3GBNH

Crystal structure of fab cr6261 in complex with the 1918 h1n1 influenza virus hemagglutinin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
187
structure length
160
Chain Sequence
EVQLVESGAEVKKPGSSVKVSCKASGGPFRSYAISWVRQAPGQGPEWMGGIIPIFGTTKYAPKFQGRVTITADDFAGTVYMELSSLRSEDTAMYYCAKHMGYQVRETMDVWGKGTTVTVSSASTKGPSVFPLGCLVKDYFPEPVTTFPAVLQSSGLYSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin
publication title Antibody recognition of a highly conserved influenza virus epitope.
pubmed doi rcsb
source organism Influenza a virus (a/brevig mission/1/1918(h1n1))
molecule tags Viral protein/immune system
total genus 28
structure length 160
sequence length 187
ec nomenclature
pdb deposition date 2009-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gbnH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gbnH02
3BQUC 1J5OH 1PQZA 2IJ0C 2PO6D 3BPOB 3MACL 2DDQH 4IMLA 1PKOA 4Y5YC 5J6HB 3MLVL 5C7XL 5HDOA 2IPUG 5GHWH 4HWUA 4OKDA 3EKCA 4KI5C 1WTLA 3MGTA 3MRHB 1QACA 1EAPB 4LSQH 4KMTL 3GBNH 4QRSA 4GW1B 1EGJH 4QHKI 2YBRB 4WEMB 5GSRB 2VLKB 4M1CD 5E2UL 1ZWIB 2AI0H 5FKPB 2CKNA 4IOIB 3S88L 3DROA 3B9KD 4JY4A 3D85A 1FNEA 3SY0A 3QAZC 3VWJB 3L3GA 1L0QA 2HLAA 2Q7YB 4DW2L 4U0RB 1VHPA 1ZEAL 4Y4FC 3D2UD 4I77H 5J6GB 2ATKB 3B9EA 1CF8L 3V5KA 3UZVB 2FJHA 4KQ3H 1UM4L 4U3CA 4X8JA 4XVJL 3X3GH 5BS0E 1N5AB 3VRJA 4FFYH 1RJLB 2PR4L 2XTJE 4H20H 2Q1EA 3QZWA 5D1QD 4JFOA 5FHBH 5TDOA 4NFBA 3M1BA 1ES0A 4UDTA 4IOFC 2BVPB 4NM8H 4QT5A 5E6ZA 1FC2D 4TUKL 5DJCA 1EEZB 3U30B 1TJHH 2DICA 4PJEF 1MCBA 1XF5A 4AEHH 3DTXB 3L3KA 1KCKA 2BFVL 5HI4C 3BIAX 5LQBL 1JGUL 3MRJB 2ESVD 4ETQB 4G43B 2I07A 3O4LD 4P23C 5H37G 4MLSA 1U95A 4HCRA 1FIEA 2VO5A 3MRRA 3VDCA 5E99H 3HC3H 4TQEH 1YQ2A 3HG1B 3BP7A 3O6LL 5LBSL 5JW3L 1UENA 2VZSA 2N56A 3N1QC 1E27B 1WAAF 1VKXA 5IB2B 1DLHB 1IKFH 1V3JA 4TRPL 1OAYH 3QEQD 4OV5A 1I1CA 4XX1G 4PS4L 1QHOA 2XY1A 3LN5A 3KPOB 1KACB 4K9EL 1NFKA 1G7MB 4FP8H 3ARDB 4PJHA 4PB9H 4U6VH 3VXUE 4U05A 1J86A 2C1PA 1FYHB 2X9XA 1T5WA 4DVBA 1FV1A 4BQCA 1IGCH 3MBEC 3IJHA 3WJJA 1JF5A 1NJ9B 1CR9H 4MHHI 4QRPE 5H35B 3VXUA 1XF2A 2NY2C 1HHIA 4AEIL 3IETA 2PN5A 1I4FB 5GGVH 4NQVA 3TC9A 4ZS6D 5LGJB 2AP2A 5MI0B 1YEJH 1UEYA 3MJ7A 3QHZH 5FK9A 3CVHH 3TT1H 3TIDA 3KPQB 4QRPA 3MV11 1B0GB 2Z31A 3PWPE 2D7OA 1UGNA 2WLYA 3P73A 3H9SB 4RMTA 1TETH 5F6IC 3R8QA 5C09A 5BV7C 2PNDA 2VXSL 4PY8J 3SKNA 1IEAB 3DRTA 5L9DL 1LO3L 4X5WA 3GRWA 4BQ6A 5F7DB 3CPLB 4ZQKB 1IQDB 4APQC 2EYTA 1G9NL 1OGAE 3U7AA 4TTDD 3MACH 1JFQL 3GMMB 3QWOB 4Y16B 1A6ZB 3OHXA 2DTSA 3RL1B 1HIML 2VZ3A 3QIBB 3I3EA 4UT6L 4ZOEA 3LB6D 3MLVH 4ODBD 5C7XH 1ADQH 4W81A 4O58L 3UMTA 3EJZD 1I9IL 4UDUB 3VFRB 1Z9MA 3JV6A 3S35X 5ESVB 2NQCA 1MI5B 2Z91A 4PR5B 1EJOL 4XXDB 5C0JA 4LFHD 1QBAA 3OG6B 1U8MB 4EBQL 1RZGB 2XTLA 5I8OL 1EXUA 4Z7VF 4ZFZB 3F12A 1KENL 2KKQA 1QVOA 4XCYA 2PXYB 4H88L 4RFNC 3L9RA 3ULVH 5DQJB 3FT3A 1T7VA 5ID1A 3U83A 5DMYA 1FFOA 3C09C 5E2WL 4WU5B 2VERN 5DC4B 3GIZL 3JBG7 1WC7A 1P53A 3U0PA 1AC0A 1KN4L 1BREA 1T1WA 1ZHNA 1RK1A 1UM4H 4QXGH 3UTPE 4YHPA 1DANU 1E4JA 4ELMA 4X99B 3T0XA 5J8OA 1U8LB 2W0PA 1OQOA 2PR4H 4XH2B 3UTTE 3W0WE 3HCVA 1JIBA 3G08B 4O2EB 1IKNA 4LCIL 2DQUL 4G6JH 3ARFC 2J8UF 4AT6B 3N50A 4F9PC 5ADPL 5H94B 4Q6YA 2AJSL 4UOW0 4ZD3L 1CFVL 2VR5A 4NQCB 1KELL 2XKNB 1CFSA 3HR5A 3T0EA 1G6RB 1TJGH 3DX7B 1ZAGA 4LOUD 4TUKH 5L2KE 4PJCF 2PTUA 1MJJB 4U1NA 3C6SB 4X0KB 5F1IB 3Q6FB 3LEXA 2HP4A 4DWHA 2BFVH 5LQBH 3ZT6A 5EORL 3MLUL 1JGUH 4GSDL 1F02I 3RQ3A 3IAPA 2XICA 2JJTC 2V5YA 4Q9BA 1OB1A 3GSQA 4QXTA 4S1SH 4YFEA 1AY1L 1QLFB 4LIQE 4FQ1L 1KIQB 1H3VA 5SV3A 2F53D 5I8CA 1R0AL 2I9LA 1S7SB 2WK2A 3OSKA 4DVRL 1UYWH 5LBSH 1I85A 1YC8A 4TSAL 4QTHA 5JW3H 1BIIA 4LLUB 3WMSA 1WVZA 5FEBA 2XOTA 1DBKH 4BSVA 3BIBX 2OX5A 4J3SA 4TRPH 4ISVB 2ICWA 4LGPB 4PGJA 5GGUB 2OQJB 4WO4A 2DYPB 4P4RB 1N59A 1QUNA 3GMNA 5FYKD 5IHZB 3AS1A 3NTCH 4ZPTB 2O61A 3TO2A 1NUNB 3BH8A 5HYJD 15C8H 5KS9E 5E5UB 2BP3A 4AEEA 1R3HA 4WUUB 4ZO6A 3L7EB 2H45A 3UP1A 1BBDH 2BVUA 2ZUQC 3QUYB 5FDWA 1D6EA 1FFQA 1UC6A 1XFPA 1KV3A 5ALCL 5I6XB 4QOKD 1RZJL 1A7PL 2L7JA 3ET9F 3ULUC 3QIUD 4JJ5B 2X4QA 3CDGB 3QXUA 1RURL 1Q9WA 3DSFL 2GJJA 4F9LC 1NDMA 1TNNA 4X6DE 3F6IA 1JUFB 3VWKD 3RZCD 5D7KE 4WTXA 2V2XB 1ZVYA 4MAYA 3U82B 2HTLC 4NQXA 4DKFH 3GSOA 5DMGD 5T1LD 1TVHB 5DRWA 2Z93B 3L95A 1JTOA 5LGKA 3K0WA 4EDWL 1R3KA 2VXSH 1LO3H 4EDXA 1J1OH 5CKGA 3BH9B 4PJAE 5SWZE 5FOBA 5FAAA 3WS3B 4JCLA 3VW3L 3QP3A 3L3JB 3DO3A 3IXTA 2BHYA 5DUPL 1W8NA 3VFNB 1UVQA 2P5EA 4BFIB 2CK0L 5I9QB 4AH2B 5JW4R 4F57L 4JFYA 5JIIA 2BSSB 3OZ9H 3BESR 4O58H 3TNMA 1PG7W 1I9IH 2X1PA 4JFHD 1WUNT 3TESA 1LO5A 5I2IB 1IGYB 4BFBD 3OKOB 4ONFL 1J0JA 1FIGL 4IRZH 1JCKA 1I9JH 1VGEL 2Y1VA 5K9KB 1JNNL 1KEML 1EJOH 1SEBA 4Z7UB 4UNUA 4RISL 4HXBH 4CRPA 4EBQH 4BJLA 2BHZA 5AEAA 3RGHA 2X4PA 4NKIL 3BWAA 5CHNB 1VEOA 3BQUA 4H88H 4PLKD 4JAMA 3KDMA 5DJZB 3IDYC 4ZXBB 1RMFL 1LILA 4GW5B 2XZZA 4QYOB 4X5XA 3ZE1E 2F58L 1CL7I 2DQCL 3NGBB 3CX2A 3GI9L 4MX7B 1LO2H 2FL5A 1XF3B 3HS0A 4HBCL 5E8DL 2V7HB 5CGMA 3GSXB 4OF6A 1F90H 1NGPL 1XGRA 4HPYH 1HZHL 4QRRE 2PW2A 4XB8A 2BXZA 1RUKH 4LQFL 3FFDB 2X4UB 1MFNA 1F8TL 5IOPA 3FRPG 2DQUH 1TENA 4RDQF 3L5WB 4FXGB 