3GBNL

Crystal structure of fab cr6261 in complex with the 1918 h1n1 influenza virus hemagglutinin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
Knots found
sequence length
201
structure length
151
Chain Sequence
VLTQPPSVSAAPGQKVTISCSGSSSNIGNDYVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEANYYCATWDRRPTAYVVFGGGTKLTVLEELQANKATLVCLISDFYGVETTTPSKQSNNKYAASSYLSCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin
publication title Antibody recognition of a highly conserved influenza virus epitope.
pubmed doi rcsb
source organism Influenza a virus (a/brevig mission/1/1918(h1n1))
molecule tags Viral protein/immune system
total genus 25
structure length 151
sequence length 201
other databases KnotProt 2.0: Artifct K +31
ec nomenclature
pdb deposition date 2009-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gbnL01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gbnL02
5DJ0A 3PWLB 1G7LB 4PRBB 1RIUH 4LNVA 3BIKA 4Y16A 4NN5C 2XI9A 1E4KC 2VZUA 4JO3H 2R4SH 5TDOA 1KFAH 5I18L 5J9PB 3BZEB 4JG0L 1QQDA 4JB9L 1U8QB 2F15A 1F11B 5I1DB 4J4PD 2B4CH 5A2KH 1DQLL 3FFCE 4U49A 2GITB 1OSZB 1UVQB 1MI5D 3QH3A 3OAYH 3S34L 4HUVB 1AFVL 1U8IB 3OG6B 5CKAA 2VLJB 4NPYB 5JLZB 1WSST 3D3VA 4NNPH 3ARFA 1QVOA 1MNUH 1S7XA 3BIBX 5D71L 1MCFA 4X6CB 1AO7E 1P1ZB 5CZKA 2W9DL 3O3BB 3VWJB 5DJ6B 2P5WD 1DBJL 5HSFA 1HH9B 5ID1B 1LK3H 5B3JF 3MR9A 1BX2B 4GRWB 3LH2L 5GJSH 3EOTH 2IPKB 3O6MH 4H8WC 4U6HB 1S9XA 1PYWA 2H2SD 2W0FA 3DXAB 2FJGB 5FYKL 5ITBH 1JZ4A 5TQ2H 1UM5L 1I3RB 3KVQA 1U8HB 1KACB 1Y18B 3EO0B 4PY8I 1NAKL 4QRTA 4PYHA 3DX8A 4EUPA 3CLFL 4KMLB 5T1KD 4PJ8C 3G6JA 1T66C 4LQFL 3QIUC 4LRNH 3VXNB 1A4JB 3O9WC 4F7EB 1D9KA 4XH2B 1BF8A 3PHOB 3RY6A 1CG9B 2CXGA 2X4NA 3U2SA 5GHWL 5L8LB 1C5DB 5GGVH 2RB8A 5IR1A 4TYUA 4IIQA 3X12B 1KV3A 4APQB 4QOKA 2A6JA 3QUXD 2NTFB 3EZ8A 2PCPA 5F21B 3HNSL 5JOPE 2FO4B 5KSAB 1CGSL 2YUXA 3UTTA 1TJIL 1A7PL 3EYOB 5HPMB 5E9DB 3NH7H 3GMMB 4OQTH 4Y8AA 1EAPA 3RY4A 4LDOB 3PWUB 2FATH 2IAMC 5IVXE 4GRLD 5IQ9B 1ES0A 3MV7A 1MLCA 4A6YB 5ERWB 3OAUL 2FWOB 4H5SA 5JIKA 4UOJA 3C5SA 3ILPB 4JFDB 4LLMA 5J8OA 3S5LG 2K7PA 4EOWH 5EIIA 2X09A 5DXWA 4R2GD 3SCMD 4ZPTB 4NGHL 5L0QC 3DX6A 2VR5A 1QSEA 1BLNA 1KIQB 3O6FC 5TJWK 4FTVA 4NHCL 2ADJB 2ZWLT 1RUPL 2HVJA 3WNMA 3GJFH 3MUZ1 1KJ2L 1BVLB 3FRPG 1VERA 1H8OA 1S9YB 4LARL 1GGIL 2B0SL 3VRLE 1SVZA 2XA8L 1VEPA 3ARDB 4U1MA 3UTOA 5GGQL 4BM7A 4KKLD 3G08B 1F4XH 1FIEA 4AIZB 3W9DA 3MV8B 5HHMD 4H25A 1RJZA 2BVPA 2A9NH 3P9MB 3UTZB 3S35H 4MZ2A 2ADIB 1KTRL 2XG5A 3FQXB 1ZOXA 2R69L 4JFPA 3PGFL 4OBRA 5JA9A 3GSRB 4EQ3A 2H2PC 3QWOB 5C0BA 4DVBB 3VE0B 4XMLH 3V6ZB 3EOAB 3PNWB 2PXYD 2P5EA 4ZMAT 3IU3A 1KYOJ 1A7RL 1IKNC 3OV6A 4G6MH 1AP2B 5J6HA 4UT6L 4L3ED 2VZ3A 5FA3B 2P44B 2NNAB 3PF2A 1G7MB 4I0PC 4EN3C 5ID0A 2GW5A 4QRQA 1B6UA 4NO5A 3RHWK 4WFHD 4AL8L 3WKML 1YEHL 4I3RL 3MGAA 3VD5A 3PIQA 3MGOB 5C86A 3HZMA 1T21B 3ZDZE 4WW1B 1JYWA 4QEGA 3G5XB 4FQQB 1AR1C 2CKBH 5E56A 4J2XA 2YXMA 4U1JB 2ADGA 4WWKD 1OCWH 5DQDL 5BS0D 1CGYA 1PKQE 1LDPH 1I7ZA 3QEGL 2NY0C 4LU5H 3GBNL 1MIMH 3W39A 3FZUC 3IJYB 3HRPA 1HHHB 2DKMA 3ALPA 1DLFL 4KRPC 5DQJA 3B3IA 2V2XA 3HUJF 1IC4L 1JPTL 4QHLA 5KVMC 3QYCA 5BOZG 5E8PB 1A9BA 3MLYH 1KGCD 2NXZB 4BQBA 1MPAL 3Q6GL 4NN7C 5I75C 1EO8H 5FM5M 4G6AC 2NLJB 3U4BH 4X4XB 3QUKB 2EDLA 3FT4A 3Q6FA 1OTUD 4JPVL 4PS4H 5CKGA 1EJOL 3PV6B 1VGEL 4RZCA 1UM6L 1NCNA 3DMMA 4ISVB 4CMHC 5IFAH 3BKMH 3VFSA 4ACPA 1FG9C 2GI7A 3BFOA 3V4VH 3S36X 3MJ8A 5ICZA 5KSBA 4JM2B 4L4VA 1Z6JT 4O9HL 5BVPH 1T5XA 3K74B 3FN9A 2FEDD 3WIHH 1TZHB 4Z5RA 3TH2T 2MHAA 5EUOE 1ZLSH 3W0WE 1TENA 1CFNA 3D2UB 4BFGA 5HHQB 3KNBB 4PB0L 1UXWA 1N5YL 5C8JA 5AG8A 3ARZA 2D7MA 4CU8A 4M7ZC 3NCJL 3VG9B 3DV6B 4HH9B 5KVEL 1ZHBB 5JUEH 4KXZH 4Y19D 2Y72A 3QJFA 1G6VK 2VDQL 3ARUA 1NJ9B 4K3DL 4JZNB 4Y4HD 3UBXA 3VW3L 1NBVH 3GMQA 4Q6IB 3C5ZC 3MLZH 3UX9B 3FOLB 1WICA 3KPQB 4JN1H 5GRZA 2Q1EA 3VWKC 3LKNA 1B4RA 4WI9A 4LVOC 5CMAB 2NY7H 5KANI 4GQ9H 2OBGA 5F6HJ 3OJDA 7FABH 1NSNH 1FL5A 1MI5E 3CZFA 4YZFE 1SYSA 1RJCA 2MKLC 2VDNH 2JJVA 3PWPB 4LVEA 3TF7C 1UWEH 1NC4D 4Q0XL 3QEUA 4JRXD 3SE9H 3QAZC 4HKXB 4M02A 3UROR 1NGYA 3SDYH 1EVUA 4X6FA 1LEIB 4OGAC 1WZMA 5F70A 4Z7WA 1ZLVK 2EO1A 3WL9A 3T0EB 2P5WE 3HNTH 5JW3H 4XX1E 2X4OA 5F6IC 2CDEA 4FZEH 2ZSWA 2FX9H 4EZMA 4JFQB 1I1CA 1QACA 5DVOA 5IEKA 1Q72L 5GS2D 2B20A 2GSIA 4R0LA 1CXKA 5FHBL 5IG7B 4YHKL 4YX2H 4J8RA 2WWMD 4HGMA 5ITFB 2HLFD 1XT5A 1MY5A 5MI0C 5HYSA 4Y2OA 1W0YT 2HYMA 1A6ZA 4JY5L 5D6CB 2F74B 3G04B 4U1GC 4RGNC 1BIIA 3NGBB 1FAIH 2BRRH 1HZHH 1GVIA 3MJ7B 2ARJB 3B8SA 3TN0B 2F58H 2EYRA 5ICYA 3RP1A 4UB0L 4QWWD 3HR5B 4P5TD 4PGDB 5ESAB 4YDIH 1UB5B 3BZ4B 4U6TA 1DJSA 4U1SB 2WIIB 5IB5B 1C08A 3BKJH 1EBAA 4X8JA 2PYED 1XH3B 4WGVB 3PDOB 5JNYA 2BNQD 3DARA 3MRHB 1I8KA 4L4JA 3O0RL 3PL6C 4XHJC 4XNUH 1I8MA 1WFNA 4OAWA 2P7TA 4JANA 5T5NG 3OZ9L 4OCSH 2YOCA 2WAHA 3FQUB 5LWYH 2X41A 2D31B 4JDVA 4EDXB 2CR6A 4MA8H 5I66A 5INCB 1HQRB 2OI9C 3BUYB 4ZOAA 3WN5A 3ARYA 1N64L 3PWNB 5D2NA 1DUYB 4L1DA 1KPRA 4P2QD 2W91A 4PG2A 1FO0H 3TH3T 2F53D 1XZ0B 3FQNB 3ZTJH 4QYOB 1CU4L 2DLGA 4PJ9A 4F8QA 5L6YH 2JB5H 4F7TB 1AKJD 1OP5H 5E2VH 2DQJL 2VDMH 3BEVA 4MAYD 2LFGA 3GJFB 5HD8D 