3GBNH

Crystal structure of fab cr6261 in complex with the 1918 h1n1 influenza virus hemagglutinin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
187
structure length
160
Chain Sequence
EVQLVESGAEVKKPGSSVKVSCKASGGPFRSYAISWVRQAPGQGPEWMGGIIPIFGTTKYAPKFQGRVTITADDFAGTVYMELSSLRSEDTAMYYCAKHMGYQVRETMDVWGKGTTVTVSSASTKGPSVFPLGCLVKDYFPEPVTTFPAVLQSSGLYSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antibody recognition of a highly conserved influenza virus epitope.
pubmed doi rcsb
source organism Influenza a virus (a/brevig mission/1/1918(h1n1))
molecule tags Viral protein/immune system
molecule keywords Hemagglutinin
total genus 28
structure length 160
sequence length 187
ec nomenclature
pdb deposition date 2009-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gbnH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gbnH02
2B39A 2OCFD 1WBZB 3FHQA 3UTPD 2Y1VA 1QG3A 1FVCB 5ICZB 4DOHB 1OP9A 2XZCH 3GSXB 4LRNL 1XF5B 4X7TB 4XVUC 1JZ6A 3BRFA 2BNRA 4R26H 3RQ3A 1BVKB 4CBPA 3ZYZA 4OGAD 4ZS6C 1N8ZA 5EBGA 4JZOA 2QKIA 3NA9L 4ODWA 1FNGB 3LKNA 5I0DA 3U48A 5D2LF 4JQIL 3LEVH 3IKCB 5D7LB 2ZSWB 4H20H 4TNWF 5HHMB 2EKSA 3N1QC 5HDQL 1MREH 2HFEA 2LVCA 2UY7A 3RP1A 3EO0A 3FFCE 4M5YH 2HT2D 1UXSA 3S5LB 4F3FA 3QDME 1YYML 3IFOA 3SY0A 4M61A 1RZIB 4OKDA 4IDJL 4UIMB 1ZAGA 1YPZA 1VEMA 4JY4B 3QNXA 2V9TA 3ZDZE 3KGRA 1F6AA 3C6SB 3DETC 3F7VB 1RZJH 5C8JB 4U6TA 5GISL 1D5XA 1IM3A 5FECB 4QRTB 3EIFA 1QRNA 4ERSH 5DD0H 1Q9LB 3VW3H 3OGCA 2BNQA 4WGWB 2XACC 5HYJB 1WFOA 3RI5F 5KVGH 3E6FA 1ZHBA 2EE2A 5IQ7L 3RVTC 2DLIA 5TDNB 3PWJB 4NFBA 4Q2ZB 1QLEH 2FEEI 2FL5B 1R3IL 4ETYA 2VH5L 5BZDA 3BFOA 4WW2F 3CSGA 3KDMB 3G6JE 1U8IB 1G6RA 2EZ0D 5KSVA 3H3KA 3EOTL 4F33A 4JDVA 4TSAH 1PZ5A 1QOKA 3I9GL 2XXCB 4HLZG 4K7PY 4OI9A 5FEBA 2XWTB 1IGFH 3QO1A 1ZA6A 4PD4J 1M6OB 4UIMA 4QT5B 4IOIB 3SDAB 3N1PC 1CD8A 1T21A 3UTZB 1S9YB 4J4PD 5DD5L 3VD4A 4PRPE 4JPWH 4MA8H 5CEZH 1MCFA 3LIZL 4BJLA 4PJCE 1X9QA 1QBMH 3C5ZC 4JRWA 5GZND 3G6JF 3RL2A 4YFEA 3G08A 3U4AA 1QEWA 3QUYC 3BO8A 3A67L 3C6LA 3BT2L 5I75B 4ONOA 2EDWA 3L3HB 5BS0E 5DMKA 2CJUL 3RWJA 4LHUA 4PV8A 2O5XL 4IS6B 1PX4A 1CFQA 3LHPH 4ZSOA 1SYVB 4IEFB 4HUMB 2BDNL 5D1QD 2SEBA 2EEAA 4OD1H 1JZ5A 4L5FH 3MRLA 5IWLA 1U8HA 3T2NL 3VU2A 4RGOH 1XIWA 1PSKL 2HWZL 4XBEL 4UOW0 2ZUXA 5D1QC 5C09E 4LLDB 2AEPL 3QBTB 1TENA 3AMKA 1KCRH 4ZO7A 1IM9B 2AJ3B 2DLHA 1JZ2A 3FQWB 4R26L 3H7BB 4UB0H 4QRPD 1FHGA 4UB0L 2A77L 1KJ3H 1PKQE 4G7YH 1B0WA 3BN3B 3PV6B 5F6HJ 3OKDB 4IRZL 3RX7A 1OAKH 3B2VL 4Y7MA 5C6TH 3FOMB 2ATPA 4MXVF 4ZO6A 4POYA 3N0PB 4Y4KC 4NZRH 4D9QE 4G6MH 1CXEA 1FNLA 4WFGD 4R7NB 3S7GA 5KSBE 4AIXA 4M9OA 1DN0B 1G9NH 4I0PB 3GGWA 1QLRA 3PV7A 3VXTA 4FQHA 4Z7WE 1P53A 4U6YB 2GY5A 2DIJA 5T5NG 2EIDA 2YSSA 3I2CL 1M7DA 2JJTA 1C5DB 2WQRA 4AEIH 2A9NH 1XGRA 3F62A 3K4ZA 3PP4H 3C2AH 3U0TB 4ZS7H 3HZVA 4BM7A 1NDMA 3MFFB 4JE4B 4HG4J 4L8DA 1GOFA 5DR5H 4JG1L 1CDUA 2DLEA 2LV4A 4JO4L 3NH7L 1UWEL 1A6TB 1C5CL 1TITA 4Y8AA 5DC0A 1FL3B 1YMHA 1NH6A 2H8PA 3SKJL 2PXYC 1MEXL 5IHZA 5GRJL 4Q9QL 1CGWA 3K4AA 2ZKHL 1BOYA 4XCFL 4HPYH 5D96B 4LASH 5TF1L 4NC1E 3GBML 5FF6A 3OB0H 4LLQA 3MCKB 2VXUH 4MAYB 4OM0H 4OCWH 1EHXA 1KC5L 1NFDF 4OCXH 3N9GH 5J12B 3RFZC 1DN2A 4I0KA 3TV3H 2OK0H 1HILB 4LNVA 2XOTA 3LEXA 3G08B 2G60H 1QEWB 1J1PL 4LSPH 1AXTL 1YNLH 3NFSH 1UJTA 3JWDC 2YRPA 3DI2B 1BGXL 5C0AB 1T2QL 3MNWA 4Y16A 1AGDA 1XH3A 3G5ZB 2HH0L 3QUZC 3U79A 4NBYB 4JFFE 4OV5B 2Z31D 1RU9L 4FQ1H 1RMFL 3MRJB 1A6PA 4G42A 1BVZA 4KTEL 4RQQB 2WAHA 1KCVH 5TGBB 3SOBH 1GOGA 3ARED 3ARUA 4DVBA 1XEDA 3O6MH 3QISA 4DQOL 3DARA 2P5WA 4JO1H 4FQXA 4U1HA 1KF9B 1C12A 1FJ1A 3MBEB 4QHLB 2VISB 4LSSL 5CD3A 3VXQB 3LKSA 1ADQL 2ZCHL 5B38B 1NEZA 1JGDA 2YPKB 1QVOA 5LGJA 1C1EL 3CNKA 2HN7A 5GGRA 1OM3L 1I7TB 3FQWA 4RIRB 3GBNH 1Y6MR 4NNXB 3L3DB 5CP7A 3RGHA 3TP4A 2A1WH 1P4LB 1JGUH 1R6VA 4XCEA 3ARSA 5ALBH 3EYOB 4GW5B 2P1YA 2EDHA 2I9LB 1U3YA 5CJOL 3PABA 3QCUH 1FAIL 1RZ8A 4PJGB 3DGCR 3L3GB 5EA0L 3EOBA 4XVTH 5GJTH 3QZWA 1S9XA 1ZTXL 3IDIB 5CWSB 5E6IA 3ZYJA 1UWGH 5EUOB 4J4PA 4PRPB 2C3GA 2KDGA 1HOCB 5DJ0A 3GM8A 3CC5A 2W59A 2A0LD 5FYKE 3V5KB 5DHYA 2BVOB 1XGRB 3OXRA 4QXTA 5E8NA 5BS0D 1T1YA 5IV2B 5GGQL 3KNBA 4M7ZB 5DURB 2JIXA 4Q0XH 5IW1B 1CFSA 3F65A 1IEAB 5IB5B 1CLYL 5IESL 5F7FA 2A6JB 5HI4C 2FBJL 5GRUL 2OSLB 1T7ZA 1GZPA 3QDJE 4H1LG 4DOHE 1E0OB 1FL3A 2MCG1 4OM1L 2BNQD 4QF1A 2W9LA 4NO2B 4KKAD 1G84A 1UC6A 1UQSA 4NFDA 4QRPE 3TNNA 4PJHE 4F3FB 1MAML 4J7RA 3NZHH 4Q9QH 3QUZA 5I76B 1FDLL 4EN3A 1NKRA 1UZ8B 1IARB 3LMJH 2YPLD 4XBPA 1LE9B 3RWHB 2QLVB 4HIJB 3CH8A 2RAMA 3KPLB 4JZJC 2HAZA 3LS4H 1U3HC 3SGJA 4HK0A 4BUHA 3PHQB 1U8KB 3IDXH 2A74B 3VXMD 3WNKA 3HUJF 4MA3B 4MJIE 3QSKB 4PJEB 4WTZG 1BX2B 4R8WL 3NFNB 1MJUH 1YC7A 1PBYA 3L3IB 2OTWA 4P9ML 3IXTB 5TQ0L 1DQDH 1EJ6A 5IB2B 1YECH 4LSRH 1KB5A 4ZOCA 3H0TA 2C3WA 4MQ7A 4ORGB 4RZCB 3SKMB 4PUBL 2IG2L 2XI9A 3TO4A 1DQJA 1P9MC 2EH8H 3VFRA 5ID1B 1HSBA 3EAKA 5GZOC 5D4QA 1TJHH 3S96B 1KCVL 1XCTA 3SOBL 1FPTL 2FD6L 3D2UD 2CK2A 4YDIL 1RJZB 1MPAL 2FX7L 2R2EB 4OQTH 4XMLL 1Q1JH 3UTTD 1HQRA 1BQUA 2ORBL 3WUWG 5BRZA 2MHAB 2VDPL 3VRJB 2GSIA 1EUTA 5FA4B 4O58H 1S7VA 3HMXH 4MD4A 2AEIT 4PJ8C 1YMME 4RRPA 4DGYL 3L3DA 