4IBLT 3I50H 1JWSA 5DMJB 5FKAA 3BKCH 3UX9B 1OGTB 4W6XB 2VIRA 4I3SH 2LVCA 2WAHA 4RGMC 3D2UA 1B4JL 5EO9B 4ZD3H 4XPGL 1CFVH 5EZOL 3DO7B 3X14B 5EBLB 1L7IH 4DN4L 2A1WL 4JLRB 4NRYA 4QHNB 4Y4FA 1FO0B 2OI9B 4ZOCA 4NO0D 2YK1L 1U42A 1WZ1H 2LE9A 1F2XK 3BJLA 4S1DD 4DTGH 1FCCA 5IB5A 5DLML 1K4CA 2NY3D 2YEZA 5ETUB 2FATL 1OTUC 2V7NA 1AY1H 2EDXA 3O3BB 4L4VB 5HI5D 5KBNC 4FQ1H 1J10A 2BMKA 1CD0A 4C83B 4JHAH 4DVRH 1C8PA 3MRGA 1T20A 4J1UB 4MA1B 4XBPA 3DX8A 1DVFC 5IF0A 1SY6A 4I9WE 5EDXA 3WUZA 1S7VA 3TJEH 2ESVA 1IMHC 3ZHKA 2MQ3A 5B38A 4PB0H 1JF1A 2APBA 4Y8DC 5C0CB 4JDTH 3R0NA 4UINL 4KKBC 1YEFL 4KQ4L 3OB0H 4Z0BL 4R7NB 3QFDA 1G7IA 3WS6C 3MOQA 5T3XH 3BKJH 4P23A 2IG2L 3TFKD 2R29L 1OTTC 3SGKA 2DQIL 5ALCH 4N1HB 4PJXB 1P4LA 4RZCB 1RZJH 1ZOXA 4TYUA 4JRWA 2NX5A 1U8QB 3BIKA 3REVB 5I17A 5I18L 1RURH 3BXNA 4HK0A 5FGBA 3VXMD 5IB3B 1I7RA 4MNHA 4HKXA 1HYSC 1F13A 1JV5B 4KGJA 3QI9A 3B83A 3TLRA 3QA3B 5EH1A 3UPCA 1UH3A 2GITB 5T3ZL 3RX7A 3MROA 5HVHB 1FVCB 3TBYB 2HVKA 4LKXB 4H1LB 4P4KD 4KDVA 1DQML 5FM5M 4F7EB 3QWRA 4EI5D 1A3RH 1CICC 2CJUL 2W60B 3WO3B 4Z7QE 4NJ9H 1S7XB 3OB0K 3MBEA 4LGSB 4EN3B 4YQXL 4QTIL 4OSUL 4V1DB 4IIQB 4ODWB 3DSNA 4L3CB 3O6FD 3BSZL 4PJ8A 2NR6C 1S7UA 4DGVL 2CK0H 4NKOB 1ACYH 4NNXB 2YPLE 4P5TB 2CLVB 3CK0L 2WWMD 4Y2DB 1FNHA 3KPRD 5GGQH 3K81A 3AS3A 3I9GL 2OSLA 4XPHL 5E7FA 5IMLA 3G9AB 3T1WA 4U1HA 1FIGH 3RWJB 1HXYB 3VMOA 5L0QB 4FZ8L 4YC2B 1JNNH 1KEMH 1MCLA 1KC5L 4APQA 1EFXA 5JMRA 4L8CA 5TPWL 3C2AH 3ARRA 2DLFL 5BXFB 2PYEE 1RMFH 3A0OA 3SE8L 1PBYA 1ZT1A 3TBVB 1QP1A 5DF0A 4UV7L 3TCXA 2VUOA 1HH6B 3B9VA 2HAZA 5KZCD 5JPMA 4WGVB 3V95A 4CU8A 4HH9B 2FIRT 3SDXA 1CXIA 3MA7A 2IAMB 2GFBB 3PL6B 3KJ6L 5BW7C 1NGXB 4MQXC 1DBAL 2W9EL 2WQ8A 3C60D 4H1LH 4PJGE 3EZ8A 3ROLB 3ARUA 4K8RD 4LCUB 3FCTA 4JY6A 4OAWB 1YJDL 3F5WA 3RWDB 3ARBD 1E28B 1KCVL 4QHUB 4KJQC 1CXEA 5CBAB 3MRDA 2IWGA 3WUWA 4OD1H 1A6PA 1R3JB 2P24B 3F62A 1B4JH 4GG8A 3CXDL 4ELKB 5E95B 1TVDA 3HMXH 5EZOH 4HWZB 2DBJA 4DN4H 4MCZA 3TBSB 4BELD 4KRPB 3UXFA 1RY7B 4JPVL 5IB1A 3QRGH 3GMQA 1NCAL 5AZEH 5IJVB 3ULVF 2R1XB 3DECA 1EBAA 4LCWE 2QADC 5JW5A 3MZTA 2EZ0D 4I2XE 2A74B 5DLMH 6FABL 3AS2A 3T8XA 4HLJA 2FATH 5C0BD 2APFA 1J0YA 1I9RL 2AXHA 3VFTA 1FCGA 1U58A 3HC0A 5D6CB 5DRNA 4Z7NF 2DQHH 1ERNA 5F97E 4MNGB 4RAUA 5C6TL 3FQTB 1O7SA 2Y7QB 4XP1L 1B2WH 1NGYB 3TGXA 2ATPB 4AYFA 3OBAA 4NSKA 3HE6C 1D5BB 1JPSL 2X44D 4P2QD 1GSMA 4UINH 1CQYA 4KQ4H 4Z0BH 5B21A 3HC4L 1TQCB 1GZPA 2F53A 4QY8A 5FGCB 5K9QG 1I1AD 2JJTA 1G9MC 1GJIA 1O7VA 2IG2H 3B6SA 4JPIB 4RMUA 1I1FA 4LPXA 3GSUA 4KFZC 1OWRM 1S78D 2DQIH 5D5MF 2X4OB 3CH1B 4A2LA 4K3EH 1QLRB 5DEGB 3C8HA 1LO0L 3QEHA 3CXHJ 2FYYA 2YZ1A 4JGJA 1P6AB 2HVJB 3LSOB 3RJDA 1MHCB 5I18H 2VDML 1F4YH 1N4XH 2HN7B 1AO7E 1PY4A 1FBIL 5HYIA 4OCYL 1QFOA 2AS5M 4NQUA 1QNZH 5T3ZH 4QXUL 3O41A 3EOYG 1UXSA 4EQ2A 3ULUE 4GKZA 2YRPA 1AO7A 4ZDHB 4Q9QL 5HD8C 1DQMH 1QSZA 4YBHA 4PLJD 4QOKA 1BQLL 1YEHL 4NN5B 2VWEC 5E5MB 3WIHH 4Z78A 3QIUA 2CJUH 4HJJL 3CFEA 1KYOK 4X7SL 2J3SA 2EE9A 1ITBB 3GIVB 3QJHB 2P7TB 4JM2B 4MJIB 4WNQB 1YEIL 3VWKA 4JG0L 4LRNL 2C4FU 2C5DC 1MEXL 4YR6B 3ILQC 2ZOLB 2JCCA 5DMKB 3BSZH 5CD3B 2FR4B 3LEYL 4IDLA 4JN2A 1BFSA 4HLZG 5T1LA 1JZ8A 5HHME 1LWRA 2Y5TA 2XWBB 1CT8B 3FN0L 4G7YL 3GHEL 1NGWB 4HKZA 1FZMA 4YHOL 1CDCA 4XMPH 3NH7L 1KYOJ 1TZHA 1BAFL 5MEQB 3I9GH 1ZXQA 4XPHH 5CP7B 4RRPA 1PKQA 2VDPH 4FZ8H 3FFCB 1L9MA 5C07D 3OJMB 2IF7A 4YDVB 2HH0L 1NCCH 1DQLH 1XR9A 1ZT7A 4ACPA 1IAIH 1MCEA 1GCFA 3ME0A 1T21A 1N6UA 3H7BA 5F88A 2DLFH 1EV2E 3FB5A 4HV8B 5CZXC 3SE8H 4POZD 4LAJH 4XCNA 2FEEL 4UV7H 1S5IL 4RIRB 3O81A 4G8GB 4XPFH 1LP9F 4MMXC 5KANI 1U2CA 4ZYKB 1J0KA 5LWYH 4OZGF 4YZFE 4BK5A 3HRPA 5F1NB 3RTQC 1RK0A 3QCTH 1A6TB 4BM7A 2EDYA 4P9HH 3UZQA 4NQED 1RJZB 4QRUB 4HJGA 4J4PC 4HS6B 4HXAL 4P49A 3WFZA 1ND0A 2KBGA 1UZ6F 4XWGH 4PV8B 5CSZB 5E8PA 4K23H 3UO1H 3CXDH 1P69B 3R8BB 1K2DB 1FSKB 4LDOB 4Y1AB 2CKBL 5A1AA 3ZKSD 4YHML 2Q86B 3MRQA 5MERA 3P9LB 3U0TA 4JPVH 4H0GA 2VDOH 3O3DB 1HQRB 1NCAH 3S36H 1C12A 2NYYC 4C56D 4NO2B 4X6CE 2IH3B 3VFOA 2WMPA 3RVVC 5F7MC 1KN2L 3QDHA 5FYLH 1SVCP 1YNLH 3QG6A 5KSAD 4FXKB 2AJXL 2DQTL 4LVEA 4NO0A 3NA9L 4ZO9A 5EUKB 4X4XA 4OLUL 3VD3A 32C2B 3KHQA 4XP1H 2HFEB 1FFRA 4OCMC 4I0PB 4XBGB 3PHOA 2H3NA 3GB7A 3W9EA 1AGCB 1SJHA 1BFOB 4YX2L 3ILPB 4GBXC 5CJQH 5I74B 3TCLB 1JPSH 2LU4A 1RULL 1IC7H 2RCSH 2VLJB 2MQ0A 1FVDB 1IGFL 5FO7A 4ZUTB 4HHAB 3K7UA 3RU8H 1VFBB 4PRAA 4I48A 2QQLL 4K7FB 1IAIM 3PGDB 3S35L 2D7NA 4XGZB 1HSBB 2ENYA 1LO0H 2X5PA 4IOSD 2EDKA 5D2LA 2VDMH 2YRLA 2OTUB 4LARH 3V6ZA 3UTPD 1UXWB 1FBIH 1MH5B 4OCYH 1U2HA 2UWEB 4N0FB 3RJQB 3RL2B 5T1KB 5BOZG 4F37K 5C0GB 1E4KC 5HGAA 1IC4H 3RWIB 3SPVB 3UTTD 4QXUH 4R0LB 4NFDA 1K8DA 4FA8A 2D7PA 2YOCA 1AE6H 4Q9QH 3PIQB 4JFDD 5GS0C 4NQSA 2IFFL 1LGVA 4HJJH 3C6LC 3BUYA 2ITCA 4X7SH 5M94B 3LV3B 2W0KA 1N5YH 2C7UA 1NGQL 1WFTA 4PJIB 3SDAB 1XGPA 4WEBL 4F58L 3BE1H 1YEIH 2XNAB 1MEXH 1F3RB 3DX9B 4CVXA 3T08A 1Z9SA 1ULVA 2ADGA 2VITA 3E0GA 3CFJA 3EJYC 4KJWC 4N8VB 4NQDE 3ETBF 1QFUH 4P4KA 1ZKAA 3U6RA 4G7YH 1KPUB 2APXA 4DQOL 3ZYOA 5CGTA 4Z7OE 3FQWB 4YHOH 2X09A 3JV0A 3NH7H 4U1IB 4U1JB 2KL6A 3Q2CA 3PHQA 3SDCB 3MV7B 2EXWC 1BAFH 3FB6B 2K9UA 4GRWH 3IDUA 1A6AA 4NQDA 5DJDB 