3GBNL

Crystal structure of fab cr6261 in complex with the 1918 h1n1 influenza virus hemagglutinin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
Knots found
sequence length
201
structure length
151
Chain Sequence
VLTQPPSVSAAPGQKVTISCSGSSSNIGNDYVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEANYYCATWDRRPTAYVVFGGGTKLTVLEELQANKATLVCLISDFYGVETTTPSKQSNNKYAASSYLSCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antibody recognition of a highly conserved influenza virus epitope.
pubmed doi rcsb
source organism Influenza a virus (a/brevig mission/1/1918(h1n1))
molecule tags Viral protein/immune system
molecule keywords Hemagglutinin
total genus 25
structure length 151
sequence length 201
other databases KnotProt 2.0: Artifct K +31
ec nomenclature
pdb deposition date 2009-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gbnL01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gbnL02
1NUFA 4YFEA 2OJEB 2C26A 2CRYA 3MXVH 4XNZC 5DO2C 3RWFA 3NZ8A 3D9AL 5EOCJ 3HI6L 4G43B 3QSKB 3RVUC 4AEEA 5FCUH 1CVRA 2DIAA 4NZUH 2GFBA 4F7TB 1QFWL 1EHNA 1OAUH 2FATL 1DQLL 2DJUA 1QBLL 2VZSA 4XVJH 2VLRA 4BJLA 5FUOL 2A6JA 5I8KL 3LKSA 2HTLD 3SO3B 5FYLE 2I9LB 1N3NA 4EI6A 2X44D 2PNDA 5I17B 3KDMA 1A9BA 1IAKB 4F33B 4Y4KA 3EDDA 4GG8B 4Y16B 4EBQL 4OQTL 5D5MF 5DO2D 3GO1H 4MMXC 4WI2A 2EXWD 3PWNA 4U6YA 4YFLF 5EWIL 4YE4L 2UZIL 2MFNA 4ZO9A 3RZWA 1CIDA 1OARH 1KIPA 2VMFA 4LPVA 4AH2B 4MHHG 1MLCA 3JV6A 4JHAL 4V1DB 3VFUB 2Z4QB 4LU5L 3F7VA 3KJ6H 1OP5H 3V6OC 3RNKB 5D1ZD 1UWXK 4XAWL 1YDPA 2HTLC 5C08D 3WIFA 4OIAA 3MLSH 4JKPL 3OB0H 1TTFA 2W59A 5CLWA 2YC1A 2EDKA 3OR7B 5K9OB 3NA9H 3SCMC 1MQKL 3ME0A 1QHPA 3BXNB 3OAUL 3NIDE 1CTNA 4KAQL 4CAGA 2J8HA 1JFQL 5JTWA 1T89A 5C0BE 1JYXA 5FHBH 1S7TB 3QFJA 2VXUH 3OX8B 2RHEA 1P9MC 4P3WA 5C9JB 3QUZA 1YPZB 2W60B 1KBGH 4UT6L 4WUUB 5DVNA 5EOCL 3TIDA 3O3DB 4H26B 2YD8A 1X3DA 3HC0A 1X7QB 4DVRH 4X7TA 4Y4FD 3ARFA 5FYKE 4IRSD 2BHUA 4LLDB 3LKNB 4YDJA 2VC2L 1GPOL 3LAFA 3RWGA 4AG4H 4HS6A 4OCRH 3QQ4B 5ETUB 3QG6B 2A6KB 2YWYA 3JWDC 3RIFF 5D8JH 3QEQD 3SCMD 1H5BA 3FCTB 4H1LG 4OCWH 1KGCD 2XWTB 3GSNH 4U1JB 1SQ2N 4FP8H 1A3LH 5AZ2H 2I5YL 3C09C 1FL6A 5TH2B 1MCKA 1AP2A 4NC1C 5IM7B 1FL3B 2VDLH 4XNMB 1DQLH 3WFBL 1H5BC 5GZOD 1QA9B 3UDWA 1PZUB 1T2JA 1MFDH 4G9FD 3DUUB 4S2SA 1Z6JT 3CFBB 2HKHL 4OAWB 4Y4FB 3RVTC 5CJXA 3U2SB 3D9AH 3LVEA 5AWNH 2IBGA 3IDUA 4BQ6A 3IJYA 1M6OB 2C1PA 1CE1H 4PJEB 3VFSA 5T3XE 1XAUA 5J9PB 2BFVH 4HMDA 3JWNC 3FQNB 3U0WH 2Q7YA 3SDDB 2XQBH 1GGYA 4ZXBD 5JZ7D 2WK2A 2Z8RA 5D7JB 1I1AC 1U8MB 1WICA 3OX8A 1DVFA 4K3JH 1AGDB 5C9JA 3DETD 4RFOL 5EORH 5JO5B 5I75B 3VRLE 2GHWB 5EU6E 4ZUUA 4KMTL 5T5FH 1MCPH 5FF6A 5HI5C 3CX5J 4PREB 5EU3A 3S4SG 5DA0B 2FEDD 3F6IA 4LVEA 4IJ3C 4LNRB 2K7QA 5DGQA 1RUAL 2Y6SC 5CEZL 5J57B 4Z7WF 2IQAA 4RA0C 1RK0B 4R8WL 3G6AB 2H1PL 2EKJA 4H0IA 1ODAA 4LVOB 4KVCL 5FO7B 3KJ4C 1LEIA 1YJDL 1RZJH 4HZAA 2W0PA 3C60D 3BH8B 3U9UA 4ZOBA 2BCKB 5C0CB 5JZ7C 4JQVC 5IHBA 2P44B 4PJDF 4X7SH 1I1AD 5DC0A 3V6FB 1RZJC 1B6DA 2QTEA 3DETC 4OLZL 2AKRA 3GBNH 3OR6B 5HVHC 4PJ9A 2AXJA 2E9JA 2OM5A 3VXRE 5B3NA 4WU5A 3QG7L 3QUXD 1AGDA 5D1QD 1MIEH 1FNSL 1IAKA 1NSNL 5F7KC 1XFPA 2GITA 3IAGC 3K81A 1IGYB 3GB7B 4ZAKA 4RGMC 5C08A 2Y23A 3DO7A 1PJ9A 5L6YL 4JPKL 1RJLB 1CICA 1S9KC 2VLRB 4JZJB 1B0RA 2EO1A 1HHIA 1BGXL 3OKDB 4R8WH 2W9EL 1JZ7A 1U3YA 2R2BB 1INQB 2G9HB 2VZUA 1Z9MA 2DDQH 1G7MB 2F5AH 4I1NB 3QXDA 2R56H 3S4SB 2Q3ZA 3TBWA 1GVIA 3AM8A 1MCPL 3NCMA 2XQBL 1ZVSB 4CUCA 5I15L 5GGTH 3S3SA 3TO4D 3V4VL 5DMYA 5D1QC 1XZ0B 3HRPA 3MSPA 3DRTA 3W0WE 5HPMA 4R4NC 1JBJA 5AWNL 2H9GA 5DTFA 4WIQA 4JO4L 3MOBL 3NGBC 5ADPL 3LQAC 1I9IL 3KXFA 1R3JB 5KS9F 4ODUB 1INDL 5F70A 5AYUH 3S5LG 2P1YA 2WW8A 2H32H 1G9ML 1NUNB 2HKHH 3TIDB 4JO1H 3X11B 3I50H 2CIIB 4OZFH 5DXWA 1T1YA 2B5IC 1CFSB 4LCUA 4PGZA 4D0BB 4ZFFB 5H35A 2RCSH 3QXWA 1FAKT 1R5VB 4XBEH 3D0LA 3UTPD 4FNLL 1DCLA 4HT1L 3CD4A 2VERN 2X1WL 5I1DA 4XGZB 4OCRL 3QHFH 3TO4C 4YX2H 1AGBB 3SGEH 3OKNB 2FBJL 1F5WA 4JZNA 4JFFA 5LQBL 3LKPA 4OFYA 2VO5A 4LLQA 1DJSA 1KC5L 3AY4A 4FFVC 5LBSH 4WRLA 1YEFH 3P0YH 3AS2A 5HSFA 3DPBA 3BD4A 4ZO7A 1MLCB 5EIVA 3R06A 4L1HA 2EDOA 2F5AL 2Q86A 3MNVA 2ICES 3W39A 2BY3A 1G9NC 3EJYD 1OPGL 1JPFB 1VFAA 3NFNB 5FCSH 4YHOL 3WEXB 5IBLD 2J8UF 1Q9LB 1I7RB 5C0RH 2OQJB 4G6MH 2OR8A 2H8PB 2VIRB 3I6LD 2X4UB 5E9DB 4F37F 5KVFL 3S5LA 3S36L 4JZJA 4KVNH 1BIIA 4J12A 3HG1D 4R96A 1X6LA 2B5IB 1IMHC 1T0MB 2NXYB 2C3XA 2XZCL 4G42B 1NQBA 4NQXA 1KN4H 3I75B 3TWCH 3IFNH 4JAMA 1FBIH 5FM5O 3BGFB 2X7LB 3W5MA 1BFVL 4TTGA 5CJOL 3VD9A 3VFMA 1ERNA 2Y7QB 1KIQA 3G6DL 1JPTH 3MX0A 4M43H 5HHXL 1UB6A 2RIKA 4LK4A 5IMOA 4U3CA 1WZKA 1JCKA 5IBLC 5CILL 4P2RA 2BNRB 5C0CA 3M8OL 1DANU 4X6CA 3NTCL 4BH8B 1RZ7H 4GSDL 1IEAB 1NPUA 3NPSB 1X4ZA 3EYVA 3RWEA 4UU9B 3V7AG 1SBBA 1O7SA 1JZ2A 4LQFL 5LWYL 4KKCC 5AD0A 4HJGA 3WLBA 1RUPH 3LIZH 1B4JL 4HPOH 1NH6A 1T03H 2H41A 2O26U 2IJ0C 1NL0L 1CLZH 5IEKB 5L6YH 1KJ2H 5MEQB 3K2UH 3MA9L 1EGJH 3OBAA 4ZD3H 4K3DH 4FQXD 1OCWH 1QLEH 2Q7YB 3SDDA 1X6NA 1UWGL 3CDGA 4X6DE 1EHAA 3R06B 5GRXG 1GC1L 5IF0B 2UVFA 2OTWA 4RBPK 1I1FA 4CVXA 3IFPA 4YDVA 4S10A 5KSBB 3WHXB 3T2QA 3A6OA 5E1HB 3U1SH 1C5BL 2JK5B 4LLMA 