3TBYA 3QUYC 3F6LA 2X4SA 4PJ5D 5E9DE 2PYFB 4HX1A 4ZUUB 5HHME 4OZHF 1FJ1A 1J88A 4BFIA 3ZHDA 4YJZL 3R06B 2AXFA 5TGBB 1R24B 3L5JA 1TNMA 1CFSB 3JUYA 3QCUL 4P3CL 3HPJB 4G3YL 5FGBC 1HXYA 2AXHA 3MRDB 4MA3B 2KUTA 4TUJB 2CIIA 5L9DL 4CDHA 4P5MB 1RSFA 3ULVC 5TFSH 2VDLL 5E95B 2XWBA 3IFNL 5EN2A 4ZSOB 5IMLB 3FFCA 2NY4C 3MRLA 5IW3A 4WV1B 2QSCH 3SJVD 5IFHH 4IJ3B 4DZ8A 1UT9A 1HILB 2UYLB 1YNTA 4HXAL 1F45A 4FMFA 4L3EE 4L9LB 2F5AH 3QDMA 1RK0B 2R1YA 2P24A 4PTTB 4LMQI 5C08D 1DSFH 1GH7A 1L9MA 4NKDB 3UDWC 2GTWB 4WFHE 1T22B 1R3KB 4PG9A 4M1CD 3L3JA 1A6TB 3MV8E 3QIBD 3NIGE 4P9HL 5DEZA 4OGXL 4UDTA 1HK6A 4AM0A 2FR4B 4BA8A 3O45B 1C16B 2H26A 4EQ2A 2EDYA 3QUZA 4ELMB 5D1ZD 3FB7A 5LQBL 3OPZL 1IRAY 1T89C 5ELIA 1P69B 3GB7B 5BS0E 2QTEA 3BYTA 4ERSL 1NBYA 3OB0K 5DTFA 4XPGL 1JZ2A 4LASH 4UUJA 1T0NA 2CKBB 1FZOA 2MCPL 4OTXL 4LCYA 3RX8A 4NC1C 1DZBA 1MH5B 3OHXA 5IROC 4M3JA 1CN4A 1KGCE 5LG1A 2IH3B 1UACL 4OIIL 3TWCH 4MXVF 3BKYH 1E6JL 2G5RA 2G75B 2R23B 2AJVH 2DRUA 4FQCL 2VLLB 3BZFB 3TCLB 2C1PB 2VDOL 1AR2A 4FA8A 2AK1L 4K94L 3OKDB 1WLHA 4XNMB 3O4OB 5BZDA 3QZWG 1JBJA 3N9GL 4PRPD 1TDQA 3SKMB 3JBG7 5IVXA 1S7QA 4OSUH 4F9PC 4LSTL 1S9WA 1CXEA 5T1LB 3VXOA 5DJAA 4YFEA 3QPXH 3SQOL 1NCWH 5GIRA 3SY0B 4OZ4A 3W11C 4Y5XC 3IFPA 3NTCL 4NQCB 3SDAC 3MXVH 1PD6A 5M95B 3OTTA 4LLAA 3MLTA 3MRIB 4Q9RH 2OZ4H 4IM8A 3S96A 1U8OA 3OKNB 5GGRB 2EE9A 5GS0D 3LPGA 4U7KA 4JZJC 3PP3H 3FTGA 1X5KA 2H3NA 2FYYA 1KUMA 4Y5VC 4OB5L 5HY9B 4YLQT 5EU5B 5F88B 3V5KA 5D7IE 1F5WA 2A38A 3G5YA 3MRCA 5A2FA 2BVOA 3QQ9C 4N0RA 3TBVB 4ODSH 3BW9B 5IMMA 2R4RL 3DVNB 3L95B 4Z78B 2HRPL 4JQVC 4NNXB 4OLYH 1OPGL 3P4LA 3MA7B 4OJFH 4YUEH 3BD3A 2YC1B 4WFFD 3RL1A 3HZYA 1FZMA 1WZ1H 5D1QA 4HJGB 1PKOA 3D69B 3P9LA 1LE9A 4HC1A 3SOBH 1GZQB 3ZE0F 4DZBB 5DA4A 4KKCD 4NO3A 2VL5B 3T3ME 4D0DB 4IOIA 1S7UA 4H26B 1Q9WA 2Z0BA 3QXTA 4R3SA 4Z7QF 3GDBA 4MA7L 4YZFF 5F9DC 2HKHL 3PV7A 1T20B 1KC5L 2V5TA 1KBGL 4ZDHA 1P4LB 2W59A 2M8XA 2KBGA 35C8H 3V7AG 1KG0B 1WIPA 4NZRH 1K4CA 5L7XL 2ZG1A 5C7XH 5J12B 2I9LA 1FSKC 1UYWL 1NCDH 3FAXA 5HYQB 1YEJH 5DHXB 4CVZA 3BJ91 5FKAA 4HS8H 1KSRA 5CEZL 1J1OH 3HUJB 1H8NA 1A2YB 2BVEA 1NC2D 3SGJC 4MS8C 2PYEE 3ELAT 2ZJSL 3ZYIA 2RIKA 2BNQE 3LY6A 3QQ3A 1SJEB 1UCBH 4NWUH 3I50H 4B50A 4DTGL 4MLSA 1YMMB 1IAOB 2FH8A 4UZGA 4LGPB 5DRXB 2CIKB 2FZ3B 1HNGA 2CGRH 4OCXH 2JCCE 5I1JL 4YE4H 3HE6A 4CN4A 3O3DA 3LDBB 2C1OA 1T1WA 4K7FA 2ZOLB 3MBXH 4P2QE 1OQXA 5A40E 4LK4A 3H9SB 3VFUB 4BQ6A 2F53E 3V5HB 3LN5B 3SO3C 3DURB 3IDJA 2ICES 5C0RL 2J88H 3U79A 4ZFFB 1RULH 3OGCB 5T1DH 2LABA 3O9WB 1D5MA 1FO0B 1OD9A 3SE4A 2XKNA 4OZIE 1G0XA 3TIDA 1EA9C 3CD4A 4PJ5E 3U9UB 5EUOA 3W0WA 4ZD3L 2CK0H 2DLFH 4YHPA 2E6JA 2YS4A 3OXSB 4NKQB 1ONQB 3REVA 2W9LA 2WBWB 1IGTA 3GJEA 3LS5H 3CUPB 1QLFA 3S37H 4ODTL 4JN2B 3MCKA 1KPVA 1J10A 3F62A 4PJEB 1RAMA 5F1SA 2G5BB 2IBZX 1AC0A 2DJ4A 3KS0H 5I1AA 3TVMC 4WEUD 5IF0B 4ZOBA 1CLOL 1G6RL 4J4PA 4OCWH 1UGNA 2WMPA 1NUGA 2HT3C 2YMXH 2DKUA 4TVPD 3SJVE 5TH2A 1U3HC 2VQ1B 2Y4SA 4U1HB 4JGUA 4PJ8D 1T66D 3QIUD 1KJ3L 4KHTH 1DBAH 3O6FB 5GGUA 1QBAA 4M48L 5C08E 4PJIB 4KU1A 1AGBB 2QQKL 2FNBA 4WHCA 4P46B 5I1GL 4ZUVB 2P5WA 3V0VA 3ZT5A 3IS1X 1UA6L 3SDCB 5D5ME 4RNRA 4DK3A 3PWLA 3IRZA 1G7LA 1MF2H 1QSZA 3BP7B 4HWBA 3LOWA 2B5IC 4XT1C 2ZCHL 3L1OH 4F33A 2WP3T 1F90L 3VXSB 3BZEA 2IAMD 4JAMB 1KF9B 1U8QA 1FVDB 1RZKH 4ZFOB 1N2RA 3QWQB 5I1DA 3T04D 1QNZL 5CD5C 4WJ5B 1HQ4B 4U1KB 5F1IB 4QTIH 1UVQA 2CR3A 5IB3A 3PG2A 4Q9BA 3F58L 1NH6A 1BBDL 1FNSH 2HG5B 4LLYB 4AENB 1NCBH 1IAKB 5HYEA 1IM9B 2RCSH 2JIXB 2VLJA 4NPYA 4YFLI 5JLZA 4OZGF 3RPIB 2CJUL 3T65B 2ZKHH 4PP2B 3QHZH 3LRSA 1JGDB 4UDUB 3TO2A 1P1ZA 2V9QA 3QUXA 1LEGA 3O3BA 4R8WL 2CQVA 5DJ6A 4NCC1 1SY6H 1M7IB 4PLOB 1TQCB 1U0QA 1DTUA 3VXMD 2Y07L 1C12B 1LVEA 2DQFA 4NUGL 4CJ0A 1HH9A 1MVUA 2KDGA 4LP4A 4UINH 4PRPE 4ELME 3RHWF 5E5MA 3HE7C 2IPKA 2VZVA 3C2SA 4JFFB 4M1DL 3DXAA 4FFYL 1T04A 2FJHB 3STLB 1NFKA 1I3RA 2B8OT 5E7BA 3IVKA 3RL2B 1HEZA 3SCMA 2BHUA 3OSKA 5D6DA 5DD3L 1XCQB 1KEML 4DAGL 3RPKA 3LEYH 4YEEA 1MREL 2FECI 3VXNA 1A4JA 4WHTB 2ZUVA 1KCVH 2V2TA 3KDMB 4N0FB 4OZHB 5C0IA 2XG4A 4F7EA 1P53A 5AZEH 3U7WH 2H2PD 5D7JC 5K9QI 3GMLB 4TSBL 2R0KH 3REWB 3NIFE 1OP3K 1LE5B 4KRPB 1CFVH 5BMFL 3GMNB 2GJ6D 4DFHA 4JKPH 1ZT4A 1C5DA 1QKZH 4X7TB 1X5FA 4UAOC 3X12A 2NTFA 2PW1A 3QDAA 1DQJB 4OLXH 3KYKL 2R0WL 5EZIH 5FB8A 4YK4C 2VXUL 3EYOA 5IBTH 5E9DA 3GMMA 3KGRA 4XCYA 4K55A 3PWUA 5KS9E 4GSDH 4I0PD 1DLHA 4EN3D 4HFUH 4NZJA 1U2CA 5IQ9A 5JZ7D 3H42H 4CMHB 2SEBB 5ERWA 4HT1L 2DI8A 4HCRA 4NT6A 2VJXA 1ZWIB 2XZAL 4WFFE 3ILPA 4U6YB 3MLSH 3AXLB 4GAJH 3JV6B 4GXVH 3T0AA 1NAMA 1JHTA 3OR6A 2CUIA 1QFHA 2IANB 1MCOL 4G8GB 3KYNA 3GNMH 1AR1D 1BOYA 4PY7B 4XNXH 1DUZB 3U7YL 2A73B 1KIQA 4NO0B 3FO2A 2NY0D 4ETQA 4HJ0D 1F4YL 2ADJA 4OFYD 3FZUD 4OCRL 4FQPA 2EKSB 1CFTB 1S9VA 5D7IF 4JZOB 5JMRA 2XN9D 4HLJA 1R0AL 1S9YA 4L3EA 5E5UB 5B38A 3C5ZB 3TJHC 3O3EB 3O8XD 4XPAH 1JWMB 2YPVH 4P2RB 4G6AD 2VERN 3MXWL 2J5LB 4QF1B 3MV8A 2QR0B 4X7SL 2XKUA 5INDB 4KVNH 3MJ9H 3QHTC 5ALCL 4OD2B 3VI3F 3QAZB 5J06A 3DX9B 2ADIA 3FQXA 5BS0A 1OY3B 1K8IB 1D5IH 4M7JL 3BMWA 2GUOB 3T3MF 3GSRA 1HHJB 2EDNA 2GT9A 5ACZB 4G6KL 2EDFA 3QWOA 2DB8A 1JJUA 5F89A 2HN7B 4PRDB 4DVBA 3GI8H 1HIML 