5M7QA 3LB6D 4J3VA 3QEQB 3QXDB 4ZMAT 4Q6IC 1P7QD 2X05A 3H9SD 3HRZA 2EDTA 5TQ2L 5ID0A 3TCXA 1OL0A 4N9GA 1KJ2A 3ZL4L 1A9EA 4PREB 4ZXBC 4FTVE 4MWFB 3HG1A 2IADA 3RVXC 4ELKA 1CL7H 2R2CA 2O61A 1S7TA 3NAAL 2EDFA 1CLOL 1UENA 2D0FA 1UA6L 4P2OC 3VI3F 4Y2DA 4KJYA 4P46B 1JK8A 5DS8A 3HRPA 2FNBA 4LAQH 1YEEL 3SDDA 1X44A 3S88H 3AY4C 5DA4A 1T6VN 3BWAA 3S88L 2YK1L 2GTZB 4PRNB 1U8HB 4IMKC 3B9EA 4HIIA 4S1SH 4U6HA 1GGYA 1NCBL 2XZQH 2F8XC 5HTSA 4FQJH 4LKXA 5HGDA 1AD9B 4O5LH 3DSFH 4HWZB 5F1SA 1CK0H 2NY2B 4M7JH 1FRGH 2Y72A 2ESVE 4DKEL 4L9LB 3OAZH 1HXYB 1IJ9A 5ADOH 1VERA 5EU6B 2F5BH 2CH8A 3MV9A 2IFFL 3KYAA 4I3RH 2EKJA 2E7LC 1HZHH 3KR3H 1LGVA 2AV1A 2YZ1A 3NIFF 1TPXC 4G8EA 4LLVB 5JNYA 3QXUA 5FO9B 4Z0XA 1ZT1B 1OOAA 2W07A 2W0PA 3LPFA 2EO1A 3VXTB 2C4FT 5C3TA 3BUYA 4HGKC 1A3LL 2P46B 1KBGL 4OKVA 4XNZB 5DRZB 3G6AB 1QBLH 3LOWA 2Z93A 1WZKA 5HYQA 4TRPL 2BHUA 4ODBD 4RSVA 4MAYD 2UVFA 4OZ4B 3WUZA 4YHNB 4OJFH 3UX9B 5J4MA 4ZXBD 2CMRH 3GSRA 2CUMA 1T4KB 1BWMA 4UV4L 4BZ1H 3HCVA 3UAJC 4KHXL 4WUUE 4CU6A 4OLVL 4EDWL 3ESVF 4PGDB 3SE4A 4W4OA 4OZHA 1PKOA 4GRLC 4YXHH 4Q58C 4Q9CA 5EZOL 1T20B 4NZUH 1FFPA 5CBAA 5EZOH 4KMTL 4LDLB 3BHBA 1A6WL 4KJWC 4HHAA 3TPUB 1DBML 3VXUD 1QLFB 5ABDE 2ZJSH 4NQXB 1CDGA 5D7IA 2QQKH 4ONGH 3F5WA 2Z91A 1MCOL 5F71A 4F33B 2YWYA 1TZHB 3PWLA 4XRCB 4YDKL 1BFVL 2ERJC 4P2OA 5IFAL 1YY8A 3WNMA 2BXYA 1TJGH 3HC4H 2A9ML 2V7HA 5IW6A 5E6YA 3QWOB 3QA3A 2XY1A 5I1AA 4HZAA 3MLSH 4U1KA 2HKFH 3TIEB 5DJCA 1MCDA 1A4JB 4CJ0A 3VDBA 4Z8FH 3V0AC 5FGCE 3MZTA 4ODUB 3DV6B 4TTDC 3R0NA 3O3BB 2ADFH 5TDOB 4BZYA 1EJOH 4JQXA 4K3JL 2OP4L 3SO3B 5J11C 1UA6H 3BIKB 4OF0A 8FABB 3IDYB 2ZCKL 3V4PH 5IGXL 3R1GL 2KPNA 1KJMB 2DRUA 3HZYB 4L5FL 4ZUVB 3C87A 4DCQA 3KHOA 2ERJB 2VDNL 2X1XR 4NSKB 5BO1L 1J8HB 3L1OH 1NC4D 2VAAA 4L4VD 4JFZH 1SMOA 3LN5A 1FNEA 3QUML 3L5WB 3PGDA 2HP4A 3P73B 1MCCA 4BQ6A 1LHZA 3QIUD 4FQLL 5E5MA 3Q6GH 4PV9A 4UU9B 1U6AL 1AQDA 2IAMC 3EW3B 1N59B 2PYEA 5T3XE 4DKEH 1K6QL 4KXZI 2I9LA 3MBXH 3WIIL 4I48A 3N85L 1OP3K 3GFUA 3AGVA 2DQFA 2XIDA 3TEUA 4FQCL 1A6VL 2A0LC 3V9FA 3KYNA 3IDYC 3EO9H 4KUCF 2IJ0C 4LVNC 4YZFE 4P2QD 1ZA3A 4NO5B 3KWWA 3KPTA 1BEYH 5BV7H 1JTTA 5MP6L 3JV5A 4BQ9A 2JCCA 3ULUD 4XVJL 5KSAD 1NAMA 2GJ6B 2GSGB 1FZMA 3NCFB 4QRRA 3GSOB 4EI5C 4ERSL 3FB5B 3ARPA 3GIVB 3NA4A 4JFEB 3DXAE 4M3KB 3TN0A 4WI4A 25C8H 3NBNA 4YZFF 4XBGB 3LN5B 4PYGA 2R15A 5FYJD 3RZWA 4JFYB 4WTXA 4P5TA 4HH9B 5JUEH 5F6IB 3S34L 3DOSA 5CIPB 1S8DA 1UQSB 3TO4C 4KMTH 1OAXL 3STZA 3F5WB 4HXBH 1A1MA 2C3XA 4EQ3A 1AR1C 1HWHB 5K9QI 4PB9H 9CGTA 1IAKB 3FB8A 1N2RB 1QSVA 4HKJA 4LAJH 5IIEA 4LLQB 3FQTA 3DMMA 2VMFA 1T0MA 1I7RB 2YSSB 3QHZH 2OJEB 5ESAB 3HMWL 6CGTA 1JUFA 1U8NA 3C8HA 5L2KA 2NR6C 3JV4B 4P9HL 1DP0A 4ZSOE 4KKLC 4WEBL 2NCMA 3HE6B 4F7EB 1UM4L 1KB5B 5FDYA 3S37H 1A0QL 3WD5H 3RPIB 1K4DA 1OT1A 2W9EL 2BOBA 5HHMD 4YPJA 2UWEE 4EXKA 4YK4B 2NY3D 2R1YB 2IPKA 5TE6H 5I73C 4BFBD 4P5KA 3GHEL 4OCSH 1BVLB 1VPOL 4X80H 5DJ2A 3MLYL 4OD2B 1NC4B 2J12B 5CGTA 3VXSD 2CUIA 2ENSA 2MHAA 2R2HB 5DRNB 2QTEA 3GB7B 4RFOH 5DUBB 1KN2L 4M8QA 3CSYA 1LDPL 2OQJB 4JDTH 1P4BL 3CLFH 4LGRB 3STLA 3QCVL 3GBLA 1RUAL 5BW7A 1MELA 5FYLE 2DL9A 4ODXA 4Z7WA 3UDWA 4XZUA 1S7SB 5DK3A 2CRYA 1ACYL 5D7KE 2G60L 3U36B 3QFDB 3BKCL 3HUJB 1OW0A 5DK2A 3BH9A 3N85H 4PRAA 3ILPB 5F88B 3G5ZA 1JTOA 4WEUD 5I30H 3BH8A 4FNLH 3A6OA 1ND0A 5EZJA 4FFWC 5B38G 3FRPA 2IBZY 5FKPA 1ZEAL 4NPYB 4L4TB 2RGSA 1WT5A 3QDHA 1KN4H 4BSVA 1K9TA 1FFOB 4QXTB 1LEGA 1NAML 2CGRH 4TVPH 2BJML 1FGNL 4N1EA 5DXWA 3D85B 4MX7A 4M93B 4PY8J 1ES0A 2DI8A 4XVJH 5T1DH 5CGMA 4LGSB 4X7EC 4LMQE 3NIGF 3FL7A 4U1GC 1ZKAA 3V8OA 2XQBL 4QGTA 5GGVY 4DTGH 4PGBA 3ZE2E 1CD0A 2R23B 1OTSC 5H94B 4EJ1C 1VEPA 1ITCA 3V79C 1SBBA 1FQ9C 5HI5C 3WL9A 1CYGA 2A1WL 1I8LC 4Q9BA 4XPBL 1AQKL 1KYOK 3WO4C 2A6IA 1ZLWK 1T7YA 4Z0BH 1NGWA 1J05A 2PUQT 1I9JH 4Y5VA 4F7TB 5F9OH 4HXBL 4H1LH 2VXQH 4QHNB 2R0KL 2VXQL 5I8OL 2YBRB 4FP8L 4HJGB 4ZNEE 1MCLA 1GGIH 5HJ3B 4KQ3L 2ADIB 5DRWB 3CC5B 4R4FL 1E4WH 1AXSB 3QHZL 1F4YL 1MJUL 4M1GH 4S10A 1ZGLB 1KFAH 4YHNA 4AEHH 2X4TB 1II4E 4PPTA 2WLZA 3EGSA 3QQ9C 5A43C 4WO4D 2C3HA 5LBSL 1WZLA 2P5WE 4E42A 4FG6C 4RWYL 4Y4HA 4MMXC 2FJHB 4OF8A 4LSPL 1DBBL 2F53B 5KSUB 3F12A 1MUJA 1ORQA 2LTQB 4WENB 2WBJD 3GZKA 4EN3C 4DZBB 3DO7B 4LCUA 4JGJA 1ZLUH 1BQHB 1BD2E 3LRHA 1FNGA 4JM2B 5DEZA 2RQ8A 1H0DA 3NABH 3BE1H 3MXWL 3QAZC 2XN9B 1HKLL 5DHVB 1P7KB 2EH7H 5JW4Q 2JJVA 1NGYB 2ED8A 4P23B 3H9HA 2DJ4A 2WNGA 3MRIA 1NMCC 1NBYB 2DQTL 3IFOB 4C59B 2QSTA 1PSKH 5GRWA 4X9FA 5JOFB 1U92A 2FGZA 3LD8C 4N5UA 1D5MB 1JFQL 3GSQA 4RFOL 1AY1L 1G7JA 1OSZA 3GMOA 4DZ8B 3PL6D 1X5FA 3L3OA 3U0WL 5E56A 2DJSA 2BNUB 2QBWA 4NC0B 5D7JA 2VAJA 1UH4A 5D8JL 4Y1AE 4B53A 3UPRB 1KIQA 4HMEA 4ZQKB 4LIQL 2QHRL 1Q9LA 4HWBL 4YR6B 1DFBL 5K59F 5E2UL 4XMPL 4HS3B 5L6YL 4Y2DB 3RA7L 3T08A 3LKOB 5BMFH 2EYTB 1JPGA 3RZCB 2X4NA 1JRHH 4KK6C 4WHYG 2EH8L 4BSVB 3TVMC 2GTWB 5CEYA 1NCAL 4FN0A 5E2VL 2HFGH 4GSDL 1C7TA 4Z7UA 5E2TL 1K2DA 1Z3GH 4PJFA 5IB3B 4KZEL 4FS0A 1VA9A 3O3AA 4PJ7B 2XT1B 4KRNA 4NQCA 1S7VB 2DBLH 5IVOA 1M6OA 3FT3A 3UPAA 1KXTB 1CF8L 3MBED 3MRLB 1EEQA 1Q0YL 4Z7VB 4ZUWB 2ICCA 5SWSE 4KVNH 4MVBC 2I60H 3KPMA 1JNJA 4Z7VF 3DX9A 3U6RA 1JGLL 3IDMB 2YN5A 