4OZHF 5GHWH 3S37L 2P5WA 4I2XA 4TSBL 3O6FB 1A1OA 1S8DA 1K4DB 4OFPA 4DZBA 1FVEB 3VXMD 1KLUA 3MROB 2R0ZL 2ZP0T 4EDWL 5EUOA 4OGAC 1L7TL 4JFZH 4FQXC 2BMKA 4OF7A 1U2HA 4L4VD 5J6HB 3QG6A 2H3NA 2CIIA 3FQTA 4MSWA 3PV6B 1GGCH 4JREB 4KQ4L 4NNPH 4WW1A 5D7JC 4TUOA 3ILPB 4JDTL 5LXGH 3DMMD 3HI5L 4N0FB 3GEWB 3HC3L 4PD4K 4OB5L 2ZJSH 2PYEA 5TDOB 2VXUL 3C9NA 1ZSDA 4P5TA 2DM4A 3UTTA 4EQ2A 4YHIB 4O2FB 3MR9B 5HPMB 3U0WL 2X4OA 3KWWA 3UAJC 4HUVB 1YMMB 3STZB 5DJ6A 4FABL 1MQKH 1CE1L 1EGJL 3T8XB 1EEYA 3VXSD 2DBLL 3H9SB 1T7XA 1OSZA 4LLYB 4WWKB 2P45B 3GSNB 4LHUG 1G6RA 3QCTL 2PO6B 3MLSL 1TQCB 3BWUC 1XF1A 4PY7A 3HPLB 4UBDD 4KDTC 2R23B 1EK3A 5EU4B 3QQ9D 3RP1A 4XPTL 3UDWC 5IB2B 5ISZB 3ULSB 3DMMC 3HNTL 3RNKA 4X7DC 1AGFA 1MHPH 2FYYB 3RVWD 1A3LL 5AZ2L 1MAKA 1EIBA 2JLLA 4PJXF 4OLUL 4QHLA 2Y36L 4OV6F 1FDLH 5IHZA 5ICZB 1IGYA 2AEWA 4NQXB 1BOGA 3UAJD 4HDIA 5SV3A 1PG7X 2OJZL 3P0VH 2XN9B 2W91A 3KYMB 4LCCC 3S5LB 5IJVB 4V1DD 3TBYB 4FXKB 4CVWA 1UZ8A 3NCYS 3ULVE 1EPFA 3RWIA 1IQWL 3KPRA 2L7UA 4NNYB 5E7FA 3A67H 3O2WL 3X12B 1BFVH 5L8JB 1VPOL 4P4KC 4OZFB 2Q86B 2O61A 3FOMB 5FYKL 3ULVH 3GHEL 5B39G 1ZA6B 1U8OB 2ESVA 5IW3A 1EMTH 1I8KA 3KPPA 4PS4H 1G0XA 4PGBA 3B9VA 3ULVC 2X1XR 5JQHC 3C60B 1FSKC 3SEPA 1DQML 1UVQB 4PBXA 1KB5B 2NY5C 4Z7OE 2GSGA 3QT2A 4GQ9L 1PG7L 4XNXH 3O6MH 5DMIL 4XVTL 4YBLB 2YR3A 4AEFA 3EOAB 1DQJA 3BEWA 2VR9A 4WU7B 4DN4L 4DVBB 1IGTA 3W5NA 3UPRA 2DWDB 4XTRC 1R5VA 3HLAA 2DQEH 3IAPA 4UILH 3LMJL 3RBSA 3HFML 1A1NA 3QI9C 4P4KD 1V05A 5HPOA 4G9DB 2DD8H 3X3FH 5I1AA 3RY4A 5DURB 5GS1B 2X05A 1KOAA 4GT7A 2WBKA 5FKPA 1FFQA 2VZVA 1IM3B 4Z0BH 3C5SA 3RL1B 1JZ8A 4R0LB 5HHNB 3MRCA 2BSED 2E6PA 3FQTB 4HCRA 4X7EC 1B6UA 4S1SH 3GMQA 3MLRH 4I4WB 1VKXA 3MCLL 4OLXL 3KYOA 4E9LA 3VRIA 1H8OA 12E8H 2FX7H 4YK4C 1BVLB 5J4MA 5HYQA 4XTRD 2Z31B 4TSBH 2DF3A 3AM8C 1HILB 3O9WB 4OZGF 3SN6N 1A1OB 3H3KA 1T0NA 5F1SA 3O6FA 3EDJA 2NY6C 3U0TA 3DMMA 4C56B 4U1NA 4FN0A 4EQ3A 2IH3B 4G8IA 4KHXH 2CUMA 3V0VB 5B8CB 3D2UD 3O9WD 3MLXL 4H25A 1NFDF 3V5DA 1E6JL 1S7VB 1S9VA 3X17A 3LSOA 1GGBL 25C8L 4FTVB 2JELH 3QB7C 1R3LB 2FSEB 1TJIL 4OD1H 5D7KD 1UGNA 1MCIA 4RSVA 4KDVA 3OR6A 2YXMA 3RDTA 3BXNA 2DM7A 4EIZC 4FQ2H 5ILTL 1Q1JH 3FT3B 4LSUH 2YRPA 4J1UA 2BOCA 5DJXB 3X14A 1JGDB 5CHNB 1VENA 3B4NA 3FO0H 1WCBB 5FYKU 1MCLA 4CMMB 1A7OH 1XGYH 2X70A 3BP7A 3GIVB 1R0AL 2APTA 1QSEA 4OV5B 4WFGD 4GKNB 5BJTB 4GXUM 5E6IC 1ZWIA 3JV6B 4UIKH 2APFA 4LCCB 2DQHH 1JGDA 2C3GA 3D1MC 3WFHA 1KENL 35C8L 1T66D 4P23A 4LGRB 1OT2A 1Z9SA 4HF5H 4X6EA 4ODTL 1NC2D 5LCVH 4KK9C 4GG8A 3RKPA 1LO0H 5CEYB 3CVHL 4NZTL 4LGSB 2CMRL 5FYJL 4WI4A 3HZYB 2Q1EA 1R3LA 5FDYA 3WJJC 4OI7A 2XZCH 3QXAA 4KKBD 1U92B 3T3ME 3FQWB 4Z7WA 4YXHL 4NQUA 2YPKA 5DUPL 5GGSY 2FJGB 3U4BH 4XB8A 4NNXA 3OAZH 3W2DL 5E6ID 5E2UL 1UACH 5D71H 3U2SA 4PLNC 3LZFL 1T7VA 3EDFA 1GRWA 2XN9D 2NR6D 2P8MA 1QSED 3U36B 1GGIL 2J3SA 2CLZB 2BRQA 3ZTNL 1CG9B 1BWMA 3KPRE 1BM3L 3TZVD 3VFWA 4BUGA 4RMVA 1JGEB 2H26A 4RWYL 3ARSA 1M7IA 4NKIH 4OCYH 8CGTA 1M7DB 1D5IL 3VWJA 4DGYL 1YNLH 2C7UB 1IGFH 4TUKH 5E94B 4KK6C 4MA7L 1MPAH 3MYJB 4M1GH 3QUMA 4Z77A 4KQ3L 5IW1A 5F71A 1LE5A 5D7LD 3PL6C 1RFDL 3WL9A 3FRPG 1MFDL 6CGTA 2YEZA 1RULH 4LL9A 5IIEA 4L3ED 3BUYA 2BXZA 3GGWA 1YMMD 4WTZA 4G9DA 5A40E 1QLRB 1UG9A 1NGYA 3TZVC 1XGUB 3VXMA 4OCWL 3DURA 2WM0A 1BQHA 3B6SB 3BVNB 1MCWW 1RZFL 1INDH 4AG4L 4KTDL 1CR9L 2AS5M 4FZEH 5CD3B 2GTWA 2PXYC 4MAUH 3RUGA 4JPWL 5E6IB 1R0AH 1EDQA 2R0WL 4OF8A 3DX7B 4PLKC 2ZSWA 5IHLB 1AO7A 3B9KB 1HSAA 4L4VB 1ZHBA 5I66B 3CVIH 4YXKL 1FNEA 5IVXA 2EEDA 3JWDL 4EJ1C 2A6DA 4YDIL 4R26H 2FGWH 5J6GA 1J0ZA 3FOMA 1P4IH 1AXSA 1S7RA 2YBRB 4JJHA 5E70A 5HHOD 3JTSA 2F74B 3HMWH 5D7SL 1MFBL 3QIUC 4D8PA 5I74C 1INQA 2G9HA 3B3IA 3Q48A 4PRHD 3TBYA 4F15C 4NNXB 2IPUG 4BQ8A 3C6LD 2MOVA 2NY4D 4QHKI 2YPLB 5HVWA 3QUMH 5M94B 1EBAA 4ZAKB 5C7XH 3S3JA 2X1QA 3UEZA 3B9KC 4OSUH 1BD2E 1TZIB 3HCVA 1F3DH 4HHAA 5DS8B 3CDYA 1E27B 1RIHL 4ODBD 5DJ2B 1QEWB 3Q5YA 4HWEH 1IAIL 4YK4B 1N5AA 4MAYB 5BMFH 4KVCH 3LCYA 3GK8L 4QOKD 1BAFH 2PN5A 3PWPE 1IC4L 5GRWA 2EDFA 3C6LC 4HBCL 1DSFH 2NY2C 1SHMA 1QBLH 4ZDHA 5MP6H 4GBXB 6FABH 4XVUC 2YUZA 2ZUTA 3ARXA 4WHYH 1P69B 4LKXA 2B1HL 1KCUL 1VGKA 2F54B 1HH9B 4PB9L 4P59H 3FTGA 5A2KH 2BX5A 5JNYA 3K7UA 5EUOF 1NCBH 3QDJA 1T5WA 2YKLH 1G6RL 4AYFA 2O5YL 3BKMH 1OWWA 2CD0A 2BMKB 3AB0B 3GHBL 1LNUB 4R2GD 2X4NB 4DOHB 4JRYD 1F97A 1QD0A 4NDMB 5EZIH 3WUWA 1FVEA 1NDGB 2NY2D 4GRMA 1JI1A 1G7PA 3GMPB 3LEXA 4QTIL 5CKGA 1RPQA 2VLME 5DD1H 3I6KB 5FYKH 2VWEC 3ULVL 4W6WB 4EDXB 1VERA 5M95B 1JPSL 4UOW0 2ILLA 4YNYB 5DQDL 1Q0XL 1I1FB 4CVXB 2EE3A 4PJ5D 3K1KC 3LRHA 5IF0A 4J8RB 3TH3T 1LDSA 1MIML 1NANI 4NM8H 3E8UH 4H20H 2OZ4H 1TQBB 3V5KB 3NGBB 1U93A 5BV7C 3PIQA 1U8IA 1T5WB 1MY7A 2PYFB 3U7WL 5BV7B 1F58L 1NCNA 3IU4L 5MENE 1MJJB 1U3HA 3U9PL 3ZMRA 4OKVB 2Q8AH 3C2AL 5D2NE 5K9KB 3ARED 3ARFB 1P5VA 4WUKL 4PLOB 4N8CL 3E3QE 4AEIH 5B3JE 1KG0B 1MHHB 2JJSA 1CTOA 2GQHA 3PHSA 4MA1B 4AEHH 2NYYC 2NZ9C 4FFWC 2VQUA 3C5ZC 5C0GA 2VL5B 4X6BB 3RTQD 1FYTD 5KVEH 3ARFD 2Y9RT 1A7NH 1CLYL 4P49A 5GJSH 3N9GH 3T0VA 3EW3B 3RX5A 2JB6B 4HC1A 3T4YA 3OR7A 4HKJB 3P4OA 2BHZA 5FDWA 4FZ8H 2DBJA 5DHVB 1E27A 1RIVL 4YAQA 3VFMB 3FO9A 1CBVL 3O6KL 4JQIL 4BZ2H 1KSRA 