1H15B 2LTQB 3V6ZA 2CDFA 5FXCH 2A6DA 4MD5B 2E7LC 1I1AC 4WTZA 2MPAL 4H1LA 1ZLWH 1N5AA 5JQ6H 4YFLF 5IIEB 4BSWA 1RQ5A 4C83A 5FA3A 5I1IH 1G7MA 4OQ1A 1QLEH 3VWKD 2GIYA 3NFSH 1OSPL 3I84A 1QPXA 2HKFL 3IDNB 3VCLB 3VH8G 5K9JH 4RGNB 3RKDD 4TUKH 3MNZA 5E6ZA 1ACYL 4ODWB 1T21A 1NGZA 1OT1A 2WSKA 3BPOC 5D7LB 5IBUB 1ETZB 3LKSA 4OGAD 1YEEL 4OCNC 2BDNH 4JR9H 4UILH 2EDBA 4WEMB 5I0DA 2OR8A 1HSAB 1DBBL 4MMZC 2Q8BH 1A6VL 1HHHA 3DNKA 1MUJA 2DQDL 1EUTA 3BRDA 4Y4HA 1B4JH 1I9RL 3QWRD 3FT3B 5EA0H 5E8PA 1L6XA 4Y5YC 3PL6B 2VQUA 2NLJA 1FRGH 4JQIL 4MJ6A 4QRRD 4X4XA 4TVPE 3A6BH 1OW0C 5AD0B 4RMWA 3LD8C 2NR6D 3LQAH 1A9EA 1NC4A 5T5FH 4I48B 1A02N 5T33L 1OL0A 1ZEAH 3I6GB 4OZIF 4A2MA 3RUGE 5J1AB 4LVNC 3ZL4L 1QFOA 1W72H 4RFNC 2VDPL 1AC6A 1E27A 2KKQA 4M3KB 3DGGB 2APBA 1SJHB 3LAFA 4XBEL 5JXAL 3DIFB 3D2UA 5CBAB 1BP3B 3EBAA 5HHQA 2A1WH 4OZFG 4QRUB 5ESQB 1T03H 5L88L 5CP7B 1B6DA 3SGEI 2NY3C 4NQVB 3DV6A 5JHLH 4M61B 4PJEE 1MHPL 1ZHBA 4GG6F 5DRNB 2HJFA 1L0QA 5F96L 3JTTB 2A9MH 1NJ9A 2IJ0C 3WO4B 3CIQA 4JFZL 5EFIB 5KTEL 3C6LC 4L8BB 3RVUC 3E6HA 3EGSB 4NQSB 1ZLVH 2IPTH 2ERJC 2YRLA 5CMAA 2IWGA 1YPZE 1BJ8A 4TPRH 3LPWA 1ZAGA 2B1HL 4RAUB 1EV2E 2NTSP 4WY7L 3TNNA 4WWID 4LSVH 3ABZA 1R5VB 5KZCB 3O6KL 3CGTA 4LSRH 2CRIA 3EYVB 5I1EH 3U0TB 2NY4B 1LEIA 4X98A 4PJIE 1IGML 3EDJA 1CYGA 32C2B 4P5TA 2VXQH 4HIEB 2A74A 2DQCL 1I1YA 1U8KB 2EZ0C 4YQXH 1WCBB 3T0EA 3S6CA 3VXME 5D5MF 1CFBA 1K8DB 3U7AA 1RUAH 3B9DA 4HHAB 4JFQA 2BNQA 3ZYOA 4G7YL 4I5BB 1NGWB 3QUYD 4K23H 1GPOL 1OAUH 4ZO6A 1WBXA 5DD6B 5I16A 5J56B 4Q9CA 3RI5K 3SPVB 2M26A 5FA4B 1KULA 4JFXB 1T6VN 4L8SB 5EULV 1N0XH 1F00I 1TTGA 3CDCA 2JCCA 4G9FB 5I15L 1V3MA 3BPNB 3T2QA 5F3BA 1KOAA 2ILLA 3PHQB 4OV5B 2F74A 4E41D 4P2QA 3ULVD 3VXPA 3VD9A 4FQIH 3I2CL 2F53A 3MJ7A 1A7QH 2GJ6E 3K7UA 4IMKC 3HZVB 5DFWH 2ARJA 4GUPB 1YECL 4DCQB 4YXLL 1Q8MA 3QIWB 2NY4D 4I0KA 1AKJA 2DQTH 5IESH 3VD4A 4NZDA 3HR5A 4MAYA 2OR9H 3U6RB 4LRIC 3SEPA 4LAQL 2F54B 3N0PB 1SBSL 2QQLH 3LKQB 1CXLA 4U1SA 4V1DB 2WIIA 4MA1C 4D9QD 1A7OH 2WNGA 1MQKH 1XH3A 3UTQB 1J05A 3MRHA 5C0AB 1JNLH 3RWHB 4UU9B 3SKOB 5JO5B 3F6IA 3AY4A 4XCFH 3TYGH 3P4OB 3FQUA 4G5ZH 2DQEH 3BPLB 1E28B 3BT2H 2D31A 1T3FA 3U36A 3CC5A 4EDXA 3WLBB 2JELL 2VXVL 1KTDB 3C08H 3EJYD 1KTLA 4HMDA 4PJAB 3S4SB 3PWNA 5D70L 1DUYA 3NIFF 5BVJB 3E2HB 3NZHL 1Q94B 3SJVA 2XN9E 4XRCB 3RDTC 1XZ0A 4R4BB 3SDAB 3IU4H 2APWA 1FHGA 2HTKC 2XQYG 5MEQA 4F7TA 5SWZD 3HCVA 5J1SC 4L29A 3KPRB 4NQEB 3ECBB 4ZUSB 4S2SA 3BH9B 3GJFA 1H5BC 5C08A 1J7VR 1OM3L 2OXHA 5KS9F 4M6NL 1JYNA 4Y5VB 2PYFA 4HS3B 3MA9L 5L2KD 1HH6B 3ZHKA 1R24A 2DOCA 4XNQB 1VFAA 1CT8B 2NW3B 1P7QB 5D5MA 1A0QH 4CAGA 5D1ZA 3MRDA 4JO4H 3P0YL 4JGMA 4HH8A 1H3XA 4OZGB 4PR5A 4ONFL 2X4RB 2R9HD 3HAEG 4V2CB 2PTTB 4L8CB 1LQSR 3L3HA 4I2XB 4R96A 3D0LA 1GAFL 3W11D 1HI6A 3SDAD 1HILA 2UYLA 1CGTA 4IBLT 4WCYH 4FNLL 2NY5H 2WLZA 4XXDB 5CGTA 1RK0A 5E2UH 4D9RD 4OLEA 5EORL 4PTTA 5MEPB 4HJJH 3OB0H 2AXJA 1WC7B 3RKPA 1DVFC 1F4AA 1R3KA 2X40A 2AP2A 2YPLB 2YN3A 2HVKB 2X4TA 2XFXB 3O45A 5DHVH 3WHXB 3KLHC 1P7QD 4PRPA 4QXUH 4ELMA 5I76A 1FSKB 1FLTX 4NQXA 2R8SH 1BD2D 1PQZA 3GB7A 4U1LA 2AJYH 2YD6A 4NKOB 2JJSA 3EKCA 1RJLB 3A6CH 3VFOA 4JO2L 3GSNL 5IWLC 1XF5A 2H1PL 1BQSA 3PABB 3S88L 1QYGL 1VKXB 3LS4H 1FGNH 1MH5A 3EYUL 2FRGP 1YEIL 2NYYD 2QADC 4Z8FL 5I71C 3ARBC 2IH3A 3TBWA 1OTTC 3MCLH 4QRRE 4LSSH 1IQDA 1KCLA 4HPYH 1XCTB 4MGXA 3QBTB 4K3EH 5ISZB 3PP4L 4M1GH 5F9OH 5EO0B 3D85B 3UYRH 1JF1B 2WQ8A 3ORJA 4X5XA 3TA3C 4KUZL 1AGDB 2VLLA 4GS7B 4HKZA 3TCLA 4RGNE 4NNYB 3BDXA 2ORBH 4XNMA 5F7NC 2Q86A 3SO3B 2Z93A 4X6BB 1YEFH 3QDHA 3P4MB 3JV5A 2XQBL 5GRJL 3CZJA 5T3ZD 2ATKB 3A67H 3S3PA 1QA9B 1FZJA 4M7LH 5KJRL 5GGTH 3NFNB 5I1HH 3SY0A 4JHBA 5J13C 4MS8D 1NFDE 1D6VH 1CLZL 4F2MA 3DVIA 4KDVA 3SGEH 3X17A 5GRUL 3MRGB 3DVGB 3OKNA 1IFHH 5KOMC 5HY9A 4M7KL 1Q0YL 5EU5A 3O3UN 2VB5A 3MBEC 2ZUSA 5CS7A 3BW9A 5IVNA 4UTBL 2XRAL 4Q74A 1YQVH 4QGTA 4K3HA 5TF1L 5JHDB 2RQ8A 4DVRH 1U3HB 5HHXH 1P9MC 1NC2A 4X9GA 1I7UA 2XZCH 4PJGF 1HCVA 1MCPL 1Z3GL 5HDLA 3NZ8B 3LKOB 2N4IA 2Q7NA 1NL0H 4IDJH 5K59F 2DQHL 4HJGA 5EUKB 2QSTA 1EERB 2ZCLL 1MFAH 2WBJB 3FO9B 3BRGC 3HC4L 5I8EA 4K8RL 4U7MA 2QQNH 2HT4C 2YUWA 5FUOL 3GMPA 1JNHB 1YPZF 4FZ8L 4LLWA 3RGVB 5I8KL 3N85L 2JK5B 4HGWB 5F97E 1E4KA 4E41E 3UEZA 1T20A 25C8H 3RY6C 3HB3C 3ULVE 3QQ4B 1ODAA 1P4LA 3S3JA 4UNVA 3TVMD 1DL7L 5D72H 1ZA6B 5DURD 4WENB 43CAB 3FO1A 1WZLA 5T5NF 3WFDL 4FABL 4ZFZB 2VWEC 4KTDH 3L3KB 2HT3D 4LNRB 2VLRD 5GGSY 4TN9A 3P77B 5JHDD 2HTLD 4M9OA 4UT9H 2NW2A 2GTZA 3VFRB 5TE6L 1A2YA 3VDCA 1JHLL 4P5KA 4D9QE 4DWHA 1CI5A 3IETB 1R3JB 4KK8D 2ED9A 1TXKA 3KPSB 3QCTL 3Q5TA 4PJCF 5AAWA 4KJQC 1SJEA 4NCC2 5HGDB 5SWSB 4MNQB 4KK6C 3VD3A 1P4IL 1BQUA 4M8QB 1Q38A 1CTOA 4Z7VF 4JG0H 4ODUB 4JB9H 5D1XB 3HRZB 4D2NA 1DQLH 2QQQA 5DRWB 2NY2C 2ZCKL 3VFMA 3QO0A 4BZ2L 5DRZB 3V6FA 3WLWD 1NBQA 2P8MA 4LHQB 4M6OL 3ZHLA 4KRNA 1GZPB 2MQ3A 4JHAH 5I6XB 5HVWA 5DVMA 5ESVB 3C60B 3VFUA 3P11L 1Z5LB 3LN5A 3PQYB 3CFBB 4W6XB 5CD5D 4NC1E 4PJ8A 5SWZE 3VFGL 3UJJL 1C5BL 2W9DH 3RUGA 2ESVD 4GG6B 4J1UA 3O9WA 1FO0A 4WHYG 3LVEA 5CSGA 3ULUL 1YEDB 1UFUA 2OTWB 3HG1D 3U9UA 5L2KE 1DR9A 2ITDB 4XC1L 3OXSA 1ONQA 5FYJL 1AXTH 4KI1A 5FYKH 4GKZB 2CXKA 3CUPA 