3GBNL

Crystal structure of fab cr6261 in complex with the 1918 h1n1 influenza virus hemagglutinin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
Knots found
sequence length
201
structure length
151
Chain Sequence
VLTQPPSVSAAPGQKVTISCSGSSSNIGNDYVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEANYYCATWDRRPTAYVVFGGGTKLTVLEELQANKATLVCLISDFYGVETTTPSKQSNNKYAASSYLSCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antibody recognition of a highly conserved influenza virus epitope.
pubmed doi rcsb
source organism Influenza a virus (a/brevig mission/1/1918(h1n1))
molecule tags Viral protein/immune system
molecule keywords Hemagglutinin
total genus 25
structure length 151
sequence length 201
other databases KnotProt 2.0: Artifct K +31
ec nomenclature
pdb deposition date 2009-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gbnL01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gbnL02
3N1PC 1I8IB 4MXQD 3HI5L 5GIRA 2A9ML 1AH1A 4PIRF 1AE6L 1GZQA 2NX5B 2YR3A 1X5GA 4Y5VA 5FKPB 1INDH 4QYOA 2R56H 3WFZA 2X89D 3BP4B 5FYJH 1FIEA 4JFXB 4MAYA 1KEML 4PJ5E 2XA3A 1RMFL 5T5NG 1QD0A 4UDUA 4PJBA 1T2XA 3DO7B 2ED8A 4LCYB 1R3LB 4LSSL 2UZIL 4PJCB 4Z7VA 2CKNA 5KSVB 2BVOB 1NH6A 1WIOA 3QUZB 3E8UL 1AY1L 4JFXA 1IFHH 1OAYH 4I3SH 4MAYB 4G6MH 3HG1A 4WY7L 1R6VA 1A9EB 2FEEI 1CLZH 2XKUA 3EO1A 4LCCC 3L3GB 4IBLT 3GSOB 1AR1C 2DQGH 4XP9L 4L4VE 2L0DA 1JYXA 3GSVB 5KSBF 4TPRH 1MH5B 3BZ4B 3UTZA 3WLBA 3FRUA 3TT3H 3BEWB 2VDQH 5EIQA 2AXHA 3SPVA 5TH2A 4Z7WA 4FABH 1ZVHA 3QUMH 4WI2A 1EO8H 3DMMD 3HI5H 5IF0A 3H7BA 3PDOB 4Q7DA 4MA3A 4YK4B 4D9QD 4JJ5A 1CLYL 4HPOL 1T1WB 4EIGB 4G9DA 5CKAA 3R06A 4FTVE 3PNWB 5C0DA 3VFGL 1XR9A 5IEKB 4I2XA 3ES6A 2RGSA 3KPRE 3WNMA 5CZKA 4LQFH 4XAKD 1A1NA 3GSNB 2Z31A 4OKVA 5LVEA 3X13B 1QFWM 3VFNB 4X9FA 3BPCA 4TRPL 3SGJC 4D0BB 3ARPA 1GCFA 4FQHB 4U0RB 3K4ZA 1XGYH 1ZKAA 5E95B 1QBMH 2R39A 1QR1A 3QHZH 2RQ8A 3JBG7 3BKCH 3QQ4B 3ZO0A 2WZPD 1FGNL 1ZSDB 4JG0L 4P2RD 4OZFA 3JV4A 4JFFB 3BPCB 1ORQB 1ED3A 2A6IB 4Y4FB 1EAPB 1RFDH 4ZAKB 43C9B 5I75B 3ULVE 3GM8A 1MCPH 4HC1H 4YDIH 2CDEA 1MCEA 3ARFB 1GC1L 4PPTA 5ID1B 1OTUD 3WHXA 1VEPA 4LCWD 5ELIA 4E41E 3C9NA 2D9QB 3MRDB 2XTJB 3LZFH 2H32A 4M6ML 5JIKA 1IEAB 4X7SL 3LRGA 4NIKB 1FVDB 1AD9B 3MRGB 3X13A 3T0WA 5JW3L 3LS5H 1NCBL 3C9NB 3MRNA 5K93A 3U79A 1ETZB 3DYOA 4P59H 1J0YA 2DF3A 4KK5C 5HHPA 1Q9OB 4ZUTA 3P0VH 3R06B 3TLRA 2IPUG 4YHLL 2JF1A 4OM0L 2EICA 3T0DA 3THML 2R23B 1QFWI 5IW1B 1F3JB 1S9WA 5EUOB 1JVKA 5HYJA 2Q3AA 4YNYB 3GMOA 5C08A 4YHIB 3SCMD 4JPWH 5FHAH 1DE4A 3GSXA 2FJFA 1MCRA 2VE6A 5H94A 4J6RL 3EFFA 3PABB 4N0CD 3U0TA 4G6JH 5EU6A 4JY4A 3FOMB 4GRLA 2G9HA 5E6IB 4BA8A 4XCCL 3OKNA 4TTDD 4M1CC 3JWNC 1F90H 5DTFA 4HK0B 1DVFD 5HYJD 4PUBL 2RAMA 3BN3B 4DKAA 5GGVH 2P46B 3I6LD 5EOCL 5B3JE 5C0AD 2R4SH 2M1KA 4TUOA 4JO4H 3QDMB 4K9EC 3JTTA 4JRYE 1FLRH 1B3JA 1NFDF 4U6TA 4CKVX 3OF6A 3WDIA 2XXCB 3LS5L 3KPQB 5B22A 3RY5A 1ZHNB 2YD7A 5C2BL 4GAJL 1FZMB 2R15A 1WEJL 3T4YA 1SJHA 4XVSL 2XPGB 4XBEL 3D25B 5D6CB 4JM2C 1JL8A 4ELMA 4N8VG 2FX8L 4JLRB 3RY6A 4C56A 3T08A 2GCYB 5KN5A 5FA4A 3DROA 1KCKA 4NBXB 3FZUC 5IOPA 3H9HB 3MRPA 4Y2DB 1MIMH 3WFBL 1KEGL 5FDWB 3TFKC 2G5BA 1F97A 1EFXD 3IKCB 4D9RE 3RY4A 2VQ1A 5IFHL 1OB1B 1QG3A 3UTQA 1WLHA 1QSFE 4XI5D 4DOHB 4DQOL 3BKJL 1DQDH 4MAYC 3W39A 1QBML 1RK0B 1BBDH 1J87A 1TENA 4DVRL 5IVXE 4E0RA 3PP3K 3QUKB 4WUUB 2XY1A 4MLSA 5GQBA 4TOYH 2C3GA 4PJIA 3SDDA 3BJLA 2HLFC 2NXYD 1TMCB 4GAYA 3EGSA 2B4CH 5FGBA 4YHYC 1JF5A 3P77A 2AEPH 4S0TD 4ETYA 1Q1JL 3LIZL 1DTUA 3LN5B 5SV3A 1BVZA 3IJSA 3VXUB 3UZEA 3P4OA 3RWIA 3TA3A 1FG2A 3K81A 2CK2A 4OCSH 3LHPL 4ZOAA 4LK4A 3WN5A 1RUPL 3FO0H 2CJUL 1TNNA 3D3VD 5DR5L 3OF6D 5HI4C 5AG9A 1DLHA 4CVZB 2P44B 4HFUH 3U36B 3UYRH 4O4YH 2OMNA 4GO6B 4YBLC 4PJ7B 4NC0B 5T3XH 2VISB 2BOBA 3P3YA 1DUZB 4JVWA 4P46C 4NUGL 2OXHA 2ID5A 2Q8AL 3VXPB 3HS0A 3U36A 2HT3C 1RZFH 4JZNA 4K07A 2NY4D 1XF4B 1JPSL 4JKMA 3REVB 5E70A 2CPCA 2IPKB 4YUEL 3MLWL 3QUXD 4JDVB 3KNBA 3BOVA 3AUVA 4MX7A 1M7XA 3PWPA 5JIIA 1FSKC 5L0QC 3PP4H 1T6WA 2DI9A 4PJDB 3VA6A 5B4MC 3VFSA 1EEZB 3L5HA 4LQFL 1XF4A 4FP8H 3DJ9A 4YDKL 4ZO7A 3NGBB 4MDIA 5EZJB 2NY0B 3RL2A 5IJKC 3W5NA 3FQNA 4DEPB 3AS1A 4PGBB 2F5AH 2W07A 1Z0NA 4M62H 3S5LB 1V05A 1J9CT 4FMKA 3FFDB 1EAJA 4F57L 1OCWL 1JRHL 5C0EB 5EFIA 4UOJA 1ZS8A 1KB5L 4N0UE 4JZJB 5D1XD 2ZNXA 3PDGA 5EIIB 4RWYL 1M6OA 5MENE 1CGYA 5C0ND 2X4NA 1D5ZA 4IRZH 3INUL 1LEIB 5DFWH 3VXMA 3DX7B 4YDVB 1RD6A 4APQC 1U93B 3V4UH 5AUMA 4M02A 2NZ9C 5ESQA 5FO9A 5HBBA 1TTGA 5D1XB 3EO9H 3ILPB 1I1YB 3Q5YA 4IS6B 4QWWC 3ETBF 3FO2B 4CJ0A 2ZOLA 1CE1L 4XPGH 3UJIH 4AM0A 1H0DB 4U1HB 1I1FB 2PW2A 1IILE 3O6MH 2ENSA 3MXWL 3SDCC 1X5HA 1K5NB 1KCSL 2GAZB 3ILQC 2A6JA 3QWOB 2UZIH 1WFNA 3PWLA 5I18L 4ZUSA 3I50L 4MDJA 4MNGE 4I0KA 1OHQA 1SY6L 3ARGA 1WFOA 2WUBH 3V4PL 2LU3A 5D7LD 4PJGF 5L9DH 5E0QA 3ARBA 4DFHA 4XC3H 5HYQA 3QJHA 3QEQA 1ZLUK 2ATKB 1J10A 1E0OB 5BVJA 3BZEA 1V3MA 4FXLA 3BO8A 3S4SG 1F11B 4TSAL 4U2YA 3OKOB 4YXHL 1TZHA 2IMMA 2P8PB 2VLRD 4LP5A 2DJSA 4WTZG 5C09E 2NW2A 2YK1L 1TCRA 4ONOA 3BDYL 4UDTA 3FONA 4JZOB 2F54A 5FECA 2DDQL 4KZEH 3C5ZB 2XZQL 3GSOA 5DURD 4YHPA 1IGIL 4IMLA 2Z92B 5HD8D 3SDXA 