3GBQA

Solution nmr structure of the grb2 n-terminal sh3 domain complexed with a ten-residue peptide derived from sos direct refinement against noes, j-couplings, and 1h and 13c chemical shifts, minimized average structure
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
57
structure length
57
Chain Sequence
MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Grb2 N-terminal SH3 domain complexed with a ten-residue peptide derived from SOS: direct refinement against NOEs, J-couplings and 1H and 13C chemical shifts.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (signal transduction/peptide)
molecule keywords GRB2
total genus 8
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1996-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3gbqA00
1H8KA 4IIOA 1QWFA 1MUZA 2CH4W 2L3QA 4JZ3A 2BZ8A 1E7OA 2DL5A 1WI7A 1YWOA 2AZVA 3ULRB 1ABOA 1UECA 3EG2A 4J9GA 4HVUA 2C0TA 1YNZA 4IIMA 4F17A 2X3WD 4J9FA 2GBQA 1HJDA 3IQLA 1GRIA 2RQUA 2SRCA 2O2OA 4RTTA 1M3CA 3UF4A 1M3AA 2A36A 1UGVA 1T0JA 4QT7A 2EGEA 2CREA 2LJ1A 3H0FA 5IXBA 2LJ0A 2JMAA 2KEAA 3TSZA 2DMOA 4OMPA 2JTEA 2LQNA 1LCKA 2DYBA 1ZLMA 4RTYA 1JXMA 3I5RA 1ABQA 2JS0A 3I9QA 2YUQA 1E6GA 1OEBA 1BBZA 4J9DA 1JQQA 4DEXA 2YUPA 2NWMA 2JXBA 3C0CA 3SHWA 1NEGA 1UE9A 2QDLA 1W70A 1H92A 2M0YA 4LN2A 1VA7A 2KBTA 2JT4A 2EYZA 1WXBA 3H0HA 3M0SA 5ECAA 4HVWA 5HCKA 1X6GA 3M0PA 1AD5A 4GLMA 1BB9A 1U06A 2W0ZA 2RF0A 3EG3A 1OOTA 1I0CA 2C0IA 2LNHB 3M0UA 1ZUKA 1GCQA 2KT8A 2EPDA 2JM9A 2NUZA 1GFDA 1WXTA 2EYWA 5IHKA 3EGUA 2DL8A 2EW3A 3NGPA 2KYBA 3RNJA 2RMOA 2OJ2A 2EGAA 2YUOA 3I5SA 2GQIA 2FPFA 3QWYA 3TVTA 1Y0MA 5L23A 4OMNA 2EVRA 1WYXA 3H41A 2DF6A 4JJDA 4JZ4A 3VS0A 2DL7A 2DL3A 4CC3A 2YDLA 2KXDA 1UDLA 2ABLA 1VYTA 1AWXA 2FRWA 3I35A 2RNAA 3NHNA 1UJ0A 3VS2A 4JPBW 2DVJA 1KIKA 1K1ZA 4JJBA 3CQTA 1G83A 2L3SA 3H0IA 1G2BA 1B07A 1V1CA 1NLOC 2L3PA 2FRYA 4Z88A 2J6FA 3FJ5A 1SPKA 1A0NB 2MCNA 4K11A 3O5ZA 2CSIA 2JW4A 2L0AA 2ROLA 2AKLA 1QKWA 1AWJA 2DX1A 1SEMA 2HBWA 2EBPA 4R0KA 4KRTA 5FWBA 3EG0A 2FPEA 1Z9ZA 1RUWA 2YUNA 2OAWA 2CT4A 1YN8A 4D8DA 2IIMA 2ED0A 2RQVA 3M0RA 2O88A 1CKBA 1WDXA 2DJQA 3EHQA 2KRMA 2LQWA 1M8MA 5I11A 1PWTA 2RQRA 2DILA 1JXOA 1CSKA 1PKSA 2K7AA 4FSSA 1Z9QA 2I0NA 2DL4A 1AEYA 4J9BA 2KNBB 1W1FA 2DLPA 1WXUA 1ZX6A 3VS5A 1H3HA 3TSWA 1TUCA 3VS4A 2PNIA 1WIEA 4LUDA 3QWXX 4RTVA 2DBMA 2P4RA 1QWEA 3PE0A 4RTZA 2LZ6B 1VYVA 3VS7A 1IO6A 1RLPC 4HVVA 1JU5C 2O9SA 2A08A 2M51A 4DEYA 4OMLA 2A28A 2K3BA 1K4US 4OMOA 1X2QA 5IHIA 1T0HA 4E6RA 4AG1C 3REBB 1GL5A 2W10A 2C0OA 1PHTA 3JV3A 1K0SA 2DRMA 1SHGA 1OPLA 2AZSA 2J6OA 4M4ZA 1TG0A 2PZ1A 1YWPA 3R6NA 3M0TA 4GBQA 1UHFA 1AVZC 1HD3A 1BK2A 4A63B 5IH2A 2LCSA 4AFUC 2ESWA 1KJWA 2GTJA 2DM1A 1GBQA 1QCFA 2EKHA 2K2MA 4Z8AA 1X43A 2EQIA 1CKAA 2K9GA 1N5ZA 2CUBA 5EC7A 4AG2C 1HSQA 2D1XA 4D8KA 1OV3A 2X3XD 1FMKA 3REAB 1RI9A 2RQTA 2EGCA 3ZL7C 3UATA 1PKTA 1T3SA 2OI3A 1M30A 1U3OA 2MOXA 5FW9A 3PVQA 3EG1A 2VWFA 1WFWA 3SEMA 2L2PA 4EIKA 2GTOA 2KRSA 1I07A 4OMQA 1BU1A 1UG1A 1J3TA 2E5KA 2DRKA 4J9IA 2HSPA 5IXFA 2ECZA 4OMMA 2ROTA 1UJYA 1ZSGA 2KT1A 4LE9A 2F2XA 4ZNXA 1RLQC 2HCKA 2AKKA 2B86A 5GJVB 1I1JA 2BTTA 2AK5A 2SEMA 1M27C 1YP5A 1QKXA 2EYYA 4J9CA 3U23A 2KXCA 4Z89A 1X69A 1X6BA 1SRMA 1NYFA 2F2WA 1SSHA 1PNJA 1UTIA 1Y57A 2G6FX 4HXJA 2K79A 2H8HA 2EYXA 4ESRA 2BZYA 4ORZA 4Y92A 1NM7A 2J05A 1KSWA 2CT3A 1K9AA 2VKNA 2LP5A 2D8JA 2DE0X 4AFQC 1W6XA 1KFZA 5IHNA 2V1RA 3PVLA 2YT6A 2ENMA 2V1QA 2XMFA 3THKA 1GFCA 3UA7A 2KGTA 1AZGB 2HEQA 2A37A 2PTKA 2JM8A 2DA9A 2D8HA 2HDAA 4CC4B 1JO8A 2LJ3A 1NEBA 4RTXA 1SHFA 1YCSB 3VS3A 4HCKA 3VRZA 2BZXA 4F16A 2MIOA 3NMZC 1UUEA 1ZUYA 4J9HA 3LH5A 2KE9A 3EHRA 2CH4A 1SRLA 3KFVA 1AWOA 4LNPA 2VVKA 3A98A 3M0QA 2LX7A 3NPFA 1U5SA 1WA7A 5FWCA 2J7IA 1AWWA 4WCIA 1K0XA 1VYUA 1X27A 1E6HA 1AOJA 1M3BA 1NYGA 2K6DA 3VRYA 2O31A 4AFZC 4RUGA 1FYNA 2RN8A 1ARKA 3VS6A 2J6KA 1MV3A 3RBBB 2KYMA 2KR3A 1PRLC 3UA6A 4J9EA 2FEIA 5I22A 1MV0B 4JJCA 1JEGA 1T3LA 2GNCA 1GCQC 1B3QA 1NG2A 1QLYA 2CSQA 2F2VA 2DNUA 1PRMC 2J06A 2D0NA 1XOVA 1GBRA 2CDTA 1ZBJA 1NLPC 2RQWA 1X2KA 2KROA 1EFNA 2KRNA 1UHCA 2JS2A 2YSQA 4F14A 1S1NA 2O9VA 2DBKA 1ZUUA 1WX6A 3GBQA 2ED1A 2RPNA 4CC2A 1TUDA 1UFFA 4X1VA 1GCPA 2GGRA 1WLPB 2CUDA 3VS1A 2LMJA 2FO0A 1OPKA 5GJWB 4LUEA 4RTWA 2FG0A 4AFSC 2FPDA 4CC7A 1AZEA 1K76A 4RTUA 2JMCA
chains in the Genus database with same CATH superfamily
4IIOA 3CMAA 5LJ5e 1FWZA 7AT1B 1F1BB 4BY6C 3I56Q 3I56T 1ABOA 2D9TA 1VQ4T 3SDZA 1VQPQ 4J9GA 1ACMB 2C0TA 3MO8A 1GRIA 5GANe 4M7AB 5CKHA 5CKFA 5J26A 4OVAA 1I5LA 4DBFA 1M3AA 3KBGA 3LW5E 1I4K1 2LJ1A 2YWWA 2DXBA 2JN0A 2LJ0A 2ZPEB 1YITQ 2JMAA 4A53A 2QGGA 2DMOA 3MP1A 4OMPA 4PJOB 2LQNA 1LCKA 2EIFA 3OYFA 4UC4A 4C8QB 3JB9G 2E12A 4QQ6A 2K3YA 4N4IA 4KT0E 5DM7R 4QQDA 1E6GA 1OEBA 3AHUA 1JQQA 3OYAA 3HRSA 3C0CA 1NEGA 2FHDA 4Q5WA 2CZ0B 4M78G 1WGSA 5GAN6 2HBPA 1D1CA 3M9QA 4KH1B 4C5GA 2KBTA 2LVMA 4ZGDB 1WXBA 1K8AC 2F5TX 3EH1A 3MEWA 4PFZA 4KGXB 5D6YA 4M77C 3RKYA 2OX7A 1OYXA 1ZA2B 3PGGA 3UWNA 2W0ZA 2FL7A 3DLLA 3TCJA 2VV5A 4C92E 2LNVA 2QTXA 2NUZA 1WXTA 2ZPGB 3GNFB 1WHKA 5A0GA 1XTDA 1BI0A 1D0YA 2CS7A 4J6WA 4M77D 3GNGA 3I5SA 5FROA 4C8QA 5A2QE 4QVDA 2ZPIB 2KVQG 4OMNA 1W2BA 2LT1A 3EFRA 5GANf 5CVIA 2DF6A 5AYFA 4PJOE 3EH2A 4CC3A 1M2OA 1FX7A 4M7AG 4JLGA 5GAN8 1VYTA 3PMTA 3EAEA 3V7RA 3LX7A 1B34B 2CGHA 2P4TA 1JJ2P 4BDYA 3CCJQ 1VQ6T 2DVJA 1H3ZA 1K1ZA 3CQTA 1QVGS 4HT9A 2DXUA 3M59A 1YITA 3L2RA 1D0ZA 2R5AA 3G7ZA 4M75A 3H0IA 1G2BA 1V1CA 1KG1A 1NLOC 2FRYA 4X34A 1VQ7T 4Z88A 4KUIA 2QEXQ 1Y96A 1RL2A 4LXCA 2EKOA 1I81A 2MCNA 5CCAA 1PD0A 5GMKe 3O5ZA 4J6YA 2FVUA 4N4HA 4CRIA 2L0AA 3QSUA 1U1TA 4J7IA 1QKWA 2EBPA 4OB0B 3EG9B 1OI1A 1SG5A 3URGA 3QJ6A 4E7ZA 3MCAB 4DBQA 2MF2A 2VGMA 1PG5B 3JCMd 5LJ5h 2LQWA 1TU0B 1JXOA 1N27A 5KYNA 5GAOm 1VQ5Q 2E41A 2FYKA 3OW2A 2DLPA 5GAN4 3VS5A 5GANj 4M75G 1PSFA 3RMQA 4LUDA 3OBWA 2EQKA 2K2VA 3JB9J 2LZ6B 3HRUA 2O9SA 4M77G 4OMLA 2A28A 3V7SA 5IHIA 3CD6Q 2HL3A 4C92G 4E6RA 1WPYA 4AG1C 5HKCA 4NOYA 4EPCA 2W10A 2C0OA 2QGFB 3BDLA 3JRZA 3HP9A 4HCZA 2MI6A 3UT1A 2PZ1A 1YWPA 4HA8A 1VQPT 1AVZC 4FM4B 2B8AA 1HD3A 3FJPA 4C0DC 1VQLA 1Q7YR 1KJWA 3JAME 3CMET 2EKHA 4M78C 2DYIA 4Z8AA 3I56A 4JRQA 5LJ5f 1D3BB 3MP6A 4M77B 5GMKi 2CUBA 3X24B 1WHHA 2D1XA 3SWNA 5I21A 