5LGHL 4BUGA 4JN2A 1VGKA 3OKLB 4PJEA 2Z31B 2G5BA 4X7DC 3I6LD 1FFOB 3ES6A 3CLFH 4LQFH 5IF0A 3HE7D 5JW5B 3BMVA 4RRPA 4ZTOL 4NOFA 4PJAE 2AXGB 3ARGC 2Z35B 4KI5C 1MFDL 5BZWB 1J8KA 4I1NB 3HMXA 1MFBL 3WS3A 1GIGL 1R6VA 1MIEL 2OMNA 4U1HA 1I8LC 1TIUA 1KELH 1BHGA 1Z9SA 4NQEE 3GSQA 4GBXB 5HYFA 4OKVB 3O6FA 5DEFA 2FD6L 4PJIA 1FYTB 1NMCC 4PLNC 3BWAB 1AGBA 5D7JD 1JHKL 3CX5K 2O5YL 2BXYA 3VXMA 1CD9B 3MOQA 4LHUG 3QNYB 5EC1B 1BQHG 5E1AA 1CFQB 3FL7A 5E6IB 2DMBA 5FV1L 3S5LB 4N0CC 2MNUA 3QDJB 5DHVB 4NGHH 3CSBA 4XMKL 4DN3L 2XT1B 1FVDA 3ARTA 1MHHA 4M5ZL 5CCKH 3QR2A 3TT3L 3M8OL 4MNHB 4K9EC 1CF8H 2XWJB 4NHCH 4WJ5A 5F1IA 15C8L 4U1KA 3V0WL 1PEWA 4BSVB 5E8NA 5E8OB 1KJ2H 1CLCA 2PTVA 3ZT6A 4AENA 4N68A 1IAKA 2V7NB 4LARH 1IM9A 1MCKA 3DUSA 1PDKA 2JIXA 3HC0B 2D7PA 5ICXA 2B0SH 1V3JA 1YA5A 4RWYL 5GGQH 1YY9C 2CLVB 3DUUB 1JZ8A 4JFED 3FRUA 3EO9L 5CILL 4KROC 1IKNA 3TBTA 4K3JL 3ZKQD 4K71B 1A21A 1M7IA 2XQYK 1C12A 4FXKB 4PGBA 5IGXL 5FV2A 4I0PA 4PB9L 1KCSL 1BREA 1I1FB 3DECA 3PGFH 4JFFA 5T3ZE 1OP3H 1NDGA 1TLKA 4G43B 4LPCA 3CVIL 1KIRB 4GKSB 1XCQA 2DTML 4IRSC 3U30C 1A3QA 4JGJA 3BH8A 1FZKA 2J2ZA 3BPOB 3RVXD 3AAZB 3JWDL 4NKIH 5L8KB 4WHTA 5E1HB 3R0NA 5C70A 1A7RH 4N0FA 1YJDH 4HPOL 4F37K 2CMRL 5KSUA 4UT6H 4X5LA 1XGPB 1LE5A 4I3SL 3REWA 2XN9A 3GSVB 2F19L 1YMHB 3GMNA 1PX3A 4DKDC 4IS6B 3RWJB 5CHNB 4G42A 2DLHA 5MHSD 2O5ZL 3QFJB 1JGUL 4TSAH 1I1AD 3WDJA 4AL8H 1DQJA 4K07A 4I3RH 4LFHD 4RA3A 4U7SA 3JWDC 2EICA 3Q1SL 2DJUA 5HI3C 3BEWB 3BDBA 3UMTA 3WUZA 3BJLA 3K1KC 5DQDH 5ETUA 1RZ7L 2EDTA 3QEGH 4AT6B 4EUPG 4KY1H 2FHFA 4FP8L 4U6YA 5EH1A 4EKXA 1V7ML 4I18C 2VLKD 5E8EB 1MLBB 2IANA 2UWEF 4FQXC 3IFLL 4Z95L 1JPTH 4PY7A 3V6OE 2IC2A 5T1MB 3TPUA 2R1WB 4EXPX 1MPAH 3Q6GH 1A47A 2Q20A 2EKSA 5A16B 1CFTA 3KXFD 4JPVH 4HUWB 4ZNCD 1EJOH 5C0FB 1VGEH 2P45B 1UM6H 5F9AC 1Q0XH 1ITCA 2IBGA 3C5ZA 3PJSB 2NY6C 1S7RB 3HI1A 3C6LB 1U91B 3F7YB 3VWKA 4ZAKC 3GKWH 4O9HH 2ERJB 5F1KC 3FN0L 5DWUH 3MRRB 4QF1A 5JHDE 2DN7A 4BKLB 3O4LB 2YEZB 2NQCA 4PB0H 3O2DH 3IDYB 1NEZB 5CEXB 3NCJH 3QHFL 4CMMA 1JTOA 4GKNB 5KVEH 1K8IA 2ATPB 1S3KL 1P5VA 2GUOA 1HHJA 2VDQH 4K3DH 1DDHA 2R0ZH 2ZUUA 4ZOCA 5IB2A 1IEBB 4UBDD 4PRDA 1T1YB 3I75B 2YZ1A 4RMRA 1G9NC 3QWRA 4NJAL 1GGYA 4MD5A 2G9HA 4U33A 2OK0L 2NY3D 1XAUA 3RI5F 1K85A 1A64A 3LMJL 3TT1L 4Q0XH 4AEHL 4QRRA 2BNRD 4L8DB 2OR7A 3OG4B 4OKDA 3MODH 2O61B 3VXRB 3QI9C 4YO0A 3GHEL 3NCYS 2AI0L 4RGMC 2BSED 2ESVE 1CVSC 4IDLA 5IFJB 3JTSA 3D39B 3X3GH 2A6KB 4QHMA 3HG1E 3CCHB 2DBLH 2J1KA 1G7HB 1SHMA 4U3XA 5FYLL 2VH5L 1FIGL 3KPSE 3RWCA 1ZSDA 3GZKA 4NOBA 3QRFM 2W0KA 3IXTB 4HXBH 4EIGB 5FHBH 3GSWA 1GGTA 1HE7A 5LGKA 4YHKH 2VN7A 1EZVY 2MWCA 4LEXL 5E70A 1IAII 1UENA 2HLAA 3I6LE 1NFDA 3D87B 1NBZB 3K2MC 3PGCB 4UQ3B 3ARSA 2BOCA 3F8UB 1ZT7B 3FT3A 4D0BB 3T4AB 3PL6A 5GGVY 2C3VA 4O2EA 1OAXL 3P3YA 3E8UL 4PJGB 4F57L 3AU1B 4I48A 1ZHNB 4UB0H 3JWOC 1J18A 3I6GA 1UXSB 4YHLL 5J1AA 3ZKXC 2FO1A 2VKWA 2HJKB 4O02L 1INQA 4F7MB 3VDBA 4IRZL 2PW2B 5EOTB 3F12B 1SJHA 4Z76B 3IXAB 4PRID 1OAQL 3RDTB 2A2QT 5CJOL 5CBAA 3HHRB 3O0RH 5CP7A 1D6EB 4ZS6C 4X4ME 4ZQKB 1A22B 1ERNA 2D9QB 1H5BB 2O5XL 4XCEA 5KVGL 3FFDA 4Y88A 4MD0A 3QUYA 4NQVA 4M61A 4MSWB 2AAVA 2IG2H 2VL4A 4GRMA 1A3LL 2MMXA 5EFIA 1OGTB 1OTSC 1CCZA 5FGBA 1N64H 1QRKA 3EGSA 3BVNB 4NRXB 4FG6C 5I9QB 4E41A 4HMEA 4M93C 4Q58C 1MHCA 1CU4H 3S7GA 1T2QL 1FFPB 4FXLA 2CD0A 1GHFH 3UC0H 5DSCB 1R5VA 3WFBL 2Y6SD 2DQJH 5AUMB 3EYVA 4Z7VB 1KJ2B 4XPTL 4W6YB 4WUUD 4LCWD 4JFEE 2WP3O 4HIEA 4TTDD 4U4BA 2PTUA 2IFGA 2DTSA 2HTKD 3ILQD 1K8DA 2BCKB 3QCUH 4P3CH 1YEGL 1S5IH 3KWWB 4NQUA 3MLRL 4HHAA 5IOPB 5JOEA 1I9IL 4I5BA 1NGWA 3UDWA 5DD6A 3QXAA 5JOFB 2D0FA 2E5EA 1WCQA 2VDLH 1I7TB 5H94B 3TJEL 3VGEA 4ALAH 2AJZA 4IRJD 1T89A 3V4UH 4JY6B 4OV5A 4K9EH 1CICC 1OGAB 2E27L 4HXAH 4PBXA 5GRXG 4C4KT 3MYJB 4N8CL 3BP6A 2MSPA 1QR4A 4JPKL 3HZVA 3E6FB 5MHSE 4DCQA 3VGHA 2HWZH 2ZNXA 5JXEC 2DDQL 1KXVC 1U2HA 5B21A 1UZ8B 1PGRB 3KR3L 2QADB 4HC1L 5IROA 3U6RA 3ARBB 1QPPA 3MROB 3KJ4C 4P9HH 1CDUA 5BV7C 4PJDF 1RI8A 4Z7NF 2R2HA 2IALB 3LKQA 2K7QA 4V1DA 4R26L 5L2KA 3RQ3A 4Y4KB 4HGKC 5CIPH 4AG4H 3OPZH 3E0GA 3MOAL 1LD9B 4POUB 4P3DB 4FQ1L 2BSRB 3LQZB 1DVFD 1WIUA 3SKOA 4DEPB 5EZOL 5FFLA 4ERSH 5JO5A 4XB8A 1FPTH 4OFVA 2EDKA 4XPGH 3B9KB 3P4OA 2VLKE 2WV3A 3EJJX 2MCPH 4OTXH 3KLHD 4WI6A 2HH0L 5EZJA 4F9PA 3WLBA 1XF3B 2P4AB 1V3LA 5JPNB 2VDKH 4M5YL 1KTDA 5HHOD 2M2DA 4PJAA 3S4SA 2IADA 1CR9L 2YPKB 2BVYA 4LIQE 1Q94A 1O0VA 2DLTA 3KXFE 4Y5XA 3RWFB 2FHBA 4R4BA 3SDAA 5TE7L 3LN4B 4B41A 3OMZA 4XVTL 4FQCH 3VGAC 3KPRA 4LDEB 4NQEA 4ZUSA 3WUWA 1JUFB 1ZVSB 3BH9A 4DQOH 4K94H 1OTTD 4JZJA 3MMEB 1DCLA 1K6QL 4Y5VA 4HS3A 3N9GH 1DEDA 3UTSB 5B39A 3L3IA 5GGRY 5H8DA 3OR7A 3QZWB 3N1FC 3MBEB 5DMJB 1CT8A 5CEYB 4XPHL 1P7QA 2NW3A 3WFEL 3TA3D 1QTYT 1CXIA 3J7HA 1VEOA 4ZFGL 3LKPA 2WANA 4B7IA 3TFKC 5FUZH 4Z77A 2NZ9C 3MJ9A 3NTCH 3CVHA 4O00A 5IVZA 4W6WB 4JQVA 4L8CA 5A2LH 3GK8H 1DFBL 2YBRA 3VXTB 5EPMA 1OOAA 2Q7YB 1XGRB 3C8DA 2XY2A 2F8VA 3NABL 3HLAB 4Y16D 4KKNA 3UJTL 4OB5H 2GAZA 4J23A 1KT2A 4OCLC 2HRLA 3H0TA 5EOQL 4PPTA 4JJ5B 2BNRE 4ORGB 3MTRA 4XXDA 5TPWL 1H3TA 2R4RH 5CGYC 4NDMA 2YPLA 4HUUB 3T77B 3RZCB 4JPWL 2HRPH 1H0DB 4TTGA 2Y5TB 3D3VD 3WHXA 4UIMB 3MRJB 