3GBQA

Solution nmr structure of the grb2 n-terminal sh3 domain complexed with a ten-residue peptide derived from sos direct refinement against noes, j-couplings, and 1h and 13c chemical shifts, minimized average structure
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
57
structure length
57
Chain Sequence
MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GRB2
publication title Solution structure of the Grb2 N-terminal SH3 domain complexed with a ten-residue peptide derived from SOS: direct refinement against NOEs, J-couplings and 1H and 13C chemical shifts.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (signal transduction/peptide)
total genus 8
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1996-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3gbqA00
1IO6A 3CQTA 2DM1A 2FRYA 1X27A 4GLMA 3EG2A 2HDAA 1MV3A 2BTTA 2GQIA 2L0AA 3R6NA 4Z89A 3EG3A 1PRLC 3U23A 1CKBA 2D8HA 1ZLMA 4HVUA 4LE9A 3GBQA 4GBQA 2KRNA 2RPNA 4AG1C 1YNZA 1AD5A 4RTTA 2LQNA 3REAB 1FMKA 4OMMA 1W1FA 2CREA 2A28A 4J9GA 1AEYA 2RF0A 3REBB 4KRTA 1VA7A 2W0ZA 3I5RA 1UHFA 2RQVA 1H92A 1N5ZA 1M27C 4IIOA 4JPBW 2RMOA 2C0TA 1RI9A 2MIOA 4OMOA 3EG0A 2KROA 1T0JA 3QWXX 1QCFA 2CDTA 2NUZA 3VS4A 2O9VA 1V1CA 2HEQA 2RQTA 3A98A 1NEBA 2OI3A 2IIMA 1QKXA 2JS0A 1W6XA 2P4RA 1OPKA 2CH4W 3VS6A 1WLPB 2KT1A 2KRMA 2LJ1A 4E6RA 2DBKA 2MOXA 5FW9A 1M3CA 3PE0A 1PKTA 4LNPA 5HCKA 1TUCA 3M0TA 4J9EA 2JW4A 3M0RA 1GFDA 1PKSA 2JM9A 2KEAA 3LH5A 3TSWA 4K11A 1HSQA 1YWPA 2CSQA 2FG0A 4HCKA 1TUDA 1RLPC 2JTEA 3VS2A 1I07A 2K3BA 1BB9A 1B3QA 2JT4A 1S1NA 2RQRA 4AFSC 1SHGA 1NLOC 2JM8A 1UGVA 1LCKA 2DBMA 2JMCA 2OJ2A 1I0CA 2GGRA 1Z9ZA 4J9IA 2BZ8A 2DYBA 2LX7A 3M0SA 5IHKA 2B86A 3RNJA 1QWFA 4D8DA 1SHFA 2J6OA 2L3PA 2OAWA 2HBWA 4JJCA 2CUBA 4CC4B 1OEBA 