2E6NA 1OX8A 1T3SA 1M30A 5FW9A 4HT8A 3PVQA 3EG1A 4FW2A 2VWFA 4XK8E 3I55T 3QPHA 4FIBA 4Y91A 2OTJT 3G6ET 3PTAA 3JCMJ 3S3NA 4EIKA 2XG8D 1NE8A 4OMQA 4EMKC 3CMAT 4GY5A 4LDVA 1ZSZB 4JS4A 4XU0A 1YIJA 1YHQQ 1SKUB 4C0ZA 1BYMA 1MMAA 2ECZA 5CIUA 3G71A 3QYGB 1UJYA 4LE9A 4B9XA 4ZNXA 2F2XA 4M78D 2HCKA 1VQ5A 2CZ6B 3HFNA 4JS5A 1BIBA 4LDYA 3DB3A 2SEMA 1M27C 3ME9A 2EYYA 1Q81R 3JCMQ 4PJOD 2RJFA 1X6BA 1QP2A 3CXCS 1NYFA 4PJJA 3V7CA 3LYIA 3CMAQ 2LT4A 4BE1A 3KXTA 1PNJA 3CCJA 1TUGB 2EYXA 3ZFJA 4M77E 3CC2Q 1MNDA 4JRKA 4GLKA 2LP5A 4EMKB 4M78F 3CMEQ 4A4EA 2KK4A 2V1QA 3CCLT 1RAFB 2RJCA 1Y07A 2WSEE 4ANJA 4JRPA 1UGQB 1ZBXA 1JBMA 5GAMd 5HY6A 2HEQA 5LJ5g 2A37A 2HDAA 3CEYA 1NEBA 4RTXA 1MGQA 1TTHB 4C5IA 3Q1JA 5KYXA 1N8RU 1M1KC 3FDRA 2MIOA 3CC4A 1M1GA 2ZPBB 1UUEA 1ZUYA 1VQLQ 4J8OA 2VVKA 4MMLA 2GFUA 4PJLA 3LH0A 3ZEHA 5GAMh 2J7IA 3RMSA 1AOJA 2VGNA 3JCMP 4OB1B 1OU8A 1VQ7Q 1WJQA 3A8MB 4RUGA 1IREB 4C8QE 2RHYA 1FXXA 2J6KA 2KYMA 4LDWA 1TSFA 2FEIA 2X4WA 5I22A 3CCMQ 1MMNA 4AT1B 2Y4XA 3M55A 5CAIA 5GMKj 1D09B 1QLYA 4M7AF 2P0KA 3CC7T 2DNUA 1PRMC 2BKDN 2J06A 3C4SA 3OSVA 2BE7D 3TQ7P 4M7AD 3PFSA 2RQWA 1G3TA 1X2KA 2KROA 4O5VA 5M9OA 4IUQA 2DEUA 3LWIA 1IGUA 2YSQA 1NBEB 2P84A 4F14A 1QCNA 2L3RA 2RI3A 2O9VA 5EG2A 1M4ZA 3LGLA 4MMKA 2ED1A 4BI8B 3WXMB 2RPNA 4X1VA 2LTOA 4PJNA 2DVEA 1WLPB 2O01E 3P8HA 2CUDA 3C12A 2CKKA 2FG0A 4AFSC 4Y28E 1C6VX 4QQGA 3MKDA 2JMCA 1VQ9A 2CH4W 4JZ3A 1Q7YC 3QIIA 4XU3A 2VB6A 1YWOA 3CCVA 1KQSP 2DETA 2HAXA 1UECA 1W4SA 4QVZA 1VQ6Q 1QVPA 1YJ9Q 1YI2Q 4J9FA 2GBQA 2O2OA 1K8AR 1M3CA 3CCRT 5I2SA 1UGVA 2CREA 3H0FA 3VYHB 2PU9B 3TSZA 1X75C 3OSSC 1M1FA 1DJ7B 3JCMX 4IKFA 4ME7A 1ABQA 3I9QA 1K73U 2V26A 5GAN2 2YUPA 1SF9A 2R5MA 2AIRB 3M5AA 3VUZA 1QQJA 3S6WA 1WHMA 4LN2A 1VA7A 2BE9B 2JT4A 4R56A 4XTYA 3CD6T 4MDXA 1VQ9T 2D6FA 1WHGA 3H0HA 3M0SA 3NFCA 1X6GA 3M0PA 3M56A 5FRMA 3JB9F 1OOTA 3G71T 2LNHB 2V8IA 1ZUKA 2EPDA 3S3MA 3HPWA 2EYWA 3PT9A 3NGPA 2KYBA 2RMOA 5LJ3j 2YRDA 2DFUA 2GQIA 3QWYA 5A0DA 1Y0MA 1YJNT 1YJWT 1KK7A 2KSSA 2EVRA 5KYUA 3VYGA 3EFOA 2MMPA 3PIPA 3VS0A 4IURA 4HKEA 1IB8A 3LGFA 2YDLA 4FYXB 2EJ9A 2KXDA 4XTUA 1RABB 1U8RA 3M54A 3QBYA 4OGEA 1VQ5T 1YCYA 1M90U 1UJ0A 3VS2A 4KH0B 1IGQA 2D0QB 3E19A 1KQSA 1QMCA 1RADB 2JTFA 1QVFP 4M7DE 4F7UA 1G83A 2K5FA 2NUPB 4DBRA 2VXFA 2COZA 1I5OB 3JB9H 2ZZDA 3HKSA 5J39A 1OQKA 2ZPFB 2J6FA 2JZ2A 2LX9A 2JUFA 1SPKA 4KGVB 3VJPA 5FU7C 3RIRA 4JUVA 3PNWC 1Y96B 3T9NA 2DJZA 2AKLA 1SEMA 4PJOA 2HBWA 1K73R 4R0KA 2NUTA 2DEQA 2YRCA 1KC8U 3GP8A 1ZA1B 4M75E 1RACB 1RUWA 2CT4A 4XU2A 2IIMA 1VQNT 2WSFE 2YRVA 2RQVA 5LJ3g 4FCYA 1W2BP 2DJQA 2FZGB 2RQRA 1NJIR 3TEEA 1PKSA 1O75A 2Y90A 4BE0A 4A54A 2V8JA 4RG8A 2MYSA 1AEYA 4J9BA 3RESA 1VQKQ 2O4XB 1W1FA 4M78E 3TSWA 2HMAA 2RHUA 4LDXA 4DOVA 4RTVA 1QWEA 4AMCA 3R6OA 1M9SA 5FRNA 4HVVA 1Q86U 1G3SA 2K3BA 4OB3B 1K4US 2YXYA 4XTVA 1T0HA 5KCHA 3REBB 5KYWA 3JV3A 2DRMA 1SHGA 4BB7A 3JB9I 2MAMA 3QZ5B 3R6NA 1JRIA 4GBQA 2LCLA 2QA4Q 4A63B 3X28B 2EQUA 5GMKm 2ESWA 1LJOA 3FB9A 1QCFA 1Q81U 1VQNA 3M57A 3QJYA 3QDRB 1VQ8A 1KQ2A 1N5ZA 2E3IA 4D8KA 3E9FA 1OV3A 3V8LA 2X3XD 3REAB 2A3LA 1RI9A 2RQTA 2EGCA 3UATA 4L59A 2MOXA 2XU8A 8ATCB 3N5BB 3GF5A 2KRSA 3CD6A 1J3TA 1YITT 5FU6B 4MDWA 2DRKA 2CZ1B 1KC8R 4L6V5 3SWNC 1R0CB 4OMMA 3OYGA 4FYWB 2ROTA 2KT1A 2QDYB 3WVDB 4PK4A 1RLQC 5LJ5d 2B86A 4RCCA 3EGXA 2MWOA 1I1JA 1VQPA 1BI1A 1QKXA 3U23A 2E6ZA 2KXCA 2F2WA 2LDMA 4ZTFA 3CMEA 3CCVQ 2KI7A 2G6FX 4HXJA 2CP3A 5D6WA 1FMVA 4C8QF 2JOYA 4ESRA 3CC7A 4ORZA 2J05A 2CT3A 2DXTA 2DE0X 4M75D 5GAMj 1KFZA 2K4YA 3PVLA 1M2VA 5IT9E 4M75B 2ENMA 3M4YA 3J7AF 4D6WA 3J80E 2Y4YA 5LJ3h 1PSEA 5GAOl 3CPWS 2DA9A 4CC4B 2LJ3A 4FYVB 1YCSB 3VS3A 4F16A 1I8FA 1BI2A 2HKNA 4BUGA 2RJEA 3NMZC 2PVDB 3LH5A 2HNIA 2BUDA 4C5EA 2KE9A 1AWOA 3KFVA 3A98A 3OS0A 1U5SA 3JCMg 1AWWA 1VYUA 1MMDA 4M75F 3NTKA 1E6HA 3X25B 1VQ6A 2QEXT 2LQ8A 4C8QD 3BY7A 3META 2DIQA 3CCMA 4M77A 3VS6A 2GF7A 1IHVA 3UA6A 1PD1A 4A4FA 4M7DF 3QXEB 3FRNA 3CPWA 1UGRB 2GNCA 1W2BS 2NLUA 3OYEA 2EFIA 2LC4A 2F2VA 1VQKT 4C8QG 3S3OA 2D0NA 1XOVA 2YLCA 2CDTA 2DPPB 1ZBJA 2NUTB 2Z0WA 3RERA 3VV0A 2QQ9A 1BCOA 1EFNA 1M1KR 4RKUE 1JJ2A 2WACA 3EG9A 4ZGEB 1S1NA 2XI9A 1RAAB 4QVCA 1WX6A 1OX9A 1N6AA 3KUFA 4CC2A 3CC4T 1TUDA 2IPOB 3P8BB 1GCPA 4ATOA 1M8VA 2GGRA 3CCSA 2RO0A 4A4KA 2EJGA 5D7UA 1VQMQ 1WQ7A 1S72Q 5GJWB 2HQXA 3A8GB 2NYSA 3D7SB 3I55A 1VQLT 2DTIA 1H8KA 1QWFA 1MUZA 3OS5A 3OYIA 2BZ8A 1E7OA 4OGCA 3EG2A 2COYA 4PJMA 2HQEA 4HVUA 1YNZA 2L8DA 1N8RR 4F17A 4OF1A 3ZBDA 3IQLA 1S72A 2SRCA 4RTTA 4BI3A 4M7DC 3UF4A 2EGEA 3OB9A 2RM4A 4M7AC 9ATCB 5IXBA 1NZ9A 4MZTA 1YJNQ 5FU6C 2KEAA 1K9MR 1TS9A 3OW2S 2JTEA 2GFAA 1ZHIA 2XHCA 1ZLMA 1YIJT 4RTYA 3CC4Q 3CCUA 3CCEA 1JXMA 4R55A 3I5RA 1QVFA 4DA4A 4BE2A 2I2LA 4PJOG 5A0LA 5LJ5j 4NS5A 4J9DA 1MMGA 4DEXA 5KH6A 3H8ZA 3RDVA 2HSEB 2XDDA 3H6ZA 4FYYB 2RA2A 3L2ZA 2XK0A 2QDLA 4E7KA 1W70A 1H92A 2M0YA 1LNXA 2K5IA 4BI4A 4GLMA 3QDFA 1BB9A 1U06A 3EG3A 1RAGB 1I0CA 2C0IA 4FW1A 2XICA 1GCQA 1PCXA 2KT8A 2JM9A 1GFDA 5IHKA 3EGUA 4B6MA 2DL8A 4PLIA 1VQMA 3HSBA 2PVGB 4E47A 3L2WA 2RK2A 3CC2T 5L23A 2ZGWA 2O4XA 1WYXA 1C1AA 2QQAA 4V2SA 1GXIE 2RI5A 1JB0E 4JZ4A 3FEOA 4HCBA 1IXDA 3CCET 3MP8A 1KQSS 2RK1A 1X6OA 3L2VA 3NHNA 4JPBW 4X9DA 1UB4A 3CPFA 3RR6A 3OA6A 1UEBA 3CBOA 3CCMT 4EMGA 1B07A 3CBPA 3H9NA 3E2UA 3C95A 3P8DA 1YFNA 4K11A 1YI2A 4XTXA 1EX4A 3LWHA 2ROLA 2DX1A 1AWJA 4PL6A 4C92A 3SFMA 2GQVA 4KRTA 2KY9A 2MPXC 1PC0A 1D0XA 4ZN3A 3EG0A 2FPEA 4C8QC 1Q82R 4M7AA 4M75C 3OYKA 3JB9D 1YN8A 5GANd 4O6JA 2O88A 4EMHA 1WHLA 1M8MA 4FSXA 5I11A 1Q7YU 1PWTA 4MZPA 3RUXA 2DILA 1CSKA 1KHCA 1IHWA 4JJNK 4FSSA 1Z9QA 1XQHA 4KGZB 3DB4A 2KNBB 1G5VA 3A8LB 1WQWA 1D1AA 2LRQA 1WXUA 1ZX6A 2CZ7B 1TUCA 3VS4A 2PNIA 5GAN3 3QWXX 2XIDA 2DBMA 2P4RA 2YHTA 4M7DG 4RTZA 1HXDA 1VYVA 3VS7A 1IO6A 3CCSQ 1RLPC 4PLLA 5GAN7 1RAEB 1JU5C 2A08A 3CCUQ 2QASA 1D1BA 4F7UE 2QA4T 3C94A 1D3BA 4L5GA 1M90C 4OMOA 3SWNB 2RH2A 1GL5A 2QQSA 1VQOA 1OPLA 5AT1B 2J6OA 4M4ZA 2GCXA 3CCLQ 5CQYA 1TG0A 1QCOA 5KYWB 1UHFA 5GANh 1Q86C 1KQ1A 3HTRA 5GAN5 1PM3A 4X9CA 2ZPHB 4AFUC 3M58A 2GTJA 4ELZC 2DM1A 1Y71A 4F7UG 1X43A 2EQIA 1CKAA 3G6EQ 2K9GA 5EC7A 4AG2C 3JCMf 4C5HA 1NPRA 4B9WA 3TREA 3ZL7C 2MK5A 1S72T 1PKTA 5J3BA 2ATCB 2OI3A 1TXQA 2VXEA 4XAXB 4E7SA 3ASKA 1AT1B 1WFWA 1Q81C 