4HC1H 3TBVB 1VFOA 2NTFB 3DWTA 4HC1L 4FA8A 1LE5A 1T66D 4PBVC 3RKDC 1RURH 1ITBB 4HWNA 4JHBA 3MRQB 3MLWL 2O61B 5BV7B 1MJ8L 4OF5A 3P11L 4C83B 3BJLA 1JF1B 4RAUA 3KYNB 3O9WC 5D1XA 2DLFH 5DJ8A 5CWSA 1EFXA 5DRWA 4MLIA 4NM8L 5CJBA 3VGFA 3MSPA 4X4MA 3ZYOA 1T1YB 3NIFE 2BK8A 2WP3T 2R1WA 4JPIA 5ITBL 5E08L 1Z0MA 1MLBB 2X4SB 1Z9LA 5KW9H 1AGFB 1OAUL 2AJVH 4OIIL 5E99L 4QEGA 3X14B 1HINH 3UTPE 5LWYL 1N6QL 2RFXA 4XP5H 2HG5B 4NCDA 2X40A 5I74C 5C08E 4L9LA 4XWOC 2D9QB 5AAMA 4HKXA 1X3DA 1KPUA 3RX5A 1X5AA 1D9KA 3ES6B 3HE7D 1YMMD 4K8RD 4V1DA 2AI0L 3NVQA 2DDQH 5JW4R 2H3NA 1OTUC 3HNVH 1OF2A 1CDYA 35C8H 1ZT7A 3HNVL 1EH9A 4G9DB 4PLKC 2YXFA 3I02A 4TUOB 5DJZB 4AEFA 4AY0A 3ARZA 5CP3A 4X6CB 1HHKB 4BQBA 3GMOB 4X6CF 3ALWA 5KSAB 3PNWB 5DDHB 1CG9A 5LAXB 4YXKL 4O2CB 4HK0B 3K8LA 5C71A 3FT2A 5FYJH 4LVHC 3MJ9A 4QKXB 1JPSH 1KELL 2FATH 5JPMB 1JHTB 3WXWH 3THMH 3K46A 1V3MA 1MLBA 4P4RB 3HZMA 4XPGH 4C56A 4KK5C 5JOEA 4CRPA 4GBXC 4ZPTB 2OTUA 3UBXB 5F1IA 5IFJB 1KV3A 4GXVH 4KZDL 4BUGA 3QFJE 4RAVA 3C8DA 3QH3B 2AXHA 4ZSOB 2G9HA 1R3IH 5F1NB 4G8GA 4YC2C 3RGVB 4GRWB 3IKCA 2IH1B 4LCCB 3QQ4A 1DDHB 3F58H 4KI1A 4XNQA 5CINH 1OSPH 1QSED 4XX1E 4CGTA 1U8OB 2L7JA 1XIWB 2IBZX 4U1IB 3NCMA 3RVWC 4ONGL 4JHWH 3RY5A 3N1FC 1QKZH 3B9AA 1KCUH 2EIZA 5FF6B 3VJ6B 1NEZB 3ARDD 3FCTA 3HLAA 3O3EB 3QNYB 4NN5B 3RGVD 4LVHB 3QUXD 1ZANH 4F15C 4NJ9L 4G3YL 4UU9A 4TNVF 3RBGA 3RWDA 1I1AD 2GCYA 2ICWJ 4WRLA 3WHXA 2VO5A 3RDTD 4BFEA 1UWXK 1CGTA 4RGMB 4XNUL 5JOPE 3I6KA 3IFLL 1HH6A 3DROB 1ZVYA 2MPAL 3QQ3B 4L3EB 1BM3L 4XPHH 1MJ8H 3VFTA 1BM3H 3MJ7A 4XPHL 3UBXA 4MJID 1MOEA 3CCHA 5JXEC 3UJJL 1P7QB 1G0YR 2EYRB 2VXTL 5KOVC 1I9RH 4OFDA 3EDKA 4PRPA 4JKLA 3V4VL 5IB1B 2P8PB 3GSWA 5J1AA 1E6OH 4HS8L 3TT3H 2V7NB 1PVHA 4L8BB 4JY5H 1VESA 4DAGH 1BBJA 2YPVH 2D31B 3M8OL 2RFXB 1JTPA 5K9QG 1I1RA 1R5WA 3HR5B 5KVDH 1U8QA 4PG9A 4YHOH 1FGVH 4AM0A 4GH7B 4YHOL 2IG2H 4JM2D 1ORSA 2DJUA 3RWEB 1S7RA 4K23L 4EVNB 1JP5A 4H1LB 5ANMA 5IHZB 4AIZB 4GG8B 4TSBH 1MFBH 5SV4A 4P2CG 3MLVH 1DBJH 3J7HA 3QZWG 3RWCA 1L7IH 3CX2A 5FM4A 4HPOL 2CKBB 1HHHB 1KNOA 5H35A 2J3SA 5KVEL 5C0DB 1XF4A 4RFNC 3VMNA 3AU1A 1TTFA 3RI5K 3DETD 3HS0A 3G5VA 5IVXE 4GKSA 2ADGB 3NACL 3OSKA 4M5YL 3JV4A 1AP2A 1RUKL 3U7WL 4UQ3A 2BNQB 1DZBA 3C60A 5E94B 2ARJA 4OD3H 3B4NA 3LZFL 5HHVL 5DR5L 3UZVB 1MFCL 3H8NA 2P7TB 1IE5A 2EXYD 4RX4A 3RPIA 2VLKA 2VDRH 3VD3A 3CMOL 3B9KA 3SCMA 5F8QC 4YE4H 2NXZD 4GXVL 3V6OE 1A6AB 1IGML 3VRIA 2H1PH 3KPRA 5E8DL 4LK4A 4S1DD 5EIIA 2GITB 4Y88A 3OKLB 2VLJD 3I6GA 4XRCA 4XWGH 3RY4A 3L5IA 4ZAKD 3HPJB 4HKBA 2E5EA 4JPWL 4EI5A 3T0EA 5D70L 3MQIA 3BDXA 1A2YA 4Y19B 4FFVC 1QP1A 2XA8L 5CAYB 3LKQA 1LD9A 4PLOB 5T5FL 4KKAC 1KACB 2IQAB 4FXKA 4P5TC 5T3XH 1H15B 2CR6A 4MQ7B 3JUZA 5EUOA 2H2SC 3LKOA 5BCAA 5IMKA 5CBEA 2W9EH 1KCKA 5EU7C 4ENEC 1J7VR 1CVRA 4JANA 3HMXA 5A2IH 3KNBB 2VLJB 3LS5H 2DTML 4NNYB 3LQAL 5DD1H 5FUCC 4YXLH 4X4YB 1NBVH 4MVBD 5A40E 2VSDA 2IANA 4RGOL 3CPLA 1VKXB 1G7MA 3UTTB 2Z31B 3ARFA 4OLXL 1CICB 2AW2A 2VQ1A 3CH1A 3G6DH 2H26A 4OZGE 4QTHB 1AE6H 4NZTH 2HJLB 3IU4H 1IGIH 3GMPA 1S5IL 4HIXH 1T1XB 5C92A 1A6UH 3HRZB 3WNLA 1G7LA 3JV0A 5C9JB 4H8WL 1T22B 2L7UA 1G7IA 3OWEA 2IADB 4GRWF 1GL4B 2APXA 3GKWL 1E28B 3QWRD 5C6PB 2RJMA 3QIBB 2VABA 1QPPA 5F7WC 3I50H 1RZJC 3GSVB 2AK4A 1CFNB 5CILL 1PJ9A 2BHZA 1IZJA 4NNPL 3GUTB 1IKNA 1FO0L 2VXSH 3GSUA 5T33H 1BLNA 4Y19E 3TLRA 4MA8L 5IJVB 1IC1A 3V5HA 1B4JL 1ZWIA 3QEUA 5EOCJ 4KUZH 2EEDA 4LCWD 4NQUA 4R2GD 4X4XA 4DGVH 2CLZB 4U2YA 1K3ZA 1PDKA 4GRWE 4NRYA 1QD0A 3UMTA 2VLMD 4KHTH 4QRQB 1D5IL 5FKAA 2PR4H 2Z35B 3O0RL 2NLJA 1T0NA 1U2HA 2ZNWA 3IVKB 2CRZA 1CWVA 2BSRB 1CXKA 2YD2A 4W68A 2NW2B 4UOW1 5AZEL 1VADB 5DVOA 4LFHG 3O45B 1V7MH 5D71L 1IMHC 4Q6IB 2JJUA 3QXVA 3VXRA 4YEEA 2GSIB 1XGTA 4MCYA 1E28A 3I85A 4DKFH 4YHPB 3CIQA 5IVNA 3SDCA 2OX5A 5D7LE 5BO1H 2BVQA 3QIWB 1ZHLA 3GO1H 1XF2A 1FVDB 3VMOA 2IMNA 3ET9F 4OIBA 3GMNB 4QGYA 2HVKB 5TPWH 3TNMA 4OZ4A 3Q6FA 3B2VH 1IQDA 2C26A 3BAEL 1DFBH 1E4KC 2BMKA 4O2EA 3TBTA 5C0IA 3O2WL 4Z76B 4WHDA 4ZOBA 5ACLA 1MLCB 1S3KH 3LKQB 1RHHB 3QB7C 5EU7E 1YYMH 4C54A 2B4CC 5E2WL 4TVPD 4HS3A 4GRWH 4FFYL 4JVUA 4JB9H 2A2QT 1H3PL 4QY8A 5ERWA 4RAVB 3OJDB 4QHMB 3B8YA 2XZZA 1YQVL 1F4HA 1JV5A 4I2XA 4Y5XB 2JE8A 2GTWA 4D9RD 4OV6F 3MLZH 4R2GC 4ZFOL 1J5OH 1K8IA 4KROD 4Z5RA 2HMIC 3QUYD 1AR2A 1VGEH 4EN3B 4NN7C 2HH0H 1CF8H 2JK5B 5GGRB 3BKML 3DMMC 4NQSA 1T5XB 2E3VA 2Y06H 4OT1L 4OZFG 2C5DC 3VJ6A 2YRZA 5ILTH 3QIWA 1X4YA 3IS0X 3KPMB 1T1XA 2PYFA 4PTUB 1MRDL 3QDMA 3DIFA 5KOMC 3L7FB 3AREB 1DVFB 4UTAH 5H37G 3QIBD 1MFNA 1HEZA 2B8OT 4YUEH 4LIQH 4XNYL 5D2NB 1LO2L 5GHWL 5E9DD 1QBBA 4LP4A 1LO2H 3T0VA 5E2UH 4OIAA 1IGFL 4QHKI 3ZTJH 2I5YH 3T8XB 3TA3A 2X4NB 3P0YL 2AGJH 2ESVD 4K8RH 4X5XB 1FIEA 5I8EB 1YPZF 1F11B 2YPLB 4PJCB 1C7SA 5FHBH 5IEHB 1B9ZA 2DQJL 4KUZL 5SX5H 4HGMA 2FGWH 1D3CA 2NZ9C 2AJUH 2BSSB 2E27L 3VWJA 2X4RB 5HYSG 1JRHI 4ZFGL 2DWEA 5LGHH 3MUY1 1A0QH 2R2BA 4WV1C 4JFEA 1NC2B 4LFHD 4P4KC 3FO9A 3MC0A 3VFSB 3U7YH 3KLAA 1U42A 2ATPB 1A7BA 1AC0A 1JGLH 1U0QA 2AJSH 3MNVB 1QYGL 2ZG1A 5EZIH 1ZLSH 4ZDHB 4OLWH 2X89A 4KROC 1IKFH 2CKBA 5IWLC 4XC3L 1KJVA 1UG9A 3FRPG 3L3JB 3NZHL 4MNHA 3BKYL 3VFGH 4GT7A 3O6LH 3OR7A 3FAWA 3PHOB 4QRSA 