3DROB 4N0YL 2W1NA 2X44D 4M1DH 1QSEA 2DMCA 3VXQB 3QDGA 3QFDA 4YZFE 1ND0A 5E9DE 3ULSB 1SEBA 1PD6A 2XQYG 5IUSA 4NSKA 5JOPE 4P4KB 1U58B 3R0NA 2DTSA 3TJEL 5ADOL 3HUJA 2E7HA 4P57A 4EN3C 1JI2A 4R4FL 3X11B 2HLAA 3ABZA 5EPMA 2Y07H 1D5BB 1JV5B 3RDTD 5CZXC 1VERA 3EJZD 5EA0H 2F74B 4LSRL 1H3WM 2WM0A 1OGAB 3DHMA 5JOFB 1UH2A 3QHFL 3V52L 4JQIL 4HMEA 3MJ9A 3D3VE 5K9KB 2AV7A 5MEOA 2FSEB 3KGRA 2GJ6B 2J8UF 2FLBT 5DRZB 4OCRL 1RZGA 1DL7L 1FAIL 4WY7H 3WEXA 4NQDE 3EHBD 1B2WL 1ZT4B 3V0WH 1MCJA 2YN3A 3RI5F 4QOKA 3VXQA 3ZL4H 1TJIL 2O5YL 1FZJB 4LU5L 5TQ0L 3LSOB 3S3JA 3OKEA 1CXHA 2X4QA 5B39A 4ONFL 5GGVY 2EDXA 1CFQA 2VXQL 2WWKO 4R2GB 3PIQA 5ICZB 4FABL 3EYVB 5D71L 5IK3B 4YXLL 1KCVH 1YY9D 5B8CC 3INUH 4H26A 1Q9LB 2BMKA 2W0FB 1BLNB 2H32H 1QFHA 2BERA 1OP9A 4LLWA 2DL9A 3ILPA 1N26A 2FHCA 1A1OA 3RWFB 2F5BH 4LLUB 4HK3J 1XF5B 3CVIH 3ZE0F 4N0CC 4QHNB 2JJWA 4M3KB 2W60A 5JHLL 1J8HD 1U8HB 3BZ4A 5GJSL 3EOYG 3O2DL 2VLJA 1IGCH 2GT9B 1HQRA 4PJFF 2F53E 5GIRB 5KSBE 3P4NA 1FRGL 3QQ9C 3CUPA 5ERWB 5A2FA 5HGDB 1QA9B 1T0NB 4H20L 1EEUA 5JUEL 3UROR 5C7XH 3IETB 2EDBA 4DKFL 5JPNA 3W11C 5TPWL 4TYUA 4X6CB 2IG2H 3RVXD 3OKMB 1F58H 1Z9LA 3ARBD 5MERB 4ZXBC 1OSZB 5ETUA 4ENEC 2OL3B 3CVHA 1QRNE 4PFEA 2BOBB 3QT2A 5BW7C 1MJJB 4F9PC 5F9JB 4PV9B 2LE9A 1P7KA 2X70A 5CIPB 4LRIA 3BWAB 4EDXB 1CQKA 2XQBH 1N6UA 2D7PA 5F89A 4HIHB 5LGHH 2ZCKH 3PF2A 1EUUA 4HWBA 2PYED 4XVJH 3ARSA 1KJ2B 5DDHA 3O41A 4NQEB 5AD0A 1JMXA 1EXUB 1I8LC 4UUJA 1RZJC 2R1XB 1IZKA 5EOTA 4WIQA 2M26A 3CSPA 3IGAA 1OTSC 4PJFB 4TVPE 3VDBA 4OCYL 2V2XA 3TEUA 1TVHA 3O41B 3OJVC 2D31A 2NTFA 3E6FB 3G9AB 1ZLSL 3VMPA 3S9DB 1NBYA 5DO2D 4QGYA 1MVUB 5H35A 4GW1B 5BW7A 2FEEL 1ORSB 1JUFA 3QXWA 3D39D 3L3IA 1H9VA 4CU7A 3BISA 2XZCH 5E99H 3Q6FB 1S7RB 1AGCA 4Y4HB 2CJUH 1M7IB 3LKQB 3WMSA 3U4BH 3VGGA 3RX7A 5L2KD 1JPGA 1YECL 1RIVH 4QRUA 3NABL 5F9OL 5D7IF 4F8QA 3K74B 5I8KL 3TA3C 4AL8L 5T33H 4JDTH 4QT5A 4CVWA 1WBYB 3CX5K 1XR8A 2E9JA 1Q72H 3T8XB 1J8HA 4LOUC 2IQ9L 3V5DB 4UUJB 4GKNB 4LLAA 1HXYB 4F7EA 5IFAL 3D6GA 5I18H 4ZO8A 1J5OL 3VWKD 1MJJA 4NT6B 2PNDA 4LKCA 4WFFD 4HJ0D 5BRZA 3W9EB 3EDKA 1PVHA 4JDVA 4OGZA 3BN9D 4ELME 4HIHA 1A7QH 1OLZA 3PGFH 3C09B 3W0WE 1S9VB 5L88L 1NCDL 3MRCB 3U83A 3NOIA 2JTDA 3SGDH 1CD0A 5F70A 3CLFH 5FV1L 3IXTA 4Y16B 1G7IB 3G5VB 3U9UB 1U8QA 3K3QA 1F3DH 4KU1A 4L4VA 1NC2A 3TO2A 4LVHB 4X7SH 4CVUA 2ZSVA 3LD8C 2HVJB 2QADD 5C0GA 5BS0A 1S7SA 2ZUQB 4PGJA 2DD8L 3HAEG 2LVCA 4L3EB 3HE7B 3EGSB 3T3MF 2CLRB 1FNHA 1AGBB 5JORB 3LY6A 4FNLL 2ZCHH 5CILL 3FHQA 1FIGH 1FNEA 4OTXL 5HHXL 5JNYA 5FYLD 5I66B 3HR5B 4J3SA 4HDIB 3EZ8A 1LK2B 3TFKD 1EJ6A 4UI2A 3VFRA 3ARDD 3PHSA 4PV9A 4WO4A 1QVOA 1HOCB 4PJEF 3WHE1 2GTWB 2K3TA 4PY7A 4L3AA 1CDIA 2H6PA 3VWKB 2PCPB 5GGSB 2EIZB 2E3VA 3HUJB 3S96B 1Y18B 2GJZB 1CFSA 5GRVL 4DOHE 4EVNA 3S34H 2GTZB 2N7AA 4CGTA 1BIIA 3B9KD 2NZ9D 3LKRA 4FQXC 3PL6A 1VEOA 2OR7A 1GAFL 3MV9B 4ZS6C 4KDTA 1YMMB 4HCRA 4RFOL 4KHTH 4J7RA 5KS9B 3QDJA 3EYUL 1AO7A 4H0HB 1P84K 3I3DA 2YD4A 4C4KO 2I9TB 1BQLH 1UA6L 5D71H 5E7BA 1KXTB 2J8OA 4HIJB 4NC1C 1HINH 4XTRD 4J4PA 4ODWB 4EUPA 2XZCL 4L9LC 1U8PA 2VH5H 4GKZB 4QXUL 4CADB 2IANE 1GGCH 1U8IA 3KYOB 4LFHD 2Z93A 1R5WB 3LZFL 1RULL 3QFDB 4OI7A 3T0AA 4CW1A 1BQHA 2FD6L 3D2UB 1T5WB 4OQTA 5EB9A 4KQ3L 4PGCA 5CINH 4LVOC 2YEZB 1HKFA 4J3XA 5IK3A 2ITDA 3QZWA 1SY6H 1HQ4B 2PXYC 3C5ZC 4U1JA 5AAWA 4EQ2A 4WO4B 2BRRH 3N1QC 1P1ZB 2NY7H 4PLOB 1PKOA 2EEAA 2F58L 3BGFC 5LQBH 3QWOA 4BQ8A 2L4OA 1ED3B 3FOLB 2E7LA 1QHOA 1AO7B 3C2AH 1YA5A 1ZTXH 3MCKA 2VAJA 5KSUB 1X44A 1BZQK 4RISL 1CDCA 1DSFH 1VFMA 5CZVH 3SBWA 1L6ZA 1MFDL 3IDXH 5I1HH 1MUJB 4RAVB 1WGOA 3MV8A 3L95B 3RDTC 5L2KE 1X5AA 1F02I 3EFDL 1GVIA 3DV6B 1JRHH 5IMLA 2P48B 4R7DA 3BPLB 1N0LA 1YEEH 5DJCA 7CGTA 5DHVA 2CLVA 2HFEA 3FT4B 2EE3A 3GMPA 4NQCE 4YGVA 1RPQA 1YUHA 4P23A 1ZMYA 5DVNA 1R3LA 2FX9H 2JB5H 5DEFA 1J0IA 2AI0H 1W0WA 3C6LC 4LEOB 1S7UA 5JDJA 4ZS7L 4NUJA 1U3HD 4TVPL 1U3HA 1LEKA 3SN6N 1C1EL 1U8OA 2V7HB 3T0EC 1N5AB 1QLEH 1MCSA 2FGWH 1XR8B 4GBXD 5F7FA 5FGRA 3TWCH 4YX2L 4OSUL 2Z31C 4I3GA 1XGPB 4PJDE 4UDUB 5GRXG 1ZLSH 4J12A 3PUCA 4OF8A 4AK1A 1A7PH 1FG9C 2DWEA 4Z5RA 4OZIA 3BZFB 3CPLA 5DLML 2XQYK 2KH2B 4MCZB 4ELKA 5JIHA 4M5YL 4KKAC 1NJ9B 5CGYC 3VXSD 3MMEA 4AY0A 5BOZG 4O5LL 5I8OL 4HUXB 4ODTH 1N5YL 4J3UA 4LU5H 5TF1L 1WFUA 5JXEC 2LTQB 1K4CB 4FQ1L 4G6AC 3OSKA 5IESL 2X4RA 3FFDA 3UTSD 3H9SB 3DVIA 2NXZC 2M2DA 3AREA 1K3ZA 3QUYB 4X6DE 4XNYL 2WIIB 4RMSA 4GXUN 5E6ZA 1YEJH 4NYLA 4FTVB 3S37L 3STZB 4XXCA 5I1CH 1CZ8H 1KTLB 3DBXA 3MBEB 1CGXA 3QYCA 3STLA 3FFCE 4KAQL 4Z7UB 4HLZH 3OQ3B 1NCBH 2XG4A 1FZOA 4D8PA 3CX5J 3UP1A 3AU1A 1S5IH 4FQ2H 4HIXL 5D2NA 4IIQB 4ZPVB 5J13B 2B2XH 2HYMA 4NT6A 1LNUA 1DN2A 3NCBB 4ZO6A 1N7ML 5FUOL 2BZDA 1JHTA 4AQ1B 2I60L 3WSQL 4XVUC 5F6IC 4MB4A 2P42B 5CUSL 5E24E 1JRHI 2AEWA 4K7FB 4KRLB 3DPBA 2FJHB 3TIEA 4YQXL 3CFCL 3P0GB 2PTTA 4M43L 4QXGL 4HAGA 4HFUL 5I30L 1F4YH 3ULUD 2WBJA 5L88H 3DV4B 2V9RA 2A83B 3MMEB 2H3NB 3RWGB 4K7FA 1ZLWK 3T2NL 4JRXB 3L6FA 2EE6A 4LDLB 4ZSOE 2ADIB 2WQ8A 4ISVB 5JPNB 5HVGB 1CFVH 3GHEH 4XNZC 1RJYA 2ICEB 4DN4H 5IVZB 3OPZL 1IKNA 4XCFL 2HN7B 2BVUA 1V3LA 3GMMA 1AY1H 3ZE1F 4D94A 3HAEA 1FL3A 4XH2A 4I4WA 2YD5A 1FBIL 1G9MH 2CMRH 3F58H 5I9QC 