2YLBA 2CP6A 1BU1A 1UG1A 3X26B 2K57A 4M78A 2E5KA 5FU7B 2A7YA 2COWA 1HK9A 2EYQA 3A5ZB 4J9IA 2XKOC 3GLXA 2KAFA 1VIFA 1ZSGA 3QZ9B 4KULA 2PVOB 3NTIA 5KYUB 3HL8A 4DQ2A 1NJIU 5GJVB 2MWPA 2AK5A 2OTLA 3FIFA 4J9CA 2FZCB 4J6XA 4Z89A 1X69A 2CP5A 4M7DD 5CKDA 1P92A 1WZOA 3AT1B 4PKCC 3OY9A 1UTIA 1Y57A 3G4SA 2XDBA 1M5Q1 3CXCA 2K79A 2FB7A 3MEAA 3TU4K 1RAIB 1NM7A 4WTOB 1TWBA 2AT1B 1VQKA 1KSWA 4P5NA 3E9GA 1W6XA 5IHNA 5KYYA 2M02A 4WF2A 3RKWA 2YT6A 2XMFA 3JCMe 5D6XA 3THKA 2KMTA 3VUBA 2G3RA 3EGDA 1GFCA 2KGTA 4XQ3A 1AZGB 2BIVA 2L5QA 3QYHB 2D8HA 1SHFA 1X01A 1RI0A 2X35A 1Q95G 4HCKA 4ZGJB 2BZXA 1N8RC 1M1KU 3CCUT 4J9HA 3EHRA 2CH4A 1SRLA 4LNPA 1V76A 4RMOA 4F7UF 4KUDK 3OYBA 3NPFA 1WA7A 2XD0A 5LJ3d 1UGPB 4WCIA 1VQOT 1K0XA 1ZSZA 1QVGA 1M3BA 6AT1B 1NYGA 3JCMc 4AFZC 4M7DB 4BY6B 1ARKA 3OYHA 1MV3A 4DOWA 4XTWA 4J9EA 2DTOA 4C0DB 2DTHA 3MJXA 2HL5C 1GCQC 2K5LA 3CCJT 1B3QA 1IZ6A 2X4XA 5LL6S 2VASA 1GBRA 2ZAEA 3OS2A 1NLPC 1G8XA 4XU1A 3RKXA 2OTJA 1AHJB 2KRNA 3CCQA 1UHCA 5GAOp 2DBKA 4EMKA 3GBQA 2CP2A 2DZ9A 1MHNA 2JJ9A 3JSCA 1UFFA 1K9MU 5GMKh 3E1SA 2E3HA 4ZN1A 2IVWA 3A8OB 3DLMA 4PNOA 3VS1A 5GAOn 4OMFB 2VC8A 2NUPA 2HD0A 5FLXE 3WVEB 2QG9B 1WNLA 2DZCA 2FPDA 2LQKA 4FT4A 2E5QA 4CC7A 3G6EA 4LD9K 1K76A 4QW2A 2PUKB 4QKUA 3G71Q 4IUPA 2E65A 2ZCFB 3CCQQ 2QI2A 2VYTA 1YJ9T 2RD1A 3O8VA 2L3QA 2DL5A 1WI7A 2AZVA 1VQ8Q 1VQ8T 3ULRB 4BD3A 2OTLQ 8AT1B 4IIMA 1Y7XA 2X3WD 2QAZA 4EDUA 1HJDA 2RQUA 2RHZA 1FMWA 3FLGA 4C0FA 2A36A 2C06A 1T0JA 2M0OA 4QT7A 4E2FB 3CCEQ 1BI3A 2EQMA 4E7HA 3CCQT 3GPLA 3CPWP 1WJRA 5IAYA 2H3JA 2DYBA 1V29B 1XNIA 3I55Q 2QQRA 2JS0A 4J83A 2F5KA 2YUQA 5GAMf 1BBZA 3OYCA 4VUBA 2X9HA 2DK3A 2NWMA 4JRIA 2JXBA 1LOJA 3SHWA 1UE9A 5GMKl 3DKMA 4IUUA 1VQ4Q 2V8KA 4PJOC 4M78B 1KD1U 2EYZA 5LJ3f 4FT2A 5ECAA 4HVWA 5HCKA 5LJ3e 1AD5A 2AHJB 2JVVA 1EZZB 5GAMg 2RF0A 3QKJA 3A1PA 3X20B 1VQ7A 1M2VB 3M0UA 2H3EB 2VUBA 3CXCP 3CC7Q 3UDCA 2L89A 2HQHA 4E7JA 4DBHA 2EW3A 1QVFS 3RNJA 2OJ2A 2EGAA 3M53A 2YUOA 1C0MA 1KHIA 3CCLA 2A0FB 2FPFA 3OMGA 3TVTA 4KBMB 2EAYA 4FL6A 4CI0C 2M16A 1UGSB 4N0AC 5I2MA 3H41A 2HZYA 2QTVA 4JJDA 3OMCA 2RHIA 2DL7A 2DL3A 3L2UA 1UDLA 2ABLA 1VQ9Q 1K73C 3JCMh 1AWXA 2FRWA 3I35A 4OB2B 3QUIA 2RNAA 3J81E 2E10A 3MPUB 1NPPA 3FC3A 2M9UA 1SSFA 1TOVA 1KIKA 4JJBA 4J7FA 4II1A 3BW1A 4FU6A 4ELYC 3PIOA 2L3SA 1LPLA 3CBMA 5HK3A 2P0QA 2X4YA 2R58A 1JJ2S 2L3PA 2KDSA 2DIGA 2FZKB 2EQJA 4RG2A 3FJ5A 3V8KA 1A0NB 1IRXA 2K3XA 2CSIA 2HKQB 2JW4A 4N4GA 1VQMT 5GAOr 1EIFA 3CCRQ 4M7DA 3MEVA 5FWBA 5HK0A 4JDSA 3A8HB 1N9SA 1KC8C 1Z9ZA 1YJ9A 2YUNA 2OAWA 4LD6A 4D8DA 1K9MC 2ED0A 3M0RA 1CKBA 1WDXA 3EHQA 1KD1R 2KRMA 3QO3A 2K7AA 2QK0A 1XJWB 2I0NA 2DKGA 2DL4A 5DLQE 3HRTA 1H3HA 1WIEA 4N0AA 1VIEA 3PE0A 5DLOA 4PFOA 2DD4A 2M51A 1U1SA 4IUVA 4DEYA 5KE2A 1ZQ1A 2E70A 4NL2A 1R0BG 1X2QA 4F7UB 3OYYA 2P0PA 1BIAA 4C0GA 1ZSZC 4M7AE 1PHTA 2F1LA 1K0SA 5CKEA 2RJDA 2AZSA 4BDZA 1G3WA 2OTLT 3M0TA 2OAUA 2IG0A 2JTMA 5KCOA 3MEUA 1BK2A 5IH2A 2LCSA 5DY9A 1GBQA 3G4ST 2K2MA 4ZTJA 5CR2A 4F04B 3ER0A 3GOXA 3CCVT 4JLIA 1VQ4A 2DAQA 2EWNA 1HSQA 3BDUA 3CCST 1FMKA 4IUTA 1U3OA 4C92C 4BACA 3INZA 3CC2A 3VU3C 4LDUA 1Q86R 3SEMA 4A4GA 1KD1C 2L2PA 1WHJA 2GTOA 3HHTB 1QVGP 5CQXA 1I07A 1MNEA 1YBYA 1YHQA 1OU9A 2JNGA 1OULA 1RAHB 3PMIA 1Q82U 2HSPA 3L1AA 5IXFA 1VOMA 3VKIA 3OS1A 2X4JA 2WSCE 5KYYB 1M90R 2X51A 1QW1A 3OBYA 3EFSA 3EGDB 3OQ5A 2AKKA 2LCCA 2CP0A 1LVKA 2DD5A 2BTTA 2QXFA 2RB6A 4NL3A 1YP5A 4Z02A 1BCMA 2F69A 4PFPA 4C92D 1SRMA 3SD4A 5C6SA 1SSHA 4MZMA 3LLRA 2H8HA 1YJWQ 3NTHA 2XDPA 2BZYA 4Y92A 4M77F 1HYOA 1K9AA 3SB2A 2VKNA 2D8JA 4AFQC 2EJFA 2V1RA 5CKBA 5C0MA 3G4SQ 1QP3A 3G1JA 5CO7A 1B34A 3UA7A 5KYXB 2PTKA 2JM8A 3V8JA 5CK9A 1JO8A 1O9SA 2E4HA 3BFMA 1YHQT 3VRZA 4OP0A 3HFOA 2E64A 2OTJQ 4RCBA 3BE3A 2CYZB 3EFOB 2QA4A 4C92B 3OYDA 1R8OB 1K8AU 3M0QA 2PQWA 2LX7A 5FWCA 3OYMA 5GAOq 1X27A 3L2QA 2KQWA 2K6DA 3VRYA 1B7TA 1OZ2A 2O31A 3JCMW 1YJNA 1FYNA 1G3YA 2QQBA 2RN8A 1OZ3A 1WJSA 2CP7A 3RBBB 2KR3A 1PRLC 1BKBA 3EGXB 1MV0B 4PJOF 4JJCA 1JEGA 1T3LA 4E7LA 4C92F 4YTLA 4E7IA 1NG2A 3MHXA 1NJIC 2CSQA 1TH7A 2RI2A 5KE3A 3QHSA 1YI2T 5IN1A 3CCRA 2E1HA 3OYJA 1VQNQ 3JCMb 2M1HA 2PUOB 1YJWA 3UPUA 2JS2A 3OYLA 2RHXA 3M4GA 1ZUUA 1H641 1VUBA 4TVRA 2QYZA 1N9RA 1Q82C 3L42A 4HCCA 1YIJQ 3GIBA 5GAMe 2DXCA 3QG1A 3OW2P 2R57A 2LMJA 2DERA 2FO0A 1OPKA 1R77A 4LUEA 1VQOQ 3OYNA 4RTWA 3JCMV 3F70A 5GANg 4J5YA 4A4HA 1AZEA 5L8RE 2DO3A 2QEXA 4RTUA 4XTZA
chains in the Genus database with same CATH topology
1H8KA 4IIOA 1QWFA 1MUZA 2CH4W 2L3QA 4JZ3A 2BZ8A 1E7OA 2DL5A 1WI7A 1YWOA 2AZVA 3ULRB 1ABOA 1UECA 3EG2A 4J9GA 4HVUA 2C0TA 1YNZA 4IIMA 4F17A 2X3WD 4J9FA 2GBQA 1HJDA 3IQLA 1GRIA 2RQUA 2SRCA 2O2OA 4RTTA 1M3CA 3UF4A 1M3AA 2A36A 1UGVA 1T0JA 4QT7A 2EGEA 2CREA 2LJ1A 3H0FA 5IXBA 2LJ0A 2JMAA 2KEAA 3TSZA 2DMOA 4OMPA 2JTEA 2LQNA 1LCKA 2DYBA 1ZLMA 4RTYA 1JXMA 3I5RA 1ABQA 2JS0A 3I9QA 2YUQA 1E6GA 1OEBA 1BBZA 4J9DA 1JQQA 4DEXA 2YUPA 2NWMA 2JXBA 3C0CA 3SHWA 1NEGA 1UE9A 2QDLA 1W70A 1H92A 2M0YA 4LN2A 1VA7A 2KBTA 2JT4A 2EYZA 1WXBA 3H0HA 3M0SA 5ECAA 4HVWA 5HCKA 1X6GA 3M0PA 1AD5A 4GLMA 1BB9A 1U06A 2W0ZA 2RF0A 3EG3A 1OOTA 1I0CA 2C0IA 2LNHB 3M0UA 1ZUKA 1GCQA 2KT8A 2EPDA 2JM9A 2NUZA 1GFDA 1WXTA 2EYWA 5IHKA 3EGUA 2DL8A 2EW3A 3NGPA 2KYBA 3RNJA 2RMOA 2OJ2A 2EGAA 2YUOA 3I5SA 2GQIA 2FPFA 3QWYA 3TVTA 1Y0MA 5L23A 4OMNA 2EVRA 1WYXA 3H41A 2DF6A 4JJDA 4JZ4A 3VS0A 2DL7A 2DL3A 4CC3A 2YDLA 2KXDA 1UDLA 2ABLA 1VYTA 1AWXA 2FRWA 3I35A 2RNAA 3NHNA 1UJ0A 3VS2A 4JPBW 2DVJA 1KIKA 1K1ZA 4JJBA 3CQTA 1G83A 2L3SA 3H0IA 1G2BA 1B07A 1V1CA 1NLOC 2L3PA 2FRYA 4Z88A 2J6FA 3FJ5A 1SPKA 1A0NB 2MCNA 4K11A 3O5ZA 2CSIA 2JW4A 2L0AA 2ROLA 2AKLA 1QKWA 1AWJA 2DX1A 1SEMA 2HBWA 2EBPA 4R0KA 4KRTA 5FWBA 3EG0A 2FPEA 1Z9ZA 1RUWA 2YUNA 2OAWA 2CT4A 1YN8A 4D8DA 2IIMA 2ED0A 2RQVA 3M0RA 2O88A 1CKBA 1WDXA 2DJQA 3EHQA 2KRMA 2LQWA 1M8MA 5I11A 1PWTA 2RQRA 2DILA 1JXOA 1CSKA 1PKSA 2K7AA 4FSSA 1Z9QA 2I0NA 2DL4A 1AEYA 4J9BA 2KNBB 1W1FA 2DLPA 1WXUA 1ZX6A 3VS5A 1H3HA 3TSWA 1TUCA 3VS4A 2PNIA 1WIEA 4LUDA 3QWXX 4RTVA 2DBMA 2P4RA 1QWEA 3PE0A 4RTZA 2LZ6B 1VYVA 3VS7A 1IO6A 1RLPC 4HVVA 1JU5C 2O9SA 2A08A 2M51A 4DEYA 4OMLA 2A28A 2K3BA 1K4US 4OMOA 1X2QA 5IHIA 1T0HA 4E6RA 4AG1C 3REBB 1GL5A 2W10A 2C0OA 1PHTA 3JV3A 1K0SA 2DRMA 1SHGA 1OPLA 2AZSA 