1T0NA 4KKAD 1JL8A 1CICA 1QG3A 1BMGA 2UZIL 3EFDH 1VADA 5CZVL 1T83C 2VSCA 4XP6L 4KXZI 1NEZA 3AXLB 3VRLE 1S7RA 2HH0H 3O6FA 2Y06L 5DK0B 4M48L 4FXLA 5HHOD 3C2SA 1RIUH 2YPKA 1U3HB 4MD4A 1UH2A 3MOAH 3SGDH 2QR0B 2DJSA 3QQ9D 1A1MB 1OAQL 2LU7A 5T1DL 4D9RE 1FL3B 4JB9H 4Q2ZA 1XGYH 4I18A 1I7ZB 1X6LA 1QSFD 4HCRL 1KLUB 4MA3B 1A4JA 3I6KA 3QCVL 4LVOB 1EH9A 4HDIA 4NO3B 4Y5VB 1LE9B 1CDBA 1WBXB 3O2WL 1KCRH 2NNAA 5C0EB 2X4NA 3HMWL 4I3GA 2IEPA 2MKWA 2NTFB 3TP4A 2AJZB 4XNMB 4KDTC 3RWCA 3S3SA 3I75B 1HKLH 4R96A 1JPGB 3QDAA 2P46B 5DUBA 2Y07L 4XCFH 4E9LA 1WBYA 3T77A 4ZTOL 3RKDD 2CKBH 3DV4B 4MAUH 5GRUL 1UG9A 3SO5A 3MLTA 3BZ4B 5SWSE 5HPMA 1I8IA 4F2MB 4KJYA 5GZOD 2ZOKB 3QFJE 4NKDA 3EYUL 5DJYA 4DAGL 2RGSA 1MUJA 5HSFA 1ZSDA 3UPRA 1IT9L 2FSEA 4UILL 1AFVH 1Y0LA 2H9GB 4OZHB 1DQDH 8CGTA 1IGMH 3DGGA 1M71B 5SWSA 1KFAL 4K3JL 4K2UH 2KUTA 2D31A 2X41A 7FABL 3MR9A 4Z77B 3UPAA 3CMGA 4X6EB 3BEVB 2V9QA 3DYPA 4MA7H 3ARED 2C3GA 4XC1L 5CJ8A 1JGDA 1UCBL 2W0FB 1J88A 1H5BC 3VMPA 4OLUH 4HUKB 3N0PB 3KPSD 5CEZD 4QRTA 1IJ9A 4JFFE 2WUCH 2PW1A 5I1GH 2BC4A 4YNYA 3JVGC 5JZ7D 2N1KA 3G6JB 4YX2H 3GRWL 3WXWL 5C0BA 1M7DA 1RULH 3P0YL 4HEPG 1G7PB 5EZLB 3DVNB 5JNYB 1IGFH 4PRDB 2NY0D 3SE9H 3UJIL 5AD0A 5TQ2L 5I0ZA 1A9BB 5HGDA 4X6FA 4N5ED 3HAEB 1HHJA 5IROC 1JP5A 5FM8A 3S8WA 1RUPL 2M1KA 2IPTL 2HT2C 2IQ9H 2BOBA 4DK6A 1BFTA 4P2QA 2NZ9D 5JOFB 1YMME 2V9RA 3HE6A 3S37X 2FECL 1PX3A 3WHE1 2GT9A 1A4KB 3MC0A 5GISL 4D0BB 5MEOB 4H5SA 1I8LC 3VE0A 1XF1A 2RJMA 3TIEB 4A6YB 5IKCA 1JI1A 4OCRL 4TVPE 1H3WM 4OZIA 4WEBH 3MUZ1 4F58H 5F3HA 1G7JA 1CIUA 2YUWA 5HY9A 2AXGA 4R3SB 4TOYH 2Q8AH 4G3YL 3T4YB 2VWEE 4D8PA 4L4JA 4JE4B 4NKMA 4ALAH 4P2OD 2BSTB 2XRAL 4WVRA 4DQOH 3TJHC 1WWBX 4QHLA 2QQQA 1HILA 4NRXA 4ONHA 1VEMA 3O2DA 1HQ4B 3MJ8A 4JQIL 2K3TA 1RHHB 2UZIH 4XWOD 5DR5H 4Y88A 1BX2A 2ADIA 5IMOA 4XP6H 3EFFA 4L3EE 2OP4H 3MODH 1AHWA 4MB3A 1A0QL 3OKLB 4M48H 43C9A 3PG2A 1N64L 3UTOA 4IRSC 4M7LH 4YE4L 2EYSA 3QDJD 4PGBB 1DN0A 2HG5B 2FZ3B 4AQOA 1T1ZA 5D2NB 2X1XR 3BAEL 3T0BA 5T1DH 1CLYL 4A2MA 5D70L 2CR6A 3QCVH 3TO4C 3JTTA 1YECH 3WHXB 5D7SL 1F4XL 1F97A 1C16B 1I3VA 3B43A 3O2WH 3HMWH 3GSWB 1K3IA 1AIFA 4Z76A 4AIOA 2CDFB 3QUXD 3VG9C 2GUOA 3T04D 5E9DD 1KB9K 2MHAA 1FFNB 4E41D 1OAXL 4IJ3C 5JOPE 1CBVL 4PIRF 3O9WC 4PY8I 4FMFA 4FQLH 4OCWL 1T4KB 3ULSB 4M3KB 5AUMA 3H9HB 2J12B 4GKNA 5D1ZB 5HGGS 2NY2D 4PRPE 3PQYE 5EIQA 3TZVD 4HPOH 5TE6L 1FLTX 1IT9H 4OKVA 2J7LA 1A02N 4X5LA 5CIPB 2FIKA 2R9HD 5HYFA 1BP3B 3RTQA 3STZA 1D7FA 3QWQB 3GHBL 3GSVB 1CGSL 3BT2L 4HZLA 4FQCL 4N8VG 1FAIL 2W9DH 7FABH 2VZVA 4J4PA 4O2FB 5I8EA 4PJEE 4TN9A 5ISZB 4OZ4B 2YPLD 2X4TB 1S9YA 1MRCL 4NWTH 2CXKA 4G8EB 3BPNB 3EYVA 1DUYA 1CDGA 2R2EA 3MRBA 3TVMC 3FQUA 1GGIL 2RBLA 4OZFG 4PJEA 3W39A 4C56A 4PRNB 2AERT 3WXWH 4P3DB 4Z7WB 1A9EA 3OKNB 1G9EA 3BPOC 1J18A 1SJEA 3OXSB 4J6RL 1QR4A 4E0RB 2H6PA 4YWGL 3VRIA 2XWTB 3UJIH 1CXFA 2EDJA 2EYRA 3JTSA 2AQ3A 2DKUA 5INDB 3F7VA 3VFPA 2W59A 1INQA 3O6KL 1FH5H 5JHDB 2VZ1A 2VLRB 1DQJA 2BNQB 3FT2A 1Z5LB 1WAAA 5IHUL 4KROB 2FJGB 3MRNA 5ESAA 3CMOH 5BVJA 4F37F 1N6VA 5KG9A 4NN6B 4JDZB 4HF5L 1H3XA 1FFPB 4OIBA 1BGXL 4GBXA 5BCAA 3CVIL 2VLKD 5J13B 2VLLB 5E8OB 3MFFA 2AJ3A 3E8UL 1ROWA 5JDSA 2EE3A 5EU5A 4JR9L 4LU5H 1GGTA 3VWJD 2R69H 3QH3A 2AV7A 4OCRH 5EBMB 4XI5D 2APVA 4LBEA 4HX1A 2C1OB 3MV9B 5FYJD 3WLWC 3G5XB 2F8VA 1N8ZA 4FZEH 2J5LC 5FUZL 3WO4B 2P8PA 4HG4K 1JNHA 3ROOB 4F7TA 4LCWD 2R2BB 4G3YH 5DC9B 5ICXA 4KKCD 4EEEA 1E4KA 2FJFB 3EYOB 5C0AB 3S96B 5FGRA 3C9NA 4JFDA 1LEKB 4JFEE 5TE4L 4IDJL 1ONQB 2UY7A 3L7FA 1S9XB 1T0MB 2HFFA 3PDDA 1MRDL 5EU6B 3N85L 4W6YB 3C6LA 2CQVA 1NKRA 5F9DC 3SO3B 5I75C 5SWQB 2CRIA 3QXDA 3O45B 1CGTA 1A0QH 2IPKA 1N64H 3BZFA 3V4UL 1OY3B 3G6DH 4MS8D 4LHJB 4ODXA 3BAEH 1X9QA 3BFOA 4ODVL 1CLYH 5B3JF 2DLTA 5D70H 2MJWA 1FYTE 5FV1L 2K1MA 1U8KA 2VN4A 3MLSL 4Z7VE 1F4XH 3HAEG 2BVYA 1RJYB 4GO6B 1OP3H 2F54B 2BDNL 2BNUA 4OIIL 3L1OL 4R8WH 3ZSTA 4LPVA 1UH4A 3V6OC 3HG1D 5TDNB 1CDJA 3LEVL 2UZXB 1KF9B 1JZ7A 1W0VA 1SY6L 4G9FB 3SJVE 4KKLC 3I02B 1OL0A 3U46A 3JUYA 2KH2B 1PZ5B 2ZCHL 4GRWF 1OAXH 4L8SB 2CLRB 5DRXB 4PYHA 3WDHA 2VSDA 3G5YB 4LLDA 1FG2A 1K8IB 4XPTL 4OCWH 4D3CH 2VAAA 3KLAB 3WIFA 1AXSB 4KTEL 3ARDD 1MSPA 1F11A 3QDGE 2DJUA 4XNZB 3FN3A 2VE6A 3STLA 2J8UE 4IM8A 5D72L 5TE6H 5BVPL 3L3DA 5HVGB 3AY4C 1U8OA 4GMSL 5KSBE 3LKOB 1YQVH 4MLIA 3SQOL 1XAUA 2UWEF 5EU7C 1BIHA 4ZTPH 1B0RB 3GHBH 4RFOH 5F1SA 3ULVD 1E0OB 4KDTA 3U2SA 1JRHL 3BT2H 4FQCH 1OP3K 3RP1A 3EIFA 4PJCE 5J0BA 2R2CA 2J8UA 3VFMA 4MD5B 1KLFA 4PP2B 1U8JB 2I25N 1LK2A 4L8DB 3Q1SL 1Z9LA 3ARQA 1OCWL 1K4DB 3MNZA 4ZUVA 3SGJC 4KK6D 3FHQA 5LCVL 3ZSSA 3B9KB 5I30L 1GGIH 5IBTH 2BK8A 3P4OB 4PJCA 4P46C 3MOBL 5C0RL 4LDEB 4JG1L 1E4WH 4UQ3B 4XCEB 2Q6WA 4GS7C 4LMQI 5IW3A 4XTRD 1YEEL 1NGZB 3FO0H 1WQVT 2E3VA 3RWFB 2ICEB 4J6RH 3MXWH 4YWGH 2VKXA 2DWEB 3O3EB 2VR9A 4R97B 3EGSA 4Y16D 4KTYA 5A3ID 3BP4B 2ICWJ 4MNQE 3IRZA 3QIBD 1KTLA 1BZ7B 2YRZA 1HDMB 2PUQT 3VGHA 3KPLB 3ZZ1A 1WWWX 3DMMD 4N8PA 3T2QA 1H5BA 1F6AB 5IHUH 4HZAA 2BSRB 2X7LB 3LKNB 3MO1B 1Y18B 1JK8B 2EKSB 3JVGA 4MNQA 2P8LB 3FKUS 2GK0B 1MI5D 3UDWA 1MCOL 3D3VB 3CVIH 4XPBL 3CDFA 1D5XB 3RFZC 3MLXH 3CCHB 4XNQB 4HFUH 4HBQA 2PXYD 4JR9H 5DJ2A 