3T0AA 1RJLB 3KPOA 3QO1B 4H26A 4K7PH 1FL6B 1T1WA 2DS4A 1NUDA 5IHUH 4P2QB 4IRZH 2RHEA 4NQVB 3WLBB 1H8NA 3LAFA 2ARJB 1ACYH 3NCYS 5HGAB 5C09B 4KI5D 4Y8DC 1YUHA 3FZUC 4LARH 3RUGE 1E4XI 1G7HB 4QOKA 1ZLWH 1J0KA 1EXUB 3MV7D 4NQCE 5T1LA 3QDJB 4XVUD 3VGDA 5FUOL 1NMBL 1I8MB 1F5WA 1D9KB 3ES6A 2Q7NA 4GMTL 5SWSA 3AC0A 3I75A 3LQZA 1TJHL 2X1PA 3O6FA 1Q72H 1FAKT 3TJEL 4L4VB 3O9WA 5D1XC 5IMLB 3WDHA 1Z3GL 1P2CB 4HV8B 5HI4D 5EOCH 4IDLA 5FO9A 5FA4A 3QR2A 3EHBC 1T21B 4N8VG 5EG6C 3BP4B 1QFWI 4NC2B 5I1LB 2XNAA 1A02N 3PHOA 4YGVB 2AXFA 1I7TA 4PJDB 3UYRH 3UXFA 5I73B 3DXAB 4MMZC 5I1IH 4P46D 4LSUH 4OZHE 2E9JA 3I84A 3U7AA 1J10A 1C08B 2B2XH 3RNKA 1WSST 4LU5H 1RIUL 3OXSB 1H8OA 3WJLC 1JF5A 2ZG3A 1UJ3C 5JHDE 2OR9H 5F72S 1RQ5A 3MRJA 4G42B 1KTLA 4XHJD 1AR1D 4G8GB 1EEUA 3QEQD 1MI5D 1EGJA 1CFVL 2HT4D 4UIKL 5DJXB 5IEHA 3ULVC 5GGSB 2Q8AH 1IAII 2NR6D 4JVPA 5EU5A 3RUGB 1G6RH 2XWTA 4O2FB 5I1CL 4RMSA 5GS1B 1VHPA 3FN0H 4YNYB 5IM7A 1EHLL 4OAWB 3KLSA 4JAMA 1XGYL 3SQBA 3FO0L 5F7DA 3OZ9H 2GFBB 3QNYA 3VH8A 3NPZB 2A73B 3STLB 2EZ0C 2F8OA 3OKDA 4S1RH 3MV11 3CXHJ 1MHPH 5AAWA 4JQIH 2DQUH 3CFJB 2P4AB 1HCVA 1MREL 2X6MA 4DKAA 1FV1A 4PIRF 4AJ0A 1XF3B 1IBGL 4M6ML 1FCGA 1GHFL 5C0NC 1X5HA 2R0ZL 2VTFA 2WIIA 4WFGE 3QEGL 4EIZC 1FC2D 2C3VB 3AM8A 3K81A 4LEOB 2F74A 3AU1B 2HRLA 5EFIA 1W72B 4L4TE 3V0WL 5D96C 4R90L 4OTXH 2W91A 4QCIA 4F7PB 4DCQB 3QFJA 2J5LC 5E9DB 4M1CC 3BYYA 4K7PL 4ZUSB 5GRVL 3H3BC 3V4VH 3CXDL 4MXVE 1XR9A 3ARBC 1OGAD 1T5WB 3HA0A 4YHZH 5TDPB 5FUZL 4X0KB 4IOFC 4JPKL 3MLRH 3BPCB 4R9HA 1NAKL 3KPSD 1KB9J 5C07D 1LO3H 5D72L 1NGQH 3FN9A 4JRXD 1IGMH 2XWBA 4GG6F 1CGYA 1QQDA 4P4KA 4LF3B 5CMAA 4EI6B 2ZZUT 1JRHL 3I75B 4HHAB 4N90E 3TPUA 4F7CA 1H8SA 2FR4B 5ENWA 3QI9B 5JZ7C 3QWQB 1V8HA 3ULVD 2BRQA 1RJYA 1UZ8A 5BVPL 1SVCP 5C3LD 4LRIA 1IC4H 4O5LL 2F58H 3MUZ1 4HJGA 5B38A 3LRSA 2YD1A 1UM6H 4OZFH 2QSCH 4LPTA 1RZGA 3KYKL 1IL1B 3SE3A 4QXGL 3QDGA 3ULUL 3F7VA 4WHCA 3DXAA 5EC1B 1KLGA 3PWVA 3T0EB 5I66A 3M17B 3U0TA 1XT5A 4GAJH 4X6BA 1LO5A 1HH9B 4OB5L 4WTWA 4TTDD 5JXEA 2J6EA 5HI5D 4RFNB 1SEQL 4ZOEA 5TDOA 1F3DH 5HYJA 2I9TB 2X09A 5IT2H 1FIGH 2ARWA 4WY7L 5DD6A 1UM4H 4M6OL 4MXWL 1EUUA 1QA9A 5ID1A 1KTDB 2QADD 5CSGA 4HH9A 15C8L 1WCQA 3PL6B 1FVEB 4ZUTB 5I8KL 1IQWH 5IKCA 2CO7B 3P40A 4U1HB 3LQAH 2QADC 2M1KA 3D0VA 2EYTA 4OCSL 1U8OA 5JQ6L 1NJ9A 4OZIF 3OKLA 2CMRL 2XKUA 4IBLT 4L8SC 5MHSE 1MRCL 3WS3B 4KRPD 1HKFA 1Q94B 3O11A 4PBWD 2XXMB 1WZMA 4LCWB 3D2UB 4FG6D 3GRWA 3D18B 1JWMB 3WXVL 4WGVB 4YO0A 3QO0B 5SWZD 3W9DB 1M7IB 3NIDE 4F80A 3NGBB 4ZO9A 5FIEA 3RAJL 5A3ID 4DN4L 1U6AH 2FLBT 3IETA 2YKLL 3JXAA 3TZVD 4FXGA 1JBJA 2PETA 5H2BA 2YEZA 1T22A 1SHMA 2V2XB 3W39B 1HXYA 4PJAE 4OLUL 4E41A 3G5YA 3QUMH 5IEKA 3OX8A 1S78C 2MMXA 3L3HA 2HFTA 1DVFD 1WAAA 2A6DA 2R0ZH 1BFTA 3L3KA 1JPST 3N1GC 2UWEB 3M45A 1MJJA 2Z4QA 3OB0K 1TZGH 4MD0B 3QRGH 2Q1EA 4GKZB 4GG6B 4X7CC 5IKCB 4JN2B 1PY9A 2IQ9L 3C5JA 1M7DB 3FQRB 4BH7B 2FH6A 1JYWA 2A74A 2DLGA 3KPRE 1I4FB 5IF0B 2R0WL 1Q9WB 2LTQC 4NJAH 25C8L 3OAZK 2ADJB 5BJTB 1MY5A 3F7QA 4IJ3B 4IIQB 2BY0A 1JNNH 1N5YH 4V2CB 3UTSA 4P2RA 1NANI 1A6TA 1NGZB 2P43B 4LQ1A 3TNNB 3OG6B 1HSBB 1RZ8B 1YN6B 1AH1A 5C0AE 1AO7A 32C2A 3GGWB 3L1OL 4YHPA 2R0KH 4CDHA 3HNTH 3GUTA 3CZJA 1MAKA 4JHAL 4NRXA 4J6RH 1HQRB 3MMEB 1KCUL 3RIFF 4U31A 4OSUH 4R0LC 3KYKH 1T89C 4CW1B 2NZIA 4WWKD 3VD7A 3TO2B 4I13B 3KJ4B 4UQ3B 3GM0A 2IAMD 3C5JB 1ONQA 3FQRA 2UUDK 2R29H 4I3RL 1RY7B 4N0YH 4HUVA 5TE4L 1T66C 4IIQC 5L88L 1HCFX 5JW3H 3HG1B 5T1LB 4HG4K 5KSAC 1KTDA 1I8KB 5DUPL 2D03L 4Y2DC 4PJXF 3VG0L 2NYYC 4PJFF 3TYGL 3TBSA 4OZGA 3GSNL 2CDFB 3HAEA 4U1SA 5ESQB 2IPTH 1JL8A 1KENL 3WV0A 4PJFB 4GQPH 3SDDB 2C1OB 3AREC 1NGWB 1QHOA 2D7PA 2PTTB 4C55A 5C2BL 3BP7B 4UILL 5FM5M 2Y06L 1E6OL 2UV3A 4AIOA 1ZSDB 5F7NC 1LO0L 3KJ6L 5HHOD 5IQ7H 2MKWA 4DFIA 5ADPH 2V7HB 4I9WD 5HPMA 3IJHA 1Z5LB 5DMGD 1F8TH 2X70A 4GMSH 1CTNA 1C5BL 1J0HA 3OJ2C 3T0XA 4MNQD 4Y19A 4OQ1A 2V2XA 2BERA 4XI5D 3MUGA 3W39A 4OI8A 1AQDB 1YYLL 4LCIL 1AGEB 2F53E 3MRHB 3HHRB 1L7IL 1N6VA 4LSQH 3EYUH 5TE7H 3IDJA 3H42H 4JY6A 4LSQL 2VC2H 5FKPB 3JSSA 5ACZB 3K1KC 4QHMA 2ATKA 3QH3A 4HFWA 5F9DC 1SJVA 5IBLD 3T09A 4WHTB 1CR9L 4WV1B 3DUHA 4G6JH 4OUOA 4TUJB 4G9FD 1CR9H 5C8JA 4TSCH 1L0YA 5DVLA 4ZFGH 3IXAB 1PQZB 4Y1AA 5B3JF 4YNYA 4KROB 2JKXA 3GSQB 4KC3B 5IF0A 3VXRE 3W9EB 1D5IH 1ZGLM 1Q0YH 5EU3B 2DAVA 1S9WA 2HTLC 3FRUB 3OJMB 4X7SH 4ZODA 4TPRH 5EN2A 1IAOA 2HRPH 5D7LA 4H0IA 2HFEB 1YEGL 3ULUC 3GRWL 4LSTH 2P42B 4J3UA 3NFPB 3GRWH 3QG7H 3B9KC 5DFVD 2KBGA 3GHEH 4PRDB 1ORSB 3RWEA 1FYTD 2AKRA 2PCPB 1MI5E 2DIAA 2NY0B 4WEMB 2JB5H 3EJZC 3LSOB 5GHWH 4PJ9D 1MHHB 1DLHB 3V6FB 5I15H 2FIKA 5I1HH 5I1DA 4BK4A 5DHYB 3VH8G 5I15L 4ONFL 5D2LE 4FQLH 3L7EA 3VFOB 2I07B 3S4SA 2MQ0A 3QQ9D 5CKAA 2P8PA 2OMBA 3DJ9A 5IW6B 3NTCL 4AZ8A 1G0XA 5F1KC 3JWDH 4PRIE 5HGAA 4LVEA 5EPMB 1A7RL 5AYQA 5DQJA 4AQ1B 3GKZA 3NFNA 2DWEB 5BXFB 3C60B 4X6EB 4DKDC 5TE4H 1N6QH 3C08L 4FNLL 5FXCH 2M2DA 3ZLQC 2NY5H 3O4LD 4U3XA 1AGCA 4XC1L 3TO4B 2VDOL 3X11B 1I7UA 5JO5B 3GDBA 1OGAB 3MR9B 1YEIL 3MLZL 4FQIL 1AFVL 1EO8H 2AJZA 2F53D 1AFVH 1MH5A 3RWGB 5JOFA 4LSVL 1U3JA 3R06B 4HGWB 3TM6A 4WU7A 5C0DA 1WIPA 1TDQA 4OT1H 4JZNA 1OVZA 2AEQH 3BZFA 4M8QB 