3VMPA 3N1FC 4N0FB 4XNZB 3B5GA 3HCVA 1CBVH 2DBLH 4OCWL 1F4XL 2YEZB 3P77B 4NO2A 4KMQA 3NCEB 5DD6B 1ZGLB 3L6FA 4PJFF 2VLRB 2AAVA 4NQDB 2GUOA 4UT9L 5IOPB 4OGAD 5IWLC 4OGAC 2X4OB 4JO4L 1PSKL 1QUNA 5EN2A 2FHFA 4GS7B 2BOBA 4NNPH 3ARGB 3VXPA 3DVNA 2VLLB 1JN6B 4WFHD 4YR6A 2V2TB 3PWPA 5J11C 2R4SH 2C7UA 2GHWB 3U7YL 1IGYA 2LAAA 4W4OA 4KQ4H 3MLWL 1ZT4B 1WICA 2MOVA 3O3AB 1KTRL 4X6DA 4CN4A 5J6HB 4OZ4B 4FABH 1XFPA 4N9OB 5EO1B 4I13B 4R9HA 3T1FA 2BSRA 2H41A 1I9IL 1AGCB 1BD2B 3IF1A 2VL4A 4OKVB 3FTGA 1YN7A 4H20H 4NQCD 4XP5H 4AQOA 4NT6B 4WUUA 5BS0E 1C12B 1TTGA 4I0PC 4Q58C 5E99H 1W0WB 3QUZA 1UZ6E 1BLNB 4G8IB 2YD6A 4PB9H 4OTXL 3SE8L 4MNQD 1BOYA 5E4IA 4KI5F 3RUGF 5FHAH 4ZFZA 2BCKB 3W39A 4IJ3C 2H9GA 4MB5A 4JFFA 1BQHB 4TOYL 4M3JA 4DQOH 1PFCA 1TPXC 3DV4A 1CXHA 1I7ZA 2IANE 4XVTH 4UV7H 1I8LC 3SDDA 5DMYA 5E6ID 1EO7A 4LKCA 1VGKA 2Q86A 4U0RC 1S7SA 3F7PC 4YIQB 2D03L 4YHNA 3HE7D 1AE6L 3QXAA 3JV4A 1CDYA 2Y06L 2IPUK 5F7EL 1FNEB 4JRXD 3RIAK 4I3RL 5ELIA 2B1AH 5A2JH 4HIEB 4OZHA 1OW0A 4IEFB 5DRXA 5D2NE 4YXLH 5DDHA 3C8KA 3HPJB 3VI3F 1X4YA 4E41D 3FB8B 5I1IL 5CEXB 4MHHI 2YUZA 4OCYL 3ZHDA 3P9MA 2DQTL 1T21B 4R8WH 3U9UB 3ZHLA 2D7OA 3W2DH 2O93L 4GXVL 3FQXB 5EOCH 4RGOL 5C0GA 5HY9B 5FO8B 1R0AH 3O4LA 4MAYD 4OM0L 1KBGL 4MAYC 4LLMB 4L8DA 4LHUG 1ED3A 1JK8A 5FUOL 3QFJE 1LDSA 1EAPB 5I1DB 1CI5A 5CWSA 1KN4L 5J0BA 1EHLL 4IMLB 3HZMB 4DAGL 2OSLB 5FEBA 2CDFA 3IT8D 2DTMH 5I1EL 4MQ7A 1MFDH 3DYMA 2ZKHL 4ELMB 5HYQB 4DGVH 5FA4A 3VRIA 5I8OH 3PHOA 4ISVB 2H3NA 5DVOA 4XWOD 1WUNT 4XWOC 2J88H 3NTCL 1CFTB 2O61A 7FABH 1PG7X 1WZ1L 3SE4C 3F6LA 3QQ3B 4O2EB 1KENH 1MCCA 4CNIB 1NAMA 1FCGA 4FQXA 3MRDB 3N85H 2J12B 2BNRA 1UM4H 2OS7A 4CU6A 2Q7YB 4R3SB 4Z78A 3HG1E 3WO4B 3RNKB 2VDKL 5CP3A 1A47A 4PJ7E 3L5JA 1AFVL 3EHBC 1KJ2L 2VXQH 3FN0H 2I60L 2XN9E 1JYVA 4Y89A 2XWTB 1HWGB 2VXUL 1HCVA 3KLDA 4X8JB 5I74C 1CFNA 1G0DA 4HCRH 3VGAB 1RU9L 3U36A 1N4XH 1ORSA 5CHNB 5SWSD 3S5LG 2JELL 2AJ3A 2E8ZA 4DTGH 1BBJB 1J87A 4KKAC 3ARFA 4EJ1C 1MEXH 4H5SA 4Y8DC 2JCCF 4PJEF 1T20B 5D9SB 4LCIL 5C70A 3IKCA 1JPSL 3FQWB 1CZ8L 2JTDA 4XC1L 5E9DE 3K3QA 2VH5H 1UXSA 4KXZH 1Z3GH 2XWJA 2A6JB 3WNMA 1J9CT 1NAML 3ES6B 1IC4L 