1RJYB 3WLWC 5I1HL 3GSWB 4JDTL 1NCCH 4HWBH 3IS0X 3E2HB 4EZMA 4PBVC 5DD0L 4UAOB 1K8IB 2V17H 3D0LA 4RGOH 2BJMH 4KC3B 1WT5C 2MPAH 2ZJSH 1MFAL 3NIGE 3TIDA 3R4DA 4EOWH 2NNAA 3S35L 1PYWB 4L4TA 3PP3H 2CRZA 2A83A 3DHJA 1J88A 1L7IH 2GSGA 2RIKA 2YHGA 4RWYH 3KLDA 5JO5B 3VG0L 3HMWL 2AJZA 1V5JA 3OTTA 5EO0A 3L3KB 4YZFF 3UJTL 1DE4B 2MPAL 2Y1VA 5J4MA 4F15B 1NGQH 2VLLB 4XRCA 4QOKB 2GITA 1T20A 3QQ3A 1CE6B 4DN3L 1MJ7L 4OD3L 3BGMB 2F74A 2CH8A 4NO5B 3EKCA 1CLOH 3GMQB 4U0QB 2DN7A 3O11A 3OR6A 1S78D 1VKXA 2R1YA 3VJ6B 3FT2B 4XPBH 5MHSE 3L7EB 15C8H 5ANMA 3MNWA 4G5ZL 5JR1L 2AJYL 5GGSY 4OCRH 4ZXBD 1F4WL 4FQLH 3ZKMD 5HYEA 1MPAL 2FO1A 4QGTA 1P7HL 3RNQA 4UT9L 1OD9A 2BSTA 1OAXH 3HPLB 1YJDC 4ZFOA 4YPGB 3BUYA 5LBSL 1BLNA 3LQAH 2G5BB 3MLRL 3MACH 3QDJD 5I2IB 3QRGL 3T65A 1JN6A 3DUUA 3RIAK 1C08B 5HVFB 1S9WB 5EUOA 4N90E 3NA9H 3KJ6H 32C2B 1JWMA 4B0MM 4LCWB 2LFGA 1FFRA 4X5XA 3DX9B 1FGVL 2FJFB 3DVFA 3UTTA 1I9RH 1RUKL 1QR1B 4X4MA 4MXVF 4PJIF 5GISL 3OKKB 3CVIL 2XI9A 1GL4B 3QRGH 1EZVX 1TJHL 1D9KB 4JFQB 1FV1B 2YD9A 4JFFA 3E3QC 3QHTC 3DXAA 3FO9A 4R8WH 2OJZL 2FR4A 3DX8A 1F6LL 1HILA 1A1NB 1N6VA 2QHRL 4HUWB 5B38G 1GOHA 3O2DA 3LEVL 5GGUB 1SVCP 2XACC 5I1JL 3MBXH 5D5MF 3V5HB 5I74B 4F7TB 2NY6D 3H9SE 3CSBA 5DXWA 1VPOH 1OW0A 5K9JH 3BWAA 4TUOB 3BGAA 4DTGL 2AJVL 5CEYA 1LMKA 3IFPB 4PJEE 4RZCA 3TBVA 3NZ8B 4BH8A 4QTIH 5EOCJ 1MCCA 4P5MA 2J5LC 2PTUA 1F5WA 4BH7B 3VWKC 5F88B 3E3QE 2XQBL 1YN6B 4CJ1A 1NL0H 1KPRB 1YDPB 4ONGH 4AMKL 4ZUVB 4HCRH 2CIIA 1IKFL 4RFNC 2G60L 1UH4A 3GSXB 5DVOA 1J11A 1DEEB 4XP4L 3C5ZD 4PY7B 1T22A 3FRPA 4NQED 3BEWA 3EJYD 3QG6B 1RZKC 3H0TA 4P5KA 2GTZA 4CNIA 4LASL 1B0RA 1EHXA 1QRKA 5J06A 3GO1L 2VXQH 4PGBA 1NAKH 4CRPA 2I60H 1EA9C 5C6TH 2VZ3A 3OB0H 2VN4A 3O11B 3OR6B 2KQMA 4GLRH 4JY6B 4HUKB 1FVDA 1VB9A 5I1GL 2K9UA 3SKJH 4YEFA 4JR9H 4N68A 4PRPD 3V6OA 4LPCA 1H5BC 4XNYH 4F7PA 1ACYH 3RWHB 1CDYA 4I0PC 2R2HA 2W9DH 4MSWB 1CT8B 1IM3B 1WIUA 2MNUA 4QRUB 4LPUA 4WUKH 3HUJF 3RZCA 2MJWA 3DXAD 1F4YL 3PP4L 5AUMB 3QAZC 1KN2L 2GYSA 15C8L 3P9LB 4EQ3A 3WIHL 4U6YA 5D7IE 5C1MB 4IOSD 4OF5A 2VB5A 3SJVB 1IGYA 3C5SB 4WV1C 2XA8H 2YPLE 4UOW1 4NZTH 4PG2A 1R5VA 4R3SB 1E6OL 4V2BA 5A3ID 4OCWH 3DVGA 2GTWA 4LLDA 3LN5A 1N5YH 4DK6A 3JTSB 1S5HB 5DHVH 2FZ3A 5E6ID 5DEGA 2F15A 2H9GB 3RY6C 1PKQB 3Q2CA 5CGMA 4JHZA 3NAAL 4R2GD 2FDBP 4M4RA 2DL2A 1T7WA 2WMPA 1ZGLB 4DZBA 4WUUA 4IS6A 4W6WB 4JGMA 5ISZA 1WC7A 1MCLA 1VENA 2ITCA 2XYCA 4KFZC 1GPOL 2ZUUA 4Q2ZA 4S2SB 3QEUB 4RMWA 5CD3B 5CJBA 3V4VL 1PLGL 3WFHB 3SDAA 1HH6A 1A6UH 2RFXB 4NM8H 4KK8D 1B4JH 3P2TA 2XKSA 5FUCE 4MXVE 4U1SA 1T0PB 1IE5A 3HC0A 2P24B 3WNPA 5C71A 1UFUA 3ZL4L 3RVUC 3D9AH 2XWBB 5E08H 4NOFA 5IW3A 2VQUA 5BVJB 1E4KC 1JN6B 4PLKC 3GSVA 3M17A 5AYUH 3SE4C 3IDMA 3UZVB 1TXKA 1IQWL 3GSRA 4GAFB 1KJ2A 5GPRA 1KELH 1MHHB 2PTTB 4G8IB 4MD4A 4O2FB 3V8OA 3UDWA 3VFTA 4BFEA 5DMGC 2KKQA 1QZ1A 5T3ZE 1DQQA 4RAUB 2W60B 5TF0A 5DHYB 5DRXB 1RK1A 4JZNB 3KWWB 4Y89A 5A16A 3D9AL 1MNUH 5E08L 2V9QA 1UVQB 2ZUSA 3CDGB 2AAVA 1NCWH 4HKBA 5F21B 3PWPB 1YPZB 4FTVA 1X4ZA 1Q0YH 3A6OA 2VYRE 5E2WL 4PREA 5EOQL 1UM6H 2E9BA 1TZGH 2I07A 4Z7QF 4W6YB 3TBYB 4FMFA 3BP6B 4U1MA 5KVDH 3HE6A 3LH2H 5KAQF 2ZZUT 3ARRA 5DI8B 1IL1A 2AK4D 4PJ9A 4PTTA 1U8KA 1D5ZB 1HINL 5HPMA 2J4WL 4HXAH 2R69L 4KY1H 2EDJA 3SKUD 5TE4L 3MLTB 5DVKA 3OG4B 3SDAB 4HKZA 3N85L 3GMOB 4G8GD 4ELMB 1J0ZA 5HHNB 4ZUWB 2QHRH 3DVNA 1OAZL 3N9GH 1NC4B 1LP9A 4DGYL 1G7PB 1XAUA 5FDWA 1FDLL 4P3DA 4XPHH 1U8LB 3ZSTA 3FFCD 5GRVK 4OBRA 3LDBC 4XC1H 1A6ZA 2BRRL 4FQQA 4NWUH 4D9QE 1QFUH 3KJ4C 4MB3A 3IGAB 3BPNB 4ZOEA 3PWNA 3DNKA 1QHPA 3QUZD 3NACL 2Q8AH 4G43A 5D2LE 5CEZH 2I25N 3PJSB 5HYSA 5B39B 5ECJE 1D5IL 3JTSA 5EWIH 5LQBL 2N7BA 5DUMH 1F3DJ 3F7VA 3NCEB 5FM4A 3S34L 4M5ZH 3VWJA 3OKLA 5IR1A 3K2UH 3KPRD 4U1NB 3PE9A 3JTTB 4YDLC 1AGCB 2C3HA 1KGCD 4Z0XA 2EH8L 5AWNH 4YO0A 4FP8L 4PJ9C 3BVNA 5DJ8B 4LSPL 1Q38A 2P5EA 4EI5A 2F53B 4NQTA 1IGFH 3KS0J 1XGPA 2R2CA 4QRPA 3GMPB 4NP4H 3VFMA 4BH8B 5FFLA 3JV6B 4Z7UE 4BQ9A 4C56B 3C6SA 1KCUL 1U92B 4MCZA 2YMXH 3ZHLA 4LPVA 4LASH 3KLHD 1QA9A 2Y5TA 3ARWA 3U0PA 4N5UA 5I1KH 4WI3A 5EU6E 1M71B 2IQAA 2RHEA 4IRJC 4ZNEE 3BDXA 1CICC 1BBJB 2HAZA 4JFED 2BVEA 4JAMB 4XBPA 5HHOE 1NFDE 4FN0A 2J6EH 2IANA 5E5UB 1KBGH 3ULSA 4ODXA 3ULVL 2W59A 4FQCH 2BDNH 4MD5A 3G5ZB 5F7DA 3VXMD 3SDDD 3D85B 1N0XL 4XCEA 3Q3GA 4U1IA 4X7FC 4BQCA 2M8XA 2W9DL 3FN9A 4G7VH 5HGBA 1QTYT 3QA3A 3GGWA 1TCRB 2V6HA 3O2VH 1EAPA 1MJ8L 1I1AC 2X4UB 4LSVL 4PS4L 4K9EL 4NQDB 4XP5L 3WNOA 3H7BB 1LQSR 2GT9A 1M05B 2GJ6A 2GW5A 1F42A 1Z6JT 3BKYH 4LCWE 1AHWA 4R4ND 4UT6L 2P5EB 1BFTA 4DUVA 3MBED 5T5NF 4OLVH 2LAAA 1XCTA 2YUZA 4UIKL 1ZT4A 1AGFA 2VZTA 4Q6IC 1TZGL 3WV0A 2YOCA 4I1NB 4R0LA 4JE4B 5KSAC 1A1OB 5DR5H 3HMWH 3RWFA 5BRZE 1D5BA 1JV5A 5JOEA 5EORH 1XGUB 2YN5A 5KSVA 4UOW0 5SWSE 3ARZA 5TQ2H 5SWSB 3V0VB 2UVEA 3N50A 4GXVH 4AT6A 5D1ZA 3V7AG 5BS0D 2VR4A 3BEVA 1DBJH 2DQJL 4Z6AT 4ZTOL 5LXGL 1CL7L 4LLMA 2W9EL 1XGTA 3LPGA 4UZGA 5FO9B 3W5MA 4XVSH 1NKRA 3CFCH 1IC1A 5M7QA 5SWSA 1LO3H 4D0CB 4EXPX 3GI9H 3MV8D 1LE9A 5EUKA 4E5XA 4PJ8A 2VKXA 3QXDA 5DJXB 1LO4H 3MRQB 2P8LA 3QIBA 4DCQB 2I9TA 5FYKE 4AEHH 4OIIL 3HPJB 1TETL 4IMKA 4U4BA 4PRPA 3S36L 3DSFL 1CCZA 1CFTA 4I0CC 5TDOB 