5HDLA 1V7ML 3QUMA 1AGDA 5J12C 5CEXA 4EUPB 2V5RA 4FQXC 3ZHLA 4PUBL 4HIXH 4ZSOA 2A9MH 4UU9A 1ZHBA 5CINL 5CJXA 4NHUB 1E4XL 4YEFA 2JJSA 3FQXA 3LQMA 3BRGC 4IHOB 4J7RA 2FO4B 2QQKL 5TE4H 5I71B 1I8LA 3QEQB 1SHMA 4JZJB 3GSNB 3CAFA 2R8SL 3U36B 4YPJA 5GIRB 3N85H 2VC2L 1YY8B 4Z8FH 2OR9L 1TZGL 1H8SA 1NAMA 3O6MH 1NBZA 4NQCD 5IVXE 1OTUD 2XXCB 5EUOA 4XVSH 1WICA 5E1HB 4C4KO 1ETZB 4FOMA 4PREB 4XHJD 1QFWL 1CI5A 2W38A 2DI8A 4JREC 4LL9A 3ARGB 1QD0A 3P11L 1MFEL 4L8BB 4X9IA 1P7QB 4ODVH 1R5IA 1H15B 3WL9B 1XIWC 1G9NC 4MXVF 2EKJA 3MLSH 3VXSB 4AZ8A 1ZHLA 3MRKB 4AM0A 2CLZB 4Y4KB 5ILTL 4YJZL 5ICZB 2BDNH 4M61B 4GRMA 1W0WB 3T3PF 3U7WL 3V5DA 1NFDE 4HAGA 2NW3A 2DL9A 2HFTA 5EB9A 5IEHB 1QFHA 3FQNA 4KK8D 3EZJB 4AMKL 2ZCHH 4AIZA 3K80A 4KHTH 2R4SL 4EI6B 1T22A 5SV4A 2DYPD 4EUPH 3SKOA 3GMOA 5L8KB 4XPTH 3UTSE 1D5IH 1SJXA 3IGAA 5GGTH 4HIHB 2NY6B 2F74A 1WITA 4WUUD 4X9GA 1AI1L 2DM2A 3O11B 5D72H 3AC0A 1NBVL 3QUYD 5BVPH 3C5SA 3QUXA 3UTZB 4GMSH 5IVOA 2VOTA 3SQOH 1J8HE 1VGKB 4MWFA 3G6AB 3IKKA 3REWB 3GSNH 4E41A 1BWMA 4WWKB 2XG4A 3VH8G 3NMEA 4XNYL 3X3FL 4O51B 4OGYL 5CLWA 3NZ8A 1WSST 1MHPL 1EGJA 1KJ3H 5TGBA 4K3GA 4YFLF 1A7OH 3EOBB 3ZYIA 5CMAB 2Q8BH 3P0VL 2HJKA 1IGIL 2FLRT 5LCVH 2H2SD 2R0KL 5I30H 5CWSB 1ZA3B 4PGCA 5EU4A 3CSGA 4JEGB 1FZOB 3MOBH 3U4EB 3KNBB 4DEPC 1XEDA 2VISA 1YEEH 2YWZA 3GK8L 1C7SA 5E6IB 4BSJA 1UA6L 3CSYA 2VMFA 5JQ6L 4ZPVB 2VR4A 4P59L 3JXAA 1AQDA 4FQQB 2AEPL 4NDMB 2HMID 4WI5A 3B3IB 1FNGA 3WSQH 1F4WH 2ILLA 4LLAA 3TVMA 1H0DB 3NOIA 5MENB 4U1GC 3QO0B 5KJRL 3JV4A 2ERJB 5J11C 5IIEA 1NCDL 1C08B 3GO1L 3X12B 1MCOH 2ZJSL 1FPTH 5J1AA 3P9WB 4PRIB 5TDPA 1Z6JT 3IDXL 4GKSB 4QO1A 5J6HA 5FFLA 5D7LB 1HXMA 1OF2B 4FTVB 3MRHA 1EAPA 4KRNA 4JFQA 4UTAH 4GW1A 2B39A 3FB8B 3HNTL 3OKKB 4PUBH 4X4YB 1YYML 5HHPA 5EN2B 3WFHB 1QR1B 3P30L 5FKPA 1ZWIA 3DUHA 5CINH 5LVEA 1RZJC 4IOIA 1WFNA 1U8HA 5A16B 1E4XH 5KSVB 3EOTL 5D96C 1CLZH 1IEHA 4HWEL 2QQKH 3PP3H 3UZEA 4CVZB 3MBXL 2Q3AA 2ICES 2FCBA 2Q7YA 3B4NA 1HYRC 3FN9A 2WWKO 2DBLL 3EHBC 3KWWB 1TZGH 1IEBA 3AB0B 1U41A 4LSUL 4X7FC 2CSPA 4Z5RB 1C5DB 1S9WB 4CNIB 3DXAE 1N5AA 1QFWH 3HE7B 4YK4C 2PKDA 1DJSA 4YDIH 5LG1A 1DBMH 2FDBP 2WW8A 1RJLA 1OSPL 1TXKA 2OL3B 4AJ0A 1XH3B 1U8PA 3DUSB 1KTKE 4WFED 2FX9L 4L4VD 1S5HA 5LXGL 5F7NC 1MNUL 2AJVL 2CDEB 3MGOB 5DVOA 3RZCB 5ILTH 1Q38A 3LPGA 2XA8L 1D9KC 3U7WH 3SN6N 3S3PA 1EEZA 3CVHA 5EWIL 5B8CC 1KTDB 5CUSL 3VXNB 3PP3K 1SYVA 3CFBB 3DTXA 4QF1B 12E8L 2VXQL 4AMKH 2H32B 2YD2A 5C92A 4ETQA 3HLAB 4PGDA 1NFIB 1I8KB 4LLWA 5KAQG 1C7TA 1CZ8L 2GSGB 4NM4H 5C0CD 4N1EA 2AABL 2WBJC 4PJDB 1AC6A 3T2NL 3HUJF 5D2NE 3D9AL 3V6FA 5DJ6B 2OTWB 5IM7B 1GOFA 1AI1H 4PJ9C 3HG1A 1NBVH 1J1PL 3VGBA 2X1WL 1BVKB 1N3NA 4EUPG 4OCXL 5IEKB 3OJVC 2EE2A 5IB2A 1DLHA 3V6OA 3S37L 4G7VL 2Y25A 2P43B 1ADQA 1DUZB 1K5NA 5FYKH 4XNYH 2E9WA 3UJTL 4L4TB 4YUEH 3HZKB 3X3FH 5LAXA 1A7RH 3WFEL 1UB5B 3W82A 1MHPH 3FQRA 1G7MA 3KYMB 5FCUL 3LKSB 4EVNB 3P0VH 5B22A 3D18A 1JZ3A 1IGIH 5BJTA 5C0DA 2X9YA 4OM0L 5FF6A 5EU7E 2R56L 1G0YR 3QO1B 3ZDXF 2Z8SA 4YXKL 3V4VL 4UBDC 1L0XA 1EVUA 5F1KC 4FS0A 1GAFH 2HKHL 1S7TA 5F7EL 4N0CD 3GK8H 1H3PH 5H35A 3GJEB 1U36A 4EN3D 3U7YL 1I4FA 5IWLA 1DZBA 3UTQB 4V1DD 4Y19E 1T80A 5LGJA 3GBLA 1KJ2H 5E1AB 3MRIB 4OGZA 4OLYH 3WBDA 2VNCA 4WW2B 1DDHB 1SQ2N 1B0GA 1DLFL 4XBEH 1KCSH 2AEPH 1NMBL 3IJSB 2H32H 2FBJL 3H9SA 4P5TD 4WI3A 3SGJA 5IFJB 1WLHA 2A0LD 2HT4C 4GAYB 4Y2DD 1IEAA 1MF2L 3RGVB 4OLWH 1LEIB 4G9DA 1GRWA 1MELA 4QWWD 4P46A 5F7DA 3CPLA 1IQDA 1Q0XL 4JN1L 3DIFA 1NCDH 1LD9A 3GO1H 3ORJA 5D5ME 1WZLA 2LABA 1AGBB 5DXWA 3NACL 4HUWB 4NN7B 3GMMA 3QWOA 1A6ZA 3BD3A 1OW0A 5JOPD 5MEPB 3MREA 4PJBB 3RL1A 4UNVA 3IDXH 3QIBA 5TH2A 3SCMC 3VXOB 2AK4E 5ADOL 5D5MA 4JHBA 4Q6IC 4PRHB 1QRNE 1KNOB 2IAMC 3VFRA 3L5XH 1FNAA 3EYQC 2Q7NA 5ESVA 3FAWA 2IANE 1MI5A 2AK4A 3PL6D 4XXDA 4GKOA 3P30H 3VFSA 4P9MH 4PJ5B 2VZTA 1R5WB 1JHLH 2ZCLH 1PGRB 1UJ3C 3WE6B 4HWEH 1CGXA 5DQJA 2UYLB 3DX6B 4JRXB 5E56A 3RWEA 2DN7A 4JFXB 3CDYA 3MBXH 1FP5A 4WU5A 1DN2A 4MXWH 4BH7B 3FONB 4N0UE 4XP4L 3RRQA 1E6OL 2XWJA 3S4SA 4FQXA 4X99A 1P5UA 4KRPD 1EHAA 3FMGL 4K8RL 4LMQE 5ENWB 1U8LA 5DGRA 1FZKB 1TVBB 1LHZA 5C0FA 3VGEA 3G08A 5FO8B 4O2EA 4GQ9L 3QR2A 1FRGH 3O8XC 4OJFL 4KK9C 1UACL 2GTZA 1X44A 5DK2B 5H94A 5DD6B 1WT5A 3BO8B 5DSCA 4HKBB 4G6KH 3V0AC 3OPZL 5LXGH 3D48R 1QSEB 4NQCA 1U93B 2JJVA 2XQBL 1JYWA 4CDGC 2XKNA 4E42A 5A2FA 1G6RA 1X5ZA 3DX7A 3BPCA 3QQNA 1L7TL 3GMLB 1MJJA 3OAZH 3C6SA 4PJ7B 4X0KA 2P5WB 5F1IA 3Q6FA 5BZDB 3WLBB 2P48B 4P5MB 2VXQH 5D9SB 1Q0YL 1LP9E 5D7IB 2AGJL 4OZGE 2AABH 5A43C 1KIQA 3T2NH 5DRZB 5ALBH 4L5FL 4TSCH 1V7NL 1KPVA 5GRJL 3VGAB 1YPZE 1JGEA 2A6IA 5D93C 1LP9A 1X4YA 1J1PH 3MRLB 4LLUA 5IB4B 4GJTB 3CGTA 2IQAB 1UZ6E 5DJXA 4KC3B 4OCXH 4OZGA 2CH8A 5F6HJ 3S37H 2J4WH 3LOWA 3FT4B 4ISVA 1IRAY 3KPRB 5GGUA 4GG6B 4TULL 3MV8E 3UJTH 1QYGL 2DYPA 1BJ1H 1M6OB 2IGFL 4X4ZA 5IHZA 3VJ6B 4ZPTA 3WFEH 5F7FA 2HTKD 1MFAL 3IT8D 4K71B 3OAZK 5FCUH 3OKMA 5ANMB 4QHMB 2P49B 1DEEB 3X13A 1YJDC 2Z4QB 4P9HC 1R24B 5C08B 3BP6A 1G9ML 2R56H 3QUYA 4HUVB 1T2XA 4PBWD 4YXKH 1HWGB 2C4XA 1BZ9B 2YPVL 4JJ5A 3CDGA 2A83B 2HKHH 4JKKA 5F7EH 4AIXA 4F3FB 3LRHA 3RUGB 5KZCB 1KCUL 3RWHB 1RZFL 4JM2D 4MJID 1SVZA 1S7QB 1GOHA 