1T0HA 2EQIA 4R0KA 5FWBA 2FPEA 2EBPA 2ED1A 1AOJA 1NYFA 4LN2A 4F17A 3NGPA 3M0UA 4AG2C 1PRMC 1UJYA 2AKKA 2C0OA 2DL7A 3I35A 2YUNA 2F2VA 5IH2A 1ZUKA 4DEYA 2DNUA 2H8HA 1PWTA 1K4US 1E7OA 2DL5A 4RTVA 3PVQA 3EG1A 5ECAA 3TSZA 2DILA 3UA7A 2L2PA 2EKHA 1MV0B 1NG2A 2EYYA 3SEMA 2KXCA 1EFNA 2FO0A 2KRSA 2KBTA 2VKNA 2DJQA 1GCQA 1GL5A 1NEGA 2KYBA 4RTUA 2VVKA 2LCSA 5GJWB 1UUEA 3EHQA 1GBQA 4OMLA 2L3QA 2FRWA 1X69A 4RUGA 1FYNA 2LZ6B 2PNIA 2J6KA 2X3XD 2O31A 2GTJA 2K6DA 2YUOA 2HCKA 2ESWA 2JMAA 2O9SA 3ULRB 1YWOA 1M30A 2GTOA 2J6FA 1BBZA 1U3OA 4OMNA 3H0FA 3VRZA 4AFQC 5IHNA 4F14A 1YCSB 2MCNA 4RTWA 1VYUA 1ZSGA 3VS1A 1GRIA 3SHWA 1WIEA 2QDLA 2EYXA 2V1RA 3ZL7C 2E5KA 2ECZA 2O2OA 2EYWA 1BK2A 1Y0MA 3VS7A 1UDLA 1B07A 4DEXA 2CSIA 2DRKA 4Z8AA 2ED0A 4J9HA 1ZBJA 1HJDA 2D0NA 1JXMA 1RUWA 4HVWA 1GFCA 2PTKA 3RBBB 1WDXA 2KT8A 2CT3A 1UG1A 4OMPA 2KGTA 2BZYA 4X1VA 2AKLA 3UA6A 3NPFA 5I22A 3H0HA 1K0XA 1OPLA 1M8MA 3C0CA 1Y57A 4ESRA 4F16A 2A08A 1G83A 1WXUA 3VS5A 2RNAA 1K0SA 2EW3A 4QT7A 2AZSA 4J9CA 2G6FX 1AWJA 1JXOA 1W70A 2K9GA 2SRCA 4LUDA 4D8KA 1M3BA 1UE9A 2GNCA 2D8JA 1WXBA 1PHTA 2EGEA 1AWWA 1PNJA 2F2WA 2EYZA 2EGAA 1WX6A 2DL3A 2HSPA 2LJ0A 2ROTA 2KYMA 2LQWA 1KJWA 4J9DA 4RTXA 1SRLA 1M3AA 2YT6A 4FSSA 3H0IA 1ZUUA 4CC2A 1BU1A 3KFVA 3O5ZA 4J9BA 1YN8A 1Z9QA 2LMJA 2YDLA 1WXTA 1CSKA 4ORZA 2EGCA 1WYXA 3VS3A 1AWXA 4EIKA 2F2XA 2GBQA 1K76A 2K79A 2PZ1A 4JZ3A 2FPFA 1YP5A 2A37A 1UECA 2CUDA 2DL4A 2DX1A 1UTIA 3JV3A 1VYVA 1UFFA 4WCIA 2RQWA 2CT4A 1H8KA 3NMZC 3PVLA 2DL8A 1U06A 1KSWA 4RTZA 2O88A 2YUPA 1U5SA 1ZX6A 1J3TA 2L3SA 1JQQA 2JXBA 2C0IA 2YUQA 4HXJA 4Z88A 2KE9A 2JS2A 1GCQC 3UATA 2DA9A 2LP5A 1H3HA 1NYGA 2EVRA 1CKAA 2V1QA 2DMOA 2ROLA 1QKWA 2DF6A 1I1JA 4LUEA 1X43A 1GBRA 1E6GA 2FPDA 3FJ5A 3M0QA 1ABQA 1HD3A 1XOVA 2J05A 2NWMA 2DRMA 3NHNA 1QWEA 