3MV7E 5DMGD 3VFUA 1ZA6A 2NYYD 2OCFD 4DQOH 2NZ9D 4WHYG 4FFWD 5EWIH 3DI3B 4RAUB 1QRNA 3L95B 3AXLA 3SDYH 4NGHH 5IMMA 2UY6A 1PEWA 3ES6A 2M26A 3I6GA 4XCNA 2X89A 1RK1B 4YGAB 5MEPB 1KN2L 3REWB 3VGEA 2ZCHH 4DZ8B 4ZMAT 1KJ2B 4P2QE 4M5ZH 3B2UC 4R3SA 2XICA 3NFNA 1OGAB 1L9MA 3JTSB 4HDIB 2AGJH 3T65A 1JPSH 3MNVB 2IC2A 5KOMC 1G1YA 5CZVH 1XGRB 1DQDL 4IJ3B 1DL7H 4DKDC 5E03A 3ABZA 3CC5A 1WBXB 1NDMB 1W0YT 5IROC 2NLJA 5DMGC 1YMHA 1UH3A 4PGDB 1SEBB 1Q9OB 4PY7B 4XPFL 4C56D 1HINH 5FGCB 4J3SA 3EZ8A 4KKNA 5E6IA 3LEVH 4CMHC 4NQCD 4JQVA 3CGTA 4K07A 1CLZL 1QRND 5HJ3A 3V4PL 5EO1B 3RZCC 4ZFFA 4P3DB 1INEL 4HZLB 1VFOA 3MO1A 3HI1B 1KFAH 1EEQA 1HYRC 3EO0B 2VXVH 4ZFGL 1FFPB 5EZLB 4ELKA 2F19H 1NKOA 1OB1B 2IALA 3L5XH 4TUOB 5D96B 1KPUB 4X9BA 3L3HA 4KUZL 3BW9B 4KI1A 2DM2A 4Z77B 3QEUB 1RZKC 1C16A 1QKZH 5EC2A 5A2FA 5IQ7H 3TN0B 3GKWL 1NBVL 3O3UN 5E8OB 4DW2H 3OXSB 4FQCH 3BKYL 4JVWA 3HC4H 1UKSA 4QF1B 3G6DH 4Z76B 3MUGA 1ED3B 3N06B 2B1AL 1W0WB 2AV7A 4PRPB 5I2IA 4DZBB 1CVSC 4YHNA 3SDAD 1S8DB 3F7QA 1CLOH 2CLZA 2LVEA 1A3RL 3FB5A 3F58H 5E5MB 4HIXL 1PY9A 2DTSA 4G9FB 1YNTA 5T1KD 1V3KA 1WIOA 4F3FB 1N2RA 4KJQD 2R8SL 1CLYH 1A7NL 1C12B 1WWBX 2CGRH 3GSVB 1IGIL 4LEOA 5CSZB 2KQMA 1DVFC 1SY6H 4GMTL 1CE6B 5D9SB 2NXYC 4FFZL 3QO0A 1XIWA 3T0EC 3KLAB 3PABA 5C0IB 5FUZH 4N8VA 3EFDL 3MRPB 2VISB 2NTFB 3MJ9L 1JHLH 2EDDA 4N8CH 3VXTB 5I0ZA 1UM6H 3ZSTA 2AEQL 5EBMB 4JGMA 3MBEA 4U2YA 3D3VA 1ZHLA 1WK0A 3T2NH 1H15B 5LBSL 5L0QC 1T04B 1D3CA 1EHXA 3DGGA 3VE0B 1HQRA 4M6MH 3SPVB 2R0LL 2QKIB 3L3DA 5T1KB 3QXTA 1A1MA 1NMAL 4B0MM 1KCRH 5INDB 1CDBA 1S7QA 4GKZB 3SDXA 4JPWH 4XP1H 2BSRB 1PKQB 4UTAH 2Z8WC 2CDFA 2NXYD 5T1KA 1FLRL 3EYUL 4X9FA 3GSUB 1IC7L 2VXSH 1UYWH 3WXVH 2CLRB 3UTSB 4I18A 4RNRA 1ZT1B 3SKNA 1BQSA 1KNOB 3L3IB 1LK2B 1LEGB 3I50L 3H9SD 3ARDB 3KLDA 2Y7QA 5JO5A 1ZKAA 3HZKB 3VRJB 4LF3B 4PRHB 4WTZG 5E4IA 5C0AD 4TQEL 1HSBB 3MLTB 5IFJA 3PG2A 3VH8A 3DX6B 4ESKA 1DP0A 2EIDA 4CL7A 2YD3A 5SWZE 4BKLB 4UV4H 2ITDB 2C1PB 4IHOB 3I3BA 1T0MA 1TENA 1MREH 4YEFA 1TZHA 1VA9A 4GAJL 5FUCC 5CMAA 3MV8B 2LU7A 2W92A 5GRUL 5BS0A 1IKFL 4GAFB 2UZXB 4NUGL 5A43C 5DJYB 5TFSH 4MD4A 3KHQA 2RFXA 1PEZA 3UBXG 3S34L 5CEXA 4P2QA 4U1HA 3WBDA 4TOYL 3V7AE 5EZOL 2XNAA 5IV2B 2QV2A 4U1JA 1KCVH 2D9CA 1UKQA 3DV6A 3PE9A 4NZRL 4ZOEA 1JPGA 2LVCA 5FIEA 2XI9A 3UPCA 3UZEA 3VFNB 1FG9C 4PJ7F 2NW2A 3NIGE 1MWAB 4X5XA 3AU1B 5F7NC 4Y1AB 5TDPA 4CBPA 4YDLB 5FKPB 2B7DT 5IEHB 1HYSC 1JWUA 1JTPA 2C3VA 3L5JA 5BXFB 1U36A 3REVA 2A9ML 5J1TC 4MJIE 5F7YC 3ULUH 2EYSA 4WO4B 5D7LB 4F37K 3EOBA 4FQ1H 1L0XA 3F12B 3VGAB 2ZUQC 3F5WB 3AY4C 3RX8A 4ZFOB 3SY0B 1XMWA 2QQLH 1NAMH 3VFVA 2MQ0A 3CZFA 4BYHA 1EO8L 3FONA 5KANI 4X4XB 1UWEL 5BVPH 5GS2H 1BHGA 1D5BA 3MRIB 3WN5B 3ISWA 1N0XL 1CFNA 4WCYH 4L3CA 1Q1JL 1T0PB 3GI8L 4I0PA 4XAKD 1HYSD 1OAZH 4XT1C 4OZ4B 3CDCA 1XGRA 3MRGA 4KMTH 2W07A 5FGSA 4R0LC 3QIWC 2DI8A 5I1HL 4R90L 3PL6B 5DFWH 4YXLL 4JY6A 1FYTB 1AKJD 2YD2A 1ZANL 5ID0B 5AZEH 3QIBC 5JA9A 4JO2L 4OCMC 5KSUA 1BFOB 2EIEA 2Z31D 3L3OA 5IKCA 1MUJB 1VGEH 3AXLB 4OT1H 2YZ8A 4KHXL 5D7KE 4XMLH 3TNMA 4XWGL 4RIRA 1CLCA 2GITB 3NCEB 3RA7H 4PJCF 1FZJB 2EIBA 4NCDA 1OLLA 1S7SA 4ZNEE 1P4LB 1RJZB 1WBYA 4J3OC 4AENB 5E9DD 3AMKA 1KB5L 4EXPX 4PJGF 4BQBA 4UDTB 1GOFA 2P5EB 3KYNA 3SDCA 4FP8L 2APXA 3IDGA 4TVPH 5LGJA 4JHWH 1N59A 1JJUA 3MRQB 5D8JL 3TPKA 1N64H 1OAXL 3S88L 3TLRA 1X5XA 1CGTA 3CFDA 5F9WB 5MI0B 3U9UB 3O6LL 5IWLC 2JIXD 4RWHA 2Q6WB 5FOBA 1K3ZA 2VDML 5FO7A 1SBSL 2WIIB 3RKDD 1LP9B 4XHQA 4LBEB 4DKAA 4JY4B 5DHYA 1D9KA 1M71A 1FQ9C 5CIPB 3VA6A 5GGTA 4NFBA 1SJEA 1GAFL 1KBGL 3K8KA 1XF3B 4PTTB 2AJZA 4JRYB 1DLFH 3DYOA 4LAJH 4JFEE 1DZBA 1AD9A 3OKOA 4FFYH 4G6JL 2KL6A 5EDXA 1IEHA 4KZEL 2V7NA 2O5ZH 2WBJD 1FORH 3DBXA 4HKXA 5D70H 1MCBA 1UJ3C 3INUL 1AJ7H 1IZJA 4LIQH 1CFBA 2F54D 1H0DB 4XWOC 4U1LA 4WW2F 1TQCC 5F96H 4BFIB 1DQMH 1MI5D 4JFPA 32C2B 3MROA 1KLUB 5KN5A 3RKDC 4YHML 2J8UB 2V2TA 4Q9QH 1P7QA 3SQOL 4N8PA 5C0FB 1EMTL 4JHZA 3QEHB 2VN4A 35C8H 4HEPG 2JK5A 4OAWA 4Y4FA 3MV8E 2WWKO 1P9MA 1G7PB 3GMPA 1RU9L 3FFCB 3LEXB 1EGJA 1HOCB 1T1WB 4HIJA 4OZGE 3CLEH 4HQQH 4MAYD 1K9TA 2RAMA 2WBJC 3P40A 2C1OB 1CS6A 3CNKA 3HS0B 4O2CA 3U4EB 3VFGL 5BZDA 2R29L 1DN2A 4OUUA 3UTQB 4XCCH 3PWPD 3QFDA 4OM0H 4JFOB 2ATKA 4QOKE 4I77L 5ESAA 4R4FH 4OLUH 1D6EB 1V3LA 3BYTA 3JV0A 1A0QL 1ACYL 2XV6B 4WEBH 1Q94A 5BRZD 4NQCE 3U30B 2DN7A 3DV4B 1LGVA 2DQGH 4JRYA 4K71B 4X6FA 5DRXA 4HS3B 3WFDH 1DANT 2J8UE 1IEBA 1XCQB 2CDGA 4XNUL 4Z95H 4Y1AE 1AD0B 2GAZA 3FO2B 5E00A 2F8OA 3ORJA 1I1CA 4PJDE 1KPRA 5DLMH 3TA3A 1KJ3L 1BFSA 3PWUA 4MAYC 4WDIA 3ZKND 3KNBB 2HJKB 5F1OB 4BFBD 2CGRL 4XP9H 2X10A 4JFYB 4R7NA 2NW3A 1S3KH 2UY7A 5JHDB 1RSFA 2W0FB 2I27N 5D72H 4XCEB 5HTSA 4UTBH 5GS1C 4X4MA 2X4RB 3QUYA 4UQ2A 4F58L 4GRLB 3O8XB 4OZHE 1GXEA 3E6HA 1WFUA 1AY1L 3PP3H 4PFEA 4Y5YB 4K8RH 4LLWA 4M6OL 3MGAA 4EUPA 1MRCH 4YHZH 3F7VB 3NH7H 4MXWL 3KHOA 4XCYA 3PHQB 1GGCL 4KRNA 3MV9B 4ERSH 2P8PA 3RAJH 4JFHD 5AUMA 1QKZL 4PG9A 4PRDA 4HAGA 2AJYH 5CGMA 4HWBL 3QRGL 5CINL 2D03H 4ZUVA 3BESR 3TC9A 1PQZB 2JJWA 2EH7H 3QDME 5CP7B 2P46B 1LHZA 4B7LA 5ITBL 2B4CC 4F7PB 1V7ML 5IB1A 2F74A 1D5XA 1RUML 1FYTA 3LDBC 2ADFH 4JFXA 1JUFB 2DD8L 4MJ5B 3RY5A 2JJUA 3W39B 1F11B 