2HAZA 1RFDL 4HUMB 2F5BL 4XP6L 4XNZC 3WS6C 1FNAA 1UH2A 3AREB 1U58B 4NKOA 2CK2A 3A6OA 4YDKL 4PJBE 2E9JA 2R2EB 5LVEA 3SGJA 5JW4M 3PABA 4Y2DB 1VKXA 4M4RA 2KQMA 2X5PA 1AIFA 2VDRH 2HKHH 1W0WB 4PJFF 3B9EA 4PY8J 1KBGH 2BXZA 3PE9A 2BSTB 4KJYA 5HI5C 4O2CB 4NKMA 1T5WB 2HT4D 4PV8B 5J0BA 5L7XH 3MZTA 1UYWH 4HWBL 2VXTL 1ZVHA 3D85A 5EO0A 4S1SL 2NY2B 1JF1A 3SBWC 1ZA3A 2V5YA 5IBLC 1VCAA 5CEZH 1X5YA 2Q3AA 2UWEB 3HB3D 4NNYA 3V79C 1DN2A 2ZUYA 1QFWH 4R6UA 5C07D 1MJ8H 3DSNA 4QRPD 4K8RD 4OLZL 7CGTA 5FHAL 3SDDB 2ATKA 3UTTD 4Y8DC 1QA9A 3SKJH 5EO1A 3TO4B 2OJEA 5JA8B 2YRPA 1CGXA 5I1JH 4M00A 5MEND 1N6VA 2O26U 3MRGA 3DVGA 4KJQD 4KK6D 3VRIB 12E8L 2GSGB 1O7SA 3OKEB 2VABB 2ZSVB 2DF3A 4HQQL 2OL3H 2EXWC 1YQ2A 3O41B 3TVMA 4DUWA 1UEYA 4Y4FB 4J6RH 1D5XB 5CBEA 3MFFB 3RVWD 5KSVB 1MFCL 4PTUB 1I8IB 4X6EB 5JORB 5BJTB 4FTVD 4CUCA 4XP9H 4WUUE 1HXMB 3ARGB 4LCWE 4N90D 3VWJC 2R0LH 5BRZD 5JHDA 1KB9J 3RWEA 1U3HA 2FCBA 5SX5H 1IT9L 3SGDI 1YDPA 5C0CB 3IF1B 4W81A 5I1CL 1JPSL 1C5CH 4P48A 4ODTH 3U46A 3LKOA 5F9JA 1NMCB 5EUKA 4BSJA 1A6PA 1BM3H 3FO9A 1IE5A 4WI2A 2X7LB 1EFXB 5DHYB 3NA9L 1CL7L 5FM8A 2BFVL 4Q7DA 3L7FA 2XXCB 1M71A 5E94B 3LHPH 2YN5A 1INEH 3TH4T 1UCTA 2X44D 1Q9OA 3RWDB 1G0DA 3BP5A 4K7PX 1DQQA 3D0VA 1YYLL 1MCDA 1E6OL 1ZA6A 1EH9A 4HCRL 43CAA 3WJLC 4M48H 3K8LA 3L3KA 1NAML 4APQC 1D3CA 3OJMB 4LNRA 1MEXL 2P5ED 2ESVA 3SDXE 1KPUB 2QQKH 1M7XA 4OZFH 5KSAC 3P77A 4JO1L 3DYPA 1AE6L 3HKFA 1T1ZA 5DZNA 1XF4B 1NCAL 3HS0A 4O4YH 3HG1A 3TZVB 1UA6H 3QULB 5HVFB 1R3JA 3FN3A 5ABDE 3KPSA 2ZCHH 3OKKB 4CJ1A 5SWSA 5F7YC 2X9WA 1F90H 4M8QA 2XNAB 4NZTL 4KAQL 2EC9U 3QA3B 4ODUA 2AKRB 5CIPB 3VXQB 1AH1A 1J1XL 3HRZA 2R56L 3MLXL 4N9OB 1CZ8L 5TQ0H 1QNZH 1G9ML 2YA2A 4C55A 1A14H 2AEWA 5C0GB 1QRNB 5DRZA 1F8TL 5HHOE 5DA0B 4OGYH 3F58H 4N0CD 1BBDH 3VFWA 4MHHI 2X4QA 2YRZA 1WAAE 1X6NA 2CJUH 2EXYC 4IRSB 3PQYA 2CO6B 3V52L 3EYSH 4XGZB 1ORQB 4LSPH 2C4XA 2P8PB 2J8OA 2ZUXA 1KLGB 1FNFA 1G9MC 3ARDC 4JEGB 4F37F 4HIXL 2Y07H 4NUGH 4OLUL 5DYOB 1YEDA 3MSPA 5D7JA 2OTWA 3D18B 1UJ3B 2VAAA 2CLZA 4MNGB 4HFWB 4N0UE 3BX7C 1ADQA 3ZDYE 1YY9D 4ODHL 3GSXA 2ICCA 4FFYH 4GKZA 3RVTC 4KROD 4WNQB 3VD7A 3U0PB 4KVCL 3OKLA 1KEMH 4DAGH 1AGFA 3NIDF 4XP5L 3ZO0A 3GHBH 1FFOA 2OMBA 3CFCH 1GSMA 1MREH 4RMVA 1ZHKB 1QRND 5DZLA 1C1EL 5JW5A 1EXUB 2VITB 4S1QL 4OM0L 1LILA 4NFBA 2AXGA 5BZWA 3C2AL 4TSBH 3VMNA 2C3WA 5HGBA 5BMFH 1QR1B 4Q9QH 4PGEB 1G9EA 4Q2ZA 1I3VA 3TNMB 1BFVL 2XIDA 5DS8B 5E08L 1QG3A 4OKVA 4GW5A 2AGJH 4WW2F 4JFEA 1X5XA 1NANI 4OFDA 1X4XA 5DUML 3EDEA 3DYMA 1IQWH 2W07A 1KIPB 5T3XL 3D3VE 3QNYA 1NKRA 1RUML 2XZAH 3CFIC 2NY6B 4HS6A 2Q6WB 5C2UB 2N56A 2APVA 2DAVA 1FAKT 3DV4A 5HI3D 4LSUL 5AEAA 3S5LA 4I13B 1MCOH 5DHVA 1RZFL 4BQ8A 1TFHA 3U7YH 4MB5A 1RIVL 4F15C 3B2VL 1HNFA 1TTFA 3IJSB 4FQHB 2Y06H 4PJDB 2NXYB 3BESR 4OCRH 2NY1B 2PR4H 2OSLB 1NGXB 4BH8A 1JPFB 4FQXD 4BK5A 4LSQH 1B0RB 5EDXA 1L7IL 4XX1G 2CLVA 1N3NB 3F5WA 5EB9A 1GC1C 4JRYB 1HYSC 4I4WB 3DLQR 1I1AA 5HDBE 4JM2C 1QO3B 2FSEB 3LQMA 4YHYB 3DO7B 4X7SH 1LNUB 1X44A 1QBLH 2A83A 5ALCH 2V7HB 4D8PA 1RZGB 2V17H 2V6HA 5C07E 4RFEB 5B3NA 4R7NA 4QRPE 2AQ1A 1I1FA 3MLWL 2VWEE 3HAEH 4ZAKD 4JO3L 5CLWA 1KFAL 1YYML 4RGMB 5LXGH 2FIKB 4PJBF 4YEFA 3UTTE 1D5BB 4G6KH 3VG9C 4G43A 4L4TD 5D7SH 2B4CL 1FORL 5IM7A 1AXSB 2VLKA 2L4OA 1HIMH 4OD3L 5C09B 4C54A 1L9NA 5MENE 3OAZH 4Q6IC 1F3JA 1HCFX 1KJMA 4KDTC 3IT8D 2W60B 4YDJA 1AJ7H 3BN9C 2EO9A 1DQML 1XGPA 3KXFA 1JGEB 2H8PA 1YMHA 5DUPL 4MXQC 4R7DA 5CHNA 2B4CC 3GMRA 4X80L 4M4PA 3GFUA 5I1LA 2HKFH 5I73B 2N7AA 4Y5YA 2W65A 1B0GB 2OL3B 4N90E 3VH8B 1ACYH 5GJSL 4WO4B 1OW0A 5BRZE 3O6ML 3UP1A 1I7RB 1U41A 3NPSB 3QI9D 4WEBH 5TQ2L 1KCUL 5HGGS 3T8XB 1DN0A 2UUDK 3ZKXB 1LK2A 1DBBH 2WINB 4YHNB 4JHWL 2BC4A 2K1MA 5IB4A 1A6VH 3V95A 3SGDH 1NMBL 2DQDH 1EGJA 1MLBA 4LRNL 2R2BB 1A7BA 2EC9T 4G6FD 4XVJH 4ORZC 5TDNA 4X6DB 2Y1VA 5DVLA 5HI4C 4JQIH 5HHNB 4ENED 1A1MB 4EVNB 3BQUC 3ZT7A 4FN0A 1BOGA 2BNRA 1T83C 5T33H 2Z8VC 1QZ1A 2JTDA 4XC3L 5DR5L 3TN0C 3PJSA 5FYLD 2R29H 4F80A 3C6LA 3F7YA 3NH7L 5EBLB 4CVXB 1PVHA 2WK2A 2FATL 2P5EE 4KI5E 4U1IA 1JCKA 3O6LL 4XBEH 5JXAH 5CLTA 2KQNA 3CFEB 5E00B 3SE8H 3GGWB 4PJFB 3QDMD 5L88H 1JGLL 1NEZA 4MWFB 1K2DA 1DBML 4OZFB 4GKNA 2QHLA 3OGOE 3CFJA 5F96H 4ODXA 4PJXF 4HBQA 4CU6A 4JFZH 1IEBA 3MRQA 3JZ7A 3QUZD 1U8PA 3I75A 2GCYA 4ZS6D 5B38G 1FNEB 1J1PL 2B1HH 3EHBC 3NFPB 4RMTA 1DQDH 1FQ9C 4QNPE 4GG8A 3HTLX 5DD1L 2AJSL 3O6KH 4QKXB 2O61A 1OTSD 4BH7B 1BMGA 3ZDXE 3LKRA 5DI8B 3OJVC 3SDXF 3EJZD 4FG6D 1IGMH 1M1SA 1MCEA 3EOBB 4DKEH 3CDGB 3S35L 5IFJA 4QHUB 1F42A 4HMCA 3H2WA 3QSKB 3CCHA 5HGHA 4IMKA 5DZOA 5DDHB 4G7YH 1DQTA 4PFEA 5KSBE 3WFCL 5KG9B 2Z92A 1BECA 4LRIA 1OARL 1RK1A 4Z7UF 1JPGB 5F71A 3MGTA 4XMLL 4MDIA 4H1LG 4GO6B 1Q1JL 5GZNC 1O7VA 3MNWA 5I15H 3H3PL 4HUXB 4U6XB 3PGCA 4UQ3A 2BSSB 1QSFD 5FOJA 1QRNE 1ZT7A 1IEAB 4MVBC 2WQRA 2R39A 1WAAF 4N8PA 2MJWA 1XGTB 2A77H 4WV1C 1UB6B 2JJTC 3ZKNC 1NLDH 3VFNB 2LQRA 2QHRL 1FCCA 4L9LC 4YXLH 3X14A 1UXSA 2EE3A 4LAQH 4XVSL 2QBWA 3THMH 4WUUA 1CICD 2HJKA 1SBSH 4LCWA 4F7MA 5HGAA 4WTXA 1PZUB 1KJVA 5EU3B 5F3HB 3RDTA 2BVTA 3PWJA 1HHKA 1MIML 5E24E 1D5ZB 3VGAB 3RWIA 3STZB 4ZQKA 1H5BA 1B0WA 2OM5A 4XBGB 4PGZA 1B2WL 2DJSA 2LU7A 3DOSA 