2LNHB 4OMQA 3VS0A 1JO8A 2ENMA 3IQLA 1X6GA 3VRYA 2J7IA 2XMFA 2ABLA 2J06A 1UHCA 1NM7A 3I9QA 2K7AA 1SRMA 1AWOA 2KNBB 1NLPC 1X2KA 4M4ZA 5GJVB 1RLQC 2DE0X 3M0PA 1OOTA 3QWYA 1K1ZA 2M51A 3I5SA 1OV3A 1WA7A 1T3SA 4JJBA 2SEMA 4A63B 5I11A 2KR3A 4JZ4A 1ARKA 1AZGB 3UF4A 1KFZA 3EHRA 5EC7A 2X3WD 1QLYA 1K9AA 2FEIA 5IHIA 1WI7A 1A0NB 1E6HA 1SEMA 4Y92A 1SSHA 3THKA 5IXFA 2AK5A 5IXBA 2DVJA 2LJ3A 1JU5C 4ZNXA 1ZUYA 2K2MA 1KIKA 3TVTA 1AZEA 1SPKA 4JJDA 4RTYA 2D1XA 1VYTA 4AFZC 1MUZA 1UJ0A 4CC3A 1ABOA 1X6BA 1TG0A 2DLPA 2YSQA 1T3LA 2RQUA 2AZVA 4HVVA 4AFUC 3EGUA 2RN8A 2EPDA 1AVZC 4IIMA 4J9FA 1JEGA 2CH4A 2A36A 5L23A 2VWFA 3H41A 4CC7A 2W10A 1WFWA 1X2QA 2I0NA 5FWCA 1GCPA 2BZXA 1G2BA 2M0YA 2KXDA
chains in the Genus database with same CATH superfamily
1IO6A 3TCJA 1HK9A 1X27A 4KH0B 2BTTA 1QVPA 4BY6B 2LQ8A 4M7DF 3HSBA 3CCSQ 3U23A 3QG1A 1CKBA 2DXBA 4AMCA 1TXQA 4HVUA 4LE9A 3UT1A 3CPWS 3CC4A 2RPNA 4QKUA 1YNZA 1AD5A 2LQNA 2RH2A 3I55T 1FMKA 1YHQT 1D09B 2A28A 2RF0A 2M02A 3A8OB 3CCEQ 3G71T 4PK4A 2MIOA 3EG0A 2CDTA 8ATCB 2HEQA 5I21A 2DKGA 4FW2A 3OBYA 4IUQA 3GLXA 3JSCA 4Z02A 3ZFJA 4M75B 3MEVA 2YRCA 2ZPIB 2E3HA 2FL7A 1TUCA 2XDDA 1N6AA 4J9EA 2ZGWA 5GANf 1PKSA 2JM9A 1K8AU 5KH6A 1YWPA 3NFCA 5GMKi 4HCKA 2MF2A 1M2OA 1RLPC 1TUDA 1WJQA 3VJPA 2M16A 3NTHA 3MEUA 3M53A 1B3QA 2DFUA 4M75E 2LCLA 4AFSC 2CKKA 1LCKA 2JMCA 2R58A 2KY9A 2GGRA 4J9IA 1BCMA 2DYBA 1M1GA 1Y7XA 5IHKA 1YJNT 5KCOA 2A3LA 4EMKA 5D6WA 2OTLQ 1OULA 4ZGDB 1SHFA 4OVAA 1RABB 2L3PA 4JDSA 3JB9G 4IUPA 3QIIA 3M5AA 4CC4B 2CUBA 3DB3A 2DJZA 1QVGP 4M77B 2IG0A 3EGXA 4II1A 3I35A 2DL7A 2F2VA 3CCQQ 1PWTA 1OZ2A 1N8RU 5A0GA 3CCSA 5ECAA 3L2UA 1MHNA 4J6XA 2X4JA 3UA7A 1MV0B 1Y96B 1BIBA 3A1PA 1KQSA 3MCAB 2QG9B 1D1CA 3KUFA 2VKNA 2HD0A 4M77E 3CBOA 2Y90A 5CQYA 3FDRA 1IHVA 2HNIA 2K3YA 4RTUA 3S3MA 