4F57H 3BDXA 2W9DL 3F6LA 4G6AD 4UILL 5L88L 1NBYA 4MJ6A 3TYFB 4X4YA 2EIZA 3DX9A 3VXSB 1EFXB 3ZE1E 1QLEL 3FB7A 2ATPA 4I3SH 2D7TL 1HN1A 1RIUH 2PETA 1JGUL 3MRIA 1E4WL 1NFIB 5D7LE 5FO9A 2VKWA 3RWFB 2J4WL 3HA0A 4Y5XC 3WO4C 4QRSA 1MCEA 3CUPB 4GW1A 3HE7D 2X09A 5HDOA 4GLRH 4LOUD 5ACZA 4F7MA 2VDKH 5JUEH 4G6AC 3LIZL 3GMMB 2QHLA 3RWDB 3L3KB 3KR3H 3RIFK 2IBZX 3NCYP 5LWYH 2C3VB 4LQFH 4GBXD 1ZE3C 2OTUB 3IXAB 1LO4H 4WUUE 5I1LB 2W38A 1RAMA 1FZMB 2CXGA 3QA3B 1T1XB 1JWUB 4HV8A 4U4BA 3RGVD 2EZ0C 3TT1L 1Q9WB 3OKKA 5HY9B 5C2BL 1NCUA 4WY7H 3P2TA 4WUUD 3MYJA 4TPRH 3BH9A 1C7SA 5T3XH 1PFCA 3ROOB 4GQPH 1OP5K 4RRPA 1I7TA 5D6CA 2EYRA 5L2KE 1I3GL 4EN3C 2HVKA 1FG2B 1TTGA 3EYQD 5HDQL 2DQIL 5TGBB 4WI8A 4PJXA 4LOUC 4HX1B 4ZNCD 3JUZA 1G7MA 4F9PC 4ZTOH 5GRJH 3MODL 4EN3A 1HEZA 1KN4L 3F65A 1DBAL 4Z7UE 3IAQA 2WWMC 5EC1B 5DQ9B 1I8MB 1FNHA 5KVEL 5BQ7A 2EZ0D 5IVZB 4M4PA 5BCAA 3VWJD 3PGFH 4JFQB 1MJUL 1GH7A 1KLGB 4FMKA 4OM0L 4AEHL 1A14L 4ZO6A 4EXKA 2O5XH 5DSCB 4OTXL 5I8CA 1HQ4B 3HC3H 3QUKA 5JPMB 2CK0L 1ONQB 3HG1E 4ZTPH 4ZOAA 1WEJH 1FO0A 4HH8A 3HZKA 2YD4A 2RBLA 5HYFA 3MFGB 4Z7VE 5T33H 1NEZA 2M1KA 4M61A 3RUGE 5I8OL 1CDJA 3MXWL 5BS0D 1J87A 3VGGA 5C0BB 3CSBA 3GIVA 2ITCA 1KCSL 3HHRB 3Q3GB 1C5CH 4UOJA 2IF7A 4TSAH 4L29A 4JZJC 4L1DA 2BOCB 3MRDB 1OTUC 1CIUA 3O3EB 4MLIA 4D0DB 4Q9CA 4UINL 3QQ3B 4YH6A 4C55A 4HXAL 2BOBA 1U8KA 2D3VA 1AQKH 4NUJA 1NC4A 2W0LA 3NAAH 1P53A 3ARZA 4PRHE 4MJIA 4OD3L 3I2CL 1TCRB 2VLKA 4K9EC 3UTPE 1MHCA 4YFDB 4YQXL 1AH1A 4WNQA 4XMKH 5HVHB 3GRWH 4K7FB 4RCAA 2FBOJ 1J8HD 3G9AB 1FJ1A 3WNLA 2K3TA 3VFSB 1P6AB 5IVXF 1KLGA 4Y1AD 4MNQA 3IJYB 4HCRL 5I15H 2E7MA 1FZOA 4E41B 5JMOC 5H8DA 1R24A 1QO3B 4CU7A 3U6RB 3GSVA 2NCMA 3VI3F 3TZVB 1KULA 4GS7B 5GSRB 4QXWA 1X5IA 3ZDZE 4O00A 4KJPD 1UA6H 2FB4H 1MCOH 1VCAA 3T77B 5DT1L 3N85L 5DJ0A 4H1LB 1VKXB 4WJ5B 3ZE0F 1J05B 4NKDB 2MNUA 3IDJB 4M7LH 4PJ7A 3RA7L 5GRYA 2A74B 2ICWA 5JLZA 1WZ1L 4Z7WE 3ZKXC 2WV3A 4OLEA 5E0QA 4L3EE 5HHOA 1IM3A 5T1LA 1QFPA 2IMNA 2FNBA 2E9IA 4M8QB 3SDDC 1FFPA 1FFNB 1SM3L 4LCYB 3RWHA 3ZZ1A 3K46A 1OSPH 1ZTXH 3P4NB 1MCHA 3BT2H 2XKSA 4NYLB 1EEZB 1MJ7H 3VRLF 3IKKA 1U8QA 1VFUA 2OTUA 3VD3A 2F54E 1E6OL 4P9HL 2NXZB 4M7KL 3G5YB 4DCQB 3QR2A 3B2VL 1IAOA 2XA8L 4IRJC 4HS8H 1A6UL 2OL3A 5F3HB 4Q6IC 3RJDA 3FJTA 4PJGB 3JTTB 2P8LB 3UTSD 2BNRE 3WCYA 3CJJA 4PJ5B 2CLVA 3IVKA 1ZHNA 5F6HJ 1IGMH 4F80A 1EZVY 2HWZH 1CXFA 3D25A 5DRWA 4NIKB 1N5YL 4DFIA 4OZGA 1XR8B 1C5DA 4EI5B 3QIUA 2DQJL 3EYFA 4K7PL 5EA0H 1CFTA 1NGWA 2AXFB 3GMLA 4OZFA 1IQDA 4KROD 4MJ6B 3WFCL 1H3VA 1KIRB 4NC2B 2XT1B 2VITB 2EDYA 1YNKL 2DOCA 3T1FA 1FVCB 4NRZA 3NIFF 5F7MC 5BO1L 3MBXL 1X5ZA 2E8YA 1HXYA 3MJ9A 1Z0NA 1J5OL 3IGAA 5E9DE 4WFHD 4E5XA 3S8WA 5L2KA 1YQ2A 1WZ1H 3HE6C 3LDBB 5JW4M 4UT9L 1FFOB 4MX7A 4LGPB 4QRPE 3ULSA 4UDUA 1JYVA 5GGRB 3L9RA 3ZE2F 4IRJB 2JTDA 1MCOL 1SJVA 3N1MC 43CAB 4LLWB 4NJ9H 2X4TB 3SKMA 1MCFA 1J1OH 4NQEA 3NIDF 4YAQB 1F90L 1N8ZA 3VDAA 3UZVB 1ES0A 5HHVH 1I1AA 1ZA3B 2G60L 4LEXH 3B8SA 4HMEA 2SEBB 3FAWA 3QPXH 5I1CL 5DRZA 4DAGH 5GGTL 3L6FB 5EZJA 4LCIL 5LAXB 3TNNA 1FZKA 2DLFH 3HE6D 4M48H 4X83A 2FX8H 2XG4A 4JPIB 4WFHE 4X8JA 3VXPA 2ZG2A 2A38A 3Q6FA 4XMKL 2VOTA 4XC3L 2UV3A 5HYJD 3LV3B 1L9NA 3T1WA 5FA4B 1DTUA 3X13B 4YHLL 1MCNA 3RL2A 1OQXA 2Y25A 4AIZB 1WV7T 4X6FB 5TE7H 2FR4A 2FO1A 4HBQA 2QADB 4TULL 3LEYL 4RMRA 2VH5L 2OLDA 1IM9D 3JXAA 4URTB 5JW5A 5MEND 3CX2A 4O02H 3WN5C 4EIGB 4K7PY 4EOWH 3ZE0E 3VJ6A 4OUUB 3UTQA 3KS0H 4U7KA 5F9AC 5GGSA 3BQUA 2APWA 1BBDH 1FCGA 3TV3L 2D4DA 2R39A 4QXTA 1B3JA 1VADA 1FAIH 4OGXL 1NAMB 1YYLL 4XB7A 5ID1A 5C0DB 3LH2H 2CDEA 1JNLH 4WO4C 4YNYA 3VA2C 5EUKB 2DQUH 4UIKL 2BNRD 5GISL 1YY9C 4AMKL 4M6NH 3E3QC 3QEHA 2Y06L 3OGCA 4QRRB 3JWOH 4ZG1A 3L1OL 5HYJA 4JHBA 5CGYD 4QEGA 5KOVC 3MRKB 4HWZB 3MUY1 3P30H 3WXWH 1IT9L 3ZYIA 1I1YA 3VW3H 5FUOH 2B4CL 3Q2CA 5FHAL 3NVQA 4FQIL 1OAUL 1AR2A 1JNHB 3GNML 1UJ3B 4WHCA 4HKZA 4WO4D 1UADC 2FJFA 3TT3H 4OZHA 3VH8G 2HG5A 1YY9D 1M71B 5CIPA 3WUWG 4HUNB 1FLTX 2LABA 5F7EH 5D2NA 4NSKB 1MAMH 3TM6A 2KH2B 3L3GA 3B43A 3MREB 3SGEI 1A64A 4OIIH 5IHUH 3Q0HA 3TBTB 1KEGL 1EAPA 3VGBA 5T3ZE 4PRNA 4GXVL 4MCZA 2CR6A 2R2HA 4GW4A 2IFFL 2GT9A 3MACL 1ZLUK 5EOTA 2X4TA 3IKCB 3SKMB 3O11B 3MGOB 4QYOB 5F89A 5T3ZH 3OJ2C 4YR6B 1CQYA 2VXTH 1U58B 4XBPA 4HUXA 4RZCB 3HB3C 2XXCB 3T04D 4G42A 1I4FB 3QDMB 4P2OB 4JB9H 4KY1H 1PYWB 2HT2C 4E5XB 4PJ8B 2Z0BA 3GSOB 2HN7B 3OB8A 4WI7A 4PJAE 1FGVL 4HFWA 4M5YH 3SKOA 4ZFZB 1MF2L 5FV1L 1RD6A 3PGDB 5IQ9B 4PJIE 3WLWC 5KBNC 3CFIC 3I9GH 4I13B 3LS5H 3MYZA 1BBJB 4G8GD 3OKEA 4P9ML 1JN6B 1NGWB 1RQ5A 4KAQH 3SGJC 4XPBH 1NAKL 2AERT 2VABB 1J8HB 1WCQA 1DL7L 3AAZA 3HB3D 1ORSB 2ZSWB 4C4KO 2BNQE 4MDJA 1PG7H 4JGUA 3O3BA 5CJ5A 4X6CE 9CGTA 3RUGB 5HHPB 4D3CL 2HA1A 1FRGL 2GJ6B 4YZFE 1C5CL 2P8LA 4U7MA 5DDHB 1B4RA 1T22A 4PJAA 4IOIB 5CLTA 3KJ6L 3U0PB 5E8NA 2V9TA 4YIQA 4U1KB 1NLBL 5FV2A 3D48R 1KT2A 1FO0H 1T1YB 3OJDB 5H35B 3FRUA 4NRXA 4D0BA 2DMCA 4NQDE 2R4RL 1YMME 4JM4H 1JF6A 1NGZB 1Z3GH 1ZV5A 5T33L 1TVHA 2JCCE 1A5FH 1MRCL 2VXQL 4H0GA 3VMOA 4Y89A 2OI9C 3CSYA 4GMSH 4WEMB 1W2KT 1FNAA 4MB4A 1FC1A 5DTFB 5I1JL 3OGOE 4LLVA 3ZHDA 2C7UA 3VFNA 3GSXA 1E4KC 1AI1H 2HVJB 3VI4F 4N0CC 4DK6A 1GZQB 2WP3T 2ZUXA 