3IKCB 5CILL 4IRJC 2CUMA 2BXYA 3C60B 1TQBB 1DBJH 4TVPL 2PTTB 1DLFH 4M5ZL 1FYTD 1TVHA 1NMBH 2CGRL 2FBJH 3KYOB 4WFFE 1INDH 2G60L 3V52L 3O2DL 5CZKA 3AGVA 2EDTA 5HGHA 1MF2H 3TPUA 3BH9A 1DL7L 1Q0XH 4JN1H 2DM3A 5A2KH 5HGBB 5AYUL 3FFCD 4ZAKB 5GS1B 3NACH 4WDIA 1PQZB 2DLIA 2Z0BA 3U79A 1ZLSH 3VFNA 4HUNB 1O5DT 1ZLVH 3QBTB 4IMLB 5E7BA 4AH2A 1YYLL 1IZKA 5ADOH 4JANA 3WD5H 4GRLC 2Y6SC 3HI6L 2F8XC 1KUMA 3BD4A 1CDYA 2D9QB 4PRBB 4YHIB 4L3AA 1IGYA 3OKOA 2B1AL 4QRSB 4GLRI 4G8GD 4OLEA 5CJOH 2GQHA 2MPAL 3G04B 5K9KA 4WTWA 4CW1B 4OLXL 3BYYA 4Z7UA 1BBJA 1Q8MA 5C2BH 5JDJA 2QHRL 3EAKA 5CHNA 3D85B 1FNEB 3SGDI 3SY0B 2FEEI 2GCYA 4ZXBA 3T4AB 2DIAA 2XG5A 1FVEB 4GW5A 5I1JL 3VXRE 4UTBL 4QYOA 5FYKU 2PCPB 3IDMB 2ZSVA 4MX7A 3P4NB 4Y1AD 3Q3GA 4XP4H 2XKSA 1I1AB 3FO9B 1ZLVK 3V5KB 1E6OH 2DI9A 1XCQA 1T1YA 4JKPH 1A6UL 1DSFL 3FMGH 5JW4N 2UZYB 4CU7A 3LS4L 3FFDA 1JGLH 2X4UA 2EEDA 4MD0B 4QCIA 1EEYB 3UAJD 5BS0B 1QKZL 5EO9A 1ES0B 1NUFA 3DO7A 3X14A 3WDIA 2XTJB 2XQBH 4OF7A 4UDTB 5EBLA 5DT1L 3E6FA 4JLRA 2VXVL 5EZIH 4BYHA 4WW1B 2DF3A 5EG6C 3BW9A 2MMXA 2KQMA 2ZNWA 1OAUH 2A6DA 2NY7L 4I0PD 1Q0YH 3KS0H 3O4OB 3X11A 1MLBA 4J3XA 1CD1B 5ETUA 3WN5B 1LMKA 4L4VA 2AGJH 1U95B 2LTQB 3WNMA 3BISA 4NUGH 2VLJD 4O4YL 4L5FH 1V7NH 1O0VA 4C83A 5GRJH 4WCYL 1C1EH 5HHXL 3NIGE 4J1UA 3NFPA 3KPPA 1KIPB 5LKNA 3SKUD 2Q76A 3BN9C 1JBJA 3RA7H 1D9KA 1T2QL 4J8RA 4KJPC 3UBXB 1HK6A 2ITDB 1WK0A 5B8CA 1RUML 4OV5B 4TULH 3IFPA 1QYGH 4N90E 5T1KD 2IGFH 2MCPL 4M93B 4ODHL 5C0CA 3D39E 1PY9A 1F3DH 3RDTC 1YZZA 4ZMAT 2FHCA 4HSQA 35C8H 4TNWK 2WBJA 4RGNE 1VA9A 3D69A 2A6KB 4OFDA 4PJXA 4JY5L 3IJHB 4RZCA 4JM4H 3D39A 2YPVH 4PJ9A 3REVA 3CC5B 1MFBL 5IB3A 4NUJB 3VXUB 1XF2B 3CZFB 4N9GB 3L3OB 4O9HL 1FC1A 1HHIB 1UJTA 3IETB 4S10A 1VB9A 4NQVB 3SDAD 4PJFF 1AGEB 1CE6A 3QA3A 4OD3L 2GITA 5DFVC 1MJ8L 3C5ZB 3RY4A 1FVCA 3I6LE 2BCKB 4OCSL 4GW4B 4LKXA 4M5ZH 4H1LA 4QRPB 3TBYA 4XVUD 3P73B 1CG9B 4F7EA 3I3DA 3V52H 5GPRA 3EYFB 3SKNB 2M8XA 3DRTB 3SDCD 1S7XA 3MV7D 5CGYD 4K7PL 4X5WB 5F93C 2NY4B 4EN3A 5J9PA 5JR1L 5HVFB 4V1DA 2E7LC 3PWPB 2EYTB 4IIQA 4DKEH 3HMXA 1J0HA 4ODWA 3VFGL 1CLOH 3OHXB 3GJFH 3K8KA 5ACMA 3WYRA 3SDDC 4K07A 3VXPA 3OGCA 4NNXA 1UKSA 3UEZA 4P5TA 1U3HD 2CLVA 5KVDL 4LVOC 1OGAB 4Y2DA 5I8KL 4U3HA 1XZ0A 3J8F7 3L6FB 3MV01 1TZIA 4OCLC 3IFOB 1HXYA 3RWJA 5GZNC 4H25B 2BRRH 5K9OB 2OCFD 5IFHL 1TFHA 2BVOB 5KSAB 1YN6A 3V0VA 3D25A 1K6QL 5IMKB 5IR1A 3QRFM 1EXUB 5EZJB 5DURB 3ZKMD 5BRZE 4WI7A 3F12B 3P9MA 4XCYB 4B53A 1MY5A 2JIXB 2HFGH 5BXFA 4OGXH 1C5CH 2FBOJ 1JYNA 3OKDA 4WV1B 3TBVA 4PJDF 4UTBH 4D94A 5BRZA 1WC7B 4HH9A 2IAMA 1T1WB 1QA9A 2GFBA 1ZHNB 3GJFK 1NC4A 4OFPA 1NGXA 1EJ6A 2FX8L 1DSFH 4LSPL 1S7WA 4UOJA 4LVNC 3C08H 3LS4H 1RFDH 4OAWA 3HCVB 1QEWB 5JIHA 3RWDA 4D9LL 1FORH 5T3ZE 1E28A 5DTFB 5CBAA 3GNMH 1YUHB 1JHTB 1GZQA 2VZOA 1R3JA 2P24A 1QKZH 1S8DA 3SKJH 4ELKA 5DVMA 3W0WB 5JW4M 3UTTB 5DT1H 3HR5B 2VLME 4HGKC 4OFKA 5IJVA 3OKYA 2NY7H 2R1XA 5EFIB 3OKEB 3WIHA 2A74A 3QIWB 3GMRB 3GSQB 2AEIT 3DJ9A 4KV5F 3VD7A 5L2KB 4KRLB 3TA3D 3SQBA 2VABB 5D6CA 5E4EB 4RX4D 1JZ2A 2A9NH 4WCYH 3WKMH 4HK3N 5HHXH 1NANH 4XMLL 4MNGA 1BIIB 3ZE2E 4XAKD 2BNRA 3FQTA 1A7NH 4L9LC 4BSVB 1T2QH 1AJ7H 4O5LL 3NCFB 5H2BB 1NGYA 2ICWB 3DVIA 3NFSL 2D0FA 4WO4B 1Z2KA 1N59B 1G7QB 2ZUUA 3NCMA 1D5BA 4ODHH 3KXFE 4NYLB 5EIVA 2O61B 1IAOA 1YDPB 1A7QL 3BH8B 2OJZL 4PJBF 5FOJA 4JPIA 1N0XL 1QBML 4M43L 2XZQL 4NNPL 3TN0C 1IVLA 3N9GL 4KUZH 3CUPB 2X4OA 1D6EB 3CH1A 1QLRA 4JY5H 4G5ZH 5T33L 3WFBL 5DEGA 3M8OL 2WM0A 3LSOA 3QUML 2X4QB 1MFBH 1MHCA 4CGTA 3ALPA 5KS9B 2BERA 5C0ND 2HN7A 5SX4I 4NCC2 4CBPA 3VCLB 5F9WC 4H8WH 4X7CC 4OD3H 4MQ7B 3IF1A 2DQJL 1MJ8H 3IFLL 3RHWK 5L88L 5E2VL 3KJ4B 3WJJC 4NQXB 3QZWG 4OCSH 1FDLL 4JFZL 4ZDHA 3GSRA 4LCCB 5D2LF 4O2CB 4X6DB 3L95B 1KBGL 5E5MA 4I8DA 1A5FL 3ECBA 4K7PH 4EDXB 4G6FB 1XGUA 4CADA 3GIVA 2B0SL 5JR1H 3QJHA 3B2VL 5FOBB 2FWOB 4PP1C 4JM2A 4O02L 5D1XB 4YR6A 2Z31C 1IFHH 2ZOLA 5DMKA 3DBXB 1OSZA 3VFGH 1PJ9A 3NIDF 3CDCA 4NZJA 4GMTH 2XWBA 1DBBH 4IRJA 4PJAB 1CT8A 5H8DA 2NLJA 5M7QA 5SWZB 5FYLE 3T3MF 1NGWA 5KVDH 3AROA 4U1MB 4NNYA 5B3NA 5JIPA 1UWEH 3UYRH 5CP7A 1H8OA 5E70A 5FUOH 2BJML 4ENED 5IBLC 5IFHH 3LVEA 4JRYE 4MB5A 1YY9D 1K6QH 4Y4HC 3UBXG 4YDVA 2ZCKL 5JUEL 3BWAB 1NCBL 2DLEA 5JOEA 3D0LA 2J8HA 1NAKL 2F19H 2DQGL 4JAMB 5D7IF 4YHLL 4LF3B 4NRZA 2XPGB 3V8CA 5C9KA 4Y5YB 2X40A 4G8GA 4X7TB 4WJ5B 3AMLA 4RBPH 5D1ZD 4Z6AT 2QQNL 2FX8H 2O26U 1XGRB 3OR7B 3QXAB 4LSPH 4WENB 1AR1C 2APWA 2DDQL 2VL5B 5A40E 4TUOA 2ICWI 4CDHA 4D9LH 2BVEA 4I0KA 5GHWL 1JWSB 3PUCA 4U33A 1T04A 4PV8A 4YAQB 3IDJB 4J3UA 2RB8A 3QAZB 4QRRB 1AD9B 3K46A 1XGQB 1K2DA 5ISZD 5FM5O 1EGJL 5JPNA 1IARB 4KU1A 2G75B 1EERB 2E6QA 4Y4FB 1BD2E 2AI0L 3P9LA 2H1PH 5B3JE 3O3DA 5EIIA 1HQRA 3NCEB 3QQ4A 3RUGF 4S11A 4R4ND 3CX5K 4OT1L 2W65A 2YEZB 2IPUK 2B2XH 2IH3A 2V7NB 3T0EC 2GJZA 4RBPK 4BH8A 2V5TA 4FG6D 3KYKL 3B2UD 1X5FA 4I77L 5FB8B 2LAGB 1MCSA 4KQ3L 4B7LA 4XMLH 3X3GL 4DCQA 3MNVB 4GRWE 1DQQA 5CEZH 1EIBA 5IF0B 4U6HB 3HPJA 2HFEA 4XBGA 1S7VB 4I0PA 4Q0XL 2IAND 5JHDD 5MP6L 1BEYL 4H20L 2VLRD 2BNQD 5EPMB 3T0WA 4YO0A 3CX5J 4KROD 3TCLA 3QQ3A 4DOHE 4P2YA 3QUZC 1A7QH 1I85C 2VLJA 3HPLB 1FVDA 2OJZH 1MCNA 4ZUTA 3C8KA 4P23B 