2J6OA 4M4ZA 1TG0A 2PZ1A 1YWPA 3R6NA 3M0TA 4GBQA 1UHFA 1AVZC 1HD3A 1BK2A 4A63B 5IH2A 2LCSA 4AFUC 2ESWA 1KJWA 2GTJA 2DM1A 1GBQA 1QCFA 2EKHA 2K2MA 4Z8AA 1X43A 2EQIA 1CKAA 2K9GA 1N5ZA 2CUBA 5EC7A 4AG2C 1HSQA 2D1XA 4D8KA 1OV3A 2X3XD 1FMKA 3REAB 1RI9A 2RQTA 2EGCA 3ZL7C 3UATA 1PKTA 1T3SA 2OI3A 1M30A 1U3OA 2MOXA 5FW9A 3PVQA 3EG1A 2VWFA 1WFWA 3SEMA 2L2PA 4EIKA 2GTOA 2KRSA 1I07A 4OMQA 1BU1A 1UG1A 1J3TA 2E5KA 2DRKA 4J9IA 2HSPA 5IXFA 2ECZA 4OMMA 2ROTA 1UJYA 1ZSGA 2KT1A 4LE9A 2F2XA 4ZNXA 1RLQC 2HCKA 2AKKA 2B86A 5GJVB 1I1JA 2BTTA 2AK5A 2SEMA 1M27C 1YP5A 1QKXA 2EYYA 4J9CA 3U23A 2KXCA 4Z89A 1X69A 1X6BA 1SRMA 1NYFA 2F2WA 1SSHA 1PNJA 1UTIA 1Y57A 2G6FX 4HXJA 2K79A 2H8HA 2EYXA 4ESRA 2BZYA 4ORZA 4Y92A 1NM7A 2J05A 1KSWA 2CT3A 1K9AA 2VKNA 2LP5A 2D8JA 2DE0X 4AFQC 1W6XA 1KFZA 5IHNA 2V1RA 3PVLA 2YT6A 2ENMA 2V1QA 2XMFA 3THKA 1GFCA 3UA7A 2KGTA 1AZGB 2HEQA 2A37A 2PTKA 2JM8A 2DA9A 2D8HA 2HDAA 4CC4B 1JO8A 2LJ3A 1NEBA 4RTXA 1SHFA 1YCSB 3VS3A 4HCKA 3VRZA 2BZXA 4F16A 2MIOA 3NMZC 1UUEA 1ZUYA 4J9HA 3LH5A 2KE9A 3EHRA 2CH4A 1SRLA 3KFVA 1AWOA 4LNPA 2VVKA 3A98A 3M0QA 2LX7A 3NPFA 1U5SA 1WA7A 5FWCA 2J7IA 1AWWA 4WCIA 1K0XA 1VYUA 1X27A 1E6HA 1AOJA 1M3BA 1NYGA 2K6DA 3VRYA 2O31A 4AFZC 4RUGA 1FYNA 2RN8A 1ARKA 3VS6A 2J6KA 1MV3A 3RBBB 2KYMA 2KR3A 1PRLC 3UA6A 4J9EA 2FEIA 5I22A 1MV0B 4JJCA 1JEGA 1T3LA 2GNCA 1GCQC 1B3QA 1NG2A 1QLYA 2CSQA 2F2VA 2DNUA 1PRMC 2J06A 2D0NA 1XOVA 1GBRA 2CDTA 1ZBJA 1NLPC 2RQWA 1X2KA 2KROA 1EFNA 2KRNA 1UHCA 2JS2A 2YSQA 4F14A 1S1NA 2O9VA 2DBKA 1ZUUA 1WX6A 3GBQA 2ED1A 2RPNA 4CC2A 1TUDA 1UFFA 4X1VA 1GCPA 2GGRA 1WLPB 2CUDA 3VS1A 2LMJA 2FO0A 1OPKA 5GJWB 4LUEA 4RTWA 2FG0A 4AFSC 2FPDA 4CC7A 1AZEA 1K76A 4RTUA 2JMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H8K A;  4IIO A;  1QWF A;  1MUZ A;  2CH4 W;  2L3Q A;  4JZ3 A;  2BZ8 A;  1E7O A;  2DL5 A;  1WI7 A;  1YWO A;  2AZV A;  3ULR B;  1ABO A;  1UEC A;  3EG2 A;  4J9G A;  4HVU A;  2C0T A;  1YNZ A;  4IIM A;  4F17 A;  2X3W D;  4J9F A;  2GBQ A;  1HJD A;  3IQL A;  1GRI A;  2RQU A;  2SRC A;  2O2O A;  4RTT A;  1M3C A;  3UF4 A;  1M3A A;  2A36 A;  1UGV A;  1T0J A;  4QT7 A;  2EGE A;  2CRE A;  2LJ1 A;  3H0F A;  5IXB A;  2LJ0 A;  2JMA A;  2KEA A;  3TSZ A;  2DMO A;  4OMP A;  2JTE A;  2LQN A;  1LCK A;  2DYB A;  1ZLM A;  4RTY A;  1JXM A;  3I5R A;  1ABQ A;  2JS0 A;  3I9Q A;  2YUQ A;  1E6G A;  1OEB A;  1BBZ A;  4J9D A;  1JQQ A;  4DEX A;  2YUP A;  2NWM A;  2JXB A;  3C0C A;  3SHW A;  1NEG A;  1UE9 A;  2QDL A;  1W70 A;  1H92 A;  2M0Y A;  4LN2 A;  1VA7 A;  2KBT A;  2JT4 A;  2EYZ A;  1WXB A;  3H0H A;  3M0S A;  5ECA A;  4HVW A;  5HCK A;  1X6G A;  3M0P A;  1AD5 A;  4GLM A;  1BB9 A;  1U06 A;  2W0Z A;  2RF0 A;  3EG3 A;  1OOT A;  1I0C A;  2C0I A;  2LNH B;  3M0U A;  1ZUK A;  1GCQ A;  2KT8 A;  2EPD A;  2JM9 A;  2NUZ A;  1GFD A;  1WXT A;  2EYW A;  5IHK A;  3EGU A;  2DL8 A;  2EW3 A;  3NGP A;  2KYB A;  3RNJ A;  2RMO A;  2OJ2 A;  2EGA A;  2YUO A;  3I5S A;  2GQI A;  2FPF A;  3QWY A;  3TVT A;  1Y0M A;  5L23 A;  4OMN A;  2EVR A;  1WYX A;  3H41 A;  2DF6 A;  4JJD A;  4JZ4 A;  3VS0 A;  2DL7 A;  2DL3 A;  4CC3 A;  2YDL A;  2KXD A;  1UDL A;  2ABL A;  1VYT A;  1AWX A;  2FRW A;  3I35 A;  2RNA A;  3NHN A;  1UJ0 A;  3VS2 A;  4JPB W;  2DVJ A;  1KIK A;  1K1Z A;  4JJB A;  3CQT A;  1G83 A;  2L3S A;  3H0I A;  1G2B A;  1B07 A;  1V1C A;  1NLO C;  2L3P A;  2FRY A;  4Z88 A;  2J6F A;  3FJ5 A;  1SPK A;  1A0N B;  2MCN A;  4K11 A;  3O5Z A;  2CSI A;  2JW4 A;  2L0A A;  2ROL A;  2AKL A;  1QKW A;  1AWJ A;  2DX1 A;  1SEM A;  2HBW A;  2EBP A;  4R0K A;  4KRT A;  5FWB A;  3EG0 A;  2FPE A;  1Z9Z A;  1RUW A;  2YUN A;  2OAW A;  2CT4 A;  1YN8 A;  4D8D A;  2IIM A;  2ED0 A;  2RQV A;  3M0R A;  2O88 A;  1CKB A;  1WDX A;  2DJQ A;  3EHQ A;  2KRM A;  2LQW A;  1M8M A;  5I11 A;  1PWT A;  2RQR A;  2DIL A;  1JXO A;  1CSK A;  1PKS A;  2K7A A;  4FSS A;  1Z9Q A;  2I0N A;  2DL4 A;  1AEY A;  4J9B A;  2KNB B;  1W1F A;  2DLP A;  1WXU A;  1ZX6 A;  3VS5 A;  1H3H A;  3TSW A;  1TUC A;  3VS4 A;  2PNI A;  1WIE A;  4LUD A;  3QWX X;  4RTV A;  2DBM A;  2P4R A;  1QWE A;  3PE0 A;  4RTZ A;  2LZ6 B;  1VYV A;  3VS7 A;  1IO6 A;  1RLP C;  4HVV A;  1JU5 C;  2O9S A;  2A08 A;  2M51 A;  4DEY A;  4OML A;  2A28 A;  2K3B A;  1K4U S;  4OMO A;  1X2Q A;  5IHI A;  1T0H A;  4E6R A;  4AG1 C;  3REB B;  1GL5 A;  2W10 A;  2C0O A;  1PHT A;  3JV3 A;  1K0S A;  2DRM A;  1SHG A;  1OPL A;  2AZS A;  2J6O A;  4M4Z A;  1TG0 A;  2PZ1 A;  1YWP A;  3R6N A;  3M0T A;  4GBQ A;  1UHF A;  1AVZ C;  1HD3 A;  1BK2 A;  4A63 B;  5IH2 A;  2LCS A;  4AFU C;  2ESW A;  1KJW A;  2GTJ A;  2DM1 A;  1GBQ A;  1QCF A;  2EKH A;  2K2M A;  4Z8A A;  1X43 A;  2EQI A;  1CKA A;  2K9G A;  1N5Z A;  2CUB A;  5EC7 A;  4AG2 C;  1HSQ A;  2D1X A;  4D8K A;  1OV3 A;  2X3X D;  1FMK A;  3REA B;  1RI9 A;  2RQT A;  2EGC A;  3ZL7 C;  3UAT A;  1PKT A;  1T3S A;  2OI3 A;  1M30 A;  1U3O A;  2MOX A;  5FW9 A;  3PVQ A;  3EG1 A;  2VWF A;  1WFW A;  3SEM A;  2L2P A;  4EIK A;  2GTO A;  2KRS A;  1I07 A;  4OMQ A;  1BU1 A;  1UG1 A;  1J3T A;  2E5K A;  2DRK A;  4J9I A;  2HSP A;  5IXF A;  2ECZ A;  4OMM A;  2ROT A;  1UJY A;  1ZSG A;  2KT1 A;  4LE9 A;  2F2X A;  4ZNX A;  1RLQ C;  2HCK A;  2AKK A;  2B86 A;  5GJV B;  1I1J A;  2BTT A;  2AK5 A;  2SEM A;  1M27 C;  1YP5 A;  1QKX A;  2EYY A;  4J9C A;  3U23 A;  2KXC A;  4Z89 A;  1X69 A;  1X6B A;  1SRM A;  1NYF A;  2F2W A;  1SSH A;  1PNJ A;  1UTI A;  1Y57 A;  2G6F X;  4HXJ A;  2K79 A;  2H8H A;  2EYX A;  4ESR A;  2BZY A;  4ORZ A;  4Y92 A;  1NM7 A;  2J05 A;  1KSW A;  2CT3 A;  1K9A A;  2VKN A;  2LP5 A;  2D8J A;  2DE0 X;  4AFQ C;  1W6X A;  1KFZ A;  5IHN A;  2V1R A;  3PVL A;  2YT6 A;  2ENM A;  2V1Q A;  2XMF A;  3THK A;  1GFC A;  3UA7 A;  2KGT A;  1AZG B;  2HEQ A;  2A37 A;  2PTK A;  2JM8 A;  2DA9 A;  2D8H A;  2HDA A;  4CC4 B;  1JO8 A;  2LJ3 A;  1NEB A;  4RTX A;  1SHF A;  1YCS B;  3VS3 A;  4HCK A;  3VRZ A;  2BZX A;  4F16 A;  2MIO A;  3NMZ C;  1UUE A;  1ZUY A;  4J9H A;  3LH5 A;  2KE9 A;  3EHR A;  2CH4 A;  1SRL A;  3KFV A;  1AWO A;  4LNP A;  2VVK A;  3A98 A;  3M0Q A;  2LX7 A;  3NPF A;  1U5S A;  1WA7 A;  5FWC A;  2J7I A;  1AWW A;  4WCI A;  1K0X A;  1VYU A;  1X27 A;  1E6H A;  1AOJ A;  1M3B A;  1NYG A;  2K6D A;  3VRY A;  2O31 A;  4AFZ C;  4RUG A;  1FYN A;  2RN8 A;  1ARK A;  3VS6 A;  2J6K A;  1MV3 A;  3RBB B;  2KYM A;  2KR3 A;  1PRL C;  3UA6 A;  4J9E A;  2FEI A;  5I22 A;  1MV0 B;  4JJC A;  1JEG A;  1T3L A;  2GNC A;  1GCQ C;  1B3Q A;  1NG2 A;  1QLY A;  2CSQ A;  2F2V A;  2DNU A;  1PRM C;  2J06 A;  2D0N A;  1XOV A;  1GBR A;  2CDT A;  1ZBJ A;  1NLP C;  2RQW A;  1X2K A;  2KRO A;  1EFN A;  2KRN A;  1UHC A;  2JS2 A;  2YSQ A;  4F14 A;  1S1N A;  2O9V A;  2DBK A;  1ZUU A;  1WX6 A;  3GBQ A;  2ED1 A;  2RPN A;  4CC2 A;  1TUD A;  1UFF A;  4X1V A;  1GCP A;  2GGR A;  1WLP B;  2CUD A;  3VS1 A;  2LMJ A;  2FO0 A;  1OPK A;  5GJW B;  4LUE A;  4RTW A;  2FG0 A;  4AFS C;  2FPD A;  4CC7 A;  1AZE A;  1K76 A;  4RTU A;  2JMC A; 