1FLTX 1WV7T 3PXJA 3CSYB 3JWOH 3PHQA 4JR9L 5HBBA 4XTRD 1CDBA 1IGIL 4PJBE 5L0QC 3MODH 2FX8L 1WCBA 5GSVB 2CSPA 3BXNB 2PXYB 4KJQD 4G6FB 2AK1L 1JWUA 1KTKE 4D94A 2VDPH 2DQGL 2R1WB 3HFMH 2DOCA 3ZL4H 2BC4B 5IQ9A 4YR6A 5B8CB 1MNUH 5C0CD 1NEZG 3WCYA 4LIQE 4RA3A 2JCCE 3I3BA 3VXME 2D7OA 4OQTA 1DBKH 3MROB 2VXUL 4QRRE 3JBG7 1LK2A 4WIQA 5FGRA 1BD2D 1NSNH 3OV6A 4TUJA 1DLFH 2V6HA 4OD2A 4IRSB 2OXHA 5E00A 1FSKC 4JKPH 1MSPA 4G5ZL 5ESVA 4R96B 1A1OA 4KZEH 1KIRA 1RVFL 2AJ3A 5DHXB 3BJ91 3OKYA 5HHPA 2APVA 2X7LB 2XNAB 2VDLH 1NCDH 4KV5F 7CGTA 3W9DA 4C56E 1M71A 1ETZB 1WBXB 2MCPH 1U36A 2NNAB 4AL8L 3QUMB 1PGRB 3L7FA 2CR3A 4JG0L 3NFPA 5DK0B 3UJIH 1T7XA 1J88A 1JI1A 3MRQA 1F97A 1A3RH 1CU4L 5E8PA 4KQ4L 5DQDL 1R5IB 2R4SH 1MCSA 1E4JA 1G7LB 2P5EB 5DTFB 1REIA 4NWTH 5L2KE 1BBDL 1FZOA 3GI9H 4G6KL 4ZYKB 4IRSC 3BWAB 1JZ4A 3D3VA 4JGUA 2BCKB 1WICA 3O2DH 1QFWM 4U6VH 5JW4N 3J8F7 2OJZH 4QRTA 3RTQD 5DMJB 5KSBF 3EGSB 3MRPA 1S3KL 3BPLB 4KK6D 2W0LA 3OPZH 1HINL 4Z77A 4UDUA 4UV7L 1GGCH 3F7RA 2DN7A 4Z95L 1UM5L 2RCSL 3QDJD 2R4RH 5DYOB 4AG4L 5J89A 5EBLA 4XP4H 1X5GA 2B1AH 3JTSA 3KVQA 4UT6H 2OBGA 3SY0B 4N1CA 1IZKA 4J3XA 4LLVA 1FCCA 1JHKL 4WW2A 3W82A 5J13C 4J1UB 2QSCL 1OARH 3FB8B 1BIIB 2J8UF 5A16A 4QTIH 4MAUH 5H8DA 5JHDA 5SWZE 3WFEL 4RIRA 4QXWA 4YBLB 4PTTB 3SKOA 1PLGL 5T1KB 1RUMH 1GIGH 5I19H 3DVFA 1V7NH 2W0FB 2W9DL 5K9KA 5SX4H 1G1CA 3E6HA 3LN4A 4I18C 5ANME 4P4RA 1DQLL 5EO0B 4WUUB 4F7EA 1N5AA 3P11H 4OZIB 3MJGX 1B6UA 1NC2D 2XTJE 3GMMB 4J2XA 2Q20A 3W81A 1EMTH 2XZAH 2WWMD 3FN3A 1X4ZA 2R1YA 3R1GH 5IVZA 1FL5A 2DM2A 3HC3L 1NMCB 4GLRI 4Q97A 5E8DH 5C0BE 3OXRB 1FORL 2X4PB 1OAQL 4NO0A 3IFPA 2DWDB 2ID5A 1G7QA 1RJZA 2ZSVA 1NFKA 3S6CA 4HT1L 1LP9A 4Z18A 3D87B 4HUWB 3VG9C 1FLRH 5F93C 2Y6SD 3BI9X 2ICWA 2YA2A 4N0UE 4P3DB 4QHUB 1FH5L 3H7BA 5JPNB 2XZCL 4LRNH 4M9PA 1LWRA 4MJIB 4PJEE 2Y6SC 4N8CH 3WIHL 3C09C 2DQUL 1XGPB 1NL0H 4KU1A 2CK0H 4ODUA 3U6RB 4A2MA 3GHBH 2CK0L 1A6VH 1V5JA 5E7BA 1FZOB 2HTKC 2P44B 2GKIA 3TN0C 2J6EH 1K6QH 4HFWB 1ADQA 1AD0B 2D4FA 2IPKB 3D25B 3BEVB 4APQA 4D8PA 3KPLA 1D6VL 5J1AB 4NO5A 1L9MA 2EC9U 3D85A 4MX7B 5HYFA 2X10A 2E7MA 5D93B 4Y1AB 4URTB 2MPAH 2OZ4L 5DJDB 1OQOA 3MXVL 3O2DL 5GGRY 3BQUA 5EBWA 1EBPA 3FT3B 5FGCB 1BEYL 4LEXL 2OTWB 2R56L 3ARVA 5DLMH 3REVB 4HSQA 3TBWB 3HPLA 1K4CB 5D72H 3ULUE 2BSRA 3IDMA 4MJ4A 4L4TD 5EUOE 4BQ8A 2ICEA 5EBLB 4XBGA 3MRGB 3QDGE 1Z0NA 2H2PD 2ZNXA 2R2BB 1A7NL 5KVGL 1B2WL 2GT9A 4UT6L 2D2OA 1W0WB 4WW2B 2NQCA 5LGKA 2VLRA 1AO7B 4GUPA 4TOYH 1TVHA 3CDFA 1BAFH 1KCSL 4X4ZA 4KTEH 2A83A 3P9WB 1KJVB 2CQVA 3OF6D 3OBAA 5T1KD 1DBMH 3BRDA 5T5NF 3U30B 4CMHC 3DHMA 4OFPA 5DMIH 4L4VE 5HYQB 4XNXL 4OLZL 1BFVH 3RWFB 4OUUB 3NPSC 2DD8H 3RL2B 3SE9L 5KSUA 2ZCLH 1XF1A 1SJEB 1WWWX 4PJ5A 4Q9RH 4S0TD 3UJJH 4PY7A 2F5AL 5I1JL 5HDBF 5L7XL 2AK4E 3WFCH 2VDMH 3UBXG 2FECL 3STZB 1FNFA 1QSFD 3Q2CA 3TJHC 5J3HD 3PGFH 1UB6A 4CVXA 2AEWA 1DANU 3TWCL 3PGCB 4XTRC 4AH2B 1I1FA 5IBUG 1OAQH 3CXHK 3DMMB 4ZUUA 3CVIL 5A2FA 3DGGA 4X6DB 1N7MH 3UTZA 2BNUA 5D7JB 1WAAE 1FL6A 3T2PA 2X4TA 3CAFA 4YGAB 2WV3A 1NMAL 4X6BB 1T03L 3PJSB 2D4DA 2H2PC 5HHNB 5HHXL 1I75A 3F12B 5T3ZD 4AQOA 4OF3A 5MI0C 1A4JA 2KL6A 2P5ED 3QP3A 2K7QA 2HJKA 1EXUA 1MJ7L 5EOTA 1HIML 4TNWK 2R9HC 4QWWD 2AAVA 4N0CC 4IRJB 2WUCL 3CCHB 1HYSC 4Y2OA 4JRYA 5TF0A 1DE4B 2UZIH 3UTSE 1YNTA 2EXYC 4N8VA 5FO8B 2X4RA 2YD6A 5K59E 3WFHA 1ZEAH 2VZVA 4OCNC 5L9DL 2H45A 5T3ZH 5ICYB 3FO2B 5CP7B 3CU7A 4NN5C 5AYUL 5C08D 3MRNB 1CLZH 1JWMA 5TJWK 3FZUD 4XP9L 5MENA 2OS7A 5GS1A 3V4PL 2KQMA 2DF3A 5JUEL 3DRQB 4HUKB 2NTFA 1G7PA 3MCG1 1LE5B 5BZWA 1W8NA 3WKMH 2AS5M 1AKJD 3S8WA 2DMCA 1R0AL 4NO2A 5DT1H 2EKSB 1FE8H 1TTGA 2L0DA 4LDEB 2GW5A 1QFUH 1L6ZA 5DSCA 1GZQA 1I3GL 2DYPA 2OL3L 3H9SE 5HYSA 4G9DA 3TFKD 5IJKC 2ZUUA 4JHAH 2AP2A 3ARGD 2VXSL 2C4FU 1E4WL 3QIUB 2NW3A 3W0WA 1DL7L 2VSCA 4L3CB 4ZFZB 1X5XA 3ARTA 2D7NA 3EDJA 4J3TA 3ZKMC 3RRQA 2J1KA 3LEXB 1DBBH 2IBBA 5IMMA 3GJEA 3FO1B 4F7MA 5TFSL 1ODAA 3VWKD 3PWPE 1JHTA 2W38A 1QFWH 4YEFA 4GBXA 4NKDA 3NCCB 3BISA 4WCYH 3TYFA 3WDIA 4PJXA 1R3HA 1O0VA 1DBAL 1KLFA 2PW2A 2X9XA 1DCLA 3FMGH 2W60A 1CBVH 1NBVL 4TUOA 4KY1L 2VZ1A 1FFRA 3LRGA 5D1XB 4PRHB 2JJSA 3QDAA 4HIJA 3IJYB 4LHJB 4WFFD 4Z7OF 1I3UA 1A21A 3GBNL 1A1MB 2NTSP 3BZFB 3KXFD 1K8DB 1GGBH 4JN1H 4QCIB 1JGUL 2P8LA 2YPLE 3TVMA 1S7WB 1P84K 1QNZH 1KPRB 1A14H 2P47B 1W2KT 1ED3A 1AGFA 4R4BA 5IB2A 2YA1A 4P59H 4WI6A 5IMMB 5AZ2H 5IFHH 5L2JA 4E0RB 2KZ1B 2VQUA 4ZS6D 1AGBB 1E27B 1KIPA 3FTGB 2DLTA 4P49A 2YA0A 3MLUH 1ZLVH 5GS1C 3QQ3A 3X17A 1OB1A 4LHUB 1E4XL 4ODSL 4IS6A 4IOSD 5JIKA 1U93B 2XV6B 5MEND 1MCQA 1AHWC 1F4XH 5CD5C 3DX7B 4M7KL 4M6NL 4ODHH 5IESH 4M7KH 4LSVH 2BVEA 4NGHH 5CEZE 2W65A 2FBJH 3PNWA 5DDHA 5LAXA 4S2SB 4GS7C 3QCTH 2E7LA 1N59A 1IM9A 3EUUA 12E8L 4S1QH 4JO2H 4DJMA 2WZPD 4KQ4H 4K71C 3LVEA 3QO0A 2FB4H 1J8KA 3Q0HA 4DTGL 1ZLVK 1ED3B 4KHXH 3FFCB 1K85A 2XICA 3VXOB 3WS6C 5IVXA 4QXUL 4XCFH 4G6FD 2P5EA 3PWNA 2OR9L 4HWBA 4KV5E 3TA3B 2YD8A 1MCHA 3ARBB 1S7QB 1ZS8A 3V4UH 4FP8H 3F7YA 3NN8B 4CDGC 5K9OB 3GO1L 1INEL 1HHHA 1KNOB 2PNDA 5D1ZD 4J8RA 3L5HA 2JCCB 3ZZ1A 5IEKB 4WI3A 5CEYB 2H32H 2NXYD 3F7PC 4MSWA 2Q76B 2E6JA 1U93A 1CFBA 5LBSH 4ZFFA 4HIHB 3ULVL 3WFDL 4A6YA 5I1EL 