1SMAA 3NACL 1TLKA 2WWMD 5DURD 3VXME 4UQ3B 1MNUL 2BY2A 1DANT 2CK0L 5AUMA 5I66A 3RTQB 5DO2C 3RVTD 3RVTC 2EDLA 2AQ2A 1MJ8H 3L3DA 3T3ME 2FJFA 4POYA 1B90A 5CGTA 3PDOA 3PQYB 1CGWA 5AZ2L 5F70A 1EJOL 2R39A 3RGVB 5F96L 5IFJB 2XXCB 3MLYL 3K1DA 3WFDL 5E4EB 3L3HB 4ZS6D 4ZS6C 1A6WH 4UINL 5KSAA 3V79C 4OFDA 2UUDK 5DJZA 3D3VD 4G6ML 1UQSB 4NZTH 5TDNA 4LP5A 1I7RB 3CVIH 2VWEE 4NUGL 5DMIL 2HJKB 3WFHB 2YPLB 3K4DA 1LEGB 1RMFL 2NX5B 1A7QH 2ICES 4NC1E 3L5HA 1NFDB 4LHJB 4N0RA 3QUKB 4G80B 4Z7NE 3BGFB 1BM3L 2G2RA 2OCFD 2VAAB 3H3KA 4GG8A 3FKUS 2HTLD 4M5YH 1FNLA 4I5BA 5IB3B 2HTLC 1U93B 1MCWM 3QUYD 3VD9A 3U1SL 3QSKB 2QQNH 2DI9A 1HDMB 3BP5A 3EZ8A 5IIEB 3LSOB 4OLXL 2JE8A 4OZIE 3O45B 2FGWL 2QLVB 3HI1B 3SKMA 2VITA 2ZSVB 2PCPB 1BFTA 4HAGA 5GGVY 4L1DA 4NRYA 4L9LC 3I6GB 4DZBA 2CR6A 1YA5A 2NY3B 3ARQA 4JZJC 4MB4A 3AVEA 4Z7UA 3ARBB 5HJ3B 5A16A 3CSYB 1GGYA 1AD9B 1JHTA 3CJJA 4RAVB 2KBGA 5FF6A 1TNNA 1BQLH 4PRID 1FNSL 5GQBA 4QRRA 1QHOA 5DFTA 3BPCB 1ACZA 2E7MA 5HDQL 1ZHLB 1IGFL 4OSUL 4QRPB 4Y4FD 4OD3L 4Y4FC 2MQCA 5HYJE 4POZC 5I9QB 5GISH 4M4PA 2R2CA 4PG9A 2EYTB 2OJZL 5DHVA 3UDWC 4XB7A 4N0FA 4U31A 4LP4A 5DJ6A 4Z7WE 5DS8B 3NCYP 2YEZA 3P77A 4QXUL 4F7TB 5DD6A 1ZGLA 4XPHL 4XPBL 4IS6A 2VLRA 2Q20A 2D0HA 5CEZH 1SJHB 5I73C 4NQDA 1J0IA 1OTUC 5IOPA 2X4OA 2ORBL 3C6SB 3ARGA 4Z0XB 5LAXB 2VLLA 1JN6A 1IEAB 5D4QA 2V2TA 3Q5TA 2GCYB 3QFDB 4P59H 2PYFB 4PTUB 3IYLW 2R29H 2HJLB 2KZWA 1RZ8B 3GJFB 4G8EB 2DQTH 2CO6B 1ZT4A 3O3AA 5J6HA 2X1XR 3HZVB 5IV2B 1FLRL 4OZ4A 5EO1A 4U6VL 4Z8FL 4JO2L 2DM7A 3C5SB 4GLRI 5KBNC 1AGCA 1BD2A 4OKVA 1A7RL 5B8CA 5EZOL 5FUOH 3SOBH 1LDPL 2F19L 3QIWB 3SHSA 5CJOL 1WGOA 1KN4H 4KTDH 2EDQA 1QZ1A 4NT6A 4OV6F 1C12A 1PG7H 1O0VA 5D72L 5IVZB 4OLUH 1W0WA 2HMID 4NM8L 2HMIC 1A3RH 1BLNA 2Q8BL 5GGTH 2DJ4A 4G8IA 4ZNEA 5L2KE 1BZQK 2I25N 1G1YA 2YS4A 5I2IB 2DI7A 1UZ6F 5FKPB 3TT3L 2VLKB 3FO0H 2BCKA 1EA9C 4W4OC 2EC9U 1BQHA 1QRNB 3OJ2C 1I8MB 4HKJB 1SBSH 5HHOB 1U8MB 5FA3B 1Q9LB 4AY0A 4ERSH 4WFFD 1NCUA 3U7AA 4PP1D 3O4OB 3H9SE 4PP1C 5CEZD 1DBBL 3ULUH 1XIWD 4WUUD 3NCBB 3Q1SH 4YIQA 5CBEB 5B3NA 4S2SB 4CW1A 1FPTL 3QUZC 1RIHL 3KR3H 5C0CE 1FNEA 4FFVC 4WENB 1EERB 4OF5A 