#chains in the Genus database with same CATH topology
 4IIO A;  3CMA A;  5LJ5 e;  1FWZ A;  7AT1 B;  1F1B B;  4BY6 C;  3I56 Q;  3I56 T;  1ABO A;  2D9T A;  1VQ4 T;  3SDZ A;  1VQP Q;  4J9G A;  1ACM B;  2C0T A;  3MO8 A;  1GRI A;  5GAN e;  4M7A B;  5CKH A;  5CKF A;  5J26 A;  4OVA A;  1I5L A;  4DBF A;  1M3A A;  3KBG A;  3LW5 E;  1I4K 1;  2LJ1 A;  2YWW A;  2DXB A;  2JN0 A;  2LJ0 A;  2ZPE B;  1YIT Q;  2JMA A;  4A53 A;  2QGG A;  2DMO A;  3MP1 A;  4OMP A;  4PJO B;  2LQN A;  1LCK A;  2EIF A;  3OYF A;  4UC4 A;  4C8Q B;  3JB9 G;  2E12 A;  4QQ6 A;  2K3Y A;  4N4I A;  4KT0 E;  5DM7 R;  4QQD A;  1E6G A;  1OEB A;  3AHU A;  1JQQ A;  3OYA A;  3HRS A;  3C0C A;  1NEG A;  2FHD A;  4Q5W A;  2CZ0 B;  4M78 G;  1WGS A;  5GAN 6;  2HBP A;  1D1C A;  3M9Q A;  4KH1 B;  4C5G A;  2KBT A;  2LVM A;  4ZGD B;  1WXB A;  1K8A C;  2F5T X;  3EH1 A;  3MEW A;  4PFZ A;  4KGX B;  5D6Y A;  4M77 C;  3RKY A;  2OX7 A;  1OYX A;  1ZA2 B;  3PGG A;  3UWN A;  2W0Z A;  2FL7 A;  3DLL A;  3TCJ A;  2VV5 A;  4C92 E;  2LNV A;  2QTX A;  2NUZ A;  1WXT A;  2ZPG B;  3GNF B;  1WHK A;  5A0G A;  1XTD A;  1BI0 A;  1D0Y A;  2CS7 A;  4J6W A;  4M77 D;  3GNG A;  3I5S A;  5FRO A;  4C8Q A;  5A2Q E;  4QVD A;  2ZPI B;  2KVQ G;  4OMN A;  1W2B A;  2LT1 A;  3EFR A;  5GAN f;  5CVI A;  2DF6 A;  5AYF A;  4PJO E;  3EH2 A;  4CC3 A;  1M2O A;  1FX7 A;  4M7A G;  4JLG A;  5GAN 8;  1VYT A;  3PMT A;  3EAE A;  3V7R A;  3LX7 A;  1B34 B;  2CGH A;  2P4T A;  1JJ2 P;  4BDY A;  3CCJ Q;  1VQ6 T;  2DVJ A;  1H3Z A;  1K1Z A;  3CQT A;  1QVG S;  4HT9 A;  2DXU A;  3M59 A;  1YIT A;  3L2R A;  1D0Z A;  2R5A A;  3G7Z A;  4M75 A;  3H0I A;  1G2B A;  1V1C A;  1KG1 A;  1NLO C;  2FRY A;  4X34 A;  1VQ7 T;  4Z88 A;  4KUI A;  2QEX Q;  1Y96 A;  1RL2 A;  4LXC A;  2EKO A;  1I81 A;  2MCN A;  5CCA A;  1PD0 A;  5GMK e;  3O5Z A;  4J6Y A;  2FVU A;  4N4H A;  4CRI A;  2L0A A;  3QSU A;  1U1T A;  4J7I A;  1QKW A;  2EBP A;  4OB0 B;  3EG9 B;  1OI1 A;  1SG5 A;  3URG A;  3QJ6 A;  4E7Z A;  3MCA B;  4DBQ A;  2MF2 A;  2VGM A;  1PG5 B;  3JCM d;  5LJ5 h;  2LQW A;  1TU0 B;  1JXO A;  1N27 A;  5KYN A;  5GAO m;  1VQ5 Q;  2E41 A;  2FYK A;  3OW2 A;  2DLP A;  5GAN 4;  3VS5 A;  5GAN j;  4M75 G;  1PSF A;  3RMQ A;  4LUD A;  3OBW A;  2EQK A;  2K2V A;  3JB9 J;  2LZ6 B;  3HRU A;  2O9S A;  4M77 G;  4OML A;  2A28 A;  3V7S A;  5IHI A;  3CD6 Q;  2HL3 A;  4C92 G;  4E6R A;  1WPY A;  4AG1 C;  5HKC A;  4NOY A;  4EPC A;  2W10 A;  2C0O A;  2QGF B;  3BDL A;  3JRZ A;  3HP9 A;  4HCZ A;  2MI6 A;  3UT1 A;  2PZ1 A;  1YWP A;  4HA8 A;  1VQP T;  1AVZ C;  4FM4 B;  2B8A A;  1HD3 A;  3FJP A;  4C0D C;  1VQL A;  1Q7Y R;  1KJW A;  3JAM E;  3CME T;  2EKH A;  4M78 C;  2DYI A;  4Z8A A;  3I56 A;  4JRQ A;  5LJ5 f;  1D3B B;  3MP6 A;  4M77 B;  5GMK i;  2CUB A;  3X24 B;  1WHH A;  2D1X A;  3SWN A;  5I21 A;  2E6N A;  1OX8 A;  1T3S A;  1M30 A;  5FW9 A;  4HT8 A;  3PVQ A;  3EG1 A;  4FW2 A;  2VWF A;  4XK8 E;  3I55 T;  3QPH A;  4FIB A;  4Y91 A;  2OTJ T;  3G6E T;  3PTA A;  3JCM J;  3S3N A;  4EIK A;  2XG8 D;  1NE8 A;  4OMQ A;  4EMK C;  3CMA T;  4GY5 A;  4LDV A;  1ZSZ B;  4JS4 A;  4XU0 A;  1YIJ A;  1YHQ Q;  1SKU B;  4C0Z A;  1BYM A;  1MMA A;  2ECZ A;  5CIU A;  3G71 A;  3QYG B;  1UJY A;  4LE9 A;  4B9X A;  4ZNX A;  2F2X A;  4M78 D;  2HCK A;  1VQ5 A;  2CZ6 B;  3HFN A;  4JS5 A;  1BIB A;  4LDY A;  3DB3 A;  2SEM A;  1M27 C;  3ME9 A;  2EYY A;  1Q81 R;  3JCM Q;  4PJO D;  2RJF A;  1X6B A;  1QP2 A;  3CXC S;  1NYF A;  4PJJ A;  3V7C A;  3LYI A;  3CMA Q;  2LT4 A;  4BE1 A;  3KXT A;  1PNJ A;  3CCJ A;  1TUG B;  2EYX A;  3ZFJ A;  4M77 E;  3CC2 Q;  1MND A;  4JRK A;  4GLK A;  2LP5 A;  4EMK B;  4M78 F;  3CME Q;  4A4E A;  2KK4 A;  2V1Q A;  3CCL T;  1RAF B;  2RJC A;  1Y07 A;  2WSE E;  4ANJ A;  4JRP A;  1UGQ B;  1ZBX A;  1JBM A;  5GAM d;  5HY6 A;  2HEQ A;  5LJ5 g;  2A37 A;  2HDA A;  3CEY A;  1NEB A;  4RTX A;  1MGQ A;  1TTH B;  4C5I A;  3Q1J A;  5KYX A;  1N8R U;  1M1K C;  3FDR A;  2MIO A;  3CC4 A;  1M1G A;  2ZPB B;  1UUE A;  1ZUY A;  1VQL Q;  4J8O A;  2VVK A;  4MML A;  2GFU A;  4PJL A;  3LH0 A;  3ZEH A;  5GAM h;  2J7I A;  3RMS A;  1AOJ A;  2VGN A;  3JCM P;  4OB1 B;  1OU8 A;  1VQ7 Q;  1WJQ A;  3A8M B;  4RUG A;  1IRE B;  4C8Q E;  2RHY A;  1FXX A;  2J6K A;  2KYM A;  4LDW A;  1TSF A;  2FEI A;  2X4W A;  5I22 A;  3CCM Q;  1MMN A;  4AT1 B;  2Y4X A;  3M55 A;  5CAI A;  5GMK j;  1D09 B;  1QLY A;  4M7A F;  2P0K A;  3CC7 T;  2DNU A;  1PRM C;  2BKD N;  2J06 A;  3C4S A;  3OSV A;  2BE7 D;  3TQ7 P;  4M7A D;  3PFS A;  2RQW A;  1G3T A;  1X2K A;  2KRO A;  4O5V A;  5M9O A;  4IUQ A;  2DEU A;  3LWI A;  1IGU A;  2YSQ A;  1NBE B;  2P84 A;  4F14 A;  1QCN A;  2L3R A;  2RI3 A;  2O9V A;  5EG2 A;  1M4Z A;  3LGL A;  4MMK A;  2ED1 A;  4BI8 B;  3WXM B;  2RPN A;  4X1V A;  2LTO A;  4PJN A;  2DVE A;  1WLP B;  2O01 E;  3P8H A;  2CUD A;  3C12 A;  2CKK A;  2FG0 A;  4AFS C;  4Y28 E;  1C6V X;  4QQG A;  3MKD A;  2JMC A;  1VQ9 A;  2CH4 W;  4JZ3 A;  1Q7Y C;  3QII A;  4XU3 A;  2VB6 A;  1YWO A;  3CCV A;  1KQS P;  2DET A;  2HAX A;  1UEC A;  1W4S A;  4QVZ A;  1VQ6 Q;  1QVP A;  1YJ9 Q;  1YI2 Q;  4J9F A;  2GBQ A;  2O2O A;  1K8A R;  1M3C A;  3CCR T;  5I2S A;  1UGV A;  2CRE A;  3H0F A;  3VYH B;  2PU9 B;  3TSZ A;  1X75 C;  3OSS C;  1M1F A;  1DJ7 B;  3JCM X;  4IKF A;  4ME7 A;  1ABQ A;  3I9Q A;  1K73 U;  2V26 A;  5GAN 2;  2YUP A;  1SF9 A;  2R5M A;  2AIR B;  3M5A A;  3VUZ A;  1QQJ A;  