2AJUL 1T2QH 4NHCH 4PUBH 3LN9A 1YEKH 1P1ZA 5EBMB 1IAIL 2XFXB 4PS4H 4YGVA 1BZ7B 5CZXC 3ROLA 1I9IL 5A2LH 4EVNA 1LILA 4PR5B 2F54E 1N8ZB 5JW5A 5EOQL 3O8XB 1CK0L 1FO0B 3S96A 4BZ2L 3G5YB 2NMSA 4WWKB 1CXLA 3NCBB 4I3SL 2Z91B 3E3QE 1EAJA 4FQQB 1HDMB 3FONA 1FP5A 3VFGL 3BE1L 3MXWH 4MCYB 1BLNB 5IJVA 4JO1L 1XGUA 2OQJA 1T1WB 4MDJA 2WUBH 5D5MA 4M62L 4O51B 5EZIL 4JDZA 5MERB 2GEEA 4JGMA 3MOAH 5FYKH 2QR0A 3QPXH 1HSAA 3SDXF 2F15A 4LSDA 3P9MB 3OF6A 4HWEH 1KCRL 2HVKA 3LN4B 1A3LH 4W6YB 5B39G 4JFHE 4DUWA 1IEBB 3CDGA 3LDBB 4PGDA 4DEPC 1QRNB 2DB8A 4U7KA 2ZP0T 5J1SC 3KYOA 2Z35A 4RRPG 2I25N 2YC1A 1RJCA 2KQNA 2Q8BL 4G6AC 4M3JA 2KUTA 2A73A 3CUPB 4R0LB 1JGEA 4FMFA 3T04D 2HLAA 4MQXC 1JPSL 4D9LL 5JW4M 2LU3A 1AI1L 3MLUL 3U9PH 1PYWB 2BVUA 2D9CA 1NBZB 3LPGA 3X11A 2GQHA 4L4TA 2IF7A 2XTJC 4LOUD 4CKVX 1JV5B 3WHE1 2DKSA 3MV8A 4Y4KD 5KJRL 3MO1A 4XXDA 4FQCH 3ALXA 1D6EA 1Q94A 4TQEH 5CD3B 2C3VA 1FLRL 3VFMA 5JA9A 3VRJA 5ICXB 3MLTB 1EBAA 2DQIH 1ZA6B 1H9VA 3SDAA 5E2TH 4GXUN 4IRJD 2HRPL 3IDGA 5GRZA 3WE6B 3MLXL 3QJFA 1D5BB 1XFPA 3IFLH 3MJ9L 4U4BA 2E7CA 4KPHH 2EYSB 4Y5VB 5IROC 3GSNB 3DYPA 5CLWA 4YBLC 1JGEB 1T6WA 3FB6A 1S9XB 3S34H 2XTJB 2WWKT 2EE9A 2QL1A 3DPBA 4RMTA 1DE4A 3ULSB 1D5XB 5E00B 5ESVB 2Q8AL 4ZFFB 5ITBH 5SWQB 3GSWB 1JYXA 4FOMA 3L6FA 4BFGA 4FHBD 1IC7H 2HJLA 2F19H 3HI5H 4Z9KB 3RZCC 4O9HL 2FSEA 4OD1L 1J0YA 2JJWA 2BX5A 2PTUA 5C9KA 5E6IC 3RZCD 4DZBA 3RVUC 3DO7A 4U0QB 3E3QC 1U8LB 1V3KA 1KOAA 4WFHD 1MVFA 5KW9L 5D2NA 5IHLB 3JVGA 3KLAB 1SEBB 1NGYA 2LFGA 1MCWM 3OB8A 1EO8L 4AIZA 1O5DT 2O26U 4X8XA 1XZ0A 5CBEB 3D0LB 1Q9OA 1CQYA 5KVMC 1JGVL 1KYOJ 43CAA 2BDNH 2ZUSA 2IH3B 3QJHB 4FQHB 1XF4B 3JTTB 3ME0A 4RGNB 3SJVE 4RISL 5HI3D 1EO5A 3T2NH 1XF2B 5DFTA 1A7QH 4WFHE 3ZKQD 3ARBD 2W9DH 3BQUB 1OM3H 1NCNA 3N1MC 4L8CB 4I2XE 4U3CA 3BW9B 5SWQA 1A64A 3HZVB 2V2TA 3NCJL 2A6KA 3O2VH 3S35L 3IXTA 2ZUQB 3D18A 2HT4C 5ALBL 1QQDB 4P4KB 4UDTA 2ICEB 4BFIA 3TC9A 2Z8VC 4PJXB 4X6EA 2Y4SA 4QY8B 5ERWB 4F37F 1JYNA 1X5KA 2AXGA 1NSNL 2JTDA 5J9PA 3D39E 4K3JH 1LEIA 5I16B 2H8PB 4JREB 1WWBX 1KLUB 2HKHL 1INQA 5KJRH 2DQDL 4JFZL 4CN4A 4KVCL 3RTQA 2A83B 2NY1B 3TT1H 3QDGB 4D3CL 2JELL 3V6FA 2FO1A 5HDBE 2YK1H 1ZWIB 2IH3A 3DNKA 1OP5K 3LEVL 1TQBC 3D3VD 4PTTA 2Z0BA 3WLBA 1UB5B 4PJDA 3U7YL 5E5MB 5TH2B 3ULVF 3LH2L 5DMIL 2VDQH 3FFCD 4CN6A 1MF2H 5I0ZA 1CD1A 2BSTB 3OGCB 3BPNB 3PDOA 5C0EB 3BKYH 4K94H 3MACH 3WUWA 2MFNA 5C0AA 1IGYB 1XGQA 4JO3L 5HDQH 1J0IA 1QLRB 4HCRH 3U30C 4JO3H 4NQDA 4KJYB 2HFFB 2B7DT 2OTUB 2WANA 4FZEL 3L95A 1H3WM 3JVGC 5FYJL 4XNUH 1RUPL 5A2JH 1OHQA 4OJFL 1KJMA 2GI7A 3DX7A 3V0VB 3IGAB 5DI8B 1P7HL 1S9VB 1NUGA 4JFEE 2O5XH 1R3KA 1I8IB 4KUCD 4OLXH 4NNYA 4OLVH 1GYAA 2GUOB 1FNSL 2NX5D 3DURA 3PF2A 2VLRE 1N4XH 2UYLB 3HNSL 1KPVA 3EFFA 3B2UC 2NY6C 5CUSH 3RKPA 4JFDD 4WUUD 3WFBH 4Z76A 3K7UA 3QFDA 3SKUD 4PRDA 1CGSH 2GK0A 3HAEH 1A7NH 4R7DB 3QEQE 1U91B 2XRAL 4C83A 3WIFB 5EU6A 1MFAL 2J8HA 1MHCB 4EQ2A 2A6DB 1JHLH 1WIUA 1KB5H 5DD5H 4PJGA 5IROA 1IGYA 4JKKA 4LHQB 4NO3B 1WC7B 3U2SB 3ARDB 1OAZL 5GGTA 3T4AB 4WI5A 1F42A 1FAIH 2BRRH 2YD5A 2EE6A 2ZCHH 4GAJL 5DGRA 4AK1A 3ZT5A 5EU5B 3RUGA 5ACMA 1JPFA 1G9NL 2QV2A 3QEUB 5C0FA 2IANB 2GJ6A 1Y6KR 1I4FA 4F58L 4PJ8D 1J1OL 5BXFA 3S36L 2F53A 2V7NA 4CL7A 3HCVB 5TDPA 1UCBH 3BPCA 4U7MA 2X42A 1CDCA 2WBJB 5E1HB 1QUNA 1JNNL 4HUUA 4LMQI 3QRFM 3DV4A 4DVBB 3QG7L 5IOPB 4X80L 1LEKA 4KY1H 2BOCA 2XQBH 3O4LA 1QSFE 5JQ6H 3QQ4B 1R3LB 1YEJH 3L3JA 2AEPH 3K3QA 1MHCA 1T83A 3MV7E 4GUPB 4NQXA 5D7IB 5I1CH 3QULA 1ZK9A 5BQ7B 3EO1A 4LDOB 5ACZA 2GAZA 2YZ8A 5K33A 1HXMB 3GB7A 5DUBA 4IOIA 2NXYB 3KPOB 3A6BL 4AT6B 1LE9A 5I71B 4JDZB 3QNZB 1BIIA 1JWUB 1F90H 3B43A 5C6TL 5JPMA 3WNOA 2Y07L 4FTVD 3VWJB 2X4UB 1TNNA 2QQNH 5HGBA 5BW7C 4JRYE 1AP2B 4ZPTA 4QRQA 2Q7YA 4OM0L 1NDMB 5KAQF 4KK9D 2AV7A 4NQTA 4L8DB 3C6LB 5HVWA 1MFEL 3RU8L 4K55A 5HGHA 2VZ3A 3VGEA 1WEJH 3L95B 4P9MH 1QA9B 1OB1B 1P5VA 3BGFC 5C2UB 5MENE 2XA8H 5CHNA 3R0MA 5IMLA 4IRSD 3G9AB 3U83A 3WHE0 4HW6A 4P5MA 4UZGA 5IV2A 4Z7UB 1T04A 4OGZA 1FSKB 2Y36L 1FN4B 3I2CH 1WFTA 1QR1B 2Y36H 3VG0H 1KN4L 1A1NA 4X5WB 1IEAA 1NAMH 4D0BA 5IB5A 3U4BL 4RFEB 1KLGB 5J57B 3EYSL 3M17A 2BY1A 2AABL 1E6JL 4NQDD 2I07A 4M48H 4O58L 2VLME 5E8PB 5D7SL 3BD5A 1QTYT 3CLEL 3O3UN 1MNUL 3FFCA 4YBQC 4NZTL 3VFNA 1EGJH 2YMXL 3WEXB 5DF0A 5EU6D 3SEPA 3DVNB 1FG2A 3HNTL 2LABA 5E9DE 4J6RL 3KLDA 5FA3B 3BGFB 4XCNA 4I2XB 4RWHA 1YEFL 4MNQA 4Y19D 4JFDA 4EBQH 1G9MH 3BZDA 3WJLA 1G9ML 1RULL 2OTPA 1CLOH 4JRYB 2VERN 4P57A 1IGTA 2JJTC 1GH7A 2AJZB 4IDJH 2FGWL 2NX5A 4JN2A 3IFNL 1BREA 4MHHG 4KQ3H 2VISA 5I8EA 5HHOA 3DTXB 4RMRA 4U3HA 4ESKA 2P49B 1QSEB 2ZSVB 3K2UL 1VSCA 3CFIC 3ETBF 1XR9B 5T33L 3FO2A 4KK9C 2V17L 1A1NB 1NCDL 1M7XA 4YDVA 3V6ZB 2HN7B 3G5XB 1L6XA 4DK3A 4G8FA 2FHBA 3HKFA 5INDB 3OAYH 3GMRB 4K7PX 1XMWA 3B5HA 3UJIL 4DW2L 5F7KC 5JDSB 4KJPC 3HZKB 3GMQA 5GRUH 3RWIB 4ISVB 4GS7B 1AIFA 1RZKL 4C4KO 1ZT7B 3WEXA 4A6YH 2GAZB 2Y9RT 3I6GB 5D5MF 3TCLA 1OQXA 32C2B 5E95B 3IU4L 4D0CA 4MNHB 2BHYA 2IAMA 1YC8A 1PD6A 3L9RA 1ZMYA 3JTTA 3MLYH 3B83A 3LRSB 5CEXA 2DL2A 4POZC 4YHKH 1X7QB 3AMLA 5DMGC 4PJCA 4ZFZA 4H88H 1VGKB 1H3XA 3GSUB 4PB0L 4DN4H 4PJBB 4WW2C 2YD7A 4PJ7E 1QHPA 2JB5L 1TXKA 4XMKL 3CVHL 