1N0XH 1HKFA 5H37H 1VFBA 1QBMH 1BZQK 2XZQH 3PHSA 4NM8L 4ZFOB 5I1DA 4R26H 3N9GH 4FFVD 4K7FA 1TJHL 5C1MB 4TNWF 3PGDA 4XGZA 3H9YA 1HSBA 4AEHL 3MUJA 4MQSB 3QUMH 1RD6A 4J23A 4ONGL 2OTUA 5J3HD 1I7RB 1UXWA 1MH5A 1P5VA 2UWEA 5C0GA 3MV9D 5T5FL 4OUUB 3S7GA 1CXKA 2B1HL 3RWIA 2OBGA 4OV6F 3SPVA 1U92A 3V4PL 3IFLH 4YDLC 4KVNH 5D7JD 5E2VH 3T0AA 4YHNB 3MROB 2NXYC 1H8NA 5C0AD 1FDLH 2F5AH 4JFZH 5IESH 2NMSA 4HMCA 1CVRA 1CFTB 2EXYC 5FIEA 5JO5B 1KBGH 1TCRB 2YZ8A 1X5IA 2VXTL 1IKFL 5CD5D 1A5FH 3LV3A 5TE7L 5IMMA 5FYJL 3MBEB 4JQXA 2B0SH 5DO2D 2R0WL 3RWGB 3B2VH 4PJIA 5EU6D 5I1KH 3SDAA 4O02H 1F4HA 4DFIA 5E03A 2XNAA 4P3CH 1A1NA 4G42B 2NY2B 3FOLA 4PB9L 4U6VL 4M7KH 1RPQA 4R2GC 1N7MH 1S7UB 3MJ9H 2VQ1A 5DEFA 1KPUA 3STBA 2DIBA 1ZGLP 4XHQA 4W4OC 3FQWA 1RZ8B 2E9BA 4LLMB 4Z0XA 4HD9A 4J3OC 4U1IA 1CR9L 3QYCA 3VFVB 3SDCA 3ABZA 1QOKA 2E7CA 5IMLB 5DJDA 4U1HB 5F6IB 2IFGA 5BV7B 3MLWL 3P77B 3S36X 2YPLB 1IM9B 2F54D 1WJ3A 3AXLA 1HINL 5JUEH 3CVHL 1NCBH 3TT1L 1TPXC 2E7LA 4L8CB 2IH1A 3BX7C 4G9FD 5HVWA 2DQGH 4TPRL 1U3HA 5F9JA 1A1MA 3GGWB 3U9PH 3AAZB 1FL3A 2I60L 4RGOL 3GMPB 3WFDH 2FH6A 3K3QA 2PO6C 1KLUA 4MA3A 4LPTA 4PTTB 1I3RB 3E6HB 1V3KA 2D9CA 3MA7B 4NO3A 3MGAA 4Y5VA 1V8HA 1WBXA 2PYEB 4M8VA 4LLVA 1FG9C 1EO8L 5KTEH 1AH1A 1UWXH 4XNMA 1RI8A 3FCTB 4JY6B 3U1SH 5JORB 3I75A 3CFKB 4YBQD 1PX4A 1JPGA 1ADQL 2D7QA 1P4IL 1Q72L 3M07A 1S3KH 3MRDB 1VFAB 4RFNB 4UQ2A 5EU3B 3DYMA 1DEDA 4GG8B 4PJGB 1OM3L 4M1CC 1VFOA 3X17A 4YGVA 4ZUSB 1HCVA 3C09B 1CYGA 2KZWA 4F2MA 1XR8A 2VDNL 2DLGA 2ZOKA 3IDIA 5IB1B 1X6NA 2HJFB 4MXVE 2YWYA 3ULVL 1GL4B 1JRHI 1YEGL 4N8CH 3PWJA 4OT1H 4OZHA 3DVGB 4U1SB 1XT5A 3KYKH 1U58B 3ARFB 4Z77A 2EH8L 3LY6A 1ZMYA 3MRPA 4X6EA 1UWXK 5C0IB 4AG4H 3BDBA 3CFCL 4LCWB 4QXGL 2JE8A 4I2XB 1NMCC 4RAUB 2W0FA 5D1QC 2PETA 4Q0XH 2C3WA 3BUTA 5MP6H 1BEYH 3V0WH 3SOBL 3G6JA 4G6JL 4ERSH 4FQJH 5I1EH 4WY7H 5I16B 5BMFH 4DUXA 1MIMH 5JNYA 1CFQA 4QY8B 3LRGA 1EX0A 1U8IB 3D3VD 1I1FB 4Y2OA 5BQ7A 1TJGL 3OMZA 3QDME 5IFAH 3HAEA 4PY7B 4X98A 5DZNA 1GGCH 3QG7H 4ONGH 1FZJA 2UUDH 2VTFA 4S1SL 4L9LA 5T5FH 5JOFA 3QDMA 3SGKC 2B1HH 2VQTA 3LQAL 4M7ZC 3V4PH 1V05A 3O41B 2EEAA 1YA5A 1KG0B 3A6CH 4D9QE 3EHBD 3RHWF 1A4KA 1UYWL 3E3QC 1AO7B 4D0BA 4CVUA 5FGBC 5HDQH 1Z0MA 4JZJC 1K9TA 4PJHE 4Z78B 3TN0A 1DBKL 2VXTH 1I75A 3TIEA 3QI9C 2ZUQB 5DVNA 5TE7H 3I85A 5EBWB 5FYJH 3WNPA 2R0WH 2LFGA 2W1NA 3BGMA 1INEL 3NTCL 3EDDA 1UZ8B 1MCDA 3ARVA 4R3SA 15C8L 1MQKL 4IS6B 1BBDL 1ZVHA 1E4XI 3QEUA 2ZPKL 3ARGD 2UUDK 4HKZB 1FZMB 2BOCA 4WIQA 5JXED 3LRSB 1P7QD 1YN7A 4LHUA 4EXPX 4ZS6C 1G7HB 4GXUN 1HQ4A 3VXSD 2R1YA 1RHHA 1MCRA 5HHMB 3MLWH 4PJ8C 4Y4KD 2N4IA 5C09E 4BKLB 2Z8RA 1G6RL 3LS5L 4U1LB 1HINH 4HUMB 1QFWI 4OF3A 4LSRL 4DKFL 3E2HC 2OJEB 5ERWB 2YSSA 2EDFA 4PGBA 4TPRH 3FB5B 4F15C 3P4MB 5C71A 4HFWA 5TFSL 2I60H 4RGOH 2EIZA 4M4RA 3L5IA 3RNKB 1J1OL 3BYTA 3WHXA 4RGND 1S9KC 1J1XL 1C16A 1NKOA 2NY6D 3MRFA 4P2RE 1BQUA 3LB6C 1EO8H 3GSWA 3EJZC 1RK0B 2YKLL 2CDFA 4Y4HA 3SHSA 1LVEA 3OZ9L 2X89D 4HJGB 2NY1C 4MGXA 2C3VB 2GJ6A 2IC2A 1P4IH 1Q72H 3DMMB 1GGUA 4WWKD 4FQPA 4P2RA 1WCBB 3I6LD 1OM3H 4BZYA 3IDYB 5L8JB 2IBZY 2XYCA 4IRZL 1I9JL 1T4KA 3ULSA 3WJLC 1JN6B 5D1ZA 5B4MD 4LPCA 1TLKA 4HXBL 2VDNH 5DUML 5MERB 1A6WH 3U0TB 5C8JB 4X7DC 2JJUA 3UROR 4OUOA 1IILE 4H26B 5T1MA 1C12B 4P5KB 3IU4H 1YEGH 4ELME 1A3LL 2W91A 1A1OB 1WFUA 2XN9E 3K2UH 3DUUA 3VI4E 5E6ID 4O2FA 5FO9B 1LO2L 1TITA 2EH8H 4OZ4A 5D6DA 3CFCH 1F45A 4RGMB 1F90L 1F58L 4FFZH 4TVSa 4X6CB 4HPYL 1T66D 4FRWA 2XN9A 3BDYH 1RUKL 1LO4H 3PHOB 3T0EE 3GB7B 3W9EB 4PRNA 3SOBH 3HUJE 4JO4L 2KZ1B 5HHQA 3JWDH 4P3DA 3I50L 3BKCL 5MEND 3OKNA 4I3SL 4LOUC 2VYRE 4Z9KB 5I73C 3OXSA 4E0RA 1I3GH 1L7IL 2V9TA 4PJAF 3SE3C 1H3UA 2J1KA 3HUJA 4PRID 5HTSA 5DHVB 4KUCD 5INDA 2Q20A 4LPWA 4YXHL 5GJTH 1WZ1L 1NC2A 1I7UA 2BNQA 3QNYB 4DTGL 1Z5LA 1DVFB 3B8YA 3HB3D 1A3QA 1JNLL 5D7LD 3N1MC 4LK4A 2FJGA 2WIMA 1T5XA 4FTVD 2NY5L 3G5VB 5HGAB 4U7MA 2IMNA 4IEFB 4PLOB 4ZOAA 3LQAH 2BVTA 4JDZA 4NJAH 1FFPA 4M62L 1L4IA 4FQ2H 1G1CA 2D03H 1KSRA 1K8DB 2VUYA 4JHAL 5E5RB 5CCKH 3QUZA 2VLLA 5F70A 4WEUD 4F7PB 2H26B 4ODSH 1JMXA 4MHHG 3FZUD 5EOTA 3TJEL 2ITCB 3IB4A 5EC2B 5F8RC 2MCG1 3TYFB 5EBMA 2EIBA 4PB0L 5I1HL 2C1OA 3MV9A 1NCUA 1INEH 3G5XA 4JDTL 3BEWB 2WBWB 1MQKH 3NIFF 5T3XL 2ADGB 3BKJL 2R2BA 3CFJB 1QFPA 1JPTL 3PWVA 5C0AA 3EYOA 3QIUC 3HE7D 1MJUL 3S96A 3O3UN 2ZPKH 5F21B 3KPNA 1LEKA 4DN3L 5F6HI 2J6EH 3PHQB 4HIEB 3VWKC 4JDVA 1S9XA 4NQDB 2MFNA 5EU6A 1CICB 1KB5B 2ED8A 2CR3A 5DMGC 1G6RH 3LS5H 4MB4A 5SWQA 2XQYG 1S7RB 1FO0L 1ZLWH 4LSRH 4GFTB 1NQBA 3HZVA 2C3XA 1ZTXH 4PD4K 1OPGL 3BPLC 5HI3D 4GXUM 1WFOA 4MD4B 4KHXH 4UT7L 1A3RL 3ZO0A 5TFSH 2P5EE 4NJ9L 4Q2ZB 3GKZA 3V8OA 3TYGH 3INUH 2PYFA 5EUOF 4W4OA 1J1XH 1RJYA 4HDIB 5KW9H 3OB8A 4U6XB 3RIAK 3LKQB 2X4NB 2G2RA 3EUUA 5TDNA 4HC1A 2YKLH 5JMOC 3TEUA 3RWCB 1VENA 5KVEL 1ACYL 4LEOB 4AEFA 5F9OH 1PZ5A 3PNWB 4L8SA 1P4BH 2XACC 4M6ML 3A67H 5ESQB 3UJJH 5DRXA 5DUBB 1EPFA 3LHPL 5GGQL 4L4TD 3G5YA 1ORSB 5A2JH 3T77B 4NIKB 1K8IA 1KTRL 3KLAA 1ZLWK 2WP3O 3WFCL 2PO6A 4FFWD 5DUMH 1JYXA 5HYQA 4DUWA 1MUJB 5C3TA 3UPRB 3LKOA 2FSEB 4KI5E 4KWUA 3C2AL 1A3LH 1B0RA 2AJUH 1AR2A 3DGGB 5SWSB 3C8DA 5FYJU 1KB5H 5DQ9B 3QFJB 4NC1C 1I1YA 