3S6W A;  1WHM A;  4LN2 A;  1VA7 A;  2BE9 B;  2JT4 A;  4R56 A;  4XTY A;  3CD6 T;  4MDX A;  1VQ9 T;  2D6F A;  1WHG A;  3H0H A;  3M0S A;  3NFC A;  1X6G A;  3M0P A;  3M56 A;  5FRM A;  3JB9 F;  1OOT A;  3G71 T;  2LNH B;  2V8I A;  1ZUK A;  2EPD A;  3S3M A;  3HPW A;  2EYW A;  3PT9 A;  3NGP A;  2KYB A;  2RMO A;  5LJ3 j;  2YRD A;  2DFU A;  2GQI A;  3QWY A;  5A0D A;  1Y0M A;  1YJN T;  1YJW T;  1KK7 A;  2KSS A;  2EVR A;  5KYU A;  3VYG A;  3EFO A;  2MMP A;  3PIP A;  3VS0 A;  4IUR A;  4HKE A;  1IB8 A;  3LGF A;  2YDL A;  4FYX B;  2EJ9 A;  2KXD A;  4XTU A;  1RAB B;  1U8R A;  3M54 A;  3QBY A;  4OGE A;  1VQ5 T;  1YCY A;  1M90 U;  1UJ0 A;  3VS2 A;  4KH0 B;  1IGQ A;  2D0Q B;  3E19 A;  1KQS A;  1QMC A;  1RAD B;  2JTF A;  1QVF P;  4M7D E;  4F7U A;  1G83 A;  2K5F A;  2NUP B;  4DBR A;  2VXF A;  2COZ A;  1I5O B;  3JB9 H;  2ZZD A;  3HKS A;  5J39 A;  1OQK A;  2ZPF B;  2J6F A;  2JZ2 A;  2LX9 A;  2JUF A;  1SPK A;  4KGV B;  3VJP A;  5FU7 C;  3RIR A;  4JUV A;  3PNW C;  1Y96 B;  3T9N A;  2DJZ A;  2AKL A;  1SEM A;  4PJO A;  2HBW A;  1K73 R;  4R0K A;  2NUT A;  2DEQ A;  2YRC A;  1KC8 U;  3GP8 A;  1ZA1 B;  4M75 E;  1RAC B;  1RUW A;  2CT4 A;  4XU2 A;  2IIM A;  1VQN T;  2WSF E;  2YRV A;  2RQV A;  5LJ3 g;  4FCY A;  1W2B P;  2DJQ A;  2FZG B;  2RQR A;  1NJI R;  3TEE A;  1PKS A;  1O75 A;  2Y90 A;  4BE0 A;  4A54 A;  2V8J A;  4RG8 A;  2MYS A;  1AEY A;  4J9B A;  3RES A;  1VQK Q;  2O4X B;  1W1F A;  4M78 E;  3TSW A;  2HMA A;  2RHU A;  4LDX A;  4DOV A;  4RTV A;  1QWE A;  4AMC A;  3R6O A;  1M9S A;  5FRN A;  4HVV A;  1Q86 U;  1G3S A;  2K3B A;  4OB3 B;  1K4U S;  2YXY A;  4XTV A;  1T0H A;  5KCH A;  3REB B;  5KYW A;  3JV3 A;  2DRM A;  1SHG A;  4BB7 A;  3JB9 I;  2MAM A;  3QZ5 B;  3R6N A;  1JRI A;  4GBQ A;  2LCL A;  2QA4 Q;  4A63 B;  3X28 B;  2EQU A;  5GMK m;  2ESW A;  1LJO A;  3FB9 A;  1QCF A;  1Q81 U;  1VQN A;  3M57 A;  3QJY A;  3QDR B;  1VQ8 A;  1KQ2 A;  1N5Z A;  2E3I A;  4D8K A;  3E9F A;  1OV3 A;  3V8L A;  2X3X D;  3REA B;  2A3L A;  1RI9 A;  2RQT A;  2EGC A;  3UAT A;  4L59 A;  2MOX A;  2XU8 A;  8ATC B;  3N5B B;  3GF5 A;  2KRS A;  3CD6 A;  1J3T A;  1YIT T;  5FU6 B;  4MDW A;  2DRK A;  2CZ1 B;  1KC8 R;  4L6V 5;  3SWN C;  1R0C B;  4OMM A;  3OYG A;  4FYW B;  2ROT A;  2KT1 A;  2QDY B;  3WVD B;  4PK4 A;  1RLQ C;  5LJ5 d;  2B86 A;  4RCC A;  3EGX A;  2MWO A;  1I1J A;  1VQP A;  1BI1 A;  1QKX A;  3U23 A;  2E6Z A;  2KXC A;  2F2W A;  2LDM A;  4ZTF A;  3CME A;  3CCV Q;  2KI7 A;  2G6F X;  4HXJ A;  2CP3 A;  5D6W A;  1FMV A;  4C8Q F;  2JOY A;  4ESR A;  3CC7 A;  4ORZ A;  2J05 A;  2CT3 A;  2DXT A;  2DE0 X;  4M75 D;  5GAM j;  1KFZ A;  2K4Y A;  3PVL A;  1M2V A;  5IT9 E;  4M75 B;  2ENM A;  3M4Y A;  3J7A F;  4D6W A;  3J80 E;  2Y4Y A;  5LJ3 h;  1PSE A;  5GAO l;  3CPW S;  2DA9 A;  4CC4 B;  2LJ3 A;  4FYV B;  1YCS B;  3VS3 A;  4F16 A;  1I8F A;  1BI2 A;  2HKN A;  4BUG A;  2RJE A;  3NMZ C;  2PVD B;  3LH5 A;  2HNI A;  2BUD A;  4C5E A;  2KE9 A;  1AWO A;  3KFV A;  3A98 A;  3OS0 A;  1U5S A;  3JCM g;  1AWW A;  1VYU A;  1MMD A;  4M75 F;  3NTK A;  1E6H A;  3X25 B;  1VQ6 A;  2QEX T;  2LQ8 A;  4C8Q D;  3BY7 A;  3MET A;  2DIQ A;  3CCM A;  4M77 A;  3VS6 A;  2GF7 A;  1IHV A;  3UA6 A;  1PD1 A;  4A4F A;  4M7D F;  3QXE B;  3FRN A;  3CPW A;  1UGR B;  2GNC A;  1W2B S;  2NLU A;  3OYE A;  2EFI A;  2LC4 A;  2F2V A;  1VQK T;  4C8Q G;  3S3O A;  2D0N A;  1XOV A;  2YLC A;  2CDT A;  2DPP B;  1ZBJ A;  2NUT B;  2Z0W A;  3RER A;  3VV0 A;  2QQ9 A;  1BCO A;  1EFN A;  1M1K R;  4RKU E;  1JJ2 A;  2WAC A;  3EG9 A;  4ZGE B;  1S1N A;  2XI9 A;  1RAA B;  4QVC A;  1WX6 A;  1OX9 A;  1N6A A;  3KUF A;  4CC2 A;  3CC4 T;  1TUD A;  2IPO B;  3P8B B;  1GCP A;  4ATO A;  1M8V A;  2GGR A;  3CCS A;  2RO0 A;  4A4K A;  2EJG A;  5D7U A;  1VQM Q;  1WQ7 A;  1S72 Q;  5GJW B;  2HQX A;  3A8G B;  2NYS A;  3D7S B;  3I55 A;  1VQL T;  2DTI A;  1H8K A;  1QWF A;  1MUZ A;  3OS5 A;  3OYI A;  2BZ8 A;  1E7O A;  4OGC A;  3EG2 A;  2COY A;  4PJM A;  2HQE A;  4HVU A;  1YNZ A;  2L8D A;  1N8R R;  4F17 A;  4OF1 A;  3ZBD A;  3IQL A;  1S72 A;  2SRC A;  4RTT A;  4BI3 A;  4M7D C;  3UF4 A;  2EGE A;  3OB9 A;  2RM4 A;  4M7A C;  9ATC B;  5IXB A;  1NZ9 A;  4MZT A;  1YJN Q;  5FU6 C;  2KEA A;  1K9M R;  1TS9 A;  3OW2 S;  2JTE A;  2GFA A;  1ZHI A;  2XHC A;  1ZLM A;  1YIJ T;  4RTY A;  3CC4 Q;  3CCU A;  3CCE A;  1JXM A;  4R55 A;  3I5R A;  1QVF A;  4DA4 A;  4BE2 A;  2I2L A;  4PJO G;  5A0L A;  5LJ5 j;  4NS5 A;  4J9D A;  1MMG A;  4DEX A;  5KH6 A;  3H8Z A;  3RDV A;  2HSE B;  2XDD A;  3H6Z A;  4FYY B;  2RA2 A;  3L2Z A;  2XK0 A;  2QDL A;  4E7K A;  1W70 A;  1H92 A;  2M0Y A;  1LNX A;  2K5I A;  4BI4 A;  4GLM A;  3QDF A;  1BB9 A;  1U06 A;  3EG3 A;  1RAG B;  1I0C A;  2C0I A;  4FW1 A;  2XIC A;  1GCQ A;  1PCX A;  2KT8 A;  2JM9 A;  1GFD A;  5IHK A;  3EGU A;  4B6M A;  2DL8 A;  4PLI A;  1VQM A;  3HSB A;  2PVG B;  4E47 A;  3L2W A;  2RK2 A;  3CC2 T;  5L23 A;  2ZGW A;  2O4X A;  1WYX A;  1C1A A;  2QQA A;  4V2S A;  1GXI E;  2RI5 A;  1JB0 E;  4JZ4 A;  3FEO A;  4HCB A;  1IXD A;  3CCE T;  3MP8 A;  1KQS S;  2RK1 A;  1X6O A;  3L2V A;  3NHN A;  4JPB W;  4X9D A;  1UB4 A;  3CPF A;  3RR6 A;  3OA6 A;  1UEB A;  3CBO A;  3CCM T;  4EMG A;  1B07 A;  3CBP A;  3H9N A;  3E2U A;  3C95 A;  3P8D A;  1YFN A;  4K11 A;  1YI2 A;  4XTX A;  1EX4 A;  3LWH A;  2ROL A;  2DX1 A;  1AWJ A;  4PL6 A;  4C92 A;  3SFM A;  2GQV A;  4KRT A;  2KY9 A;  2MPX C;  1PC0 A;  1D0X A;  4ZN3 A;  3EG0 A;  2FPE A;  4C8Q C;  1Q82 R;  4M7A A;  4M75 C;  3OYK A;  3JB9 D;  1YN8 A;  5GAN d;  4O6J A;  2O88 A;  4EMH A;  1WHL A;  1M8M A;  4FSX A;  5I11 A;  1Q7Y U;  1PWT A;  4MZP A;  3RUX A;  2DIL A;  1CSK A;  1KHC A;  1IHW A;  4JJN K;  4FSS A;  1Z9Q A;  1XQH A;  4KGZ B;  3DB4 A;  2KNB B;  1G5V A;  3A8L B;  1WQW A;  1D1A A;  2LRQ A;  1WXU A;  1ZX6 A;  2CZ7 B;  1TUC A;  3VS4 A;  2PNI A;  5GAN 3;  3QWX X;  2XID A;  2DBM A;  2P4R A;  2YHT A;  4M7D G;  4RTZ A;  1HXD A;  1VYV A;  3VS7 A;  1IO6 A;  3CCS Q;  1RLP C;  4PLL A;  5GAN 7;  1RAE B;  1JU5 C;  2A08 A;  3CCU Q;  2QAS A;  1D1B A;  4F7U E;  2QA4 T;  3C94 A;  1D3B A;  4L5G A;  1M90 C;  4OMO A;  3SWN B;  2RH2 A;  1GL5 A;  2QQS A;  1VQO