3PMIA 1NPRA 1UUEA 3RKWA 5AYFA 4E7HA 3M56A 2L3QA 1M90C 2FRWA 4XTZA 1G3SA 2P4TA 4OF1A 4RUGA 3CCEA 1FYNA 1K9MU 1D0XA 2X3XD 2K6DA 2YUOA 2HCKA 3INZA 3ULRB 2EJ9A 5IN1A 1G8XA 5GAMf 4AFQC 4KH1B 2DZ9A 3OYJA 2DXCA 4JS4A 1KC8U 1YCSB 2MCNA 4MZPA 4Q5WA 1VYUA 4A4GA 5DY9A 2ZPEB 1WIEA 1X75C 3ZL7C 3PIOA 1VQKT 3CCJQ 3JCMQ 3VU3C 2KAFA 1B07A 4PJOB 3H6ZA 1VQMA 2YWWA 3BY7A 1JXMA 1RUWA 2H3EB 1VIEA 2MK5A 1VQ4T 2RHYA 2OTJA 4XU1A 4MDWA 4C92D 1M9SA 3HL8A 3CCRT 2OTLA 4M75A 2AKLA 2AT1B 3UA6A 1N9RA 1NZ9A 4N4HA 3CMAA 3CCLT 2F1LA 3CPWP 1G3WA 3LH0A 2A08A 1VQLT 3VS5A 2RNAA 1K0SA 2K9GA 1JXOA 2SRCA 4LUDA 3RIRA 1M3BA 3CCQA 2D6FA 2D8JA 4NL2A 2K4YA 5I2SA 1PHTA 2XD0A 1AWWA 1PNJA 2EYZA 3CD6Q 3M4GA 1Q81R 1WX6A 1OQKA 2DTIA 5DLOA 4J9DA 1FXXA 3ME9A 4E7LA 2QASA 1ZUUA 3E9FA 4ME7A 1B34B 4EMKC 2E4HA 2KSSA 3C4SA 2E64A 2LMJA 2YDLA 1WXTA 1K8AC 1C0MA 4M7DG 4M77A 5CVIA 3CCMQ 1NJIR 2EGCA 5GAOn 3VS3A 4EIKA 2F2XA 4JZ3A 1YP5A 1UECA 1R0BG 3EGDB 1KQSS 2LT4A 3JB9D 4JRKA 4WCIA 2CT4A 1WHGA 3MEAA 3NMZC 2DL8A 1VQNT 5CKDA 1VQ5Q 2BE9B 1U5SA 1ZX6A 1M1KR 1J3TA 2GF7A 3CCJA 3FJPA 2DA9A 3FIFA 3EFSA 2DD4A 4BI3A 5CK9A 1CKAA 2V1QA 3SB2A 2K5LA 3VUBA 2EJFA 3P8DA 1QVGA 3CCUT 3L2WA 1N8RC 1YJ9T 1M5Q1 3M0QA 3X26B 2I2LA 4BY6C 4JRPA 1M2VA 1Q86U 2QGGA 2NWMA 3G6ET 3EFOB 4HA8A 4C92F 1VQ9Q 1QWEA 2NUTA 1YJWT 2X35A 5KYWB 1QQJA 2QEXQ 1D1BA 2J7IA 2ABLA 4E7IA 1UHCA 4QQ6A 1RAEB 5KYNA 4FSXA 4C5HA 1MNEA 2ZPGB 4ZTFA 1NLPC 1X2KA 4BE2A 1K9MC 2XICA 1VQOQ 1RLQC 1C1AA 3MKDA 4QQDA 4E7KA 1VQ7Q 1K1ZA 3DB4A 4MDXA 4JJBA 1YI2T 1R8OB 1WPYA 2SEMA 5DM7R 4NL3A 4A63B 1ACMB 5LJ5g 1R77A 3CD6A 1VQ6T 3MJXA 4KGVB 3MP6A 3JCMg 1KC8C 5LJ5e 2MWPA 2X3WD 1QLYA 4PLIA 2MAMA 3JCMe 1QP2A 1E6HA 4WF2A 5GMKl 2AK5A 5IXBA 4M75C 4LDVA 2K2MA 1KIKA 1SPKA 1UGPB 4RTYA 4LDXA 2D1XA 4KUDK 3GNFB 3CCMA 3H8ZA 