4Y4HB 3PQYB 5F7DB 5HGBB 2QHRL 4Z7NF 3EHBD 8FABA 5J1AA 4UMGA 4MNQD 4LCWD 1WWCA 2VLJA 4HPYL 3K3QA 3BIKA 1QNZH 2JJTC 3NN8B 3T0EA 1XCTB 3TZVA 4ZFZA 2DQGL 1QO3A 3O41B 4MQ7B 1WIUA 3Q5TA 5HGAA 3FMGL 3UJJL 1MFAH 5CSGA 4LLUA 5BZWA 2Z92B 3MNZB 4TVPE 3VD5A 2BC4A 4IS6B 3E8UL 1FGNH 4H20L 4TYUA 1OM3L 1GIGH 5C0AA 1WGOA 3WNNA 5I76B 4PJCB 3KJ4B 3V6OA 3DNKA 1FH5H 2FGZA 4N9GA 1H3PH 1IC1A 5FO8A 2PTTA 1IAMA 1KJVB 2R4RH 4X0KA 4QRTB 2DYPA 3V8OA 5SX4H 1NJ9A 3W9DB 1L0QA 4YBQC 1LDPH 3GM8A 4X98B 3OHXB 4N1CA 4OV5A 1BREA 4JLRA 3P73B 2ZUVA 4KV5F 2OX5A 1FRGH 3KPSB 3BP6B 2ZUWA 2XZAL 4MA8L 2MPAL 2V5YA 1FIGL 3O2DA 1T1ZA 5KJRL 3BP5A 3K74B 3BAEL 4GRWF 1JIBA 3I84A 1CGYA 1JTOA 3KPNA 2QQNH 4QRTA 4RQQB 3CH1B 3PWJA 1T20A 3MRMB 3BUTA 2CRZA 4CVUA 5I30H 3AUVA 1MHEA 2XPGB 3KG5A 4P9MH 1T2QL 3LKOB 3D3VB 3EJJX 5D7JA 3MRNA 3JVGC 3VWKB 4AQOA 4F57L 3VXTA 5I19L 2GCYA 3GDBA 3FT4A 3UMTA 2EC9T 1CCZA 5I1KH 4Z0XB 43C9B 3MNWA 1BZ7A 1R6VA 1Q9KA 2DYPD 5T5NG 3ARBD 4Q2ZB 5HDBE 1UM4L 3GI9L 3T3PE 3DUHA 3S88H 3LKQA 4NPYA 1MFCH 4L3AA 1MNUH 3V0WL 1TJGL 3NOIA 1VEOA 3HNVL 4ORGB 2JKXA 1I7UA 3TGXA 4HGWA 4NZDA 3ARBB 3FT2B 3BN9D 3BQUB 3U79A 5MENA 1A6ZB 4NC0B 2IWGA 3TBVB 3BRDA 3L3JB 4KTEH 4U6HB 3EO9H 4BUHA 4WFEE 3JZ7A 2W65A 2IADA 4IRZH 1MRFH 3QDGE 4Y7MA 3B9AA 5J3HC 4Y8AA 3PHOB 2BNUB 1ZGLP 2AXGA 3MRCB 2FIKA 1MRDL 1MI5B 3L3HB 3KPLB 3RTQB 5IROA 2ZNXA 1BVKB 4QRQA 5GGQL 1B2WH 1FNFA 4OFIA 1K8DA 1D9KD 2E27H 1N7MH 4H8WL 1CT8A 1CFQA 2R1YB 4FRWA 2QQQA 3OF6A 3S35L 3BN9C 3MLZL 2R69L 2H2PD 3CUPA 4V2CB 4BSWA 3U0PA 2DWDA 4U7SA 1OL0A 4N0YL 2NNAB 4MS8D 2NXZC 5E2VH 2JCCB 2OK0H 4ZYKB 2AJUH 4LNVA 1ZS8B 4GAGH 3U48A 2JF1A 1G6VK 3L1OH 1X5HA 3A6BL 4NQED 5M7QA 3HRZA 1KB5A 1QSFA 2VL4A 5ABDE 5GGRA 1I9JH 1PLGH 1GGUA 1JV5A 4LPUA 4NP4L 3X3GL 2BJML 1PX4A 3MRBB 2BY2A 3QDGA 4J3UA 1PD6A 3VG9C 3MJ6A 5FM4A 1MEXH 3GJFB 5LQBH 5D93B 1YEGL 3DECA 2PKDA 2OXHA 2FBJH 4Q9QL 4OLWL 3TV3H 2VLJE 3RVXD 2AK1L 3ZSSA 4ODWA 4NT6B 2HN7A 4HT1H 3BJ91 1MWAH 1T3FA 1F6AB 1LD9A 3U7YH 3ZYOA 3SKUD 4NRZB 1BX2B 4O02L 2BVOA 3LKSB 2A6IB 2R1WB 4G3YL 4MXQC 1H3XA 2AXHA 3C8KB 1EJOH 1I3RA 4X99B 2ZOKA 4CW1A 1JYNA 3EO1B 4BQ9A 4G6JH 1HKLL 4PY8J 5JW3L 2UUDH 1DFBL 1DBJL 5F89B 3MGOA 3MUJA 5IW6A 2EDJA 2GFBB 5IB5B 1I8LC 1HDMB 3QEQB 1HNGA 4CNIB 1N6UA 3I85A 4PRPE 1YEHH 4A6YH 1NGPH 4Z5RA 3T8XA 4G8EB 1ADQH 5JHDA 4LLYA 1YZZA 2FH6A 4JEGB 4HIEB 1QFWI 4PJFE 2YRLA 4DCQA 1BEYL 1CFQB 2R1YA 4YBLC 3RGVA 3EYSL 3FQUB 1HHKB 3H0TB 4MCYA 5FAAA 3QNZA 4GW5B 4DWHA 3Q6GL 4Z7VF 1X5FA 4N5EC 1ZSDB 2E27L 3WE6A 1SY6A 1D5ZA 1MHHA 1BQLH 1B0GA 2PTUA 5CJQH 3D39B 1UCBH 2GTZA 4X80H 2NY1B 3HG1B 3KPOB 3NIGF 4NJAL 5JDSB 3PP4H 1PBYA 3RDTC 3QZWG 5EB9A 1VSCA 2IADB 3W82A 5FM5M 1NSNH 4HD9A 1ZLSH 4IIQA 4QHMA 1PSKL 3VDCA 3WXVL 3GSRA 1YC8A 1FYTE 1LQSR 15C8L 2LE9A 4N90E 3BHBA 2FEEL 1ETZB 2AJXH 4CU8A 3QH3A 5KTEH 4ORGA 5AG9A 4R4BB 1GHFL 4GAYB 4KK5C 4M1DL 2V17H 3UJIL 3BQUC 3FB6A 4AM0B 4N5ED 5CJQL 1KTDA 2F9BT 5EBLB 3NABL 3I6KA 4GAYA 3G9VA 5GGVH 1I3VA 5IMLB 4L8SC 4V2BA 4P9HC 1BZ7B 1R3IH 2DQCL 4KRPB 1N0XH 5E8EB 2AJ3A 1AXTL 1JZ4A 3ETBF 1RUAH 3C5JB 4BFEA 1JZ5A 3ARGA 1P1ZA 4PR5A 2GTZB 4PV8B 5E8DL 1D5ZB 5DZNA 3O4LB 3OAYK 4FQLH 3ZYJA 3R1GL 4O9HH 4WHDA 2XRAH 1VB9A 1AGEA 3DX8B 2A9MH 4Y5VC 5DUBB 2HFEB 3NZHH 2GJ6E 4LCWE 3DRQB 5B4MD 4ZDHB 1U0QA 1L4IA 5IB4B 4JRYE 4OM1H 1EJOL 1KELL 2JJVA 3IFLL 1X44A 2BNRA 4H1LH 4JM2D 4WHTB 5HD8C 4BZ1L 3QUXA 2PW2B 3MCLH 4BH8A 2VDNL 3DXAA 4O2EB 3RQ3A 2FHFA 2J88H 2L4OA 4L8SB 1I9RH 2J2ZA 4RA3A 5SWSB 1FO0B 4H5SB 1FH5L 4W4NA 3SJVE 3DRQA 4Z7UA 1YN7B 1CGSL 3CCHB 1TZIA 2C4XA 1P4LA 3IJHA 4PUBL 1NFDB 2CJUL 1KFAL 5HBBA 3TESA 3P4MB 5E08L 5HVFB 4XPGL 4BFGA 2HRPL 4NUGH 3JWOC 3BE1L 5CD5C 4XH2A 2MWCA 2B20A 3CXDL 2F53E 5DQ9A 4PJIB 5BV7H 2ARWA 4P5KA 3D0VB 5HHQB 4F8QA 3AREA 5FA3B 1HINL 3MA7A 2FEEI 2V5TA 3MLVH 3VXRA 3G6JE 4PJBE 3MRBA 3QDGB 4G6KH 5TGBA 4ODHH 1KEMH 1ZT4A 5C0CD 2RJMA 1WAAE 4ORZC 5ICYB 3EFFA 4NFCA 2XOTA 4P99A 4Y5XA 4MD5A 3CFEB 4S0SD 1K5NA 5MERA 3ARVA 3OKNA 4MXVE 1ZHNB 4Y4HC 4RDQG 3CZFB 1GOHA 4XGZA 3GBML 2E7HA 4WTWA 4Y5YC 3IDNB 3Q5OA 4M7LT 3LRSB 2H2SD 4GMSL 4F7EB 1IAII 3GMNB 2VLKE 3UJTL 3C08L 4NQVA 2EDHA 3DYMA 3PWPB 1YEEL 1BLNA 3WKNA 1L6XA 4DK3A 3SDXF 2O93L 4TRPH 3RY6C 2GK2A 3KXFB 1UM6L 1NC2A 1MI5A 4U6VH 4QRPB 2O5XL 1ZLWK 1MOEA 4DUWA 1FL5B 4FOMA 1CD9B 2CR3A 3ZL4H 2ICWB 2ATPB 4Y4HD 3RU8H 3FO1B 5CBEB 2BVUA 1EFXA 4JN1H 4P46B 1XZ0A 3G08A 3OPZL 2ZCLL 4S1RH 2YMXL 4LPXA 3WNKA 4KKAD 1TVBA 1JZ3A 4JKWA 1JPST 1BD2A 1JGEA 3MZGB 1A3RH 4U0QB 1WSST 3CXHK 1YEJH 4ETQB 5BW7C 2NMSA 5EFIA 1JWSA 1UH2A 3U7WH 1I3RB 3SBWA 4AJ0A 5L0QB 2ITDA 3U83A 1JGVL 3WNMA 2GJ6D 5GS3A 2HRPH 4K7FA 4NHCH 4YR6A 2YN5A 1L7TH 4JFZL 5F88B 2V2XB 1AKJA 3SKJH 2XPGA 1LO4L 4JR9L 4KKAC 2WBWB 5KAQG 2DLTA 5DURD 1CDCA 3MLYH 3R0NA 4P4KB 3MZTA 4H88H 2PW2A 4C56E 3ZDYF 1HWHB 3VXUE 3O2DL 2F8VA 3L5WA 4ELMF 4HC1L 2J4WH 4QY8A 2IG2H 4XCFL 3SDXB 5D1ZB 1MLBA 1YEIL 5D1ZC 3T2OA 4GO6B 1ZMYA 4I3GA 4K23H 1ZT7A 5DJ8B 4K9EH 4J1UB 4AZ8A 2XZQL 4QXGL 1EO7A 1TJHH 1AGCA 1ORQB 5E7BA 2GKIA 4TUJB 3G5VB 4HIHA 4JN1L 1RZKH 4HPOL 3I02B 3RY6A 5JHDD 2YMXH 4S1RL 1YYMH 4DGVL 1N4XL 3BDYL 4JFFE 4XI5D 4LHQB 1F4WL 2LV4A 2ESVE 5C1MB 4HEME 5KSBF 