A;  1OPL A;  5AT1 B;  2J6O A;  4M4Z A;  2GCX A;  3CCL Q;  5CQY A;  1TG0 A;  1QCO A;  5KYW B;  1UHF A;  5GAN h;  1Q86 C;  1KQ1 A;  3HTR A;  5GAN 5;  1PM3 A;  4X9C A;  2ZPH B;  4AFU C;  3M58 A;  2GTJ A;  4ELZ C;  2DM1 A;  1Y71 A;  4F7U G;  1X43 A;  2EQI A;  1CKA A;  3G6E Q;  2K9G A;  5EC7 A;  4AG2 C;  3JCM f;  4C5H A;  1NPR A;  4B9W A;  3TRE A;  3ZL7 C;  2MK5 A;  1S72 T;  1PKT A;  5J3B A;  2ATC B;  2OI3 A;  1TXQ A;  2VXE A;  4XAX B;  4E7S A;  3ASK A;  1AT1 B;  1WFW A;  1Q81 C;  2YLB A;  2CP6 A;  1BU1 A;  1UG1 A;  3X26 B;  2K57 A;  4M78 A;  2E5K A;  5FU7 B;  2A7Y A;  2COW A;  1HK9 A;  2EYQ A;  3A5Z B;  4J9I A;  2XKO C;  3GLX A;  2KAF A;  1VIF A;  1ZSG A;  3QZ9 B;  4KUL A;  2PVO B;  3NTI A;  5KYU B;  3HL8 A;  4DQ2 A;  1NJI U;  5GJV B;  2MWP A;  2AK5 A;  2OTL A;  3FIF A;  4J9C A;  2FZC B;  4J6X A;  4Z89 A;  1X69 A;  2CP5 A;  4M7D D;  5CKD A;  1P92 A;  1WZO A;  3AT1 B;  4PKC C;  3OY9 A;  1UTI A;  1Y57 A;  3G4S A;  2XDB A;  1M5Q 1;  3CXC A;  2K79 A;  2FB7 A;  3MEA A;  3TU4 K;  1RAI B;  1NM7 A;  4WTO B;  1TWB A;  2AT1 B;  1VQK A;  1KSW A;  4P5N A;  3E9G A;  1W6X A;  5IHN A;  5KYY A;  2M02 A;  4WF2 A;  3RKW A;  2YT6 A;  2XMF A;  3JCM e;  5D6X A;  3THK A;  2KMT A;  3VUB A;  2G3R A;  3EGD A;  1GFC A;  2KGT A;  4XQ3 A;  1AZG B;  2BIV A;  2L5Q A;  3QYH B;  2D8H A;  1SHF A;  1X01 A;  1RI0 A;  2X35 A;  1Q95 G;  4HCK A;  4ZGJ B;  2BZX A;  1N8R C;  1M1K U;  3CCU T;  4J9H A;  3EHR A;  2CH4 A;  1SRL A;  4LNP A;  1V76 A;  4RMO A;  4F7U F;  4KUD K;  3OYB A;  3NPF A;  1WA7 A;  2XD0 A;  5LJ3 d;  1UGP B;  4WCI A;  1VQO T;  1K0X A;  1ZSZ A;  1QVG A;  1M3B A;  6AT1 B;  1NYG A;  3JCM c;  4AFZ C;  4M7D B;  4BY6 B;  1ARK A;  3OYH A;  1MV3 A;  4DOW A;  4XTW A;  4J9E A;  2DTO A;  4C0D B;  2DTH A;  3MJX A;  2HL5 C;  1GCQ C;  2K5L A;  3CCJ T;  1B3Q A;  1IZ6 A;  2X4X A;  5LL6 S;  2VAS A;  1GBR A;  2ZAE A;  3OS2 A;  1NLP C;  1G8X A;  4XU1 A;  3RKX A;  2OTJ A;  1AHJ B;  2KRN A;  3CCQ A;  1UHC A;  5GAO p;  2DBK A;  4EMK A;  3GBQ A;  2CP2 A;  2DZ9 A;  1MHN A;  2JJ9 A;  3JSC A;  1UFF A;  1K9M U;  5GMK h;  3E1S A;  2E3H A;  4ZN1 A;  2IVW A;  3A8O B;  3DLM A;  4PNO A;  3VS1 A;  5GAO n;  4OMF B;  2VC8 A;  2NUP A;  2HD0 A;  5FLX E;  3WVE B;  2QG9 B;  1WNL A;  2DZC A;  2FPD A;  2LQK A;  4FT4 A;  2E5Q A;  4CC7 A;  3G6E A;  4LD9 K;  1K76 A;  4QW2 A;  2PUK B;  4QKU A;  3G71 Q;  4IUP A;  2E65 A;  2ZCF B;  3CCQ Q;  2QI2 A;  2VYT A;  1YJ9 T;  2RD1 A;  3O8V A;  2L3Q A;  2DL5 A;  1WI7 A;  2AZV A;  1VQ8 Q;  1VQ8 T;  3ULR B;  4BD3 A;  2OTL Q;  8AT1 B;  4IIM A;  1Y7X A;  2X3W D;  2QAZ A;  4EDU A;  1HJD A;  2RQU A;  2RHZ A;  1FMW A;  3FLG A;  4C0F A;  2A36 A;  2C06 A;  1T0J A;  2M0O A;  4QT7 A;  4E2F B;  3CCE Q;  1BI3 A;  2EQM A;  4E7H A;  3CCQ T;  3GPL A;  3CPW P;  1WJR A;  5IAY A;  2H3J A;  2DYB A;  1V29 B;  1XNI A;  3I55 Q;  2QQR A;  2JS0 A;  4J83 A;  2F5K A;  2YUQ A;  5GAM f;  1BBZ A;  3OYC A;  4VUB A;  2X9H A;  2DK3 A;  2NWM A;  4JRI A;  2JXB A;  1LOJ A;  3SHW A;  1UE9 A;  5GMK l;  3DKM A;  4IUU A;  1VQ4 Q;  2V8K A;  4PJO C;  4M78 B;  1KD1 U;  2EYZ A;  5LJ3 f;  4FT2 A;  5ECA A;  4HVW A;  5HCK A;  5LJ3 e;  1AD5 A;  2AHJ B;  2JVV A;  1EZZ B;  5GAM g;  2RF0 A;  3QKJ A;  3A1P A;  3X20 B;  1VQ7 A;  1M2V B;  3M0U A;  2H3E B;  2VUB A;  3CXC P;  3CC7 Q;  3UDC A;  2L89 A;  2HQH A;  4E7J A;  4DBH A;  2EW3 A;  1QVF S;  3RNJ A;  2OJ2 A;  2EGA A;  3M53 A;  2YUO A;  1C0M A;  1KHI A;  3CCL A;  2A0F B;  2FPF A;  3OMG A;  3TVT A;  4KBM B;  2EAY A;  4FL6 A;  4CI0 C;  2M16 A;  1UGS B;  4N0A C;  5I2M A;  3H41 A;  2HZY A;  2QTV A;  4JJD A;  3OMC A;  2RHI A;  2DL7 A;  2DL3 A;  3L2U A;  1UDL A;  2ABL A;  1VQ9 Q;  1K73 C;  3JCM h;  1AWX A;  2FRW A;  3I35 A;  4OB2 B;  3QUI A;  2RNA A;  3J81 E;  2E10 A;  3MPU B;  1NPP A;  3FC3 A;  2M9U A;  1SSF A;  1TOV A;  1KIK A;  4JJB A;  4J7F A;  4II1 A;  3BW1 A;  4FU6 A;  4ELY C;  3PIO A;  2L3S A;  1LPL A;  3CBM A;  5HK3 A;  2P0Q A;  2X4Y A;  2R58 A;  1JJ2 S;  2L3P A;  2KDS A;  2DIG A;  2FZK B;  2EQJ A;  4RG2 A;  3FJ5 A;  3V8K A;  1A0N B;  1IRX A;  2K3X A;  2CSI A;  2HKQ B;  2JW4 A;  4N4G A;  1VQM T;  5GAO r;  1EIF A;  3CCR Q;  4M7D A;  3MEV A;  5FWB A;  5HK0 A;  4JDS A;  3A8H B;  1N9S A;  1KC8 C;  1Z9Z A;  1YJ9 A;  2YUN A;  2OAW A;  4LD6 A;  4D8D A;  1K9M C;  2ED0 A;  3M0R A;  1CKB A;  1WDX A;  3EHQ A;  1KD1 R;  2KRM A;  3QO3 A;  2K7A A;  2QK0 A;  1XJW B;  2I0N A;  2DKG A;  2DL4 A;  5DLQ E;  3HRT A;  1H3H A;  1WIE A;  4N0A A;  1VIE A;  3PE0 A;  5DLO A;  4PFO A;  2DD4 A;  2M51 A;  1U1S A;  4IUV A;  4DEY A;  5KE2 A;  1ZQ1 A;  2E70 A;  4NL2 A;  1R0B G;  1X2Q A;  4F7U B;  3OYY A;  2P0P A;  1BIA A;  4C0G A;  1ZSZ C;  4M7A E;  1PHT A;  2F1L A;  1K0S A;  5CKE A;  2RJD A;  2AZS A;  4BDZ A;  1G3W A;  2OTL T;  3M0T A;  2OAU A;  2IG0 A;  2JTM A;  5KCO A;  3MEU A;  1BK2 A;  5IH2 A;  2LCS A;  5DY9 A;  1GBQ A;  3G4S T;  2K2M A;  4ZTJ A;  5CR2 A;  4F04 B;  3ER0 A;  3GOX A;  3CCV T;  4JLI A;  1VQ4 A;  2DAQ A;  2EWN A;  1HSQ A;  3BDU A;  3CCS T;  1FMK A;  4IUT A;  1U3O A;  4C92 C;  4BAC A;  3INZ A;  3CC2 A;  3VU3 C;  4LDU A;  1Q86 R;  3SEM A;  4A4G A;  1KD1 C;  2L2P A;  1WHJ A;  2GTO A;  3HHT B;  1QVG P;  5CQX A;  1I07 A;  1MNE A;  1YBY A;  1YHQ A;  1OU9 A;  2JNG A;  1OUL A;  1RAH B;  3PMI A;  1Q82 U;  2HSP A;  3L1A A;  5IXF A;  1VOM A;  3VKI A;  3OS1 A;  2X4J A;  2WSC E;  5KYY B;  1M90 R;  2X51 A;  1QW1 A;  3OBY A;  3EFS A;  3EGD B;  3OQ5 A;  2AKK A;  2LCC A;  2CP0 A;  1LVK A;  2DD5 A;  2BTT A;  2QXF A;  2RB6 A;  4NL3 A;  1YP5 A;  4Z02 A;  1BCM A;  2F69 A;  4PFP A;  4C92 D;  1SRM A;  3SD4 A;  5C6S A;  1SSH A;  4MZM A;  3LLR A;  2H8H A;  1YJW Q;  3NTH A;  2XDP A;  2BZY A;  4Y92 A;  4M77 F;  1HYO A;  1K9A A;  3SB2 A;  2VKN A;  2D8J A;  4AFQ C;  2EJF A;  2V1R A;  5CKB A;  5C0M A;  3G4S Q;  1QP3 A;  3G1J A;  5CO7 A;  1B34 A;  3UA7 A;  5KYX B;  2PTK A;  2JM8 A;  3V8J A;  5CK9 A;  1JO8 A;  1O9S A;  2E4H A;  3BFM A;  1YHQ T;  3VRZ A;  4OP0 A;  3HFO A;  2E64 A;  2OTJ Q;  4RCB A;  3BE3 A;  2CYZ B;  3EFO B;  2QA4 A;  4C92 B;  3OYD A;  1R8O B;  1K8A U;  3M0Q A;  2PQW A;  2LX7 A;  5FWC A;  3OYM A;  5GAO q;  1X27 A;  3L2Q A;  2KQW A;  2K6D A;  3VRY A;  1B7T A;  1OZ2 A;  2O31 A;  3JCM W;  1YJN A;  1FYN A;  1G3Y A;  2QQB A;  2RN8 A;  1OZ3 A;  1WJS A;  2CP7 A;  3RBB B;  2KR3 A;  1PRL C;  1BKB A;  3EGX B;  1MV0 B;  4PJO F;  4JJC A;  1JEG A;  1T3L A;  4E7L A;  4C92 F;  4YTL A;  4E7I A;  1NG2 A;  3MHX A;  1NJI C;  2CSQ A;  1TH7 A;  2RI2 A;  5KE3 A;  3QHS A;  1YI2 T;  5IN1 A;  3CCR A;  2E1H A;  3OYJ A;  1VQN Q;  3JCM b;  2M1H A;  2PUO B;  1YJW A;  3UPU A;  2JS2 A;  3OYL A;  2RHX A;  3M4G A;  1ZUU A;  1H64 1;  1VUB A;  4TVR A;  2QYZ A;  1N9R A;  1Q82 C;  3L42 A;  4HCC A;  1YIJ Q;  3GIB A;  5GAM e;  2DXC A;  3QG1 A;  3OW2 P;  2R57 A;  2LMJ A;  2DER A;  2FO0 A;  1OPK A;  1R77 A;  4LUE A;  1VQO Q;  3OYN A;  4RTW A;  3JCM V;  3F70 A;  5GAN g;  4J5Y A;  4A4H A;  1AZE A;  5L8R E;  2DO3 A;  2QEX A;  4RTU A;  4XTZ A; 