3AM8C 3VXQA 2M26A 4MD5A 4D0DB 3T0DA 4F7MB 3HZYB 3C5JA 4UB0H 3MLRH 1F58H 2EDNA 1MCPL 1JGDB 3B9KA 2Y36H 3NBNA 2ED9A 1T89A 3P4OA 4QRTB 5EO1B 1OTSC 2PW1B 2ARJA 2BC4B 4UQ3A 4HWBA 4JO4H 4XCEA 3MCLL 1JWMB 3RGVD 1YMHB 3EO9L 4OD1L 3ARZA 1NGZA 2EC9T 2QADB 2VKWA 2RQ8A 2BRQA 3HMXL 2ICEA 3QNZA 3RBSA 4JFFB 5I1CH 3KGRA 5I66B 5AD0B 4S1DC 3O3EA 3VGFA 4AENB 5HGDB 3OR6A 2IADA 2NY3C 4YXHH 3M45A 3QRGL 2DS4A 5HI5C 5AZEL 2Z35B 1HDMA 4J3WA 3KPLA 4PRHD 4CU6A 4ZNEA 1JNLH 1ZT4A 4JZOB 2BOBB 1F6AA 5D1QA 3LKNA 3MO1A 3ARPA 3IFNH 2NY5H 4ZO8A 1Y18A 1JK8A 2DMBA 3QHFL 2E6PA 4M62H 4N9OB 2P8LA 2D7MA 2ESVE 2GK0A 3DI3B 3HE6B 2D0HA 4BSWA 4WI4A 5DJAB 2DQHL 3O4LE 2VB5A 4PJ5D 4H5SB 4QGTA 1YMMB 2KDGA 1B2WL 4ZFFB 1FNLA 4GAFB 4JRXD 3R06A 3ZKXC 1WTGT 5L8LB 4OQTA 4XCCH 5I1HH 3O4LA 3OXRA 3I2CL 5GGSB 3TFKC 5F3HB 4EUPA 2NX5E 2X05A 3PXHA 3E3QE 3HI1B 4NHCL 5HY9B 3OJDA 1D5ZB 3Q5TA 5GGTA 1JPTH 3LD8C 4D8PB 1MJUH 3CFIC 4K3EL 4BUGA 4DN3H 4IHOA 2YA1A 2FO4A 4PJGF 3MXVH 3QEQA 1MREL 1F4YL 1N4XL 4JZJA 3GSNA 3U36A 5GIRA 3PWNB 2EDDA 1YY8A 1QSED 4M9PA 1QNZL 4PYGA 4P4KC 5IMOB 4JVWA 3EFFB 1FO0H 1ETZA 4EI5C 4G80A 4MJ5B 1OPGH 3BKMH 5E4IA 2P5WD 3W81A 3ARGA 1MWAB 5C9JA 2UVFA 4UT7H 1T1ZB 4UI2A 3WIHL 1P7QA 2R0LL 3RIFK 4HLZH 2CMRH 4L3EB 2NXZC 2DIJA 1Z0NA 3VXSA 3O6FC 4ZO7A 3MRKA 1H9VA 3MSPA 3G5ZB 1RU9L 4M61A 5DI8B 3WV0A 2XZAL 4N1CA 3ZT7A 2WWMC 1JZ4A 2VL4A 5KVEH 4I18C 5IEHA 2CDGA 3PGFL 4M6MH 1W72B 3T09A 4XMPL 3LHPH 2X1OA 1WZMA 3O0RL 1GC1L 2HRPL 5ICYB 3QPQD 2VDPL 4JGUA 3MCKB 5CBEB 5AUMB 1HI6B 4M5YH 3WFCH 2XKUA 1KJMA 4HIHA 3B5GA 5JA9A 1NCCL 1DQLL 5C08D 3O11A 1IAIL 3SDXE 3H0TA 3UTZA 1JMZA 2X89A 3G6AA 3REWA 3RTQB 1M7IA 3K2MC 1SJVA 2R2HB 5F7YC 1R3LB 3Q48A 4PRPB 3PQYB 3C60C 5DYOB 4H0IA 5IVZB 4LVHC 2BHUA 4XPFL 1S9YB 4K8RC 2X1QA 1IC1A 2LV4A 3EOBA 5JXAH 3ARBC 1MCPH 2Z8WC 2FHFA 3H7LA 5LWYL 4NBYB 3WJLA 3MRBB 1ZA3A 3QCTL 1WEJH 4MDJB 1FZOA 4YEEA 2BX5A 4P9HL 2ADFL 4PJEB 3IXAA 3W39B 4DGYH 3U4EA 4HJ0C 2L7UA 3KNBA 3SDDD 3MCLH 43CAA 4DUVA 1NEZG 1A9EB 3EO9H 3GUTA 3QXTA 5FXCH 4XWGL 3UO1L 4K23L 1U8NA 5E6IA 3SE4C 4ZAKD 5ELIA 3VRIB 2QBWA 4AY0A 3ARTA 5FV2A 3JTSB 2EZ0C 2I5YL 1FGNL 3VFPB 2VDOL 3MUGB 4FQQA 1HHKB 1IBGL 4NDMA 3S36L 4YBLC 3FT2B 4X80H 3H8NA 3ZTNH 4UAOC 1H0DA 2E6JA 5MENA 3QO0A 2NW2A 5BVJB 3QHFH 1RZKL 4JVUA 5FYLL 1QPXA 1YNLL 4GBXB 4ZNCD 4S1QH 4PRIA 1OT1A 3OQ3B 3GZKA 3V7AE 2AJ3B 4S0SD 3D85D 3NZHL 2F53E 4GKSA 3S3JA 5IW1A 8FABB 3SE3A 3MYJB 2H41A 2CUIA 4PJFE 4GAJL 4OD2B 1UB6B 4UIMB 1OF2A 3HZMB 5CJQL 4OGAD 4LBEB 1W2KT 3I2CH 1NUGA 1IC7L 1ED3B 2RCSL 1S78C 3FB8A 2P8PB 4NHCH 4F7TB 1VERA 5EN2A 3WFHA 1QR1A 4PJFA 1Q94B 1WZKA 5INCA 3RU8L 2J8OA 3N1FC 5I1AB 1DP0A 5FYKE 1WGOA 3C9NB 5IVNA 3VA2C 5KSVA 3V5HB 5HYJE 4ZUUB 4OB5L 2JB6B 3PJSB 2JLLA 3OTTA 1REIA 1MREH 1WF5A 3WXVH 4CVZA 4LARL 1TMCB 5BS0D 3D0VA 5JLZB 4QOKE 3Q6GL 3C6LB 4MXQD 4Q97A 3KWWA 2GAZB 1IC4L 4LASL 5HYJA 2XTJD 2Y5EA 1JGVH 2OLDA 2GSIB 4PLJC 4Z5RA 1S9WA 3QXDB 4JFEB 4CNIA 2P8MB 3HE7A 3BKYH 4MA8H 4I0CC 1AE6L 4BQ8A 3BZFB 2LU3A 2DQDL 1JJUA 2WUBH 2JCCE 2OL3A 3FTGA 5T5NG 2R0LH 3RVWD 3PGCA 1RZIB 4F8QA 3RI5K 1NDGA 3LQZA 2K7QA 4P3WA 1N5YL 1G6VK 1AHWC 3BE1L 4LPUA 3MGOA 1JPFA 4X6CF 3RZCA 1RU9H 1I8MA 2XZAH 1KJ2A 4U6YA 3RIAF 1PKQE 2GI7A 1KTDA 2GYSA 1W0VB 1FYTB 2W0LA 3VXNA 1QFUL 4XNUH 1FE8H 4Z7VB 4QF1A 1N6QL 1YNTA 1BVZA 3D5OF 3PGFH 1PEZA 2H32A 2D7TL 4I5BA 3V9FA 3HLAA 3O0RH 1GC1H 2GSGA 2HRPH 3IDGB 3GM8A 4GAGL 2VAAB 4PJDA 1KGCE 2JK5B 3EFDL 3SJVB 2GTWB 3BGFC 4JFHE 2OTWA 5DJ6A 3SKMB 1PD6A 4HAFA 4HMEA 4LLYB 4HUXA 5IM7A 2DD8H 4POZC 2VE6B 3N1PC 5DJ8B 1IM3B 1NMAL 2QKIA 3L3DB 1BVKA 2VN7A 3F7YA 5IEKA 1RIUL 3MOAL 3PWLB 3MUY1 4BFEA 4EQ3A 1DUZA 3QDGB 4JB9L 4U7KA 3VXUD 1XGYL 3DETD 2V17L 3WKNA 3ZDZF 2J8UB 5J56B 1PYWB 1UB5A 4F8TA 5DD5H 5KSBB 1E6JL 3KYMA 5AG8A 3RKPA 3WIIH 3C5ZD 3MNZB 4ZUVB 1KCRL 3W11D 1P7KB 5I0DA 4QRPD 2Z31D 4KV5E 3QO1A 2ENSA 4PJCB 4R4FH 2ADFH 1HKLL 3QNXA 4MVBC 1RIHH 1JWUA 4NC1E 5CAYB 1RIVH 4PG2A 4FQHA 3O3AA 4JO3H 5E8NB 4UUJA 2NY4D 1SBSH 4XCFL 5DD0H 2IBZX 1EUTA 3DI2B 2DKSA 3PWPD 3MLYH 4BUHA 4MAUL 4F33A 4XZUA 3AM8A 4YHKH 3MRIA 1X5AA 3RVTD 5C70A 1ZA6B 2I5YH 5IBLD 4MCYB 2FD6L 1BOYA 1FGNH 4UIKH 2F15A 1IBGH 1VSCA 4R4BB 1KTLB 3AU1B 4RWHA 5FECB 5IFJA 3KLHD 5B39A 1OGAD 1AFVL 1HHHA 3KG5A 3MRMA 4GAYA 2UY6A 1H5BB 4NWUH 1DQDL 3RGVA 1IGML 1LEIA 5KSAC 4FN0A 1MIEH 4K2UL 5HHVH 1RZKH 3MJ6A 5IGXH 3O2VH 4MNQB 1AGBA 4YIQA 3NA4A 1BQSA 1HHGA 4HUWA 1BQHB 4MA7L 1MLCA 1SYSA 5DURD 5MEPA 4PJBA 3NZHH 3IJYA 2JIXD 4WTZA 5EOCL 4GAJH 1BVLB 2WUCL 4PRHA 1KNOA 4LNVA 5I1GL 5DZLA 4G6AD 5CEXB 4JPWL 4ORZC 4OI7A 3ARYA 3TNNB 5D2LE 4WFHE 4C58B 1BLNA 4GT7A 5I76B 1CE1H 2H2PD 3SE9L 1R5WA 2OK0L 3FQXB 1LQSR 3WE6A 4OB5H 3FOMB 2UYLA 3DX6A 4JRXA 1VACB 4JFXA 2IQ9L 4H8WC 3Q6GH 3NIDE 4Z7UF 4BH7A 4B5EA 3FONA 4IMKC 4LASH 1G7LA 1NAMB 1AQKH 1MCWW 2P1YA 4NGHL 4UOW1 3W0WD 3VXME 3T3ME 4C54A 4KXZH 3TV3H 4WI9A 1CN4A 1WCQA 1X5LA 4K7PY 2DQDH 1FZKA 4XVTL 2BSED 1R3IH 5IVXB 3QIWD 3VXMA 3RIFF 5DK2A 3BO8A 5L2KD 4HKBA 4ORGB 3M17B 1IGJA 2WBKA 2EECA 2OM5A 1U93A 4LP5A 4TOYL 4QGYA 5DHYB 2Q8AL 3CFDB 3V5DB 3GMLA 4YHYC 2NW3B 2P5WA 1X5XA 5CEYA 4ALAL 3WLBA 1N6QH 3FQNB 3F6LA 4UNTA 2OZ4L 4KKAC 4EI5A 