4IRSC 1F02I 3DUUA 4KFZC 3AC0A 4OFDA 4XHJC 4NO0A 1SYSB 4I48A 2XFXA 3QYCA 3BZEA 3L3JA 1YUHA 2KQNA 1DBJH 4E41D 2YA1A 3O6KH 3HMXA 2AJVL 1KGCE 5DK2A 3EZJB 4B53A 4JREC 1YUHB 2HVKB 4BFIA 2Y07H 4G5ZL 3QQ4A 5ETUA 1SYSA 5KG9A 5I1GL 4K2UH 3LKQB 4NPYB 5FGRA 1Q72H 1RZ8B 5GZOC 3MUHL 1S9XA 2VLRE 4XI5C 5EC2B 4E0RA 4Q0XL 3BIAX 3PP4L 3LEYH 3V6ZB 2OYPA 4YDJB 2FJHA 4IBLT 4M62H 3UYRH 2XY1A 1WZMA 1BQLL 1KEML 4XHJD 3Q6FB 4Z0XA 4XVSL 3TJHD 2Y5TA 5I71B 4UNVA 3GKZA 4ZS7L 1PAMA 2MQ3A 1X5JA 2AABH 2D0GA 4ZXBC 3UYOD 3JSSA 3MRJA 2EYTA 2DLFL 2WQ8A 4D9QE 3VXUD 2FH8A 2PYEE 5CSBA 1C8PA 1T20B 4D94A 4LCIH 4PRAB 4APQA 2VSDA 3KPMB 1ES0B 1M1SA 3QI9B 1KC5H 1ND0B 2APBA 5DC9B 5I1EH 4XCFH 4CNIA 4UT7H 5HI5D 5C08E 5FYLH 1YEHL 2WBJB 2WANA 1G9MC 5ERWB 3D18A 4YHKL 2VLMD 3ZHLA 1DE4B 1RJZA 5J89A 1HHGA 4P5MA 3OHXA 4ZODA 2E9BA 1F6LL 4N1EA 1NBYB 3BMWA 4K94C 1I9EA 3C60C 4WW2A 4FXGA 1BJMA 3H42L 3HE6A 3HAEG 5DMJB 5H37H 1JGVH 3HE6B 2DI9A 4JDVA 2J6EA 2VQ1B 5FKAA 3MBED 1YEKL 1KXQE 3BPCA 3F8UB 1HK6A 1S9WA 4MA1C 2I9LA 3DVIA 4XRCA 3LN5A 4PRDB 1A9BB 3QUXC 2O5YH 2Y07L 4G5ZH 1YEGH 1KELH 3THML 2R2EA 4C83A 3R1GH 4FTVE 3MV9A 3QDAA 5E8DH 3RNQB 5IFHH 1XR8A 4PB9H 2MTPA 4QNPE 5JOFB 3Q1SH 4A2MA 4N0UA 4P57A 5DHVA 5IFAL 2H32A 4OCXH 4PJEE 4ZYKA 2FWOA 5L9DL 5INCB 3H8NA 3P4OB 4KI5F 2AK4E 2W0FA 1LO3L 3VXOB 3V4UH 3EAKA 4ZUWA 2PXYA 5HGBA 4FQQB 3L7EA 1RZGA 5F1IA 3PDDA 1NUGA 3WSQL 1J0IA 2A2QT 2FO4A 1P7KB 2HFEA 5I19H 5KS9B 2IANA 1RZKL 1MAJA 3FO2A 4JVUA 5E00B 4P5TB 3UTTB 5SX4I 4JZOA 5J7CC 3QPQC 2Y06H 2J12B 4HUWB 4LIQE 1FFNA 2AXGB 2D7OA 1CK0H 3BSZH 3TP4A 2C9AA 1TVHB 1J1PL 3ALXA 4LCWA 3MGTB 3ET9F 4NBZB 1YYLH 5F1NA 1WZLA 3QUML 2ZOLA 3PIQB 4HMCA 1HXMB 4C59B 1A7PL 4HH9B 3WKML 4HGWB 3MFFA 5E6ZA 1A7OL 3HN3A 3RPKA 5K33A 2IPKA 5GJTH 4XZUA 3QIWB 4WFFD 3HTLX 4QNPF 3QO1A 5CJBA 2CDEB 3AAZB 2NPLX 1EX0A 4FQ2L 2IPKB 4WENB 2HFTA 4G6KL 3MV8A 1CICC 1XF2A 1H3UA 1Q9KB 4FFVD 5CS7A 3IDIB 3D6GA 4XMPL 3WUWB 1HH6B 1CZ8L 4OD2A 1JF1A 5L9DH 4IIQB 4QHMB 3VH8B 1UM5H 4PJHE 3BEVB 2WUCL 3VGAC 3WJJA 5E1AA 3N0PB 1TLKA 5K9QI 4PRHA 4Z8FL 1TCRA 3FMGH 4WEUD 2BY0A 3GRWL 5SX5K 4LHUA 3HG1A 2E7BA 2BVQB 5E08H 1YPZE 4OD3H 2BOBB 3UO1H 3FTGB 3ZKQD 4GRLD 5DR5L 2QL1A 4XVSH 1QLFA 4XBGA 1NFDA 2IEPA 4YJZL 3T4AB 4DN3L 2G5BB 1G7QB 1HKLH 5JW3H 3N50A 4Z7UB 1MVUA 4E42A 3FOLA 3RI5K 5F1IB 5DHYB 4ELME 5IWLA 1OP9A 1YEKH 3ROLB 1JNNL 1PKQA 5KSVB 4BSJA 1E4KA 5FK9A 4PV9B 3ZDYE 3VXRD 3G5XA 4AY0A 3OKMA 4M1GL 2XWBA 4PJHA 3WS6C 1T04A 1N8ZB 1NEZB 4NZRH 3RZCB 1CU4L 3SOBH 5IB5A 3NMEA 3H6JA 1QBML 3IJSB 3L5HA 2VDQH 1Q8MA 1DUZA 4OCYL 3UTZA 1MVUB 2JB5H 1GZPB 1D7FA 1DBBL 2C4FT 2VAAA 3QWQB 3BPLC 3WFCH 3MRPA 3C08H 2EEAA 4PJFA 4GAGL 2A6IA 2R1WA 3MLWH 5EULV 2BVOB 5FHBL 1OAQH 4JKMA 3EGSB 5HGAB 3G04B 4JO3H 1WAAA 1C7TA 2EEBA 4ODVL 5I71C 1HHJB 1MSPA 3UBXI 3WS3B 5EUOE 1LO5A 4MQXD 1XT5A 5DK0B 4RAVB 4H8WH 5E5MA 2AJ3B 2WMPA 4P5TD 3UTTD 3EDEA 4L4TD 1SMAA 4ZTOL 4NQDD 5DUML 2X1PA 3B2VH 4ODTH 1R3KB 1KACB 3IDXH 5EOQL 2CPCA 2A6DB 2DWEA 3RWCB 3ESVF 1FL5A 3BT2L 4XZUB 3ARPA 3CFKA 3GMRA 4WV1B 1WITA 2PW1B 4Q74A 3PP3K 3PJSA 3QH3B 4PP1D 1SVCP 2IQ9L 1QR1B 4APQB 3FHQA 2P24A 1ZHKA 5ADOL 4HH9A 2WSKA 1ZGLM 4IMLA 3P3YA 3SE3C 4JKKA 4HLJA 3MLYL 5E2TL 1A6WH 1CK0L 2B2XL 3PXHA 2RGSA 4P5TC 2QSQA 4YIQB 5H37G 3U82B 2FECI 2Z35A 3SGKA 1UB5A 1T2XA 2X9XA 1T22B 4C58B 5GS0L 3HNVH 1F4WH 3C5ZB 5DF0A 5C09B 2DM3A 5FUZL 5D7JD 5MERB 3D39D 4Q58C 3P0GB 4YDKH 1MCRA 4J4PD 5DQJA 4Q97A 5KG9B 3QUYC 3IFLH 1QP1A 4WTXA 5J06A 2B39A 5FXCH 1FPTH 2R8SH 2XTJD 3ARBA 5E2WH 2XNAB 4FG6D 2HLFD 3OF6D 1ZLVK 1SVZA 3HUJE 3SO5A 3GNMH 1HCFX 3MJ7B 3PGDA 1J1XL 2V7HB 1AR1D 4U33A 5B38A 1GJIA 3OKLA 3ULVF 1XR9A 1KPVA 2EDNA 4APQD 2MPAH 3TO2B 3U6RA 2R2BA 3MUZ1 5I8EB 3THMH 4G7VH 2QQNL 4XCNB 1DUYB 3QQ9C 4X99A 4UQ3B 4DW2L 3BAEH 1K2DA 4OI8A 4IOSD 4L8DB 1NMBL 3QHZH 5FYJU 1F3RB 3RGHA 3VFPB 5I9QB 2AJYL 3RVWC 5JPNB 1BJ1H 3KYAA 4GFTB 3FT4B 3QUZD 2P49B 1T3FB 4MNHB 1YN7A 3TBSA 5C0JA 5J12C 1GZPA 2VAAB 4CADB 7FABL 4CU6A 4TRPL 5IB3B 3JWOL 4YGVB 4DTGL 3MXWH 1LDPL 2HLFC 3BWAA 1NC4B 1WIPA 4ZO8A 1T80A 4HWNA 5E2TH 4QOKB 4RAHA 3WIHL 4KHTL 4O2EA 3FL7A 1S5IH 3QZWA 4XCEA 5DJCA 4APQC 3KXFD 3AMLA 5KSVA 4LHJB 4WV1C 3PWVA 2CK0H 1Z9OA 5H94A 5C0EB 1UENA 4HIIB 5F7FA 5E4EB 3MRLB 3BDBA 1J18A 2DTML 3I3DA 3LKRB 2DAVA 3QZWB 4FA8A 5TPWL 1NLDL 3ULVD 3QUZC 3KPMA 4TULH 2YSSB 1ZEAH 3CIQA 5GZND 3MA9H 3C6LB 1CI5A 1F2QA 2HJFB 3K80A 4XNUH 1W0VA 5JIKA 4FQHB 4LSRL 3M1BA 3R0MA 4Z18A 5CBAB 2COQA 1OOAA 1JF1B 3T3MF 4HWBA 2AGJL 4PBWD 4L8DA 3MRFA 3S9DB 4Y5VA 4Y19B 3OAZK 4KUCD 3CDFA 4KU1A 4MGXA 5BQ7B 4IRZL 2ZPKH 4MWFB 5ALCL 3DI2B 4A6YL 1I85A 4LMQI 3OKLB 5EUKA 1JI2A 2CJUH 1YEEH 2W0KA 5GZNC 3CFBA 2VJXA 2LFGA 5CJXC 1MHPL 1BVZA 1EXUA 4HX1A 4HW6A 2A73A 1R5IB 4Q9RL 3FT2A 2KPNA 2NY5H 4PRPA 5BRZA 1UWXH 3LD8B 8FABB 2BSSA 5I74B 2NX5B 5DK0A 2VKXA 1H0DA 4UT9H 1IVLA 3TYGH 1NLBH 1QSFD 4OLYH 1H5BB 3FCTA 4HAFA 2E6QA 4U1MB 1RZIA 3AS0A 4JDZB 1IZKA 1U91B 1BOYA 2QSTA 2NY6D 2KKQA 4M1CC 4L3EB 4HFUL 3LV3A 3MNWB 3QAZB 43C9A 1CGVA 4MCYB 4OCSL 1FNGB 3MCKA 2DKSA 4PD4J 3EO0A 1YY8A 4H26A 1D6VH 4WUUA 4NP4H 4Y2DA 1T5XB 1C08A 3OZ9L 2CRIA 2PXYB 2Q8AL 4JG0H 3HLAB 4LPTA 1KJMA 4BZYA 5KSAA 3MLUL 