5JIHA 4KKAD 4MSWA 5LBSH 4ZPVB 5BO1L 3MLYL 3PDDA 2JELH 3NN8A 1EO8L 4XCCH 2VXVH 2UZIL 5BW7C 1IAMA 3LEVH 5D70H 3DBXB 4PS4L 4ONHA 4KWUA 5IFAL 5MERB 3DRTB 3QUMA 5TE4L 3V4VL 3WXWL 1U3ZA 2WUCH 4WHYH 3QO1B 5EO9B 1I3GH 4PRHB 4N8VG 1OM3H 3IDIB 4QHNB 4U1NB 1HSBA 3K81A 4M6NH 3T0DA 1NCCH 3RX5A 3MA9H 5CWSB 4KRLB 3TBSA 3VFPB 4U3HA 2X10A 4S1RL 4S0SD 3O4OC 4JE4B 3QP3A 1G0YR 1WWBX 1NGQH 3TESA 2D03L 3P0YH 4LBEA 1U8MA 5F8RC 1IM3B 1DVFA 1U93A 4G8IB 1SJXA 5HHPA 3MLZL 5JOFA 2EDJA 4L4TE 3QEQB 4JN1L 5CJQH 4LLQA 5FO7A 5FO9A 3HAEB 5H94A 2R1XB 2NY7L 2D4FA 3UCRA 4GLRI 1HYRC 7FABL 5F1NB 4XNZB 2VDNL 4L9DA 1Y0LA 1AHWB 1GAFH 3TFKD 3SE9L 1X5HA 1F2XK 1WJ3A 1OGAA 1WAAA 4FNLH 5ANMB 4I8DA 3WKNA 5IWLA 3G6JF 1IC7H 1MHEB 2C7UA 1CDIA 3E6FA 5EORH 5HDBF 4QXTB 1Y6KR 3DRQA 5JW3L 1CLYL 4O2FB 3ARBA 3HR6A 3MROA 2RBLA 4KK9D 1GC1H 4OF5A 2IALA 2B7DT 1IILE 5GSVA 4N0UA 2FL5A 3ALXA 5CGYD 3BDYL 3GO1H 1LP9E 4J3UA 5CP3H 2BSRA 3TA3A 2BX5A 3CX2A 4YX2L 1BVKA 1P4BH 5K9KB 2H1PH 5DUBB 4MMXC 1TPXB 4N1EA 2OYPA 4WW2B 4PJ7E 4UT7L 5JPNA 2BRRL 1YEIH 4Z8FH 2RAMA 1HZHL 3ZSSA 4ZOEA 2RFXB 1FC2D 3U0WH 2F58L 1MSPA 1G7JA 4NM4H 4DN4H 3RWFA 1MRCL 3UBXI 3PP4H 5GGSB 5AYUH 2PO6B 1JPST 4YDIL 5CZXD 3VXUB 3WHE1 5EU4A 4KUZH 5J12C 1RZIB 5FYLE 1F13A 3FB5A 2YZ8A 4Q6YA 4QT5B 1ZVSA 2GK2A 3BKJL 4FQ2L 3ISWA 4D0CB 1FVEB 3BZDA 5HI5D 4LVHB 3QG6A 5F7LB 4XNUL 1Q9LB 4GAGL 2XQBH 1J0YA 2A0LC 3QZWA 4H8WL 4KJWC 4LGSB 3QDME 4FMKA 5GRJH 3RBGA 3MBEA 5DK2A 5F9WC 1TVBB 5IBLD 4HIHA 1P2CB 1PFCA 2ENYA 5KJRH 3W2DL 4GQPH 1SEBB 4TVPL 4PRNA 5KW9L 5GZOC 4MA8L 3O2DA 3SGKC 5IHUH 1MAJA 2VNCA 4G8FB 5GRUH 1P9MA 1KB5A 2ZUQB 1JYXA 2EYSA 3VXTA 4PD4J 1WEJL 2Q7YA 1F2QA 2VR9A 1UM4L 1FO0L 4ONGH 3LDBC 2OQJA 5LJYH 1OVZA 3MO1B 1IGIL 3WFHA 5L6YL 1R3IH 3ULUF 3NCBB 1Q0YH 2JB5L 3L5IA 5JIIA 4WFED 1XF2B 3AGVA 4YXKL 1XR9B 3E3QC 5JW4Q 2VDML 3I3BA 1VFBB 5B8CB 2AEIT 1MCHA 2ARJQ 2XRAH 1XIWB 2DQUL 5TF1H 3D25B 4HUUA 3T77A 4EUPH 4ZYKA 3UYPA 3BE1H 2C26A 3IDGA 1NQBA 2VLJD 5IQ7L 2Y5TA 3MRJA 5C07A 1PBYA 4QRPA 3LV3B 2DQHH 5J11B 2QL1A 2H9GB 4K3GA 1BF2A 3VWJD 2N7BA 2B39A 3HMXL 1C7TA 3LSOA 1YY8A 5SV3A 3HC4H 1FBIL 2VISA 3MRMB 4X5WB 2R2EA 5C6TL 5FUOH 3CMOH 3ESVF 1RU9L 2QSCL 4FZ8H 3OKMA 5IFHL 5MENA 1QSFE 1NGPH 3I85A 3N85H 3UZVB 3DXAD 2UY7A 4Z9KB 3FQRB 3QISA 3CU1A 1RUKH 1FN4A 1WBYB 1JMXA 2BSTA 1DL7H 4CVUA 4JDZA 2MOVA 4O2CA 3CFDA 3Q5OA 3ZDXF 4EI6B 5IMKB 3WFDH 4FRWA 2G60H 4JVWA 3UPRB 1RIHL 3C6SB 2GHWB 5B4MD 4TNWK 2Y5EA 3X11A 4MDJB 2HFGL 4HWEL 1WFOA 4GH7B 2XZQL 5BRZA 4P46C 3VRJB 3U4EA 3QCTH 5KSBF 4JFYB 4UOW0 2E7HA 2X6MA 3SDCC 4APQD 2P49B 2J8HA 1P4IH 3GRWA 3SDDA 5E2TH 5KSAD 1QBBA 3BIAX 5DMKA 5E9DD 4HWZB 3TO4A 3P4NB 3BWUC 1IGFH 4X7FC 2PNDA 2WIMA 3L3DB 1OAZL 1LO5B 2ZCKH 2WZPD 4YBQC 4GW1B 2ZPKL 3VRIA 4C56B 4JFDD 3L3GB 2HFFA 3B43A 1I85C 2V5MA 3L6FB 1R3LB 3FOMB 4L5FH 3P11H 1SJVA 4IOFC 3O41A 4J3SA 4MJIB 1C5BH 2NX5B 3MFFA 4PTUA 2LVCA 1I8IA 4QY8B 4KZEL 4HKBB 3U83A 5BJTA 3ULUH 1WWCA 3ARGA 5EU7C 2EXYD 4EI5B 3KPLB 1TQCC 3BO8A 1LO3H 1MQ8A 4KDWA 4G8EA 4LCUA 8FABB 1TTUA 2VO5A 4P4RB 3W81A 5FYJH 3QPXL 1S7VB 1I8LA 4Y1AB 1KXTB 3BP4B 3MOBH 1IC5L 1T0MA 4U05A 1NCWL 3ROLA 3ARDD 4LEOA 1GGCL 1URLA 5C0DA 4Z7WF 2BMKB 5GPRA 3MXVL 2CUMA 3L9RB 3FHQA 3KYOA 1BVZA 5HDOA 1K4DB 3FB8B 3MV8D 3CNKA 4XMPH 4Q9RL 1X4ZA 4AY0A 5LKNA 4RCAA 3C5JA 2H32A 4XBPB 1EFXA 1XGQB 3WDHA 1RJYB 5DHYA 3P73B 2XWTB 3KPPA 2X1OA 4ZTOH 3OXRB 3RVTD 1MFDH 4ZXBB 1ZANL 1MCBA 4M6AA 2XTJB 1ZHLB 3CLEH 4E42A 1MFNA 2EIZA 4NBYB 4F15B 1TQBB 1CTNA 5FF6B 2FD6H 4RIRA 4Z7UB 4LPTA 2DM3A 2J8UB 1JHKH 2BOBB 2O5YH 4OLYL 2DL9A 4P57A 2BNUA 1J5OL 3HNVH 2VMFA 5ACMA 4M43H 3G5ZB 3WEXB 2HMIC 1WZ1L 3UXFA 3MLVL 2VTFA 4F3FB 1IAIM 3SOBL 4LHUB 3B5TA 4X99A 5IW1B 5DO2C 1BQHB 2LU4A 5I17B 2YK1L 3I3EA 3QJHB 4C4KO 4HD9A 4P4KB 4XMKH 3QA3A 4DN3H 5CIPA 5FKPB 4NC0B 4F7CB 5L2JB 4M5ZH 5E99H 4WU5B 1K5NB 3TT3H 3AVEA 43C9B 3M8OH 2DS4A 3OKOB 5SX4I 4GXUM 5C0GA 2IEPA 1F3RB 1QRNA 4Z0BH 5IV2B 1HOCA 4NIKB 35C8L 1FG2A 1EX0A 4NZRL 1LO4L 5I8CB 4UIKL 4DOHB 5C7XL 2D7TL 4PJHE 1GYAA 3WFZA 1MCWW 4IRSA 5EU6B 5D2LB 2BVQB 5T3XD 4XGZA 4P2OC 1RUQH 3H9YA 1KEGH 2MQ0A 1J1OL 3EO9H 5D96C 2NXZD 1PW3A 5H2BA 1J9CT 3QFDB 2E9WA 5DJ0B 1DEEA 5DYOA 2J5LC 5SWQB 1I9JL 5IB1B 1HWHB 3BIKB 4NZUH 1UCBL 5IGXH 1HKLH 4MQTB 4PB9H 1KCSH 3I50L 5TDOB 1JWUA 1HYSD 1QQDB 4LKXA 4DGIL 4JM2D 3VA2C 5KBNC 4JHZA 2E7CA 2VYRE 4PD4K 1CWVA 4WNQA 4OCXL 2GFBB 3EYQC 4FQLH 4KMTH 4W70A 5DJCA 2DTMH 4AK1A 3D2UD 3MPCA 3RIAF 3QH3B 4KC3B 1YNKL 3L3OB 2LTQC 2VITA 4HPOH 1RZ8A 3ARFB 3QNZA 1BBJA 1R3HB 1S7XB 3FT2B 3OF6D 4I3SH 3OQ3B 2F19H 4I18A 3BGMB 4WFEE 4OM1L 1RULL 4PGEA 1P7HL 4FQXA 4JREC 4X8XA 2O5ZH 1JGUH 3Q1SH 3BD5A 3MR9B 5I2IA 3SKNB 4HF5H 3EOYG 3BQUB 3AMLA 1S9XB 3RVVD 3PWPD 1PYWB 1F6AA 4G80A 2B2XH 4MXQD 1KIPA 5EZLA 1CE1H 3NCYP 2VLJE 1IEHA 3S37L 4K2UL 1RZ7H 3DROA 5MP6H 4K7PH 4S11A 4ZAKA 4X6CE 5E5RB 4EUPB 3T1FA 4RRPG 1EEQA 3G6JB 4LLDB 3T0ED 4L4TA 4Z95H 1D9KB 2YMXL 3IJSA 4FQHA 4GRWE 1BZ7A 5BXFA 2OSLA 3DXAE 2MQCA 4O51B 4DKAA 4IIQB 4QOKB 2A6JB 1BEYL 4J3WA 4P2CG 4PREA 2PCPB 4NQDB 2FHCA 2E8ZA 5LCVH 1B0RA 1EAPB 3BXNB 1IGYB 4AMKL 2EEBA 3DTXA 2DM4A 1JGVH 5HI4D 4I4WA 3T3PE 3MV7B 1QO3A 4OUUB 1UZ6E 4H5SB 1WISA 