4MMXC 2EC9U 5IMKA 4NO0A 3ZKMC 2JELH 3O9WB 4ODHL 5DJ0A 5CWSA 4GW1A 4D9RD 5FK9B 5ALBH 1HKLL 4G7YL 3GBNH 4KI1A 1WAAF 1A1MA 2OR9L 4PGDB 4LSPH 4XP6H 1QSFD 3VFVA 3W82A 2MCPH 5C8JB 5CJOH 1U2HA 3OXSB 3T0EA 4G8FB 4TSCH 1JNJA 4HS8L 4I0PD 4TUKH 5I19L 1XH3A 4RSVA 4W6XB 2JJTC 1F8TH 1CN4A 2IALA 3KPNB 4N5ED 1NAKL 1RAMA 4PP2A 4KROD 3VG9B 3WO4B 1P7QA 4GRWE 1TQBC 4M1DL 5HHMB 1AO7D 1BGXL 1YMMA 4IHOB 4JN1L 5E8EA 2BSSA 2QHLA 4A6YB 4BFIB 1YNTB 5C3TA 4N9GB 4JDZB 2BNRB 5CKGA 2WW8A 5D1QD 1I8LA 3K4AA 5IBUG 4F9LC 4GAJH 3RUGF 4LOUD 4RGMC 2VIRA 3RPIA 4XB7A 1U2CA 1S7XB 1AQDB 1G9EA 1YEKH 4YHYB 1EX0A 5DD6A 4XC3L 5I2IA 1MREH 3CNKA 1ZLWH 4M1GL 1UQSB 4GOSA 2CKBB 5EO9B 3VJ6A 4EI5B 4PS4H 4G6ML 5HHVL 2VIRB 1HI6B 3GMLB 4NOBA 1P6AB 2P24A 2ERJB 3P0YL 4AEEA 5CHNA 4JFEE 2R69H 4KY1L 5D2NC 3P4OB 4JKLA 2P5WB 3GK8L 3ZT7A 1ZANL 3CU1A 4FQJL 4U1GB 4ZFZB 2IBGA 5JW3H 1J8HB 5F7KC 3TZVC 5IEHB 3FQWB 2FHBA 4LSDA 1VFAA 4JM2B 3L3IB 5GS0D 2AABH 3IU4H 3D48R 2KL6A 4ORGA 1JK8A 2VXTH 4NQSA 4OM0H 1IGYB 2VLRE 3BHBB 2WWKT 4KDTC 1XIWB 5DMGD 5IGXH 1RK0A 5E6YA 4MJ5B 4JY4B 1FFQA 1RUAH 4JRXA 4RDQF 1BFVL 3MYZA 4FXKA 5GJTH 2BSRB 4YWGH 3MRPB 1U95B 4HIXH 3SE8H 1L7TL 5D70H 1BWWA 5J11C 4OFKA 5BRZD 1KEMH 4M7ZC 4M1GH 1E4JA 4YEEA 3VD3A 2EH8H 5AWNL 1H15A 4LPYA 1CXLA 2EDQA 3GMRB 3MV11 4PJ8D 4Z7WF 1KJ2H 1B2WH 3TVMB 1CFNB 1WZMA 3G9VA 4PJAF 3HRPA 1P4BL 5IVXB 4BSVB 1JNHA 4MNQE 3DGGB 5BZDB 4ZNEA 5L8LB 4OLUH 4QOKD 2QQNL 1KTDA 1JFQH 5DQJA 5I17B 3O2WH 2FB4H 4RAUA 3KXFE 5I6XC 1QFUL 1HDMB 3G5YB 1GAFH 5IQ7H 3QH3A 2FX9L 2JB5L 3MRHB 5ILTH 5HGAB 4GAGH 3W2DH 2Z8RA 4HX1A 4Z7VE 3V7MA 1PSKL 3IDMB 2GK0B 4OFYA 5E8OA 2VXTL 3H9SA 4Y1AE 2A6KB 3RDTA 5C0FA 1JTTA 1S7TA 3WNNA 1A7RL 5KJRL 2QQKH 5IQ7L 5BV7H 1KCRL 2WBJC 5IWLC 4OGXL 2ZP0T 4BZ1L 5TDOA 3PGDA 2N1KA 3D2UA 3SCMC 4NGHH 1TJGH 3BE1H 1FE8L 4O2EB 1B4RA 3X14A 2B5IC 1T1YA 4K7PH 2X4RB 4I77H 5I1GH 1CR9L 1RURL 3VFNA 1Q9OA 4WFGD 3WL9A 3FT3B 3RVUD 2DQEH 5DEFB 1ACYL 2X6MA 1MRCL 5C9KA 5ENWB 2P49B 3RVWD 2PXYA 5D7LB 3ZTJH 5I8OH 2AK4E 1YMMD 5CIPH 3HZKA 2DOCA 5D7SL 2VLKB 2AXJA 2R1WB 1TPXC 3L1OL 5D1QB 1U8IB 3KYOA 2QSVA 4A2LA 1TJGL 2NY2B 2XFXA 1OB1A 1UM4L 5EPMB 4Q6IA 4X5WB 1ZGLM 1NUFA 3ULUF 1BQSA 5GSVB 1G6RA 2H2PC 4FZ8H 3RNKB 5F1IB 4AYFA 2EDYA 4JCMA 1SEBB 5DMIH 1NFDA 2HMID 5DWUL 2BY0A 3CSYB 3MUZ1 1NMAH 3T0ED 1BD2A 1EBPA 1S7UB 4P2OD 1KSRA 4Y1AB 3B3IA 4HS8H 4HCRL 3P4LA 1C5BL 4OUUB 1NLDH 4CW1B 4MDIB 3IDJB 5IIEA 3B9VA 3MNZA 1RIVL 1T5XB 2VLKA 1DANT 5EBMB 1HQ4A 1IC5L 3ZKND 2DQTH 3IFNL 2NR6C 2OCFD 2VITA 3UO1L 1AGBA 3QIBD 2VABA 5TFSL 1XGUA 3ARQA 1T7YA 1CFNA 4B5EA 1AHWC 1IT9L 3GRWL 1N0XH 1UH3A 3KPSD 4OZGF 4QCIB 3ELAT 5TGBB 2QBWA 1JZ5A 3DMMC 1F6AA 5ICXB 4P4RB 5E4IA 4QRTA 2VUYA 4OQTL 1NGXA 3HR6A 3RPKA 3HA0A 4OI8A 3DRQB 1RUQL 4PGEB 4JPWL 5D1ZC 3WIHH 3M8OH 2BNQA 2BNQD 3FOLA 4KI5C 2ESVD 4U33A 3S36X 1BFOB 1CXIA 4XP1L 1OP5H 3M1BB 1RJCA 4GG6F 3F6LA 3RKDC 4J8RA 2D7TL 2DQHL 1LILA 1KIQB 1KJ3H 1FQ9C 5DVLA 4UNVA 4HH9B 3UC0L 1XR9B 5DD1L 5IEKA 1RUPH 4KTEH 5JOFA 2VXUH 1KPVA 5E9DB 1MAKA 1A6VH 1A3LL 1B90A 4LHUG 3MGTB 1AI1L 2VDNL 4V1DD 1A6TA 1UJ3B 4F37K 3ZKQD 4WCYH 1S7WA 3MSPA 1JWSA 3TN0A 4XRCB 3U4EA 4Y4HD 1J8HE 5C86A 4KKLD 4M3JA 2HKFL 2PYEE 5MEPB 1AP2B 4OCMC 5FYJE 1IEHA 2NY4C 2WBWB 3SOBH 4N0UB 4NM4H 4V1DB 1L0YA 1BQLL 4H8WH 4FFVC 3VFRB 4CAGA 5TFSH 2GUOA 4GFTB 2EZ0C 2OP4H 3FCTA 3H3KA 2OK0L 3O45A 1CICD 3NABH 1ERNA 1D6EB 5F9OH 2YA2A 4IMLB 2QKIB 3D85D 3EBAA 1I3UA 3Q1SH 4XMPL 4WRLA 4XHJC 3WJLC 1T89A 5T3XD 2YZ8A 1MAMH 1KYOK 3VGAC 3DXAE 4UBDD 4IM8A 3IS1X 2IWGA 1MCIA 5HPOA 3O3DB 4IDJH 1BBDL 3SDDC 1JNNH 2G5RA 1EK3A 4LHUB 3SJVD 3RL1A 1MCFA 1EEZA 2CR6A 3QCTL 3REWA 5BS0E 5SWQB 2WLZA 1GRWA 1HSAA 3RGVD 1ZGLA 5J12B 4MD5B 1K8IA 4HWUA 1UCBL 1MHEA 5IJVA 4DAGH 1CE6A 2PO6B 5GGQL 4GH7B 3VI3F 2XT1B 5JNYB 3QIUD 1JHTB 4P9ML 3NZHH 4QT5B 1KPVB 4Z77B 1KTLA 4PJGE 4WFFE 4OB5L 2P5WE 5EZOH 1HYSC 4LGRB 5BXFA 4ACPA 3PL6D 1JGLL 1FLRL 4OGYL 3HI1A 3HLAB 3W9DB 2FH6A 4M61B 3VRLF 3MNVB 1YQVH 2WQRA 1X5XA 3VXSB 5KVEL 4GG6A 1R5VB 3CLEH 1IEBA 5ISZD 3O4OB 4E0RB 4J1UA 5D7JD 3T2QA 2X1XR 3FFCA 5IV2A 4J2XA 4UIMA 1WJ3A 3DSFH 3V5DA 1N3NA 1P53A 1RVFL 3B9AA 3IETA 1T0MB 4N1HB 1JZ3A 4IDJL 3DYMA 5LJYH 1ZEAL 1Z0MA 1LP9E 3OHXA 4JO2L 4LCYA 4XZUB 3O8XD 5BOPA 4PB0H 3HAEH 5E2VL 4JM2D 1XT5A 3RUGB 4R9HA 5EU6D 3FZUD 4YC2C 4C58B 5ITFA 2XZZA 3TBWB 1HXMB 2EIEA 3BDYH 4FQXA 2NQCA 4YXHH 4JQIH 1NC2D 4DKDC 3V0VA 5DMJB 1A3LH 5E94B 2YKLH 1R3KA 4Y2DA 1BD2D 4RGNC 3G6DH 3G08A 2D03L 1IAOB 3B6SA 1P84J 3LN9A 1QFOA 3P9LA 2Y7QB 4JPKL 3JXAA 1I7RB 4XMKH 3OJ2C 5D72H 5I1CL 3LV3A 1DQLH 3OWEA 2Y06H 4KPHH 2F8OA 2LU4A 1NEZG 3CFKB 4FS0A 4IDLA 5EUKB 2NTFB 3E6FA 4E5XB 2VLJB 1QLFB 2QKIA 3O6LL 5L7XH 4QRTB 4JRXD 2O5XL 1CVSC 3T1FA 3TYFA 4XNXH 3OJMB 3CH1A 1I9IH 1JGVH 4S1QH 5DK2A 4EI5C 1HE7A 3WYRA 3L5WB 2FECI 1YC8A 4WUUE 5FOJA 1QNZL 4NQEA 4HV8A 1I8MA 1YEFL 3EYQD 5HHPB 3EDFA 4NHUA 1IT9H 3L5IA 1HHKB 4PV8B 3SE3C 3B9KA 3QPXH 3GJFK 3G5XB 4QXTA 4NKOA 1JHKH 2HWZH 2JKXA 4Y2OA 4GW4B 5I73C 5L2JB 3MRJB 1G7MA 3SE9H 3K7UA 5ERWA 3IRPX 5ACLA 1AJ7L 5HHOB 3I50H 3MRIA 4P2CG 5ILTL 2D2OA 4K94L 1FZJA 1TITA 3F7QA 1VFUA 2I26N 3L3HA 1NBVL 4K2UL 1RHFA 2EECA 3TNMA 2FEDC 3O4LB 4JFDB 