1U8JB 1Q0XL 2XFXA 1MUJB 3BVNB 4W81A 1TETL 3BPOB 1UM5H 5CJOH 5F1IB 5IFJA 4XNMB 5DS8B 1G9NC 1K4DB 3WIHA 1YJDH 3UTTE 2BXZA 1E4XH 4ODTL 4WHYH 1I8MA 3OR6B 4JFQB 4UNUA 5GGUB 3IFPB 3GIZL 3GJFK 5IR1B 3IAQA 4YHLL 1QR1A 1KULA 1J86A 4JZJA 5LGJB 4GW4B 4R4ND 3RX8A 4D0CB 3P30H 2BVPA 4GG6E 5I1LA 2QR0B 4M62H 1MQKL 3P4LA 2H9GA 2AK1H 4XCEB 3DGGB 4X6DA 3NGBC 2FB4L 4R4BB 3Q6FB 3R4DA 5KVFL 2AEQL 1FFNA 3MROA 3O3BA 4E41D 2Q3AA 1S7UB 4N0FA 1UKTA 2GK2A 4JFXA 4HWUA 3V52L 5D9SB 3ILQD 4X83A 3RWJB 3TZVA 5DJ0B 3EOTH 3RZCA 3FOLB 3D0VB 3KYMB 1M05A 4POZD 1T89A 2NY4C 3HC3H 4MJ5A 4Y4HC 3TIDB 5SWZA 4H5SB 1JMZA 3NTCH 4FABL 4YHMH 5FHBL 2ITCA 1FFOA 1ZSDA 3LD8B 4X99B 7FABH 4Y4KA 3UTQB 2JIXB 5I1EH 1QSFB 4BH7A 2AQ2A 5DWUL 2V9QA 4J3SA 5LGHL 4MS8D 5HXMA 5F9AC 4ZUWA 1F45A 4XGZA 2QKIB 4UOJA 3VCLA 4QNPF 4MS8C 2UVEA 4WEBH 3T3MF 3SGEH 3RNKB 2ADFL 3K74B 4NN7B 5DQ9B 3OXSA 1XGYH 5ID0B 4X9GA 3OX8B 5I2IB 3BKMH 3S5LA 1UACH 1TZHA 1UVQA 3PWLB 3TCLB 2OM5A 3WLWC 1YY9C 1YEDA 4NC1C 3KS0J 3JWOL 2V2WB 1LP9E 4IRJA 4QNPE 2PO6B 1IKFL 1RK0A 4J23A 1OWRM 3L7EB 3VFOA 4MA3A 4PJEA 4Y5YA 3DV6A 3W11C 2A77H 3EJZD 1RHHA 3RVXD 3O3DA 1TLKA 3B5TA 5C0RH 1AD9A 1T5WA 5MEQB 1WT5C 3QI9D 4ORGA 4RZCA 3SKMA 5F1OB 5I8CA 3RBSA 5TDNA 5I1KH 1HNFA 3B9KB 5FO7B 3MRRA 3F58L 3OKKB 4I5BB 4HKZB 1BGXH 4PYHA 4JRXA 1TQBB 3DYMA 3MV01 1SEBA 4EDWH 5H35B 2QEJA 3EO0B 3CZFB 3AY4A 4X8JA 3SDCB 3C5ZB 1I1FB 4TUKL 4D3CH 4M5ZL 2ZWLT 4GFTB 3VFUB 5AD0B 4ODHL 4GW4A 5DJZA 5C86A 3TZVC 1HHKA 4MD0A 2ADGA 2J4WL 1XGUB 3QNXB 4DN3H 3TNMB 4MDJB 2X4OA 5GGQH 5J6GA 1MCPH 5D1ZA 4PP1D 3HLAB 2PYFB 2W0FA 4MZ3A 4RISH 2VDQL 5FECA 2X70B 4APQC 5JXAL 1K3IA 1OLZA 4GRMB 1DJSA 2XY2A 1EV2E 4GKNB 4O02H 3VFVA 1IEBA 3VXUE 1BJ8A 4PGCB 2EC9T 1CXHA 4FXKB 1A4KA 2BSED 5CJ5A 2APFA 3C8KB 5CMAB 4EI6A 2XZAL 3RDTB 3WN5B 4PRBA 5F1NA 4DK6A 5CHNB 3ZE2F 2VWEE 4JANB 2ICWI 1UEMA 1NAMB 4EIGB 1KEML 3R06A 4W6XB 2ZUQC 2VIRB 1HHIA 1E4KA 4WJ5A 1SBSL 3IDXL 4RFEA 1QBML 3T3PF 5AG9A 1YQ2A 2LQRA 1D9KC 5L0QB 1JI2A 1MCNA 2DQHH 4Z95H 1D5ZB 1EAPB 2B4CH 4PJ5E 4YC2B 1MI5A 1A6WH 1G6RL 2C9AA 3MLPA 5B8CA 4NCC1 4AMKL 1B0GA 3QIUC 1KT2B 4R3SB 1WVZA 3DX8B 4W70A 5D2LA 4OGYL 1OAKL 4K23H 2XPGB 4WI9A 5GS0D 1YEDB 3L5JA 1KEGH 1RIVH 2RBLA 3MRMA 3T4AA 3NACH 1XIWC 1R24A 2DM3A 5GS3A 3SDYL 4FZEH 3QUXB 1NJ9B 4YH6A 1FDLH 3V0VA 2PF6A 4ZUVA 1FYTE 1JZ3A 3FO1A 1ES0B 1KUMA 1WLHA 5E4IA 4AENB 3QT2A 4JPIB 1KIUA 3L5XH 3O8XD 3CX5J 2G2RB 4GQ9H 3O9WD 3FKUS 2V9RA 1J87A 2VAAB 1F2QA 1X5LA 5TPWL 1RUQH 5GS0H 1B6DA 4HFUL 4U0RC 1P6AB 3DRTA 2O5YL 4I5BA 4JRXB 3EYFA 2NXZB 3UO1L 1A5FL 4B41A 3DVGB 3FFDB 3A0OA 4XH2B 3IU3B 3MJ8A 5C0GA 2WW8A 1AJ7L 1P2CA 2HJKB 4HV8A 4TQEL 4NYLB 3REWA 5JIPA 2GYSA 3F7YB 3NN8A 5K9OA 1R3JB 3IDNB 5GGVL 3D9AH 4J8RB 1K8DA 3ZDYF 3W0WD 5F70A 2YBRA 3TVMD 1OAXH 1ZHLB 1P5UA 4LEOA 1NGPH 1DSFH 2DYPD 1ZHNB 3KXFA 3OL2A 4JHWL 2ILLA 2Y5TA 4EI5B 1J11A 4K8RC 4U1KB 3KPQB 4WWKC 1OTUD 4HUXB 3ZO0A 5IBLC 3TBTB 4OCWL 1GHFH 4I0PC 5FCUH 5EIQA 5ILTL 1AKJA 3MBEC 3S3SA 5C1MB 3U9UA 2AV7B 1T0NB 2GJJA 3IVKA 4PJAB 4G80B 3MA9H 4U49A 3AB0C 1SYSA 1ORQB 2X89D 3CMGA 3JUYA 3NZ8B 1J1PH 1JWSB 1XAUA 3HTLX 4HQQL 4UAOC 4CVUA 5T3ZE 1GRWA 1LEKB 3O8XA 4GBXD 1LK2B 3CK0L 2HLAB 4Y16C 1LEGB 3VWKA 1KLUA 1BFOB 4YHZL 4CVWA 2PTTA 1DLHA 3VWJD 5FGBC 1MQ8A 3BZ4B 4X7DC 5EU6E 5TE6L 4G9FB 4R4FH 5JLZB 2Y5EA 5F9WB 3SBWA 3ZSTA 1KFAL 3JZ7A 4PJGE 3HPJA 2C4XA 1T0MB 2ESVA 2R0LH 3ARGA 4K7FB 4FQPA 4UV4H 1HILA 3KXFB 4RA0C 4XCCL 1B0GB 2YMXH 4JDTL 4KAQH 1A9EB 3C2SA 1QRNE 4JPVH 4PREA 1IRAY 1XR8A 1G6VK 5AWNH 4JLRB 4OF7A 4RGMC 3LEYH 1BF2A 2F58L 2R69H 3EOYG 1TJIH 3I3DA 4K3EH 3UJTL 1B4JH 1I7UB 3P3YA 3T4YA 2DMBA 3EFDL 3MR9A 4LNRB 3WJJA 3PE9A 3QDMD 1BJMA 4ZAKB 1VFMA 3E8UL 3I50L 3G6JA 3RUGF 1CIDA 1CDJA 3SCMC 1QSFA 1Q8MA 2ICES 4NGHL 5C6WH 1HIMH 2G2RA 2A9NL 3BZ4A 5DD3H 3L5XL 3N06B 4F2MA 1IQWL 3L6FB 4PJIB 3CFEA 4S1QL 4DUVA 4HWBH 5C07B 1OTSD 2NY3C 4ODXB 4F7CB 2UY6A 1S9KC 2YUVA 4N0UB 4ZDHA 4ZO8A 1I7ZA 2XKNB 4CUCA 4NJAL 3B6SB 2AJYH 5ELIA 4LL9A 4Z0XB 2AKRB 5FA3A 3V2AR 3OKEB 4UTAL 1EO7A 4MHHI 1INEH 4OBSA 4YHKL 3SE3C 5JMRA 3WMSA 2HWZH 3L3OB 4XBEH 1MIEH 4LNRA 4Q6YA 1F90L 4GLRH 1ZHNA 2B20A 3RNQA 2FWOA 2C1PB 4M93C 3RVWD 5E1AB 1KIRB 3TBYB 4LLYB 5H37H 5ICZA 3QI9C 1I3GH 2OL3H 1MIML 1C8PA 3BRGC 2DKUA 4KDWA 5I17A 1MLCA 3SBWC 3N9GL 3VXRD 5JW3L 2Y25A 1RZKC 3P2TA 5I8CB 4NN6B 3C5SB 1YQVH 2OSLA 1LMKA 3MRGA 3QHFH 4UINL 1CE1L 3QI9A 4M43L 1ERNA 2HA1A 1HI6B 2MTPA 3OJDA 1RIUH 3E2HC 4N0CD 3BT2H 4I1NB 1L7TL 3IJSB 5GGSY 1XCTB 4YHLH 1WFNA 2VLLA 5HVHB 4N0UA 3BWUC 4YX2L 4EOWL 4F57H 4N90D 1KGCD 1INDL 1WUNT 5BRZB 1RJLA 5KSBA 4XPFL 4WO4B 1INQB 4MQSB 2WBWB 4UT9H 35C8L 4APQD 1MHEA 4UT9L 1S7WA 3FMGL 4JZNB 1OPGH 5T1KA 4MNQE 4PGZA 4Z0BL 2FWOB 4YJZL 3MX0A 4DAGL 3PL6C 2IPUG 4EUPH 1UZ6F 5E1AA 3TJHD 3TBVA 1R5VB 3ALPA 3B8SA 2XRAH 1P4IL 2EDEA 1Q9KB 5DK2B 4LBEA 1P4IH 1GGBL 2AQ3A 4KKCC 1LO4L 4S1RL 5HSFA 1PZUB 1U3HB 1AGDB 1XH3B 2EDJA 1KGCE 4JVWA 4OSUL 5J8OA 2ZJSL 1TJIL 2W92A 1IFHL 1RZFH 5HY9B 1ZT4B 5HGGS 4DWHA 1NFDA 2M8XA 3D39B 4G6JL 4YDKH 4OZGB 1FVCA 3ROOA 1MH5B 3RWGA 4TNVK 3H42L 2DICA 4L9LC 3RHWF 3ZHLA 5HI3C 1F11A 4NO0D 1CLCA 4NIKB 3MOBH 4WO4C 5IBTH 4ENED 4JDVB 3HMWH 2IAND 4NUJA 