3C5SB 1MF2L 4XXCC 4RFEA 3TN0D 3L1OL 1ZGLP 1P7KA 2DI9A 3QI9A 2E6PA 1BWWA 3CU7A 1LP9A 3DX6B 1QSEB 3SN6N 1BLNB 1BZ9B 5HYJB 2FJFA 1D5BA 3ULVL 1SM3L 5EOCL 5IVXF 1L7TH 1AXSA 2FB4H 4I0CC 4QTIL 2P8LB 3JVGC 5C09A 3KPOA 2Q76A 4PJ7A 3WO4C 1DE4A 2V2WA 1U8NA 4RSVA 1N59A 1NCBL 3IB4A 3IFOA 4JFDE 4LCCB 3TT1H 4QXGL 3WV0A 3M1BB 3QHZL 4U1MB 1RZKC 4BQCA 3RNQA 4G9DB 2UUDH 1AQKH 4H25B 2AI0H 1RJZB 2FLBT 2BVPB 3GJFK 2Y7QB 1IMHC 3GUTB 2OL3A 2EE6A 3VGGA 1I7RA 4JFPB 2VH5H 1FIGH 3VRLF 4W68A 4MJ4A 5C0BB 2WINA 1TITA 1JK8B 2ICWI 1R5WA 3LEYL 3O2WH 3ZKMC 4EBQL 5DJ2A 2R2BA 4Z7OE 2ICEB 4XWGH 3IU3B 4L8SC 3DSFL 2HP4A 5AZEL 3RWGA 5J6HB 2QEJA 4X6DA 3DETC 2I5YL 3BPNC 4JKPL 5ID0B 4F57H 1RURH 1A1MA 4NFCA 3RY5A 4QRQB 4NO5B 1H8SA 4MAUL 3UZQA 4KPHH 1YUHA 4MJIE 3PIQB 2YSSA 4YHLH 1YZZA 4MVBD 1EO5A 1QEWA 5IBTL 3QIWC 1MAKA 5EBLA 4O02H 4CVXA 4IRZH 6CGTA 1J8HB 2Z4QB 4GSDL 3ZKND 4HFUL 5ENWA 5C3TA 2C3XA 3HN3A 1I7ZB 1EPFA 3W39B 3MLSL 4GAJL 4J3TA 4MWFA 2O5XH 3P30H 4OZFA 1A1OB 3VI4E 3GNML 3BAEL 2V2XB 4QHLB 4RGOL 2QLVB 1MELA 3CH1B 1A9BB 3L5HA 3ZDZF 3AROA 4CADA 1EEZA 3BPLC 2NCMA 3FONA 3WSQH 1QHOA 1V7NL 3O3AA 1QSFA 2BHZA 3V4PH 1FNEA 1X5JA 3MV9B 3DMMB 1PG7H 1N6QH 3VFSB 5IUSA 3IDMA 4YIQB 3MJ8B 3E2HC 4JFOA 1AXIB 4D3CL 2YPVL 4L4VB 3WFBH 1T5XB 1CDGA 3IKKA 5T3XE 5DK3A 2OP4H 2MHAB 4KKBC 1CFNB 4IOSD 2I07B 1J8HD 2J8UE 5GJTL 4KVNL 3MJ9L 4HDIA 1N8ZB 3CVHL 1UXWB 5HTSA 5C8JB 1CICA 2FIRT 1HHGA 4ZG1A 4JKMA 1YN7A 1YEGH 4RQQB 1X4YA 3MLRH 4MB3A 1G7QB 1I9IH 4WI3A 1CL7I 5DDHA 2O93L 2F8OA 4TULH 3QJFB 5JXEA 3QDGB 1ND0A 5KG9A 5EUOF 1EEYA 3LKNB 3TJEH 2JJWA 3CZFB 4HUXA 1SYSB 4U6XA 4RMQA 2BSSA 4ZO9A 5DJXA 2CLRB 3H3BC 4HK0A 1ZT1A 5JQ6L 1IEAA 4YXHL 2YD5A 5T1LD 1RZJC 2E27H 2DKSA 1XGTA 5C92A 4DOHE 2UVEA 4OLVL 1QLEL 4X6FB 3NOIA 4WWKC 2IBZY 4NQCD 4JPKH 4HV8B 5EU6E 5D2LE 2Z8SA 4Z7WB 3WL9B 2DDQH 8CGTA 5IKCA 5K9JL 3CMGA 4HC1H 3HI6L 1ZS8A 5T3ZL 3WXVH 1TVHA 2ZSWB 4XP4L 2EECA 4R26H 5KN5B 3RX7A 1IAIL 3CSGA 3PWPE 5F3HA 3WYRA 4PUBL 2BDNL 2GK0A 2HFEB 4UILL 3FQWA 4R0LB 3MOAH 3C9NA 4FQ1H 2DYPB 5HJ3A 1D5ZA 1N26A 5EZOH 5IT2H 5GRYA 4N9GB 2VE6B 1CD0A 3PHSA 5IMOB 1A6ZB 3T0EE 4ZPVA 3H9HB 4CNIA 2X70A 2W38A 1FRGL 4YC2C 5F9WB 3KPTA 3A6BL 2AVGA 1CR9H 2FBOJ 3DBXA 1KNOA 3R4DA 3AFLA 4XPFL 4POYA 5MERA 1AGCB 1ZEAL 5C0JB 4MCYA 2PKDA 4NYLA 1F02I 1KENH 5JMOC 1C08B 3KYMB 3IDIA 4QHNA 4U1NA 2HT2C 5JNYB 4GS7C 4HEPG 5CWSA 4UV7L 1T03L 3LQAC 4M6ML 4Q97A 4KHXH 4IMLA 4OAWB 2E8YA 4JVPA 2P7TB 3BSZH 3WFEH 1Z0MA 2D0HA 4MD4A 5JHLL 1FH5L 5K93A 4JDVB 2A9ML 4JLRB 1IM3A 3MACL 3IDXH 1FFQA 1Q9KB 1UKSA 4NP4L 5D2NB 1DFBH 4GRWF 4KJWD 2A0LD 1NLBL 3HAEA 1KPRB 2R1XA 3NABH 4TPRL 3RU8L 3WS6A 1N7ML 4PJ9B 2VN4A 4LSVL 5GZOD 1YMMD 5EOQH 3BHBB 1TCRA 4PJHA 5I1EL 1U9KA 5FK9A 2W0PA 3RTQB 1MHEA 3C8KA 3V5DA 4HX1B 5LAXB 3T3PF 2VXQL 1I9EA 5A43C 1FV1B 1PG7W 4G6JL 2AXFB 2D7NA 4JPWH 4RFOH 4LPVA 3BN3B 1BGXL 3L5WB 3H9SD 1NFIB 1RFDH 1OP5K 4NRYB 2F5BH 4XP6H 4NHUA 3G9AB 5ECJE 1ED3A 2R8SL 1F4WH 4TNWF 4LLVB 3GI9H 1A7NH 4LCIH 3SBWA 1TMCB 3O9WD 2XWBB 1FDLH 3WJJC 4YAQB 1N0XL 3IKCB 2ICWA 1FLRL 4BYHA 1U92A 2WBJC 2DQGL 5FDWA 1XF1A 3MUJA 5HHVL 2X1WL 4PRBA 2LAAA 1IZKA 3RGVC 2R1YB 2P24B 4KTEL 4L3CB 2ADFL 4PV9B 1AO7B 3SQBA 4FFZH 5J9PA 3ZTNH 2DQTL 5GGSA 3L3JB 2OR9L 2EDDA 4S1SH 2P46B 1F11A 3MRBB 1SEQL 1HINH 4ZSOE 4AM0B 2H26B 4QT5A 2GITA 5A1AA 1OSZA 4P2YA 2AV7B 5AG9A 2P48B 3FB7B 5GISH 1MQKL 4DKFH 1WZKA 3KJ6L 3KLSA 4HUVA 5DJDB 1U8IA 1JNLL 4OLZH 5F44A 1EIBA 1Q9LA 1LDSA 5FECB 2FH6A 5FHAH 4XCFL 3TYGL 4UUJB 1T0NB 3O6FD 1FZOB 4G5ZL 4ODVL 2DQEL 4X6CA 4LCYB 1SEBA 3NIGF 2KZ1B 3VWJA 4Z7OF 1VPOH 1B90A 4P46D 5D1XC 3C08L 4G8FA 5ID1A 3SDCD 1EO7A 1BX2A 4U6HA 3MO1A 1PZ5B 1QD0A 3IU4L 2FJGA 2WUBH 4HQQH 3WUWG 1FL6B 1U8HA 2DIAA 1GL4B 1Y18A 1XR9A 3EO0A 5I74C 3VXSD 5I6XC 5GRVL 2GJZB 1ADQL 5IJKC 3BPCB 4NRZB 5JW4N 3C60C 2JB6B 1VFBA 2OTUB 4YBQD 5B39G 2J6EH 2AJXL 3GBLA 3S3SA 5IVXB 1S7QB 1J8HE 4BK4A 3D25A 4XH2A 3PHOA 4IOFD 1CG9A 4KZDH 1IT9H 1A0QL 1IM9D 1EDQA 2JIXD 4YHMH 5DJAB 4Z0XB 5GIRB 5DD5L 3S97C 3WJLA 3IFPB 5EBGA 3VGBA 3LV3A 4APQA 1RVFL 3MLTB 2FO4A 2GEEA 3ARWA 5DJYB 1OD7A 1RV6X 5KSAA 3WIIH 3S96B 1U8OB 1ZKAA 3MRMA 1LO0H 3GKZA 2CDGB 2Z31C 3NA9H 1CL7H 4I77L 4YHOH 5HPMA 5EWIL 2BFVH 1T7ZA 4YPJA 3FTGB 3C09B 1VADB 4YPGB 1TJGL 1JWSB 3QIBC 4A6YA 3S37X 4JFFD 1F3DH 2FWOA 1T2JA 4JFDA 1JVKA 5ACLA 1YYLH 1SMOA 1E6OH 4ZPTA 4HCRH 5J1TC 3HI5H 4NQCE 5IMKA 4EI6A 3RGHA 1U3JA 5GXBB 1NAMH 3C6SA 1PAMA 3KYAA 5KVFL 3PP3K 4GBXC 4X4YB 3I6KB 1NCAH 3HZYB 3RL1B 2RGSA 4KRPD 2NY5C 4LPUA 1BVLA 4OBSA 3P9LB 4UNUA 4P2OB 4JFYA 2CH8A 5D96B 1JZ5A 3ARDA 1Q9WB 5E6IC 4R3SB 2GY5A 2NZIA 3G08A 3MLXH 1BWMA 1FGNL 4AIZA 4NM8L 3P4NA 2HMID 3HPLB 3P9MA 3TEUA 3L3DA 3UTZA 5JPMB 1LO5A 4EJ1C 4YFDB 4XZUB 5DO2D 3MCLL 3JUZA 4GW1A 4AIOA 1MJJB 2FGWH 3BOVA 5IHBA 4HPYL 3L6FA 2H6PB 4K3EL 3CAFA 1RZJH 2IAND 4G8GD 3V52H 5DT1H 4MJIA 4P99A 3VE0A 4NO0D 3VG0L 4PIRF 4P23B 2ORBL 3BGFB 3EOAA 2L7UA 1PSKH 3PNWA 1YEFL 3UO1H 4K71C 1AP2A 1PKQB 5GS0C 1FGVL 1H3PL 4ODHH 4P2OD 4JREB 3A67L 3C5ZD 2NNAA 3BP4A 5C6PB 4H1LH 1JNNL 3FQTB 3M17B 4P2RD 3P0GB 1FFNB 3L9RA 4LIQL 3HE6B 4XP5H 3O3DB 3R8QA 5F8QC 3HUJE 2C1OB 1T1WB 2C3GA 4K7FB 3MGOA 5C3LD 4XBPA 2AEPL 