4E41B 3S3PA 5FYKH 1ZHLB 2MFNA 5E5MB 1AI1H 1ZA3B 1MCOL 2APWA 2VDNH 4L8BB 4QRSA 4YHKL 1B0RB 5EU7C 3WE6A 2O61A 2IFGA 5JHDE 4UINL 4WW2F 1YEDB 1ZHNA 4R4FH 3OG6B 5C0AA 2AEQL 2EE9A 2H2PD 2R9HC 4F2MB 3WHXB 1NDMB 4JPIA 5DRNB 4F58L 3PL6B 5E1HB 1UXSB 5DHVB 5C0BE 2OK0H 2FZ3B 2QV2A 3QFJB 5CSZB 5DJAB 2QQLL 1UWGL 1TTFA 4HJGB 1K9TA 4ONHB 4LP4A 4TTGA 2OI9C 5HXMA 4F2MA 1BVKA 3VFMB 4QO1A 3TT1H 3NIGF 5C6PB 4NRXA 4E41A 4I8DA 3FTGA 3H6JA 1AO7E 3HE7A 3T0XA 1UZ6E 4HJGA 4NHCL 4FQ1H 1ND0B 1T1XB 2L7UA 2RBLA 2P7TB 4NN6C 3GBML 1OF2A 4GS7B 2HTLD 1Y6NR 4NRXB 1KOAA 2FNBA 1K4DB 1VADA 4P57B 1FNGA 1TIUA 5C0AB 1T04A 3GJFH 4X99A 7FABL 2IBZY 3CXDH 2DD8H 5JPMB 4ODXB 2DS4A 2ZSVB 5CJ5A 1WZKA 2A6JB 4G9FA 3IDYB 4QRSB 2D3VA 5SWSD 4LRNL 4BKLB 3B3IB 1K6QH 1OPGH 5E8DL 3LEYH 2DDQH 2EXYD 4P3DB 2VSDA 1MWAL 3KPOA 5T5FL 3H0TB 4GRLC 4S1SL 1RK1B 2OTWA 3V6ZB 5F7EL 1PDKA 5I66A 4KUCD 1XZ0B 1T21A 4L4TD 4NBYB 5AZEH 3MOAL 4HMCA 5LWYH 4LKXA 4Z7VF 2YC1B 3QSKB 4J3OC 3MREB 4UDTB 5F9WC 3SE8L 1ZT7B 3VDAA 4Y8DC 4M7KL 1Z9OA 3WS6A 1HHJB 1OARH 2VSCA 3V6FB 3G5YA 2EKSB 3UTSE 1BIIB 3HZVA 1NCTA 4JO2H 3QEQB 2OP4L 1UM5H 1NGZB 1NBZB 5AZEL 1A4KB 4RQQA 1DLFH 2F53A 5KSBA 4XNUL 3WS6C 3TIEB 3UC0H 1FO0H 3VGDA 1FZOB 3CLFL 1WBXB 3C8KB 4UQ2B 5D8JH 1AKJA 4HWZB 5HDBF 2R1XA 1CFSB 3BP6A 4LPXA 2OQJB 3UPRB 2NY3C 2VLJD 3P4MB 5DK0A 3GUTA 3QUKA 3WJLA 3B5GA 1JGDA 1KB5H 2F54D 5FB8A 3IRZA 2ZUXA 2E7MA 4KUZL 3SO3C 4M48L 1S8DA 2VDPH 4YHNB 5DJDA 3PWVB 3HAEB 3T2OA 4KQ4H 3I85A 2AKRB 3GUTB 5D7JB 4U6HB 4WNQB 5HVHB 2Q86A 2O5ZL 1OSZA 5ETUB 1A8JH 2F53D 3PQYB 5EO1A 4B7LA 3VD5A 4CVXB 4OKDA 2AJVH 2CLZB 4L3EA 4JANB 2XRAL 3V0WL 2UWEE 3UJJH 4NKMA 3ZLQC 3BZDA 3BXNA 4WW1B 3WXVH 4R90H 4CU8A 2X70B 35C8H 4H1LG 3S5LA 3ZT6A 5KVGL 2W38A 2DYPB 5F3BA 1JYNA 1YQVL 1MJUL 4P5TA 1S9KC 3H9HA 1JGUL 3VXSA 4OLWL 1NCUA 2IAMD 1XMWA 2C4XA 1MSPA 3AU1B 4GKSB 4WVRA 4G5ZH 5TPWH 5CJXC 4KI5F 4HGMA 3KPPB 5I71B 3EOBA 3QNZA 1IC7H 4H20H 5JUEH 1YNKH 3HRZB 1MCQA 1KIUA 2R29H 5ESAB 4WEBL 1T83A 1MHHA 3ZDZE 3O8XA 1WWWX 1G9NC 4NYLB 1ADQA 1F4HA 2R2EB 4P0DA 3ARBC 3RKDD 4QHKJ 2B0SL 1PKQE 2J2ZA 5E00B 4M03A 2UWEB 2W0KA 4NUJB 1CTOA 4WI5A 3BXNB 3HB3C 4WI7A 5DWUH 2WUCH 1Q9KA 1KIPB 5I8CB 5EO0B 3IDGB 1GGIL 1WWAX 2DQDH 2AJ3B 3VXNB 3MO1A 4IRJD 3RWEB 4ZPVA 2DYPA 4JQXC 1M7DA 4MHHI 2CLVB 1TZIA 4KKLC 1DR9A 4EI6A 3O45B 5CD3A 3FO0L 1FYTE 2NY2D 5C0RH 2D7QA 1LE5B 4MA1B 4A6YH 3MA7A 1EHLH 4BH7A 4HT1L 4FFVD 3FB7A 3U46B 3MBEA 2EDWA 3MC0A 5L2KB 3M45A 5IMKB 3EZJB 2Y9RT 2W0PA 2X4OA 3QUMA 3KPLA 3CC5A 4U1LA 4LNRB 4D8PB 3O6FC 1UCTA 3ALWA 4PP2B 4LHUA 1QRND 3H42H 4MNGA 12E8H 4NQVA 4KJPD 1YY8B 4NPYB 4PP1C 3U48A 4UTAL 1FE8H 4CN4A 1RZGB 2Y25A 3DVGB 1JJUA 3LKNA 4HH9A 4JQXA 2DICA 3QQNA 3NCMA 3T2NH 4OZGE 2H9GA 3EOAB 5A2IH 4KROB 1XGTB 3VXRB 5FO8A 1IZJA 1NLBH 4OM1L 1FNSL 2OSLA 5B21A 1NMBL 4MYWB 3LQZA 3MV8B 1DQML 3QWRD 4LLVB 3QNYB 5C9JB 1JNLL 2Z92A 5D72L 2XWTA 5JQ6L 4Z8FH 4KKNA 5DJ8A 3WUWB 2EDLA 4HJ0C 2UWEF 1T4KB 1HYSD 1WUNT 4JG1H 3WEXB 3RZCB 5F7WC 5IMOA 4XCYA 4X4ME 4GBXB 3X11A 3FONB 3QUYD 5F96H 2PCPA 3TYGH 3LKNB 3MJ8A 4K55A 1N5AA 5CEYB 1WITA 1HZHL 3N0PB 2DLFH 5IT2L 2Z4QB 3VI3E 3QFJD 3U1SL 5JW4N 4O02H 4HEPG 4PB0L 3GSUA 3QB7C 1T22B 4FG6C 3RWDB 1OL0A 4WHDA 4G9FE 4HK0A 1VGKB 3EYVA 3FO2A 2OI9B 4NWTH 1FPTH 1RZFL 4JB9H 4PJHA 1A9BA 3WDJA 3DUHA 4G6JL 4NO2B 1JWMB 3G04A 3WSQH 2YD3A 2GAZA 1CG9A 2UUDK 3VE0A 2C4FU 3VXRD 1BECA 2HVJA 3D87B 5DFVD 5GGRY 3LKPB 1IAIH 3DTXB 5EOQH 1INQA 2AXFB 1H3VA 1PSKH 3MUHL 3D1MC 2CLRA 5F8RC 4L9LA 4ZTPL 1CU4H 1A7NL 3U9UA 1JPTH 2X10A 1H3PL 1ZXQA 3SQOL 4WO4D 5HSFA 4YO0B 3HNTL 3RZCD 4KROC 4YHKH 4U7SA 3MPCA 1ZSDA 3I02A 2QTEA 2NY0D 2ZG1A 4Y4KB 1KCRH 1MIEL 2DTMH 5DUBB 4OF0A 4KZEL 1BM3H 3MLUH 5D4QA 2APFA 4PJAA 3T3ME 5E8NB 4HS6A 3QNXA 4WFHE 2R0WH 1JE6A 3KPTA 4PB9H 4RFOH 2AEIT 1ZOXA 1OCWH 5M94B 1CDBA 3IJYB 4XCYB 3QEGH 4R0LB 2H8PA 1BZ7A 4N8VB 2Y5TB 3WN5C 1MCBA 2GITB 4KKCC 3FB5A 1T80A 4JJ5B 1BOYA 3DX6B 4PJEA 3HUJE 1RIUL 1JPST 2HT4C 2IPTH 5J3HC 2YUXA 5H37H 2WINB 2VZSA 3UMTA 1FJ1B 3PJSA 4W70A 5I73B 5CBAB 3HCVA 2D7MA 1D5IH 5EWIL 5I1LA 4PJ5B 3WO3B 3D5OF 3GB7A 4F80A 1X6NA 1EZVY 3MV7D 4KVCH 2WBJB 4K71B 3H42L 3A6CH 5BV7B 3TJHD 3G6JB 4O51B 3NZ8A 1FYTD 3EO9L 3MRFA 3CD4A 1KLGB 4FFWD 4J4PD 3FQUA 3BVNB 4ZODA 2APBA 5DGRA 4IRSB 3D69B 3NFNB 1KG0B 5E8OB 1HXMA 4GQ9L 2XOTA 2PXYD 5FYKL 2XTLA 4NQUA 1Y6KR 1TCMA 3H3PH 3MV01 3GK8H 3MLZH 3VFPB 1LWRA 3U30B 4X4YA 4OCSL 5KZCD 2FL5B 5KVDL 1XCQB 2BXZA 1J0KA 1GIGH 3MYJB 1NSNL 1VFAB 4JFYA 3U46A 4X7CC 3BD4A 3MQIA 4MJ6B 1AIFB 4NP4L 3UEZA 3SDAD 5IQ9A 1D9KA 4JFQA 3JUZA 3MRRA 3SE4A 1GH7A 1EDQA 4WFED 1FO0B 2CRYA 2CSPA 1QACA 3TO2B 4HZLA 2MHAB 4M1CD 4M6MH 4P99A 3KYNA 3DUSA 1MFBH 1IM9A 2CKBH 4M93C 4BFGA 4JO1H 1JF1B 2F58H 4XHQA 2DQFA 3QXVA 1GSMA 1HDMA 3U7YH 5D7IA 2H3NA 3QRFM 4WWKA 2HFTA 3D18A 4WTWA 3MLXH 4QHUB 1YNTA 5DJZA 2YPVL 4JFDD 3LQZB 1E4XH 5T1KD 1MIML 2L7JA 4HUUA 2I9LB 1WAAA 4NWUL 4F15C 4GKNA 1W8NA 3V6FA 4WGVB 1XIWC 4Z7UA 1DANU 4NKMB 4NZRL 4MJ6A 2EIZA 4JY6A 4ZOCA 5HVWA 4W4OA 2F8XC 1X4XA 4OLVL 5SWZA 1FO0A 1KUMA 3R8BB 1CK0H 3TZVB 1HHGA 4P3CH 4TVPH 1LGVA 4WW2B 4U6XB 2NCMA 3UXFA 4PD4K 4GKSA 3O81A 5GRJH 3LS4H 2BFVH 1OWWA 3HNVH 4PLNC 1A6AB 