3X14A 5MP6H 3CPLB 1B0RA 3D85D 4QHKJ 3MRCB 5DJ6B 2X9YA 3UZEA 4S1SL 1HHJB 1UXWB 5AUMB 4OD3L 2VDML 3WXWL 4PV9B 2F9BT 1JF6A 3RVTD 2PYEB 1IVLA 3MFGB 4JO4H 1OAYH 4OZIA 3BD4A 4HK3J 3G9VA 3MV8E 1G7IB 4JG0H 4LHUG 4Y5XC 5I1IL 4HK3N 5DTFA 1HZHL 1TVHB 4NP4L 5EFIB 4P2QE 5JHDD 1CG9B 3RNQB 3P77A 2ITDA 1ZGLA 1FZKA 3T1FA 1UKSA 4ZPVA 3FHAA 2FEDD 3C9NA 5K93A 1BQLH 2R8SH 1ZVSB 4X4XB 2RIKA 3LCYA 5SV3A 3GIVA 2FEDC 2NY5C 4NQCB 3ZT7A 4M1DL 3PXHA 4TSAL 5DWUH 3IDUA 3ZDXF 3AS2A 3T0WA 1UKQA 1HI6A 1I8KA 4M00A 2NLJB 4GBXB 2E9WA 2EDKA 1DUZA 1CN4A 4LKCB 2B5IB 1UWGL 3FOMA 4FFYH 5GRXG 4RX4D 5EOCL 1A7OH 4ISVA 1B3JA 2H2SD 1C16B 1QBLL 3OGOE 1G9EA 3DO3A 3O6ML 2X1WL 3BEVA 2VR9A 2VZUA 5CKGA 4TVPL 2DDQL 2QQKL 3D3VB 4DUXA 2X4OB 2EDNA 3BPNC 3K2MC 5AG8A 5HPMB 2BCKA 4EUPG 4IMLB 4GW1A 4JO2L 5JXAH 5KN5B 1JPFB 5D7JC 4AT6A 3G04B 3WKML 3BGMB 1PG7L 1EEZA 4F15B 3MUGB 2YWZA 3RKDD 2YC1B 4HIEB 2EDYA 4ODVH 2NXYC 5EPMA 5I74B 3TBSB 4Z8FL 1KJ2H 3ARQA 3KPPA 3BP5A 1I3RA 2BZDA 4WFFE 1JYVA 4R6UA 3QDJA 5D1ZC 5IP4A 5CS7A 2G5RA 4G6ML 8FABA 3VWJC 43C9B 1FL5B 5DA0B 2P24A 3VFMB 3VD9A 2VKWA 3O3AB 1N64H 2EDQA 2UYLA 5IBTL 3TT1L 2B4CL 4POUB 2IBGA 4IHOB 1H5BC 3NMEA 4I4WA 1A7PL 2OR7A 3X12A 4PRPD 5FDWA 1F6AB 3C6SA 4G43A 2OR8A 3WBDA 4Y5YC 4H0GA 1DQDL 3QDMB 1NFIB 4JG1H 5KZCB 3ARDC 1IC4L 4GRMA 4UUJA 4MJIA 2XWJA 3WD5L 3QUXC 1QSZA 3O0RH 2CRMA 1NPUA 2CIIA 5JA8B 5CLTA 2D0GA 1BFSA 4YDIH 1X5ZA 4NOBA 3RDTA 3WN5A 4U1LA 3PWJA 1N0LA 3SPVA 5DSCB 4K94C 3V7AE 1FG2B 1MJJB 4NOFA 4CADA 1FG9C 4PJ9B 4NP4H 3CFKB 3RGVA 1YDPA 1M4KA 3BESR 4M6OH 3PGCA 4AH2A 5KTEH 4IRSA 3ORJA 3RTQB 2YUZA 4PJXE 1FNAA 2MWCA 2FSEB 4OAWA 3BP6A 5MENB 1DQQB 1RV6X 1QSEA 2VLKB 1BD2A 6FABH 3GK8H 3HI1A 1RIHL 3U9PL 1DUZB 4AG4H 4RNRB 4NQDE 1JN6B 4LF3A 4NKMA 1UJ3B 3MA7A 4JB9L 5BVPH 1VFAB 3PABB 1GAFL 4FTVA 3VXMB 2VH5H 4F7TA 1X6NA 4CVZA 2XPGA 1XF3A 3I6KB 1AXIB 2WIIB 1OW0C 5CZXD 4GSDH 2V2WA 2FX7H 4OQTL 1T3FA 4MDIB 4ACPA 1SY6L 3P30L 4K2UH 1RZGB 1SYVA 2VZOA 1DEEA 4P57B 5FYLL 1MQKH 5E8NB 2X4UA 3BN9C 3IRZA 3TO2A 3K1DA 2R4SL 3W2DH 3NH7H 4MJ2A 2R9HD 4QWWC 4HJJL 1BMGA 2IWGA 3VI3E 3ULUH 2WSKA 3SGKC 3BN9D 4CMMB 2H41A 4BQCA 4LCYB 4WDIB 4LSUL 4K3HA 3OAYK 1AQKH 3WJJC 2UZXB 3KYOB 1GIGL 4LCUB 5I19L 1R5WB 1SJEA 4LLAA 4PJ5B 5INCA 1BPVA 1R3HB 4M03A 4AM0B 2XWBB 4YAQB 5KS9E 1NCCL 4HKZA 1ZVHA 3KHQA 5HVGB 4PJ8A 2FZ3A 2CJUH 5DO2C 5ITFB 4WU7B 1NEUA 2JB6B 3MV9E 2GJ6D 3U4EB 1BFOA 1CXFA 5BMFL 2N4IA 3WFDH 3DUSA 3OPZL 5I76A 4OGXH 3IT8D 3ZKNC 1Y0LB 4EUPB 1IC5H 2J5LB 1BECA 1YY8B 1VACB 3DX6B 5F89A 3SKNA 1FVDA 1W8OA 4TSCL 1CICC 5EWIL 4I0CC 4X7FC 5BVJA 1CDIA 3GHBL 5C0FB 3MGOB 5AWNL 3TIEA 3BEWA 4B50A 3PJSA 5D1XD 1Q9KA 2CO6B 2H9GB 1FYTA 1FH5H 4DQOH 4WUUA 2HT2C 3UJTH 3H6JA 4MAUL 4LSSH 5E24E 4IMKA 1VFBA 1UWXH 2DQTH 5E2JA 2ZUYA 3VFRB 2QQLL 1S7QA 2WUBL 4OBRA 2BVOA 3MLWH 2QQLH 3O4LB 5C0JB 3IGAA 4X4ME 5DI8A 2X4QB 3JWOC 3JV6A 1LDPH 3CFBB 2AJXL 1K8IB 5GGSA 3IXAA 4M6AA 2WBKA 4WTZA 4P48A 4Y1AD 5KTEL 4TRPH 1HXMA 1HWGB 1CLZL 1NCWH 1RPQA 4F9LC 1WTGT 4FMKA 2LU4A 3LMJL 4PJHB 3VMPA 5C0AD 4RNRA 4XVSH 3VFWA 4BA8A 5GSRB 1JN6A 5ALCL 2EDXA 5FUZH 1WGOA 1R0AH 1A7RH 1NKOA 1FV1B 4GOSA 2NY0D 2OXGA 3QUZB 3ZT6A 4JHZA 1LD9B 3B5GA 4NWUH 2KH2B 2FJGA 1KB5L 4GMTH 4LVOC 4PJBF 3LQMA 4OCYH 4KRLB 1WZ1L 4WWKA 1UT9A 4OGAC 1MHHA 1VFBB 4D0DA 4JM4H 2BFVH 4GKOA 1U8KA 43CAB 2BFVL 2YUXA 4J4PC 2YR3A 2P5WB 2FLRT 4HF5H 5D5MB 1G9MC 1QKZL 1S7XA 1JHLL 4HF5L 5MERA 3E2HB 3HC4L 3ZMRA 2B1HH 8CGTA 3CFBA 4FFVD 3GSOA 2X9WA 4LPWA 1FC1A 1X5JA 3FB5A 3RL1A 3ZKMD 1C5CH 5I17B 2CLVA 1LVEA 5C0ND 3QHFL 4UINH 3SDXA 4F8TA 2HKFL 3UTSD 3RHWK 3LB6C 5DVMA 2QHLA 4X5LA 1IGCH 3DV4B 4M4RA 3LKPA 4IIQA 2E7HA 4G8GE 2BOCB 4N0YL 3GJFB 2VLJE 1RUPH 4YX2H 4JFDE 3STBA 2Z8RA 5TFSH 1GC1H 3DVGA 1RMFH 2FR4A 1QFWL 4YWGH 4M61B 4U1JA 1EZVY 3T1WA 2PW2B 3ARBA 3LS4L 3G6DL 3B2UD 5I1JH 4NKOA 4OCXL 5HHOE 3QJHA 2AJSL 1RSFA 4XCNB 1F8TL 2EDBA 2V5MA 5F89B 3SKNB 3FQTB 3MMEA 4L8SA 4G8IA 3A6BH 4NM4H 2DQHL 4H8WH 1JFQH 4YFLF 1DVFA 4LAQL 2Y5TB 3PWVB 3FN0L 3T0EC 1EHLH 3MGOA 5JIHA 1KJ2B 1VEOA 1XGPA 4AMKH 3PG2A 3TVMB 1JPTH 3FJTA 1S5IH 2UZYB 5L8LB 1JPTL 4Y4HB 3EYUL 5TE7L 4Z7WF 1AO7D 4G7YL 4GMSL 1GJIA 1GPOL 1LK3H 1I1AB 2J8UA 2BSTA 5IMKB 4K9EL 4YDJB 1CE6B 4C58B 3OTTA 5JW5B 2IFFH 3NCYP 2BRRL 4OLWL 3QEHA 1LEIB 2DQCL 5F44A 1FFPB 5DQDH 5CBAB 5IMOB 3NPSB 4B0MM 1WFUA 4QRPB 3E8UH 4JQVA 4X8JB 4M6NH 4B7IA 3UTQA 1CS6A 1CGXA 4RBPK 4YXKH 2O93L 1A1OB 4AEIL 3O2VL 3S35H 4X98B 4KK8D 5F7LB 4TVPE 3RWHA 3S9DB 3QAZB 3U4BH 1CFTA 4ZS7L 3TGXA 4Z78B 3AS1A 3CXDH 1UB5A 4KK8C 4MNGE 3ARGB 3VFPB 1F6FB 3ZKXB 2O5YH 4XMPH 3CDGB 1D5BA 3QYCA 2JF1A 3PWUB 4BK5A 2C7UA 1XR8B 2YEZB 2G75A 4R7DA 1AGBA 1E27A 1KIPB 1HH6B 3DROA 4X6DF 4EEEA 1PX3A 1OP3H 2UUDH 5I75C 2PCPA 3IDJB 4JY6B 3U46B 3KPSE 3GSVA 3X3GH 3AAZA 1PYWA 3D9AL 3DX8A 5D2LB 3SDAD 2FHCA 1NMAH 2UWEA 1WC7A 1MCOH 1OGAE 1N0XL 3DSNA 3INUH 4XNZC 2NX5B 5F97E 1K2DB 3SQOL 5LXGH 2YRLA 3T0DA 4U1MB 3GSXA 4X7TA 1SJHB 3MV8D 1RUAH 1KC5H 4UT7H 4BKLB 4NRYB 3LV3B 1SMAA 3VXSA 3QUMA 4PBXA 5FOJA 1BIHA 3RU8H 4Z77B 1Q9WA 4PTUA 1BZ7A 2R1XB 2HYMA 5KG9A 5JORA 3P4NA 2ZSWA 1UJ3A 1T83C 2X2YA 2BY2A 2A6IB 1IT9H 1HEZB 4JQXC 1IT9L 1XZ0B 1F3DJ 3EJYD 4NBZB 1L9NA