2D7TH 2X2YA 2HLFD 3FRUB 1T22B 4BZ1L 4IRSB 4WO4D 5D7IA 3GMOB 5KANG 1NFDB 4GAGH 5DR5L 4OZFB 4LSSH 4LLQA 1OAZH 3IGAB 1JF6A 4N68A 5E94B 3TO4B 1M05A 1Y6MR 4HQQL 2OP4L 3MODL 4LSVH 4WHTA 3TBWA 3QQ9C 3MRLA 1NMAH 3PABB 5IB4A 2WNGA 2QSCH 5IT2L 3C5SB 4GUPA 2IQAA 4M7LL 3LMJL 2D0GA 1EO5A 4MWFB 3UTSB 4JKLA 4Y5XC 3KPRA 1EHXA 2V17H 3F7RA 3JSSA 3TPKA 5GGRY 3VJ6A 1YECL 4IJ3B 2WINB 1E6JH 1J8HB 2YD8A 3O9WB 5TGBB 4YLQT 3MTRA 3H42L 4QHMA 5ANMA 1DEEA 2HJKB 5C3LD 4MAYD 1F6FB 2Z4QA 1R24A 5KOVC 5C08A 4W68A 4HUVA 5C6PB 5IHBA 2Y23A 4A6YL 2A2QT 4TNVK 5D7KD 3RKDC 1FGVH 3VFWA 4EJ1C 4G6FD 3RUGA 1U3JA 5HJ3B 5GZOC 3CD4A 3NCYS 3RWHA 5IJKA 4FQLL 1S7QA 5D1XD 2FHBA 3HNSL 3LPWA 1B6DA 1X4XA 4MZ2A 4PJXF 3C60A 3K8MA 1DR9A 2FD6H 2O5ZH 4ZUWB 2PTTA 4CUCA 4HPOL 2I24N 5SWZD 1LNUA 3IAGC 5K9JL 3ARBA 1JZ5A 1FNGB 1XCTA 2HKFH 3ZLQC 1P9MC 3FAXA 3TVMB 4S2SA 4P0DA 5IQ9B 4CMMB 3HRZB 4OZFH 4KK5D 3AREC 5IIEB 5KVFL 2W9DL 3ARXA 4ZAKA 5GS1A 3NCJL 3VI3F 4PG9A 4G6ML 4NWTL 5C0BE 5J1AB 3KPMA 3EDFA 3T0VA 5TDPB 3H3PL 3SE4A 1EBPA 3E1F1 5JZ7C 2E27H 4OFVA 3BQUD 5ECJE 4G8IB 1MPAH 2BVQA 5EOCH 1RUAH 3LH2H 1XMWA 3WCYA 2Q87A 1HXMB 3UDWC 5AG9A 4PRBA 4YHIA 5JQHC 1U3YA 4JPWH 2NY0C 2YMXH 4JFQB 3TA3B 3PV7A 5ACLA 1FAKT 2EC8A 3G04A 4N5EC 4CW1A 5HHPB 4KI5D 2NCMA 4P2QE 1U8HB 4ODUA 2OK0H 4N0YL 1CFNB 1KIRB 5GJSH 2NZ9C 1FH5L 1CTNA 2Y9RT 3T4AA 1FNFA 4I4WB 1FVEA 1G0DA 4NPYA 3KYNB 2PCPA 3IDMA 1A14L 2DLHA 3CMOL 4QRRD 4N0RA 3P4NA 1IEBB 4NGHH 5CJXC 3EO1B 1I1AA 1AXTL 3FO9A 3IVKB 3NPSC 2JJSC 1EHNA 4Y4FD 3PWUA 4LAQH 2J5LB 4OZIE 1LDSA 4OF0A 2AKRB 4XVTH 4OM1H 4LU5L 1U8PB 5ACZB 3ZKQD 2X4SA 4MD0A 2R69L 1EEYA 1RQ5A 3L3IB 3DXAB 5BS0A 3RI5F 1S5HB 4LSTH 4ODTH 1FN4B 4FZEL 3IU3A 2GHWB 5FA4B 4P2OC 4OLZL 1T7ZA 3CVHB 4WW1A 5EOCJ 4IOFD 5I75B 1SYVB 2YA0A 5TF1L 1N2RB 2OZ4H 3GKWL 3P3YA 4XWOC 4BZ2L 4PGDB 4BZ1H 3DURB 2B5IC 4LLWB 1UADC 1BQHG 1CD1A 4JFPB 3WN5A 3U0WH 3LPFA 4WHYG 5HI4D 1Q9LA 1II4E 5I1LA 3F65A 4I9WD 3V6FB 4RFEA 4PV9A 4P23D 4HQQH 1YC7A 3HAEH 1KIPA 1PG7X 3D6GA 2FRGP 5IT2H 4G8FB 3GJFA 1N3NB 1MAKA 1IE5A 3TH3T 3LMJH 3G6DL 1G0XA 5C07E 2NX5D 3UBXA 2ITDA 5GRVL 4YDJB 1K5NB 4URTB 4LP4A 1YNKL 3MFGB 4NO5B 3EDEA 1X4ZA 5LAXB 4NOFA 2I26N 3QI9D 1MHEB 3FQRB 4P57B 3NFNB 5C07A 3QUXC 5EBGA 3H42H 1CDIA 3D18B 4R8WL 5BJTB 2DQFA 2XFXB 5C0DB 2V2TB 3LDBC 4YDKH 5JHLH 5FF6B 3T1FA 1TTGA 2A6KA 4A6YH 3SGEH 2JJWA 3QWRD 3CC5A 4LNRB 4LKCA 2VDRH 1S7TB 4NUJA 3CZFA 3MBED 4N9GA 3R1GH 3L3OA 1X7QB 4NQEE 1ZS8B 4D3CL 1AGEA 1TTFA 3TZVC 4C4KT 3HNSH 3C5ZA 1KPRA 2R9HC 2BCKA 4PJ8D 4GH7B 3DHJA 4GW4A 2AK1L 5L7XL 3RPIA 1J7VR 5CS7A 4HUUA 5DWUL 5K9JH 1CG9A 1YQVL 2FEDC 4NQEA 1HCFX 4F7CB 4Y19B 1BOGB 1KB9J 4ZTPL 3EYFA 4RFOL 2DM7A 4G9DB 4P46B 5IK3B 1SEQH 3DIFB 5KVFH 1LD9B 5DFWH 1S9VB 4GS7B 3NCJH 3PWPA 4C56E 5DGQA 1IM9D 4G6MH 1AGFB 2OMBA 3H3PH 4APQD 1EFXD 3TBTA 3QJFA 3MREB 4CMHC 5MHSE 5TH2B 4NCC1 2A73A 2X6MA 5IBTL 2FGWL 2ZG2A 3EW3B 3G9VA 4KKNA 5D5MB 2AW2A 1QBLL 1OGAA 1E4WL 4K94L 4JM2F 2V2WB 4LPYA 2DL2A 4KMTH 5J06A 3L6FA 4PGEB 3VFUA 2NY1D 3FO0L 4HKJB 3IFOA 5K9OA 4H25A 1MY7A 1DTUA 2BVOA 2AK4B 3MXWL 5KSAA 1WAAE 5E2UH 2PYED 5IMKA 3VFSB 1QRNB 2CIIB 4HC1L 2G9HA 5EZJA 3S88H 1MRFL 2FO1A 4UMGA 4RDQG 3D1MC 4N0YH 5AAWA 2JIXA 2XIDA 3RNQB 4B50A 2IANB 1JNJA 1Q9KA 1EHLL 2ADJB 3RWEB 3DV6B 4U1KA 4WV1A 5AAMA 1AP2A 5CSGA 5F3BB 4DW2H 3CZJA 1ZEAH 1A14H 1CF8H 2RIKA 1AXTH 1CIDA 2ZZUT 5J12B 2XWJB 4XVJH 3L3HB 3S4SB 4FQXB 3VWJC 2EDWA 3MLXL 3OX8A 5CIPH 4HFUL 5C0FB 1QEWA 4XI5C 3LKPA 4U0RC 4N0UB 5LJYH 4KH2A 5IBUB 1ZK9A 2G5BA 3CLFL 5DTFA 2GTZB 4KDWA 1YUHA 5KSBF 1JHTA 2L4OA 4JFDE 5DSCB 4KKCC 2EH7L 5DJ0B 1IAKB 3ARFD 3W0WA 4HIXL 3UTTA 3IDNA 1EMTL 2A9ML 2FX7L 4WI8A 5D7JB 4E42B 3L5HA 4OLZH 2YD1A 3BPCB 2YUXA 3VH8B 4IMKA 5L2JB 1B88A 2BY0A 2KQNA 5TF1H 3GKWH 5EFIA 4HWBL 3OKEA 4BZ2H 4JO2L 1TIUA 3QIWA 2CRZA 4JREB 1GYAA 3QT2A 3T65A 3GMRA 4U2YA 3LKRA 5L2KA 4K55A 4XRCB 2VABA 3U30C 1HEZB 2OYPA 3ARWA 1XIWB 4Z8FL 1KPVB 1XGTB 3QCUL 3O6ML 4HG4J 1JGEB 4MS8C 2A6IB 4XVSL 3O6LH 1LP9B 5ID0A 2DKMA 4MMZC 5DJXB 4OZGB 2P4AB 3H3KA 4M02A 3RZWA 5H2BA 2WLZA 1MHHB 1A47A 1YPZB 1YNKH 4PS4H 1G7QA 1ACZA 2BY3A 5HHOE 4K9EH 4NYLA 1YDPA 4KZDL 1QTYT 1HSAB 3OKMB 4MSWB 3X13B 5ITFA 1QSFE 3MV8B 3BP6B 3CUPA 1AO7D 1I7TB 5HHOA 3PP4L 3FO2B 1PVHA 1UM6L 5IG7A 3SBWC 2YC1B 5KS9A 4OQTL 4TNVF 4AL8L 5E2TL 4KHTL 3ARDC 2WWKT 4AEIH 1QSFA 3VCLA 3ULUD 4Y5XA 3LN4B 3EDKA 1D5IL 4MQ7A 1BF8A 5GGTL 1LEGB 2X4RA 5KSUA 1R5VB 3QUKB 3UYOD 3UCRA 3JWOL 2AK1H 5L7XH 4LCCA 5GRVK 2LVEA 5GGRA 1QQDA 4O2CA 3RVUC 4X6DA 3ULVC 5DWUH 4ZS7L 4AQ1B 3CSPA 4X9BA 2HTLD 5IWLC 4JHZA 5HGHB 3LAFA 5L9DH 3GSNL 3TPUB 5MI0C 1VDGA 2ARJQ 2FWOA 5HHMD 4KK6C 4DEPB 1G9NH 2AJYL 5D1XA 4B41A 5F44A 1GIGL 2CIKA 4WDIB 1KJ3L 1JFQH 1A7OL 3DBXA 4C59B 2Q8BL 4LCYA 1T03L 4KMLB 1HIMH 1MJ7L 4PJAA 5IVXF 4JGMA 4UT6H 5SWZA 4XTRC 1ZHKA 2FGWH 3JWDC 1EDQA 5IV2B 4JANB 1QBLH 1BWWA 1KGCD 2RFXB 4U1MA 4PJIF 4K94H 2AV1A 4E5XB 3BVNB 1BM3L 3KPSE 5CEZE 2AXFA 4Y16C 1OW0C 3AMKA 1P9MA 4QNPF 5A3IC 2O5YL 3QIBC 1BBJB 4U1GB 1BPVA 3AREA 5I8OH 5J11B 4HC1H 1MRFH 2P47B 1T7XA 3DMMC 1KENH 3BP5A 5CJBA 4C55A 4X83A 5E2JA 1IL1A 3KPSA 1MVUA 1EHLH 4LF3A 2GCYB 4NT6A 3MNWB 2XPGA 1NFDF 1KULA 3WSQL 1F4WL