3IKCA 3U30C 1I8IA 3RX5A 1W72H 4PR5B 4RBPH 2ICWI 2VJXA 1KF9B 2KUTA 5FGCE 3B9EA 1KGCE 3LB6D 3U4AA 4FFYL 3HS0B 2I9LA 1SM3H 3BMVA 5EOCH 1S7QA 3BUTA 4P48A 2NY6C 5I1LB 3BZFA 1CDGA 3CPLB 5F9WB 2AP2A 2DKUA 2P8LB 3FMGH 4S10A 4Z7NE 3PV6B 4KTYA 2Q86B 4AIOA 2OTUB 5F93C 4IRJA 4PJ7A 1NGXB 2A77L 3UPRA 3DTXA 1V3JA 4C4KT 1PQZA 2WWMD 3UJTH 1BQUA 1I4FB 2Y5EA 4BZYA 3KHQA 1LO4L 3FAXA 2BNQB 4KWUA 2NY7L 3QFJA 5CSZA 3B2UC 4PY8I 1OOAA 2I07B 4R26H 4S1QL 4XPBL 3M07A 1SM3L 2KZ1B 1GGBL 4PJXE 5BO1H 4A6YL 5GGTH 3WXWH 1CLOL 4F7PB 3QUYA 1VFOA 4OZIF 3NMEA 4Y19E 3PIQB 5T33L 4LSQL 3HNSH 2APXA 1DQQB 2FYYB 1T7XA 1S5HA 4NCC2 4DZ8B 4TUKL 1GGTA 4HF5L 4RMRA 1ADQH 3KPNA 4K8RH 3BKYL 4Y7MA 4HUNB 5KW9H 5DMIL 4Y5XB 5LAXB 3CXHJ 4G8EB 4UIKH 1NCDH 3HNTH 1UA6H 2NXYB 3AXLA 1G9NH 2X41A 1ONQA 4TQEL 1UWXK 3F6IA 3H7LA 2VXUL 5TGBA 5EU4B 4Q2ZB 3MROA 4BYHA 1ZK9A 3QDHA 5GS1A 2EYTB 1NLBL 5CEZE 2PYEB 2BJML 4NNYB 1WZ1L 3QCVL 5D6DC 1AKJD 2NXZB 5CD5D 1IMHC 1JTPA 3SDXE 1MRFH 3I75A 4LLQA 1E27B 3QDGE 3C5JB 3RJQB 2LTQC 3SGDI 4JM4L 5IB4A 1YEGH 4UT7L 1R3HA 1MJUH 2HTKD 1EIBA 3TH4T 1J86A 1C16A 2AV7B 5ICYB 5HHOA 2NLJB 2JJVA 4YGVB 2EE2A 1BAFL 3HMXL 3T4AB 1DN0A 1IQDB 4WUKL 1P5UA 4APQD 4MCYB 3SDXF 4MNGB 4HDIA 1VPOL 2ZOKB 5F88A 1A7OL 4NJ9L 3U7AA 1QFWL 3ULVH 3NPSC 1QLFA 3ARXA 1M6OB 1P9MA 1ADQL 1KTKE 1IC4L 1N64L 3UTTB 4JZOA 3CCHB 5FECB 2AJZB 2CDEB 4LAQH 3RX8A 3U6RA 5CAYB 2Q7NA 4L8SC 3PQYD 4UQ3A 4WI4A 1UG9A 2Q87A 3UTPD 2X1WL 2WUCL 4DFIA 2OZ4L 3I75B 3CDFA 4PJHF 2DJUA 1KJ3L 3MRQA 2EYSB 4G8EA 1DBAL 5EU3B 3Q6GL 4HX1B 4EXKA 1DUYA 3HB3D 5EFIB 5C0DB 3FQXB 3RGVB 1LEKB 1U3HB 4DGVL 3RDTB 5HI5D 1XF5A 5DJAA 1AQKL 5JHDD 5E8PB 1A0QL 1IGFL 4KVCL 2Q76A 2JJSC 3GSNA 1Q0XL 3SKMB 2IADA 3MR9A 4U1NA 5LKNA 4XHJD 3NA4A 4QXGH 2D4FA 1MFAH 1SYSB 2HFFB 4DKFH 4I9WD 1R3HB 2WV3A 3K2MC 5E8PA 2KQNA 3MNZB 3V6BR 1MCWW 5C09B 4F7EB 4WO4C 3RI5K 1CDHA 1Z9SA 2R0WL 3QO0A 1YN6A 4PTUA 3SE9L 5KVGH 5CEXB 4LHQB 3GI8L 1GGYA 4LPWA 5TF1H 3GHEL 2KDGA 2BSED 2QSCL 3NCJL 4M7KH 5HYIA 1UKSA 4XCEB 3TESA 3ZDYF 4PP1D 4P3WA 5C09D 5K9JL 1WCBB 3QPQD 2A9MH 2VKWA 4ZFOB 3U0PB 4XWOD 2Y36H 1NMBH 4M61A 1E4KA 4M6OL 5EC2B 3V6OE 2D7OA 2DQFB 1WTLA 4IOIB 4LVNC 2GK0A 1CZ8L 3DRTB 4PJXF 1X3DA 2WP3O 3AB0C 5E2WH 1QSED 1RV6X 3LN4A 4BFBD 3O8XB 4JFZL 1TJHH 4GW5B 5T1MA 2BVTA 4ZUSB 1MCNA 4CUCA 1A4JA 3NCYS 5FF6B 2BFVL 2IFFL 4YC2B 4TSBH 3CK0L 1PQZB 2XZQH 3PHOB 3JWOH 1HZHH 4FFWC 5DSCB 3B5HA 1JHLH 3P11H 2GSGB 3AFLA 3CX2A 1UEMA 4K8RD 4DUWA 4G8GB 3C2SA 4X8JA 4I18C 4EI6B 1P4IH 1CGSL 1I3RB 1ZVYA 3JV6A 5BJTA 4YHPB 3KXFA 1UJTA 3LPWA 4RMUA 5DFTA 4Z9KB 4ZYKA 1MCKA 1LK3H 2D0GA 4OAWA 3HI6H 4KMQA 3D39E 2BNUB 2VXSL 4FXGA 1IAII 2ZSWB 3JWOL 4M9PA 3JSSA 2DQEL 3RZWA 3AGVA 2R0ZH 4M6NH 4MJ2A 4WWID 3SDAC 2XRAH 1IQWH 1A2YB 4MNQB 1AE6H 3U7YL 3L7EA 3AMKA 1X7QA 5CP7A 3P4MA 4ERSL 2FD6H 5T3ZH 3CDGA 5HVHC 4PJ7E 2OZ4H 2GSIA 4M6AA 4A2MA 2E6JA 4GRWB 1S9VA 3BWUC 4Y5XC 4KRPD 2ADIA 4ISVA 4KH2A 4D2NA 4PRNB 1QFPA 3AREC 3RVXC 2EEBA 1B9ZA 4HK3N 4GRMB 4TRPH 5DYOA 3KLHC 1EFXA 1QKZL 5JDSA 2XA8L 4Y5VC 1RJZB 5IG7A 2X9XA 5J0BA 1CF8L 1X5YA 1PBYA 1AIFA 3D0VB 4KAQH 4NKIL 3VXPA 3WIFA 3L3KA 1U95A 3PQYE 5IG7B 3TO4C 4RFEB 1TVHB 1I7ZA 3ZE2F 3RWHA 1MJ7H 3W9DA 4L4TB 3VE0B 1UB6A 3NN8A 3C60D 4Q6YA 4DTGH 4GAYB 4FTVD 3DRQA 1RHHA 1NAMA 5C0RL 4NZRH 2BDNL 4NZUL 5DO2C 1AR1D 2VMFA 2Y36L 1VGKA 1I9JL 4WWKD 2Z35B 3DX6A 3FQWA 5C07D 4MWFA 2DI8A 3W0WD 3SKOB 4YDJA 3AS2A 3KPSE 1XCQA 1X9QA 5E8NA 5LG1A 5HY9B 3ROLB 4HPYH 2RFXA 5E2VH 4WW2C 1JWSB 3TN0B 1U8OB 4MS8C 1IVLA 3ECBA 5IB2A 3CXDL 3CFJB 4HUUB 4FFZL 3T77B 4ZS7H 5I0ZA 5JQ6H 4WCYL 4KV5E 1GZPA 1W72A 4RQQB 1YZZA 3S37X 5ID1A 5ESVB 4I5BA 2MCG1 3VA2C 5LGKA 1EBAA 4HFWA 4P4RA 3WXVL 4B53A 5KOMC 1NMCC 4X5WA 1NJ9A 3LHPH 2V5RA 2X1QA 4JFHE 1OSPH 4JRYB 4LSUH 1MELA 3QDMA 2V5MA 4UQ3B 3QULB 2H1PL 4F7MB 2IGFH 4OZFB 2MWCA 3HZMB 3BEVB 3KHOA 3MJ9L 1BF2A 2ENYA 1NEZA 1RJLA 4Z78A 1MF2H 4NO3A 1RY7B 4UNTA 3F7RA 3VD4A 4EUPH 2G9HB 3CDYA 5E6IA 4AEHL 4WDIA 1IC7L 3DGCR 4FHBD 4NNXA 2A1WH 1RZKH 4QRRD 3RBSA 5T1MB 3C5JA 5E9DA 2BX5A 4OUUA 5T3ZD 3FRPG 2HTLC 1HHKA 5GXBB 4EN3A 4I13B 3KYKH 5J1AA 1KIRB 3O4LA 1U36A 4GQPH 3KDMA 3GIVA 4X0KA 2YWZA 2HKHH 3U0TB 1INEH 2OR8A 2YWYA 2C1PB 3ARDC 3QDGB 4Q9CA 4N5EC 2HTKC 2HLFD 2NXYC 3IT8D 1MFEH 3BP7B 4W81A 1M71A 3OKDB 4UB0H 3IU3B 1F8TL 4GG8B 1DEDA 3BH8A 5FYJU 5KSAB 5IKCB 4ODVH 1WZ1H 5J6HA 1I7RA 2G75A 2IH3B 5D7KD 3LQMA 5FM8A 5FOBB 4X98A 3BI9X 1P9MC 1K5NA 4JN2A 4MA8L 2R8SL 1CYGA 1Q1JH 1EEYA 3KJ6L 2VABB 1TVDA 4RNRB 2H26B 2G2RB 1T3FB 4S1SH 3ZKXB 3B2VH 3A6BL 2H2SD 4KJYA 2EC8A 3EDDA 3QH3B 1MF2L 3U2SB 3L5WA 5BVPH 4UTAH 1KLUA 1RIHL 1U91A 3GI9L 1QO3A 5D2LB 4MJID 4XMPH 4AM0B 1A0QH 5CMAA 1J18A 2I5YL 2YUWA 3ME0A 4YR6B 2MOVA 3CVHL 1DVFC 4J6RH 4LCIL 3ULUH 1BFOA 1T4KA 1M7IA 3LKQA 5K9OB 2W65A 3AY4A 3X12B 1OP5K 1LO2L 1L6XA 4XMLH 3SGKA 5I16A 4G6FD 5T1LB 3GJFA 3TZVD 4RZCB 3TBVB 5KSUA 4I3RL 3OKOA 5CLTA 1UM6L 2Z4QA 3EDJA 2KPNA 1J1XL 1A7RH 4P9MH 3EFDH 1KV3A 3LQAL 3MLRH 3O3BB 3T4AA 4U6XA 3S35X 3MTRA 2DWDA 1N59B 3GBMH 3VXUA 1BJ1J 4JQVA 3TVMC 4HIJA 3HKFA 4S11A 4PJ9B 2X9WA 4XI5C 3IDJA 3QNZB 4QHLB 4X9IA 3S3SA 1BREA 4YDLB 3FQRB 4KZDL 3FJTA 4PV8A 1WWCA 1OQOA 3MLTA 4L4VB 4OD3H 