1FL6B 2Z4QB 3WD5L 3WNNA 3OPZH 4D3CL 3MOBL 3OKDB 4HIEA 3BEWB 3VFWB 5EUKB 1U8IA 4PRNB 3HPJA 3FB8A 4PV9B 5CEXA 1ZA3B 1JPST 1RIVL 2DRUA 4LU5L 4ODWB 3SDDC 2CRMA 2IQ9L 3MQIA 1KSRA 1T21A 3VXUB 2G60H 3MA7B 5DK3A 1WBYB 4PRHD 4KC3B 2XZZA 5HY9A 5FO8A 2DM4A 1TENA 4M48H 2HRLA 4LLMA 3MV9B 2DKUA 4WW2F 2WP3O 1HINL 1EAPA 5I1DA 3RU8H 1U92B 1FNGB 4IMLA 1X5KA 3HZMA 2MCG1 2OSLA 1J1XH 1OW0C 2X4PB 5JW4M 3RL1B 4ELMA 5HYQA 1X44A 4NZRL 3LKSB 4ISVA 5JMRA 4YBLC 2P5EB 2L7UA 4IMKA 1CFTA 5D7JB 3VXNB 3M8OL 1SYVB 3WL9A 2DKMA 5GZOD 1BJ1J 3QQ3A 1HSAB 1HE7A 5EOQH 4JQIL 1ZT1B 4QWWD 4O2EA 3ULUC 4QY8B 3LDBB 1K8DB 1DQLH 4CNIA 4U3XA 3CSGA 4AEHL 3D2UB 2X4NB 4EXPX 1VENA 3MV11 4XVUC 2Q7YA 4R3SA 3JV0A 4LIQE 3RNKA 4NQCE 1AGDB 4KKCD 4NN7B 4U2YA 4KKCC 4RFNC 4TNVF 3EFDL 3D0VA 3RQ3A 2XZCL 2XWTA 1MOEA 4PJ7F 4X8JA 3A6BL 2ZOKB 5TE7L 1LK2B 3CIQA 3L3GB 4U1LB 2R8SL 3GB7B 4A2MA 5CHNA 1BBJA 4EZMA 2BHZA 5IEHB 2YRZA 4FQXD 3S88L 4FQXC 5J3HD 3DX8B 1T20A 5D9SA 3BZEB 32C2B 2BNRD 2ERJC 2UYLB 3SQBA 3FQWA 3OAUL 3DYOA 1P4BL 1ES0B 2HFFB 4KZDL 2DICA 4TUKL 1E6OL 1PYWB 2A6JA 1ZWIB 3ES6A 1OPGL 4L1HA 4YWGL 3WFBH 4YHYC 2CMRH 1B4JL 4WDIB 2MCPL 3KJ4C 5FGCB 4YHZH 4JRXE 1U8HB 5F8RC 4UQ3A 3ZYIA 5CGYD 5K59E 1P9MA 3RTQA 2GFBB 5I1HH 1PZ5B 1NGXB 3EJYD 3FMGL 2A73A 5I1CL 2UWEB 4M1CD 3VWKB 4M1CC 4Z0BH 1IAIM 3ARFD 4E41E 3ARFC 4OD3H 4KKBD 4NC2B 3MUHL 2XRAH 3T3MF 1FFPB 5IFJA 4OZFB 5EOCJ 1A9BB 4WCYL 4L4TE 3T65B 2A2QT 4FFYH 4WRLA 2FIKA 5TPWL 1WVZA 4FQIL 3L3HA 4XPBH 1A3LL 4PTTB 1SY6L 1UQSA 1MCRA 1QSVA 5D5ME 2JB5L 4F37F 1I7RA 3TCXA 3X3GL 2HJKA 3RI5F 4KGLA 3WFHA 5JW3L 3GK8L 2YPLA 4KTEH 1LEGA 1BMGA 2NX5A 1NFDA 3QUKA 4G80A 2VAAA 1ITCA 3K1KC 4QRQA 4L9DA 5FUZL 4HJ0C 4QEGA 1ADQA 4PJDB 5T3ZE 4Z7NF 5T3XH 4MB3A 2PXYB 3PGFH 1HDMA 1JMXA 3AGVA 5IIEA 3LSOA 4U1GB 4OCNC 5DUPL 3HI1A 1H3TA 1OT1A 3GMPB 1YEKL 2DQJH 2PCPA 4F7EB 1H15B 4KK6D 3I6GA 3I2CL 4OZIF 2Q8BH 2AQ3A 3HMWH 3QDMB 2EDBA 5HJ3A 3S3PA 1OHQA 3CSYA 1AD9A 4XP9H 4FN0A 3P40A 2GEEA 2EKSB 2DYPD 5C8JB 2R56H 2NR6D 3BPCA 5JDSB 1K5NB 2BC4B 4BKLB 3QH3B 1Q94B 4WV1B 4FFWC 3U4BL 1U8PB 1UVQB 2YXMA 5CBAB 1ZHLA 2CXKA 5IP4A 1RJCA 4QRPA 1A0QH 2KUTA 1NMAL 3PHQA 2ZOLB