3WMSA 5DD0H 1E28B 2L7JA 4ZNEA 4GUPA 3P0YL 4R2GB 5AEAA 3RX7A 1NGXB 3SE4C 4NRYA 4DAGL 3QWOB 1DQJB 3BEWB 4WV1A 2AW2A 2R0KH 4G7YL 4X6DB 2CO7B 3IXTB 1MH5B 4LSSH 2YC1B 4ZOCA 2FL5A 4UDTA 3BPNB 1CFVL 4M1CD 1UVQA 1P6FA 3EFFB 1J1OL 2BDNH 4UDUB 2EIZB 4JLRB 3NABH 3QHFL 3CK0H 1CWVA 1QLFB 4ZQKA 2IH1A 2J8OA 3IYLW 3KPSD 1A8JH 3WNPA 4KRPD 3SKJL 4JANA 3OXRB 5J13C 4P5KB 2VN7A 4XMLL 4PRIA 1IKNA 1MUJA 4HSQA 1HZHH 1A7PH 5KSUB 1T66C 5J0BA 4MDIA 1PSKH 2N1KA 4Y16A 3O2VL 3IF1B 1XF5A 3WDJA 3N1FC 2HYMA 1X5YA 4KTEL 4PJ8C 1ZANH 1XF2B 4PP2A 4PTUA 1S78D 2UYLA 1NCBL 3MRGB 4EI5A 1T7WA 3MOAH 1QUNA 4KKBC 1ITBB 4ETQA 1HE7A 5EOTB 4U1IA 3OG6B 1MFNA 4LSVH 4KRPC 2NY4B 1YN6B 1F4XH 1HSAB 1NGXA 4QRRE 5EN2B 3G5XB 2NR6C 3T0WA 4XPHH 4WHTA 1AI1L 3O4LE 1S7XA 3WXWL 4HUKB 2R9HC 5DD0L 2EC9U 2F53A 4UV7L 3AS1A 1EO5A 1C1EL 4LCWB 2YZ1A 1TCMA 2G5BA 4QHNA 1IILE 1XGUA 3MCKB 1FNGA 2GJJA 2R29H 1ZLVH 3EYOA 4PJ8D 5K93A 4LASL 3H9SE 5JR1L 4M43L 4KK6D 5HHXH 1S78C 4QHKJ 3CSYB 3QDMD 1EEUA 4N5UA 4NN6C 5SX5H 4I0CC 1FZMA 1RU9H 1CF8H 3PL6D 2BSTB 1AHWB 4NKMA 2IANB 3I6LE 1TETH 3RBGA 1AIFA 1HHHB 5ACMA 1DR9A 2PCPA 4MSWB 4G8GE 1U8IB 4JFOA 1MWAL 4OGYL 3DV6B 3VXOA 5FUCE 3F7YA 1YC7A 1VDGA 1JNNH 2R9HD 5TE7L 5D7IF 2K9UA 5F9OH 1MFBH 5SWZA 4NN5C 4OFYD 1DBMH 3HMXL 4DN3H 1AQDA 2XY2A 5CEXB 1UA6L 1CDGA 5I8OH 4KZDL 2PXYD 2BZDA 4YWGH 2GY5A 5DJYA 2FCBA 4QTHA 4RDQF 5ICYA 4Z7VA 1G7LB 4L4TA 3M17A 5D7IE 3LQAH 3VFTB 5JR1H 4C4KT 4D9RD 1YEFL 3B5GA 4HUUB 3T0DA 2V5RA 2AK4D 3V52H 4NDMA 1OF2B 4MVBC 5IQ9A 5E2VL 3MLTA 4G8GB 4F7PA 4KY1L 3SKOB 5JDSA 4B41A 1A7QL 4OLVH 5CEYA 2VLJD 5E95B 3K4ZA 4MJIB 3MRMA 4KDWA 5FECA 2Q76A 3H3BC 2IH1B 1VGKB 1A6TA 1ZT1A 3SKNB 2QJDA 5DJAA 4XBPB 5A3ID 4LCCA 1FCCA 2NY4C 3PHQA 2KZ1B 5DI8A 3KPSA 2IFFH 4FQQA 3IJSA 5ERWA 4X8XA 1X5KA 2WIIA 4JN2A 4ODXB 2OS7A 5MHSE 4UTAL 1Q72L 1I1AB 1ZK9A 4MVBD 3BFOA 2AI0L 3VE0A 1NMAH 4OT1L 4O4YL 4OM1L 1S7UA 2C3WA 5F7EL 4ODXA 4Z7OF 1IGFL 4TUKL 4MA3B 1TETL 4LRIA 1KJMB 4Y4KC 3X3GH 5D2NB 5JXED 3NCJH 3FQXA 1T5XA 3KNBA 1JHTB 4DTGH 2VZTA 3EBAA 4MNGE 1KPRB 3UCRA 1N5YH 2FJFB 5EOCH 1IC5H 5AYQA 1U41A 3RIAK 1UJ3A 4KK8C 1F8TH 4XRCB 2WNGA 4NKOB 1GOGA 5J12B 3BPCB 4XVUD 1CE6A 5D9SA 2BVQA 2XKNB 1JFQH 1S9XB 3NCBB 3RHWK 1WBZA 4YEEA 5J1SC 3MJ7A 4G9FA 2J6EH 1T6WA 2ATKB 5IFAH 5E5UB 2YA0A 5IOPA 3WNOA 2PYED 3ARYA 4D9LH 1FNSH 1HKFA 4BA8A 4Y4KD 4NZTH 3TIEA 4PJXB 5JXEC 4XPBL 4R2GC 4NO2A 2XFXB 3BZEB 4I0PC 3KYOB 3OXSA 5EU7C 3FFCA 1W72A 4I0PB 4LARL 3GMQB 1WJ3A 1Y6MR 3TH2T 5IVXB 1BJ8A 2HAZA 3QIWA 3BP4A 3MV9E 4R4BA 4QHUB 4YO0B 4M4RA 1ND0A 3MPCA 2HFFA 5MEOA 1Q9WA 1T7ZA 5FM8A 3CX5K 5T3XL 1KUMA 3ARTA 1ROWA 2D03L 3GSRB 5ESVB 3BISA 3F12A 4QWWD 1U8NA 4U1LB 3H2WA 5I1AB 3V5HA 4OKDA 5LJYH 5IR1A 2Y5TB 4ERSL 4UNUA 5ACZB 2EDQA 1MNUL 3V0WH 4JR9H 5AAWA 5GRVK 4HKBA 1FIEA 3BD3A 4I0PD 2D7MA 3KPLA 3LD8C 5CKAA 4RGMB 5FA4A 2EKSA 5T1LB 3QNZB 3O45B 1P7QD 3FQUA 1ORSA 2XACC 5I1KL 2DWEB 2ZUUA 1S7WA 1MCQA 1PZ5B 5IBUG 5AAMA 1FV1B 1EUTA 3C5ZD 2ADJB 1F90H 3CU1A 3FFDB 1AQKL 5ESQA 3BRFA 1BJ1J 4U3HA 4KZDH 4ZAKD 2ZZUT 4Y88A 1DQDH 4L8CB 1CGUA 2I26N 1IAIM 3EIFA 1WBZB 4J7RA 3UYRL 5I73C 2VDLL 2GUOB 1ZEAL 3KPTA 3MV9D 4AENA 5C9KA 3VW3L 3OKDA 5JPNA 5IJVA 4NQCA 5FYKD 2R2EB 2XIDA 4X6DF 4C83B 2C5DC 1FFOA 2XN9A 4PJHF 3U7YL 1QSZA 1QRNB 1OAQL 4YHYC 3CAFA 4NQCB 3MLWL 1P84K 3I02A 3CCHA 4UAOC 4UIMB 4JRXA 1QVOB 5E24E 4K55A 4XX1G 1GGTA 4DOHE 2BXYA 4O51A 4WU5B 4HQQL 1NEZG 4PB0L 4LRNL 2DQUL 1FVCA 1FE8L 5TQ2H 2EH8L 2PUQT 3OKMB 2IBZY 2AEIT 4ZQKB 2P5WE 4I2XE 4P5MB 1II4E 4F58H 3IU3A 5CCKL 2DQFB 5JDJA 1DEDA 4NO5B 4IRSB 1OGAE 1I8IB 2HWZL 4HUVA 2ITCB 5I0DA 5F7UA 2WBJA 1YYML 3KXFE 2OK0L 4FQJL 3T0AA 4JM2F 1FSKB 2IPTH 4LSVL 1G84A 3QI9A 1AD0A 2IGFL 3PV7A 1NAKH 4YPGA 2JCCF 4NBYB 4ODHL 2ADIA 3DVNB 3C6SA 4R9HA 4M03A 4K9EL 3HZVB 3F58L 5ESAB 5GGQH 5I8CB 2EDTA 2R1XB 5TPWH 4F7EA 4JM2B 1K8DB 3O2VH 3RZCD 4M5YL 2I9TA 2VSCA 3CU7A 3G5ZA 3P4NA 5BVJA 1CZ8H 5KAQF 4M8QA 4IM8A 2VTFA 4JGJA 4WFFE 3O2DH 1OTTC 1HCVA 1ZAGA 4PJEF 2UZYB 1QBBA 5GS0C 5KSAD 5TE4L 1ZLWH 1Q0XH 1CGSH 3DMMB 4NO2B 4AK1A 5E99L 4H1LA 3IFPB 2P4AB 4X7FC 4L4JA 1TJGH 1A6WL 2B2XH 5J1AB 3MA7B 1OT1A 3O3AA 5DZOA 4LSSL 3CVHA 5F1NB 4D9RE 4G8FB 1AIFB 1HHHA 1NMBH 3QHZL 4PJAF 5HHME 3W11D 3ZT7A 3SDAC 5E8PB 5D5ME 4LPYA 4CN6A 1FZOB 1M7XA 2VE6B 3HAEA 5J8OA 5HHNA 1NC2B 3RJQB 4OF3A 2E7LA 2X5PA 5C0CE 5IMKB 5C6WH 5ITFA 2BVTA 1H3TA 3PXJA 3LOWA 4JM2A 1YNKH 1HHKA 4YQXH 5KSAC 4JQXA 1DVFD 2E7CA 4WGVB 5JIIA 3I9GL 2F53B 5IFJB 3HZVA 1RHFA 4X9HA 4H5SA 2W60A 1MHCB 2ADFL 4F7CB 4HIEA 2P43B 3VXQA 1NANH 1IEAA 2M2DA 3TO4B 4EVNB 1LP9F 1KTKE 5KS9E 2YSSA 2ICEA 2H32B 4XPHL 2FZ3B 3JUYA 1KNOA 2CUHA 3W11C 1AXTH 3ZL4L 5BVPL 3V0AC 5ITBH 4MDJB 2BRRL 2D2OA 2Y4SA 5EBWB 2C4FU 3OMZA 2UYLB 3ZTJH 2YD7A 2H6PA 4DJMA 4M7KH 4NCC1 3C8KA 5T1MA 1OD7A 2Q76B 4KXZH 3T0EE 1CDIA 2IPUK 2OZ4A 2AI0H 2VDQL 3M07A 4JQIH 1H3GA 2CKNA 1VFMA 5D1QB 3IGAB 4PJIA 4G8GA 3CLFH 2IAND 3GSOA 4MNHA 3TBSB 4JANB 1OF2A 2EXYD 1XGTB 2IMMA 1WT5C 2V6HA 1HH6A 4RGND 1A4KB 3PABB 2VZ1A 3WV0A 4JFQA 4FQPA 3CPLB 3M17B 3IJHB 4S11A 1AXSB 1S7RB 3N1QC 1DUYA 3QIUB 3BI9X 2A6JB 1QNZL 1KPVB 4FS0A 5GXBB 4JRXE 2BP3A 4YDIH 5DR5H 1YNTB 1NLDH 3VDBA 1R3HA 4LLQB 2DQIH 1E4XL 