4PJBB 4C54A 1R24A 2J3SA 1RZIA 4PJ8C 5GJSH 4CMHB 2HH0H 3HMXA 1RVFH 3OX8B 5D5MB 4OCXH 3OXRA 3WUWA 4FA8A 1U93A 4LHUD 4AIZA 3P73A 1NMCB 1BJMA 4GBXC 4JRXE 4TUJB 2ED9A 3LDBB 2BRQA 3ZDZF 2QJDA 5DC9B 4HKXA 5JIPA 1ZHKB 3KPSB 2NY3B 5J1SC 5FUCC 1E28B 2MMXA 4OV5B 5IHUH 3QEQD 3V5KA 3GSWA 5IQ9B 3K1KC 4KKAD 4M8QA 3GEWB 2Y6SC 5SX5H 4EDWH 5FA3B 2GKIA 4JZJC 5GGSA 3QIWA 1URLA 5GGRB 3TBSA 5JW5A 2Q8BH 2IFFH 4U05A 2ZKHH 4HLZG 1CS6A 4HZLB 3QJFB 4GXUM 5D2NB 3BT2H 2V2XB 2Z8SA 3CU7A 3KNBB 3PWVA 1N2RA 4PJBE 1MFEL 1ODAA 2DWDB 3IDIB 4JO4L 5HDLA 1MFDH 4BSWA 3DO3A 1S7WB 5E1AB 4KRNA 1OGTB 2DQDL 5I15L 4XAKE 5D8JL 4B41A 4M8VA 5DK0B 1R0AL 1VCAA 3WD5L 5DQDL 5DJZB 3DECA 4LBEB 5IW6A 1TLKA 3MA7B 3DRTA 5EIVA 5MERA 1JGVL 4XNZB 5IM7B 2V2TA 3NTCL 1NSNH 3O6FD 3HI6L 4KK9D 3TM6A 3FCTB 1QNZH 4JO3H 2OL3H 2NMSA 3LEYL 3G08B 1YPZE 3TT1L 4DCQA 3ET9F 5CZXD 5BQ7A 2BOCB 2CO7B 1J05A 5F44A 2FIRT 3RWCB 5ADOH 1TQBB 2W0LA 4NKQB 3ULVD 1OAYL 5JW5B 1ZHBA 2VC2L 2YSSA 5ALCH 1C5DB 2IG2L 4HGWA 5I8KH 2EDNA 2FATH 2XICA 1A47A 4LIQE 3O0RH 2BVOA 3RWGA 3L5XL 1CIUA 3GJEB 3UJIL 4H1LH 1SBSH 3U7WH 5DTFB 3ZSSA 3E6HB 4X6FA 1KIQA 4HH8A 1EEYB 1S7VB 1MIEH 2HRPL 3EOBB 4CNIB 1NGWA 3RBGA 4APQA 1EGJA 2IJ0C 1MI5B 1VSCA 3SQOH 1MWAH 1I7TB 1ZANH 5EZIH 4N0RA 3QUYC 4WEBH 5BQ7B 3P11L 4HWEL 1D5XB 1SBSL 3QCUH 5EU3A 1Q0YL 1P7QB 2AS5M 1S8DB 2HFGL 3S88L 4XAWL 3OX8A 2X09A 5D5MA 3MGOB 3BZEB 2B2XL 3HZYB 4WHTB 5CJOL 4FG6D 3K4DA 3MUY1 3KLAB 5K9QI 1CDUA 4P5MB 2X7LB 4K8RC 3MZGB 3NFSL 1MHPL 1BIHA 4PY8J 4OGYH 3RWDA 3L9RB 3GRWA 3O6KH 1JZ4A 3DMMB 2V7HA 4M9OA 3R8QA 2PKDA 4X7TB 1NC4D 4XVTH 2IPUK 3WUZA 1B4JL 5DFVC 5FV2A 4RISH 2QQLH 2C3VB 4MD0B 4PJ8B 4CMHC 5T1KA 4JHAL 4JVPA 5SWQA 3K46A 5FYLH 1N59A 4FZEH 3OB0K 1AKJB 2VOTA 4EDXA 1BZ7B 3CMGA 4N8VA 4NQDD 3RZCC 4YFEA 2D9CA 4OLZL 2A9NH 2E27L 1BEYL 1QR4A 2FRGP 2VXVH 4XMLL 5DZOA 1PGRB 3TPKA 3OKEB 2B4CL 3N1GC 4EN3D 1J12A 3DX9A 2EIDA 2DB8A 3VXTA 4D0CA 4Y5YC 1MREL 1YNKL 4LCUB 5I19H 5IMOB 5I1DB 2O61B 5BVPL 4XXDB 1C1EH 4C57C 1D9KD 2Y7QA 3PWUA 2OLDA 2DM7A 2ATKA 3P4NB 4TNVF 2YKLL 2I5YH 3IJYA 2DLIA 1IM3A 1N8ZA 3F12B 2KBGA 2HT4D 4KV5F 1BEYH 2W0FA 4IOFD 4DGVH 2V7NB 4OD1H 1T5WA 5F7YC 3MODH 35C8L 1G7MB 3T3PF 4Z8FL 1QSEE 1X5KA 4DZ8A 4H8WL 3GIZH 3RNQB 4UILL 3TO4D 1YJDL 1D5MB 2DM4A 4OFDA 2JB6A 4HG4J 5IBUB 4X99B 5C3LD 1G7QB 3C87A 3PDOA 3SY0A 3ALXA 3CIQA 5C0CB 4X4XB 3LEVH 4XPFH 4PG9B 3CXHK 3GMQA 1CE1H 3TO4B 3IXAA 3LKPA 1D5MA 3C2AL 1QPPA 2P7TA 4NQVB 4MA1C 4WI9A 3RGVC 4X83A 3U9PL 4UTBL 2R0LH 1KBGL 1CXFA 5I74C 4Y4KD 4K3EH 5DA0B 4F8TA 3VXOB 4HG4K 1ZTXL 1G0DA 2VTFA 4OFPA 4YBHA 3C60A 1UB5A 1RUMH 3QIUC 3EAKA 3OAYH 1CG9B 3CFJA 1UM4H 3D0VA 4L3EE 2VL4A 3L3OA 3DUUB 2B0SH 2JLLA 4ODVL 1B88A 5DRNA 1M7DB 5DURB 3MNWB 4LEXH 2NLJA 3V5HA 3NZHL 3RA7H 4LLYB 3FT3A 2YPKB 5SV4A 1BQHB 3CDCA 2EXWC 5LBSH 4GW4A 5L2JA 1KXQE 4AEFA 1MI5E 3K8LA 2ZCKL 5DQ9A 2AGJL 1RURH 3W11D 5ESQB 2VAAA 3V6OC 1A6VL 4PRPE 2VDRH 2DMBA 3QP3A 5MEQA 3T09A 4FQQB 3ZYZA 3R1GL 1GOGA 4OCLC 4KDWA 3R0MA 1LVEA 2X4TA 5DUPH 1H3UA 2XV6B 4HS3B 4WFGE 4MXWH 4PYHA 3ZTNL 4OZIE 4U6VH 5IHZB 3KWWA 2O93L 4CL7A 5C08E 3NCYP 3EJYC 1S7SB 2W91A 4G3YL 5T5FH 1G84A 4R90L 1CFBA 4ODTL 2PO6D 3MBXL 3SKJL 2F8VA 2OXGA 4NNPL 2VDOH 3FN0H 1T2JA 4KJQC 4KZDH 2AV1A 4Z7WB 3HNSL 1RHHB 1BHGA 1YEHL 5DD5H 3GMNB 2OSLB 3ESUF 5I1JH 4OLZH 2NR6D 5IB2B 1NGQL 3L3HB 5GZND 4MJ5A 1YYML 2FB4L 2MQ0A 3MXVL 5HJ3B 3RUGE 1FYTA 3WD5H 2VDKH 4OM1H 4RMVA 3UPAA 4HULB 1AP2A 3RL2B 1FFNB 3AAZB 3LKSA 4QOKE 4U3HA 5IEHA 3QHZL 5L6YL 1SJEA 1C5DA 3TN0C 1H15B 4OV5A 4U1LB 4GQ9H 2FO4B 4XMKL 5D2NE 4F9PA 4H5SA 2LVEA 4HD9A 4EI5D 1Y0LA 2VNCA 3LV3B 1UXWA 5D96B 3RGHA 4XTRC 3KYAA 2ERJC 3UX9B 1QP1A 2J88L 5FGCB 4UNUA 1J0HA 1I1CA 3B2UD 3IDUA 5FKPA 2E6PA 4OZ4A 4TSBL 1Z5LB 3LN4B 3HMXH 2ADJB 3HFMH 5EA0L 5T3XE 2YC1A 4OFIA 5HJ3A 5JR1H 1E4WH 3OMZA 4OBSA 2VZUA 3T0BA 3QR2A 1CFVL 4IMKC 4Y4HC 1A7PL 2GCYA 4YH6A 3GB7B 4AIZB 3BQUA 3ARTA 5FHAL 4U1KA 3ZMRA 1X6LA 5D5ME 4NN5B 2COQA 2DQUL 4OCYH 1JNHB 1NCAL 4O51A 5TE7H 2DQTL 3KPMA 3VFGH 4K3JL 5EZJA 4CBPA 3FKUS 4BZ2L 5DJDB 1H8OA 4OQ1A 5KG9B 3BKMH 4G8GA 4U1KB 3QO0B 4RGNB 3ARYA 1HI6A 3GMLA 5B3JF 3RRQA 5ALCL 2H45A 4V1DE 5IHLB 5D1ZB 3STBA 3OAZK 5J6GA 4LMQE 3RIAF 3FHAA 4M00A 3H2WA 4LSSH 2IAMB 1BD2B 4ZUVA 2YK1H 5EC2A 5IVNA 3O3DA 4PRIA 3TVMD 2FCBA 4YFDB 5IHZA 3TPUB 2BVYA 1Y0LB 1OT2A 5I1EL 5B3NA 2GI7A 1YYLH 3BPOC 4LSTL 2OL3L 3QG7H 1T1ZB 5JXAL 2FWOB 5DRZA 4K7PX 4HMDA 4D9LL 2DQHH 2YRZA 3EOTL 4HXAL 4Z7QE 4UILH 2J8HA 5GRUL 3QCUL 4NQDA 1BF8A 1UWGH 2CR3A 3P77B 3GNML 3B9KC 2Z31D 4NBZB 1RU9H 4PBWD 4X6BB 3KYMA 2YRLA 3O4OC 4GUPA 3BSZH 4RAVA 1LEGA 4JFPB 1MRCH 2CKBL 1EFXB 3UYPA 4YQXH 3IJSB 3PL6C 4P2OA 3WBDA 3D85A 3P0VL 4WU7B 1A4KA 5EH1A 3UTTE 4LSRH 5I30H 5DA4A 3NIFF 5HYFA 2HFEB 4XC1L 3MRLB 1ZV5A 1FFNA 3LVEA 3V4UL 3DMMA 4FZ8L 1GIGL 3O3EB 3X3GH 2HJFB 1BFSA 1TDQA 1F58L 1G7QA 1M05A 1CD9B 1H3PH 1EVUA 1N4XL 2GK2A 2MQ3A 2OS7A 4X5XB 2EYSA 1OF2B 3RVVC 2EYTA 1ZVSB 3LOWA 2UYLA 2ZCLH 1XCTB 1U92A 5D2LF 3T2PA 4K2UH 3MRDA 4D3CH 3AM8A 4BFIA 3KR3L 3QIUB 1FNSH 4NQCD 1ZA6B 1KN4H 3VMOA 1UT9A 3A67H 4LVNB 4NZTL 4M7LT 1YEIH 4HPYL 3MR9B 3S37H 4BM7A 3BIKA 1X5ZA 1MHCB 1IGJA 2ILLA 4QXTB 4ODUB 2E5EA 4X6CF 2ORBL 