#chains in the Genus database with same CATH homology
 1H8K A;  4IIO A;  1QWF A;  1MUZ A;  2CH4 W;  2L3Q A;  4JZ3 A;  2BZ8 A;  1E7O A;  2DL5 A;  1WI7 A;  1YWO A;  2AZV A;  3ULR B;  1ABO A;  1UEC A;  3EG2 A;  4J9G A;  4HVU A;  2C0T A;  1YNZ A;  4IIM A;  4F17 A;  2X3W D;  4J9F A;  2GBQ A;  1HJD A;  3IQL A;  1GRI A;  2RQU A;  2SRC A;  2O2O A;  4RTT A;  1M3C A;  3UF4 A;  1M3A A;  2A36 A;  1UGV A;  1T0J A;  4QT7 A;  2EGE A;  2CRE A;  2LJ1 A;  3H0F A;  5IXB A;  2LJ0 A;  2JMA A;  2KEA A;  3TSZ A;  2DMO A;  4OMP A;  2JTE A;  2LQN A;  1LCK A;  2DYB A;  1ZLM A;  4RTY A;  1JXM A;  3I5R A;  1ABQ A;  2JS0 A;  3I9Q A;  2YUQ A;  1E6G A;  1OEB A;  1BBZ A;  4J9D A;  1JQQ A;  4DEX A;  2YUP A;  2NWM A;  2JXB A;  3C0C A;  3SHW A;  1NEG A;  1UE9 A;  2QDL A;  1W70 A;  1H92 A;  2M0Y A;  4LN2 A;  1VA7 A;  2KBT A;  2JT4 A;  2EYZ A;  1WXB A;  3H0H A;  3M0S A;  5ECA A;  4HVW A;  5HCK A;  1X6G A;  3M0P A;  1AD5 A;  4GLM A;  1BB9 A;  1U06 A;  2W0Z A;  2RF0 A;  3EG3 A;  1OOT A;  1I0C A;  2C0I A;  2LNH B;  3M0U A;  1ZUK A;  1GCQ A;  2KT8 A;  2EPD A;  2JM9 A;  2NUZ A;  1GFD A;  1WXT A;  2EYW A;  5IHK A;  3EGU A;  2DL8 A;  2EW3 A;  3NGP A;  2KYB A;  3RNJ A;  2RMO A;  2OJ2 A;  2EGA A;  2YUO A;  3I5S A;  2GQI A;  2FPF A;  3QWY A;  3TVT A;  1Y0M A;  5L23 A;  4OMN A;  2EVR A;  1WYX A;  3H41 A;  2DF6 A;  4JJD A;  4JZ4 A;  3VS0 A;  2DL7 A;  2DL3 A;  4CC3 A;  2YDL A;  2KXD A;  1UDL A;  2ABL A;  1VYT A;  1AWX A;  2FRW A;  3I35 A;  2RNA A;  3NHN A;  1UJ0 A;  3VS2 A;  4JPB W;  2DVJ A;  1KIK A;  1K1Z A;  4JJB A;  3CQT A;  1G83 A;  2L3S A;  3H0I A;  1G2B A;  1B07 A;  1V1C A;  1NLO C;  2L3P A;  2FRY A;  4Z88 A;  2J6F A;  3FJ5 A;  1SPK A;  1A0N B;  2MCN A;  4K11 A;  3O5Z A;  2CSI A;  2JW4 A;  2L0A A;  2ROL A;  2AKL A;  1QKW A;  1AWJ A;  2DX1 A;  1SEM A;  2HBW A;  2EBP A;  4R0K A;  4KRT A;  5FWB A;  3EG0 A;  2FPE A;  1Z9Z A;  1RUW A;  2YUN A;  2OAW A;  2CT4 A;  1YN8 A;  4D8D A;  2IIM A;  2ED0 A;  2RQV A;  3M0R A;  2O88 A;  1CKB A;  1WDX A;  2DJQ A;  3EHQ A;  2KRM A;  2LQW A;  1M8M A;  5I11 A;  1PWT A;  2RQR A;  2DIL A;  1JXO A;  1CSK A;  1PKS A;  2K7A A;  4FSS A;  1Z9Q A;  2I0N A;  2DL4 A;  1AEY A;  4J9B A;  2KNB B;  1W1F A;  2DLP A;  1WXU A;  1ZX6 A;  3VS5 A;  1H3H A;  3TSW A;  1TUC A;  3VS4 A;  2PNI A;  1WIE A;  4LUD A;  3QWX X;  4RTV A;  2DBM A;  2P4R A;  1QWE A;  3PE0 A;  4RTZ A;  2LZ6 B;  1VYV A;  3VS7 A;  1IO6 A;  1RLP C;  4HVV A;  1JU5 C;  2O9S A;  2A08 A;  2M51 A;  4DEY A;  4OML A;  2A28 A;  2K3B A;  1K4U S;  4OMO A;  1X2Q A;  5IHI A;  1T0H A;  4E6R A;  4AG1 C;  3REB B;  1GL5 A;  2W10 A;  2C0O A;  1PHT A;  3JV3 A;  1K0S A;  2DRM A;  1SHG A;  1OPL A;  2AZS A;  2J6O A;  4M4Z A;  1TG0 A;  2PZ1 A;  1YWP A;  3R6N A;  3M0T A;  4GBQ A;  1UHF A;  1AVZ C;  1HD3 A;  1BK2 A;  4A63 B;  5IH2 A;  2LCS A;  4AFU C;  2ESW A;  1KJW A;  2GTJ A;  2DM1 A;  1GBQ A;  1QCF A;  2EKH A;  2K2M A;  4Z8A A;  1X43 A;  2EQI A;  1CKA A;  2K9G A;  1N5Z A;  2CUB A;  5EC7 A;  4AG2 C;  1HSQ A;  2D1X A;  4D8K A;  1OV3 A;  2X3X D;  1FMK A;  3REA B;  1RI9 A;  2RQT A;  2EGC A;  3ZL7 C;  3UAT A;  1PKT A;  1T3S A;  2OI3 A;  1M30 A;  1U3O A;  2MOX A;  5FW9 A;  3PVQ A;  3EG1 A;  2VWF A;  1WFW A;  3SEM A;  2L2P A;  4EIK A;  2GTO A;  2KRS A;  1I07 A;  4OMQ A;  1BU1 A;  1UG1 A;  1J3T A;  2E5K A;  2DRK A;  4J9I A;  2HSP A;  5IXF A;  2ECZ A;  4OMM A;  2ROT A;  1UJY A;  1ZSG A;  2KT1 A;  4LE9 A;  2F2X A;  4ZNX A;  1RLQ C;  2HCK A;  2AKK A;  2B86 A;  5GJV B;  1I1J A;  2BTT A;  2AK5 A;  2SEM A;  1M27 C;  1YP5 A;  1QKX A;  2EYY A;  4J9C A;  3U23 A;  2KXC A;  4Z89 A;  1X69 A;  1X6B A;  1SRM A;  1NYF A;  2F2W A;  1SSH A;  1PNJ A;  1UTI A;  1Y57 A;  2G6F X;  4HXJ A;  2K79 A;  2H8H A;  2EYX A;  4ESR A;  2BZY A;  4ORZ A;  4Y92 A;  1NM7 A;  2J05 A;  1KSW A;  2CT3 A;  1K9A A;  2VKN A;  2LP5 A;  2D8J A;  2DE0 X;  4AFQ C;  1W6X A;  1KFZ A;  5IHN A;  2V1R A;  3PVL A;  2YT6 A;  2ENM A;  2V1Q A;  2XMF A;  3THK A;  1GFC A;  3UA7 A;  2KGT A;  1AZG B;  2HEQ A;  2A37 A;  2PTK A;  2JM8 A;  2DA9 A;  2D8H A;  2HDA A;  4CC4 B;  1JO8 A;  2LJ3 A;  1NEB A;  4RTX A;  1SHF A;  1YCS B;  3VS3 A;  4HCK A;  3VRZ A;  2BZX A;  4F16 A;  2MIO A;  3NMZ C;  1UUE A;  1ZUY A;  4J9H A;  3LH5 A;  2KE9 A;  3EHR A;  2CH4 A;  1SRL A;  3KFV A;  1AWO A;  4LNP A;  2VVK A;  3A98 A;  3M0Q A;  2LX7 A;  3NPF A;  1U5S A;  1WA7 A;  5FWC A;  2J7I A;  1AWW A;  4WCI A;  1K0X A;  1VYU A;  1X27 A;  1E6H A;  1AOJ A;  1M3B A;  1NYG A;  2K6D A;  3VRY A;  2O31 A;  4AFZ C;  4RUG A;  1FYN A;  2RN8 A;  1ARK A;  3VS6 A;  2J6K A;  1MV3 A;  3RBB B;  2KYM A;  2KR3 A;  1PRL C;  3UA6 A;  4J9E A;  2FEI A;  5I22 A;  1MV0 B;  4JJC A;  1JEG A;  1T3L A;  2GNC A;  1GCQ C;  1B3Q A;  1NG2 A;  1QLY A;  2CSQ A;  2F2V A;  2DNU A;  1PRM C;  2J06 A;  2D0N A;  1XOV A;  1GBR A;  2CDT A;  1ZBJ A;  1NLP C;  2RQW A;  1X2K A;  2KRO A;  1EFN A;  2KRN A;  1UHC A;  2JS2 A;  2YSQ A;  4F14 A;  1S1N A;  2O9V A;  2DBK A;  1ZUU A;  1WX6 A;  3GBQ A;  2ED1 A;  2RPN A;  4CC2 A;  1TUD A;  1UFF A;  4X1V A;  1GCP A;  2GGR A;  1WLP B;  2CUD A;  3VS1 A;  2LMJ A;  2FO0 A;  1OPK A;  5GJW B;  4LUE A;  4RTW A;  2FG0 A;  4AFS C;  2FPD A;  4CC7 A;  1AZE A;  1K76 A;  4RTU A;  2JMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...