1TVBB 4WUKH 2XN9E 5KW9H 1G7HB 3IDMB 3V52L 1OY3B 4M3KB 2OL3L 4KV5E 4WEBL 3O8XC 5IBTH 3WS6A 5B8CC 1C08B 4MNQE 1CT8B 3ROOA 3QFJD 4AMKH 1B0WA 4RGNC 2CQVA 3TN0A 5D7LA 3BH9B 3P9MB 2R15A 4Y0GA 1C16B 2BSTA 1RV6X 5HY9A 2AK4A 1KG0A 3UTOA 4YHYB 3QA3A 3TCXA 3W9EA 1OD9A 2HRLA 4HFUH 5I1IL 3LN4B 3LPGA 3EYOB 2MCPL 1CU4H 2VDKL 3SOBL 4N0UE 4LKCA 4KJWD 5DJDA 3TWCL 4HZLA 3V5HB 2CRMA 4CKVX 2H9GB 4OBSA 3WO3B 4A6YA 4F7MB 3UP1A 2D9QB 4GW1B 1U3HC 3DOSA 1S7XB 4J3WA 1FLRH 4WJ5A 1U9KA 3O8XD 3IDNA 1ZHKB 2A73B 5EUOB 1KCSH 2FWOB 3VMPA 1QOKA 2AJVH 1YN6A 4LIQL 4Y19D 4YHPA 3S4SA 1G6RH 3NCCB 4AM0A 4MD4B 5C0DA 2AP2A 4WWID 4UNTA 5DK3A 3QULB 2I9TB 1A4KA 1QBAA 2OL3H 3FQWA 5I1CH 5C0ND 4GH7B 1RUMH 3WDHA 1DEEA 3QIWD 3PGFL 2GJZB 4K3HA 3K8MA 3HAEH 3LKOA 1R3IL 2DQCH 1DLHA 4PRIB 2XA8H 3C09B 3C6LA 3QISA 1ZT7B 5BOPA 2X9WA 3O3EA 3NBNA 2PO6D 1KLFA 2CLRA 3UTSA 1RIHH 3CSPA 3T0BA 1I8IA 1QSFB 4Y8DC 4ZSOA 5EIIA 3PWVB 1CD8A 2DLGA 5EO0A 5IK3B 4I9WD 3L6FA 3WD5H 3IXTA 4HC1H 4MA3A 1A1MB 3N1PC 1RK0A 1ZA3A 3C8HA 3OL2A 1TQBC 3WYRA 1S9YA 1PGRB 1KCRL 4TPRL 2NNAA 3MREA 2XG5A 3QUXB 3AVEA 5TJWK 3DXAE 4XXCA 5EO0B 3U4AA 3T08A 3QHTC 1P4BL 2FB4L 5B39A 3TT3L 5CEZD 4FQIH 3TA3B 1MFCL 5DJAB 5F9JB 3MNZA 3DX8A 2J6EL 4RX4D 4RIRB 2GAZB 1K2DB 3FN0H 2OBGA 3NPZB 1BX2A 3V6ZA 1BZ9B 1JWSB 4NWUL 3PHOA 1JWMA 3D5OF 3LB6C 3P30L 4I77H 1T6VN 3BJLA 3O6FD 1IFHL 1IC5L 3ELAT 4IOFC 2D7TH 5ICXB 3U0TB 5TE6H 5BRZB 2VLJB 3CH8A 1KIRA 4U05A 2AABL 2ZWLT 3IDYC 2E3VA 4ZS7H 1A02N 1K85A 1IARB 3OGCB 3MV7A 4P46A 1K8IA 1RUQH 1HOCA 1T1WA 3GBNL 3O4OC 4I4WA 3VI3E 2P5WD 1OHQA 1QRNE 2X40A 4YHPB 3JVGA 3EUUA 2DLEA 4YHMH 4ONFH 4M5ZL 3UROR 4JFFB 3LB6D 3DX7A 4X7CC 3G5ZB 5BVJB 3TCLB 1CQKA 4OLYL 3O6FC 5E99H 2Z91A 5GS1A 3MO1B 2JJSC 5ENWB 4JCLA 1NEUA 2PCPB 1KT2B 1G7JA 3C6SB 1YNLL 3UO1L 4IDJH 4AIOA 4HWUA 1INEH 4QRUB 3ILQC 1I9JL 3GGWB 5F6IC 5JNYB 1GCFA 3OKOB 4LCYA 3RWHB 5IUSA 3ULUE 3X13A 3AROA 3BRGC 1X5GA 5FGBA 5DZLA 5F7LB 4UV7H 1XF3A 1GGIH 2D7QA 3BP4B 3CFEA 2FO4B 5HHOE 1W72B 3UJJH 3T09A 1SBSH 1NGQH 3N9GL 4IRSA 1YDPB 3ESUF 2Q8BL 1NDMA 3AGVA 5EU5A 3T77A 2WP3O 3RUGF 3ZKNC 4E41E 3GJEB 2XWJB 3ARWA 4X0KB 2J7LA 3QEQA 4Y19E 1WFTA 4S0TD 43CAA 3RWIB 1HHJA 1YA5A 4ZPVB 2CH8A 3L9RB 1PYWA 1S7SB 4DUVA 4LHUD 4ODVH 3KYMA 3UTTE 2AQ2A 1YEIH 4PGCB 3LN5B 4NN6B 4HUXB 4QXUH 1VGEL 3TEUA 1OWRM 5C08B 5I6XC 1JHTA 4L4TE 5HYSG 3TO2A 3ZHKA 3VRJA 1HXYB 5GGRY 3FZUC 1XCTA 5AZEL 1MHEB 3BGFC 4L8SA 3RZCA 4LASH 1U8KB 3CH1A 1EAPB 7FABH 3GJFA 4ZTPL 3QUYB 1EH9A 4P23B 4I5BB 4OTXH 5DYOB 4OBRA 3WSQH 2J88L 1KXTB 3VFRA 4TN9A 4R7DA 2BCKA 2OJEA 2DL9A 4Y16D 3GUTA 3ROLA 3BP6A 4OI9A 1S7WB 3QFJE 1PY4A 1SY6L 4OZGB 1P5UA 5DJ6B 2VL5A 4X6BA 4GKZA 1L0YA 5KVGL 1ZS8A 1AGEB 2GK0B 1DBAH 2AEPH 4W6XB 2HJLB 1QZ1A 1TIUA 2Y72A 4ZFOL 4JKPH 3INUH 1B90A 4FQLL 3FZUD 3ILPA 3GSWA 1Q94B 1FC2D 5D2NC 1P1ZB 1IKNC 4HWZA 1U8NB 4JVPA 1CLOL 1QACA 1QLRA 3GKWH 1FPTL 5C0IA 1QPXA 4Y16C 1BVKA 4MA8H 4QRQB 4CN1A 1MFEL 5BXFA 4QRRA 2VE6A 3HAEB 4FQCL 5IIEB 1MIMH 3CFKB 3GMRB 4E0RB 4GBXC 4ISVA 4HIJB 2F5BH 4QTHB 1REIA 4XNQA 1EUUA 2YUWA 3NIFE 5BOZG 2NY2B 3QO1B 5ID1B 2A83B 4M9PA 3RGVC 1MCCA 1JPGB 5F21B 2HLAB 2V5MA 5GHWL 3WHXA 4WVRA 4YHNB 1J8KA 4K8RL 4LLAA 4M6OH 3HR6A 3VJ6B 3VXRB 2HLAA 3D3VE 3VG0L 2A83A 4NO0B 2R0KL 4G7YH 4EN3D 1CG9A 5EG6C 5DEFA 5C0AE 4JRWA 2BNQD 3GHBH 3GBMH 5BS0B 1B0GB 3BX7C 2HTKD 1UQSA 4F2MB 1QSFE 4JG0L 2VZ3A 4KI5D 4LLDA 4XVTH 5CJ8A 1KJ3H 1PKQE 3SDXE 1RMFL 2WWMD 2VR4A 3HMWL 3ARUA 4F15B 3IDXL 2DKMA 2ENYA 2B1HH 1DUZB 1NMCB 2MHAB 4M62L 3RVUD 4TUJA 2B4CH 2BY1A 4G80B 2DQDL 4Q0XH 4NUJB 3OV6A 4N0RA 1S7UB 4PRNB 4YPGB 4Z5RB 4MQTB 1VPOH 3CFDB 1QFHA 4N9OB 3RU8L 1LO3H 4LVHB 2I24N 1CXHA 1RZ7L 2AVGA 3QJFA 4K2UL 2GK0A 4N0UB 3SDYL 4JN2B 3ZDXE 5IK3A 4L29B 5F8QC 3BZDA 5DJ2A 2HTKC 2UVEA 3H7BB 4ZSOB 3S36X 1AHWC 3KS0J 3P73A 4NO5A 4KI5C 4YHZL 5DMKA 5DJCB 5TQ2L 1D5MB 1MCDA 1CBVH 3R4DA 3G6JF 4PJBF 2ARJA 2EE2A 2EXWC 3I75A 4LMQE 3T65B 1LO2H 2XXMB 3BWAB 4UZGA 2A9NH 1ZGLA 1U8LB 1OTUD 4LFHG 5IB3A 1QVOA 5F88A 2VIRA 5F6HI 5C0JB 4D3CH 3ES6B 2FX9H 4OD2B 4OLWH 2LQRA 3KDMB 4J3XA 2NX5E 3SE8L 2IAMD 3EYFB 5D93C 2BJMH 3O4OB 1J1XH 4CVZB 2L0DA 3VG9B 3C2AH 1VACB 2A77H 2FL5B 1MH5A 4OLVL 4L8CA 4UUJB 2YA2A 3MLVL 3SHSA 2WUCH 3JWDH 4C56A 4L4VA 2DTMH 1IFHH 4XX1E 5HDQH 3T3PF 3CVIL 3LKPB 4QXTB 2PO6A 3BHBB 2RB8A 2OL3B 3M45A 1UACL 4XCCL 5D71L 5F3HA 1G7IB 3BKYH 4Z8FH 3IU4H 3EKCA 3QPXL 4U6TA 1EJ6A 4A6YB 3T2PA 5DUPH 5DQJB 1U42A 4Y4FC 5E8OA 3STZA 3CLEL 4HG4J 2V5SA 4O58L 4XMPH 4KHTH 4YWGL 3DXAD 4OZHB 1RZFH 5DQDH 5IJKC 1N6QH 3LN4A 3V8CA 2IAMC 2EKSB 2PYEB 2CDGB 3RL2B 5F9OL 2Q7NA 4QRUA 3MC0A 3I3EA 4Y2OA 2V17L 5JUEL 3IXAA 4K94H 4MZ3A 5JXAL 1A6VH 5ENWA 2H3NB 4J2XA 2BSSB 2VZOA 5E8NB 4BZ1H 2GSIB 3BKJL 1JMZA 3VXNB 4JY5L 3IDMA 4JO2H 3RVTD 1EFQA 3ZDXF 2GW5A 2HFFB 4FFYL 1G9NL 4Z7UF 3V4VH 5MEOB 4KUCF 3O3BB 4U0RB 1K5NB 1J0JA 1MJ8H 1VACA 5HI3C 1LILA 3ZKSD 3LS4L 1EVTC 2VABA 5JORA 3MV7B 3EO1A 4HBCH 1IRAY 3GI8H 5GPRA 1U8OA 32C2A 1UT9A 3AREB 5FA3A 3V95A 2AV1B 4JFXB 5CBAA 4PRIE 4GG6F 4NT6A 4KROC 2VLLB 4EEEA 2FEDC 3WS3A 2X9YA 3DYPA 4GMTH 2I25N 3RI5F 3FB8A 3NTCH 2Y6SD 2CMRH 5FYJH 1KB5H 2AQ3A 3M8OH 3OXRA 5DD5L 2ARJB 3LS4H 4DQOL 5AUMB 1IAIH