2QSQA 3QUZA 2ZUWA 3MUJA 3DI2B 1ZT1B 3B2VL 3OKLB 2QQKL 3B9DA 2XN9B 5H8DA 4J8RB 3FT4A 3HPLA 5GS3A 3ZKSD 4P4KA 1MLBA 2ZCHL 4MXQC 5CILH 4NO5A 5IB4B 4AENA 4DGYH 5IIEB 3QWQB 5EG6C 2HLAB 2ADFL 2XN9A 1O7SA 4YHOL 1CICB 1GHFH 2A38A 5DLMH 3O9WA 4OCWL 3BYYA 5IFJA 1LD9A 2YS4A 3C6LD 5E2UH 2MCPL 2IC2A 43C9A 2LU7A 3DVNB 1B6DA 4QXUH 1UB6B 3NN8B 5J6HB 1DDHA 1C7SA 1UCBH 1U3HC 4EDWL 2FH8A 3L9RA 1GGIH 1OAUL 2IAMA 1IAOA 3NBNA 5HYQB 3BHBA 5TDNA 1KACB 4KHTL 1A14H 3WLWD 4TPRL 1KJ2L 3I3EA 3ARFD 4N8CH 1ES0B 3MCKB 4ZMAT 4HUWA 4WFHD 1CTNA 2CXKA 4AQOA 4OGAC 5DD3L 3FRUB 2EDEA 3GSNH 5HI3D 3CH8A 5FHBH 1IRAY 4G42A 4E9LA 3TIDB 1NCWL 1AGDA 3BPOB 3BX7C 3C08L 4EUPG 3IDXL 4LSTH 1RU9L 4ZO9A 2P5EE 3BGMA 1RI8A 2LQRA 1F11A 4OD2B 3DLQR 4MWFB 3BP5A 2IAMC 5I1DA 1HHGB 5E4EB 4KQ3H 5BZDA 3MV7E 1FIGL 1WISA 3FAWA 2KZWA 3C5ZA 5ESVA 4TTDC 1MEXH 3PHQA 2HJKA 3MA9H 4WHTA 4P46A 4Z18A 3QZWG 5L6YH 3ULUE 3QIWD 4ZUWA 2OJEA 3O6LH 2FGZA 5I1IL 4OTXH 5HHXH 1NUNB 3AY4C 3GKWH 3OAZH 4XNQA 1I9EA 2JE8A 3SDYH 4YUEH 4C59B 4S1DC 1BOGB 4LLVA 3DURA 1EPFA 3GFUA 1KXVC 3RHWK 2EIBA 2MKWA 4R6UA 3TPUA 4GT7A 1C8PA 5F1KC 1F90L 5HYSB 5A2JH 3K0WA 3P9MB 4G7VL 3WIIH 2A2QT 2OR9H 5J8OA 4LIQL 1QKZH 5DSCA 1R3KB 1R3IH 3EIFA 3DUSB 1IKFH 2C1OA 3EYUH 3D2UD 1VFBB 2NY2C 1PG7L 4PRAB 4PJXA 1V7ML 3IJHA 3ALPA 4LNVA 4X7TA 2V17L 1UWEH 4UV4H 3LKSB 1YPZF 1OSPL 5DQDH 3GHBH 5D96C 2BVQB 2O26U 2ZSWA 2VQ1B 2AQ2A 4AL8H 5FK9A 4HKXB 3KLAA 5GS2H 3ZZ1A 5F3BB 5J6GB 4O2CB 3WCYA 1PEWA 4D0DA 1NANI 4D9LH 2XTJD 4YDKH 5F6IB 4EIZC 1DBJL 2DQJH 5LWYL 2GFBB 1H3TA 4TULH 4QNPE 4P46B 4GRWF 5CCKH 5DJYB 4NQXA 5SWZB 2AV1B 1A7BA 2R4RH 4YBLB 2VZVA 1AQDA 2X1OA 3NVQA 4XNQB 1J1XH 1QSFA 4PRHA 1U0QA 1UJ3C 1FG2B 2HKHL 1RZ8B 2A73B 4OLXL 5KW9L 2A9NL 2E27H 1PY4A 5HHME 4JG0H 1HXYA 2DJ4A 5EBWB 2PYFA 3F7YA 2FX7L 4P5KB 3O2VL 3BSZL 4MZ2A 3ZYIA 1UWEL 3QCVH 3UTPE 4HLJA 3W81A 3EYOA 5F9DC 5DUBA 2CUMA 2BVQA 4G8FA 5E2TL 1KPUB 4M7ZB 1DLHB 1UADC 2QR0A 3MODL 5DT1H 5E4EC 1GXEA 3D25A 3O4LD 3A6BH 5BXFB 5IB1B 2BNRA 4KK6C 3NFSH 3NH7H 4O2CA 1YJDH 1CLCA 3IFOB 3I6LE 1FRGH 5DDHB 4X5LA 5EORL 5DRWB 5I16B 3GI8H 5CP3A 4ZXBB 5AEAA 3FMGL 1FNLA 2Y07L 4ONHA 3UJJL 1G0XA 3SOBL 1XFPA 3LMJL 4PJ7F 3ZE2E 4HAFA 4IRSA 4ZNCD 2W9LA 1HNGA 5DC0A 1CBVH 4ODSL 3TBTB 1UC6A 3QXAA 1LE9B 4OLYL 5I1IH 4OT1L 4LLYA 4NZDA 4YHOH 5GZNC 3G6JE 1NEZB 1RJLB 4Z78B 1ZT1A 2HT2C 5CHNB 3SKMA 3SHSA 1CGVA 1NMAL 1AXSB 5DD1H 2VXVL 2QQNH 4PJHE 1MLBB 2E7LC 4X6EA 3C6SB 1G7JA 4Z7WE 2CO6B 3QBTB 1UQSA 1QSEB 2FJGB 4NNYA 4GXVL 1MCDA 3MV7B 5I76A 2Q20A 1UM5L 25C8L 3JWDC 4X98B 1BVKB 3IFPA 3RU8H 1YEJL 2WSKA 5C08B 3EDEA 4XVJL 1J1OL 2JK5A 4JFEA 2VWEE 2AQ1A 4ESKA 3BRGC 4O58L 3F7PC 4NRZA 5IROC 2R4SL 1EVTC 1TPXB 2APVA 3OAUL 3QQ4A 1W72L 4LVOB 2IALB 1NDMA 1RFDL 1OP3H 4POUB 3DETD 1CGSH 2VITB 2YZ1A 5DJ6A 4K71C 1K85A 5FO7A 3FB5B 1U8JB 1XZ0A 3FOMA 4GRLB 4WU5B 4MDJB 1NBQA 4XPGL 2DLEA 5B38A 1XF3A 3LAFA 2JCCE 4PRBB 2R1WA 4XX1E 3BE1L 5JPMA 1YEFH 2VLKE 4GW5A 3V0AC 1IGCL 4DN3H 4J4PC 1MVFA 4YHMH 3FB8B 1Q9WA 1FNEB 1MFCL 4O00A 5DJ6B 4NO3B 1RZ7L 3VMNA 2HT3D 3L7FB 1SJXA 3V2AR 4G9FB 2OYPA 4PLKD 1HILB 1CD8A 2O5ZH 2Q76B 1QRNA 1AD9A 3QUXC 1NGYA 3MRGA 1DFBH 5GS1B 4NO0D 5J1TC 1DCLA 1AD0B 1S9YB 2NW2B 1NFDB 1EMTH 2YA0A 3L95A 3SDXB 1U3ZA 4MQXC 1H3XA 5CGTA 4GBXA 3ARBB 1ZGLP 2FBJH 4BSJA 5D1XA 3I6GB 5B8CA 1VESA 4Y4FC 4ZAKC 1OGAE 5HGAA 1Q9KB 5I8CA 1AFVH 4MZ3A 3PXHA 4FQIL 1HEZA 2DTML 1U8KB 1CL7I 5LGHL 5CSGA 2YBRB 1CF8H 4KUCF 2OTPA 2DYPD 3DWTA 1TZIB 3O9WC 1P5VA 1NCCL 4HWBL 5I71C 1EJOH 5FYLE 3T1WA 4PJBF 5ENWA 4JZJA 5E2TH 5BRZB 1DBKL 4RGOL 3O3EA 2ZUVA 5HTSA 5FGSA 4JGUA 4G80A 5INCA 2ICES 2H41A 1A3RH 2D7NA 4WEMB 4DKEL 1CVRA 1ZLVH 3VGHA 5JOPD 4HGWB 3MLXL 3TNNB 1W0WB 4OZGB 2AGJH 3LPFA 1A6ZB 3VXTB 1Q0XH 1C16B 5FYJD 3QXAB 3QIUA 3PWPD 1RIUH 5CINL 4JHBA 4HEME 2EDTA 4JFFE 3NFPB 3VH8B 1I3GL 3MLSL 1WICA 2HVKA 4UV7L 3SGEH 4F58H 4UU9A 5JXEA 5HHNA 5EC1B 2XY2A 5C0GB 3LD8B 4YK4C 3VXRE 3X3GL 1A3RL 3SDCB 5IT2H 1AR2A 4RIRB 5HI3C 1FVCB 2QQQA 4KVNH 3ILQD 1YY9C 4N1EA 1FZKB 1FP5A 1JYVA 1PG7W 1I7TA 3L3GA 2WLYA 3MOBH 3A6CL 4Q6IB 4U6HA 4WNQA 3U7WL 3T77A 4X0KB 3MNVA 4N8CL 1R5IA 4L3ED 4G43B 4ZG1A 1S5IL 4FQ2L 1LK2A 4UV7H 4FQIH 4LQ1A 4DWHA 1EXUA 1F45A 3VI4F 1JZ7A 4KK8C 1HSBA 3QQ9D 1NC4A 3CZFA 2AI0L 4OLUL 3MOBL 4UT7H 1BMGA 4EBQL 4KK9C 4NN5C 4M62L 3GSQB 1U8JA 3MJ8B 5HHOD 2HG5A 2IBZX 4PJDA 4JEGB 1F00I 3SEPA 2IH1B 3EYSL 4P2OB 2EC9T 4QRPB 4BELD 3EOTH 3SO5A 1ZS8B 2EYRA 5F7MC 4Q9QL 5JXAH 1CDJA 1MHPH 1KJVA 1WBZB 1CL7H 4ZDHB 4C83B 3D69A 5C07B 3MRMB 5GRUH 1LEIA 4RGMB 4JY5L 4TN9A 3DV4A 3MLPA 4MHHG 1KT2A 4JFHD 4R4BA 2XIDA 1KIPA 1VHPA 1G7JB 3JWDL 2RCSH 2FHFA 2AEQH 3WIFB 1GOFA 2WK2A 3LMJH 4RIRA 3MRMA 2ESVA 4YIQB 5C0JA 3IDYC 3F65A 2YD1A 1T03H 4P9HH 3RVTC 4G3YH 4OLYH 3MLUL 1PLGH 4K8RL 1N2RB 5JDSB 2ZG2A 4OZHE 4Y5VB 4PB9L 1G9MC 3RWCA 2HRPH 4Z77A 2IH1A 1T7VA 4HSQA 4WV1B 4M6OH 1O5DT 4PJFA 4WHYH 5TE7L 5DT1L 2IPKA 4YPJA 5JW4M 3AREB 1N4XH 3CMOL 1NUDA 1QBLL 4L3CA 1I7UA 1WK0A 3WKMH 2B1AL 4LNRA 3QAZB 2DKSA 3H9SD 2YPLA 4FXGB 3QJFA 4YE4L 2CGRL 3VI4E 3OZ9L 2C1OB 1Q9LA 2BMKB 4FNLH 4ALAL 2JIXD 3G6JA 3VXSE 3U4EB 3VGFA 1A2YA 1A6WH 4MNQA 5EZOL 1JWUB 5CS7A 1PEZA 1OGTA 5AZ2L 4ELMF 2X05A