3P73A 1C1EH 4WW1A 1IFHL 3BUTA 3G5XA 4FQQA 4U1JA 4JCLA 5AWNH 4ZXBA 3EYQD 3QXDB 1YMME 2G2RB 3EAKA 4QO1A 3NVQA 3IJYA 1XGUB 1KN4H 1D5MB 1ZHLA 2JCCF 4HIJB 2XKNB 1NUDA 3TIDB 5E08H 1NUNB 3RAJL 1CDYA 1ACZA 5EUOB 3W0WB 4KKCC 4DVRL 1TZGH 2J8UA 5DUMH 4XVUC 3REVB 1EGJL 1IGTB 2XZCL 3GJEB 4QHKI 2W92A 3QUKA 3E3QE 4RISL 3H9SE 3WEXA 2VUYA 3MCKB 1NL0L 3PV6A 2JE8A 4HBCL 4F3FA 4ISVA 4LHUA 1RMFH 5F7KC 1BQHA 5CJ5A 5I1AB 4LSUH 4JM2A 5I17A 3QJHA 3IAPA 4RGND 1KLFA 4JCMA 4XHQA 1TZHA 5L2JA 1A4KB 3B2VH 2W9EL 1K5NA 1MI5B 43C9A 5CP3A 5D7LD 2JJUA 5TH2B 3OKOA 2VOTA 3KNBA 1PX4A 5D72L 4GMTH 5C2BL 1E0OB 2EDQA 4HH9A 5GGUB 3KAAA 3OF6A 2XACC 4KTDL 5EU6A 5D2LA 2BVQA 1L7IH 4JZNA 4XAWH 1T0PB 1MJUH 4Q6IA 4UT9L 5GS2H 3FOLA 3KPQA 4XP1L 4XHJD 3PL6D 4KDTA 1BAFL 4KXZI 1QSVA 3T2NH 4YHIB 5SWQA 1JMZA 5IB1A 1CS6A 3PWPA 2FX8L 4F33B 3MLWH 4OI9A 3IDYC 4HKXA 1YYMH 2X1PA 4QRSB 3QRGH 5JIPA 1N2RB 2DM2A 1FORH 2GFBA 5T1KB 1G7PB 2A6IB 4J3OC 2CO7B 4OD3H 3HC3L 5IB3B 1HKFA 3Q0HA 3L3OA 4Z6AT 5FIEA 4JHAL 4TQEL 3PUCA 3QXVA 4OF6A 1DQMH 2E9BA 3LRSB 1R3HA 3FT2A 3TO2B 5DUPH 3BGMA 3QUXB 3VXSE 4KQ4H 1LEGB 5F7EH 3UJIL 4X80H 5IG7A 2NPLX 1S9KC 5ITFA 4BZ1H 2DQFB 1MVUB 4O5LL 1YN6B 4GRLB 3SKNA 5A2JH 4OLWL 5D6CA 5E5MB 3G04A 1NCUA 1MWAH 3BQUA 3V6BR 1FE8L 3CK0H 1AXTL 1T04B 1T83A 1KCUH 4XNYH 1U6AH 3IVKB 5KZCD 4R2GB 1HEZB 3TN0A 3SCMB 1UKTA 5A3IC 4YDVB 4JHWH 3RRQA 1NMBH 4PGDA 4WVRA 5ESAA 1UB5A 5EU7E 5IJVB 3BZ4A 1C8PA 4LLDA 2V2TB 5C0IB 3LIZL 5IB5A 4ELMF 5JR1H 3S9DB 1KXQE 3PDOA 3PGDB 3K0WA 1WFUA 1ZT4B 2ED8A 3T0BA 4JFFE 4O51A 5F7HA 1DBKH 3ZKMD 4OQTA 2PW1B 1KELL 3ZKSD 3MUY1 4MQ7B 4NQDA 3S36H 4EEEA 4XC3H 5DR5H 5FB8B 4G9FD 3DETD 4H20H 5J6GB 3BXNA 1IGYA 4N0YL 4R9HA 4XCYB 5HHMB 1G84A 3MCG1 5INCA 3ARVA 1HQRA 1DLHB 3BUYA 3VFVB 1H3VA 4OZHE 3O6LH 1QBML 2BK8A 4OUUA 3DHMA 4NT6B 3R1GL 3WNLA 2X4PB 5ILTL 5F7WC 4TRPH 3UPCA 1NAMB 1JHTB 3OR6B 1JGLH 3FQNA 4QYOA 2L7JA 3K3QA 1DBMH 4L3AA 3QIWD 2XTLA 3KYNB 4AQ1B 5DK0B 1BZ9A 4HZAA 1EBPA 1JFQL 5HYJA 2F54D 4UNTA 5CJ8A 4D94A 3QUML 3FO2B 3CXDL 1F4HA 4V1DD 5CCKL 4ETQB 1CF8L 4ZUUA 4NCDA 1SVCP 3KPMB 2P8LA 2PXYB 1S9VB 4XI5C 3R06A 5TGBA 1J1PH 1CFSA 5C0AD 3WNOA 3HPJA 4RWHA 2YA0A 4L3EB 5I9QC 4LCCA 4MA3A 5B38B 4TUJA 1F6FB 3IJHB 3QG7L 3M1BA 4BZYA 3OX8B 5DD1H 2YR3A 5EBWB 2AJSH 4LFHG 2V9TA 2IANE 4P5MA 4G8GE 3H8NA 4G9DA 2GKIA 1KCRL 5HYIA 4NJ9L 4ZSOA 5IMLA 4JJHA 4NQTA 2Y7QA 3EYFB 5DEGB 3GUTA 2JLLA 4WV1A 2JJTA 4AIXA 3ARRA 4WWKB 5BS0B 3CSYB 3V0AC 4L9LA 2EE2A 2VZ1A 2GT9B 4KKBD 5DD0H 3WFCH 2GYSA 3KPRD 4NQED 5F89B 1OARH 4P2RE 1JK8A 4NKDA 1E4WL 2GTWA 1T22A 2AJUH 4AEFA 1WITA 2CDFB 2Z91B 1XR8B 2A6DB 1Q1JH 1A6TA 2I60L 4NKIL 5I1KL 3H3PH 2ICEA 1J87A 4H1LB 5DC9B 2FR4A 1C16A 1YJDL 4DUVA 1N5AB 3QQ9D 4GW4B 4BSWB 4C83B 1MCLA 3CX5J 4HAGA 4HK3N 4MXVE 1MRDH 3CPLB 1S8DB 4GMSH 5I19L 4J3VA 5JZ7C 2C5DC 2QHRH 5CUSH 4YHZL 5FCUL 4EDWH 4TSAL 1JTTA 3BYYA 2CKBA 3NCFB 1OAYL 3VA6A 3MNZB 4YC2B 5BW7A 4XVSH 1XGYL 5HDQH 1YJDC 1ZLWK 1NGZB 1J8HA 2Z4QA 5DMIL 3LKSB 1CK0H 4FFWC 2VC2L 4HJ0C 4KY1L 1UWGH 4Y4KC 1V8HA 5GS0H 5CZVH 4M62H 1MUJB 2G75A 2R23A 1CIUA 4Y19B 1A1OA 1B2WH 4Y4HB 4ZO7A 5J3HC 1TETH 3VJ6B 5FUCC 3BZFA 4DEPC 2C1PA 2YPLD 2DWDB 4PLKC 2UVFA 3B9KC 3O11B 5BO1H 3CH1A 3O8XC 3OKDA 1LGVA 3X13B 4JM4L 2UZIH 4MJ6B 3SKMA 1T7VA 3LCYA 3Q5YA 5D7LE 1W72B 5D7IB 1A9EB 1NC4B 3DO3A 3MV9A 4JRXB 1Q0XL 5T1LA 4X83A 4KTYA 3WIHA 1CGUA 5TE4H 4POZC 4YIQA 3WXWH 2ENSA 4U2YA 1E27B 3GKWL 4NQCA 2OXGA 5TDPB 1KN2L 3L7EB 3DUHA 5DWUL 3MRIA 4QTHB 2I07A 3FO0L 5GGRA 5LGJB 1NEZG 4HG4J 4N8VB 1N8ZA 3O2DL 4OF8A 4AH2B 2IQAB 4S1RH 1QFWM 1KB5L 4N5UA 1SBBA 5IP4A 4RQQA 5F88A 2IGFH 5ISZD 2D03H 1G7QA 3P9WB 3RUGF 2HJFB 3D85D 1TZIB 4YBLB 1ULVA 3QDGA 2HT2D 2R0ZL 5C9JB 3ZE0E 3FMGH 4WUKL 3TBVA 4KQ3L 1JV5B 4XPBL 3DVNA 3E6HB 3WIFB 2HFTA 3L95A 4Z7QE 4Z78A 4JPIB 4MHHG 3QEHB 4NNXA 4RAVB 3TNNB 3MA7A 3RKDC 2CLRA 1BQLH 2YC1A 5CSZB 2CRYA 2Q8AL 3WBDA 1UH3A 4PJEF 3IRPX 3MODL 5HVHB 1T80A 3D69A 1GZQA 4X98B 4LMQE 4DZBA 1IBGL 4V2BA 3H7BB 4HV8A 4P5TB 2VL5A 4D0DA 2A74B 1I1YB 4H26A 3WO3B 3X3GL 1CLYH 2PYEB 2AQ2A 2DBLL 3B6SB 3V8OA 3SE3C 1AGEB 1ORSB 2BNQB 5KN5A 4J12A 4IEFB 1OF2B 1GGBL 3RZCC 2J4WL 1WBXB 5I16B 2HFEA 1MFEL 1EUUA 4HXBL 1KG0A 3BDYH 2DYPA 4PJIF 5KAQF 5EC2B 2FX7H 3INUH 1FNGB 3AREC 4X7EC 1MWAB 2NR6C 2JCCB 5HYQA 4N9GA 1IGCL 2VE6A 5IMOA 1U3HD 5F3BB 2WW8A 3HUJA 3H9HA 1QLRB 4UT7H 1X9QA 4P2QB 1EHXA 3VXPB 2XKSA 4Y2DC 2F53B 2FBJL 3H6JA 1YMMA 1E4JA 1IAOA 5I18H 5DRXA 1MRCH 2WBJD 1AKJB 1AGCA 1LO2L 3SGKA 1E4XL 2CIKA 4MAYB 5C0JA 2FZ3A 4OZIB 4J7RA 1B9ZA 3GRWL 4KH2A 4PJ5B 4G9FE 3KYMA 2I26N 2DQIL 3RGVD 5C71A 1MCIA 4FQ2H 3S34H 1J05B 2YKLL 1AFVH 3TC9A 2ZOLA 5I74B 3GIVB 5EIVA 4GAGH 3K8MA 5C6WH 4H8WH 3H9SA 5AZ2L 3V5HA 3DURA 2YD8A 5MEOB 2C3HA 5D71H 4AQOA 5CJBA 1II4E 1W0VB 3W2DH 4TVPH 1T3FB 4ZFFA 3U36B 3CC5B 3OGCA 5KW9H 1P6AB 3SDDC 2IG2L 4JLRA 2F54E 1Q9KA 4HEME 1DBJH 1KTLB 5F72S 3TO4C 4V1DE 1WEJH 3RA7L 2MTPA 1UM4H 2I25N 2RR3A 3LH2H 3SJVB 4DGVL 3KPSD 5DMYA 1F58L 5C0AE 1IGIH 5FYKU 5SWSD 4MNQD 2X9XA 1W8NA 1GHFL 3UC0L 5MEQB 1UM5H 3HCVB 4YXKH 1J86A 4L29B 3BHBA 2D0GA 1NAKH 4S2SB 5D1XD 5IHLB 3Q2CA 5C08B 1G7IB 1RHHB 3RTQA 5ADPL 2JKXA 5LAXA 4Y4FC 3QIBB 1FV1A 2DQUH <