3KBGA 4QVDA 1UJ0A 4BDYA 1NBEB 2LCCA 4J8OA 5GAN3 2DLPA 1T3LA 2AZVA 3OYLA 4XTUA 2LTOA 3EGUA 2HZYA 4FYYB 1B7TA 1AVZC 1YFNA 1JEGA 3JB9F 2QTXA 3F70A 4X9CA 5LL6S 1EZZB 4CC7A 2W10A 3C12A 3DKMA 2JVVA 2NYSA 1GCPA 4P5NA 2BZXA 3RESA 1VQPQ 2M0YA 2LT1A 3RKXA 1KHCA 4J6YA 4GLMA 1OI1A 2HDAA 2C06A 4M77C 1YIJA 4Z89A 5GANg 1PRLC 2D0QB 5GMKm 5GAN2 2HQEA 5GANe 1PD1A 1VQ9A 4QW2A 4BDZA 2G3RA 4R55A 2PU9B 2QEXA 2F5KA 4C0FA 1O75A 2W0ZA 1WHMA 3I5RA 2V26A 1UHFA 1H92A 1N5ZA 2CP6A 4OB1B 3V7CA 3I55Q 1YHQQ 1RI9A 1QVGS 2KROA 1QCFA 5LJ5j 1VQ7A 3VS4A 3BE3A 3A98A 1IGUA 1RACB 3OS1A 2OI3A 1W6XA 3G71Q 1WZOA 3GF5A 3A5ZB 3NTIA 5FU6C 1K73R 3JB9H 1OPKA 2CH4W 1WLPB 4M75D 4E2FB 2MOXA 3EH1A 3WVDB 1M3CA 3UWNA 1IXDA 1KQSP 3LWIA 5IT9E 2IVWA 2EKOA 4OP0A 5HCKA 2GFUA 1JRIA 2L89A 4LDWA 4TVRA 2JW4A 1QW1A 3M0RA 5CO7A 5KYWA 1S72T 4K11A 1HSQA 5KYUA 4N4IA 2Z0WA 1IRXA 3VS2A 1I07A 2X51A 4PL6A 2ZAEA 4C92A 1S1NA 1UGVA 4C5EA 2DBMA 1OU9A 1WJRA 1M4ZA 3OB9A 4Y28E 1KHIA 1N27A 4PFZA 1Q86C 5KCHA 1U8RA 2JUFA 3T9NA 2J6OA 3OYKA 1YJNQ 2OAWA 3HFNA 4M77D 3G7ZA 1OEBA 1T0HA 3ZBDA 1VQPA 2FPEA 2ED1A 1NYFA 3URGA 5FU7C 4C8QE 2AHJB 2FB7A 1P92A 3FLGA 3M0UA 4AG2C 5GANj 1UJYA 2AKKA 2KQWA 2YUNA 4J6WA 4EMGA 2DL5A 3SDZA 4RTVA 2CZ0B 3M58A 3TSZA 1OX9A 2DILA 4F7UB 2RD1A 2D9TA 7AT1B 3QYHB 2FHDA 1DJ7B 2KBTA 2DEUA 2KYBA 4HKEA 2VVKA 2V8JA 3HRTA 4XK8E 5A0LA 5EG2A 1X69A 3I55A 1YHQA 4F7UE 2O31A 5HY6A 1VQ8T 1YBYA 2JMAA 1H3ZA 3X25B 2GTOA 1M30A 2J6FA 1BBZA 2YLBA 3G71A 4RG8A 1Q95G 4C92G 2PVOB 2NLUA 2HKNA 1PG5B 1WHHA 3X28B 4M75F 3CMET 3QJ6A 2WACA 2EYXA 3CC7Q 2B8AA 4GY5A 3QDRB 2E5KA 1F1BB 2E70A 1BK2A 1Y0MA 4N0AA 1UDLA 1TSFA 3CC2T 2CSIA 4Z8AA 1XQHA 4M78B 1VQKQ 5GAN6 4JS5A 4E7ZA 4HVWA 5GANd 2VASA 4ELZC 2FZKB 5CKBA 4KT0E 2PUKB 1KD1C 1WDXA 1MMDA 1RAFB 2CT3A 5CAIA 3OYMA 5GAN4 2BZYA 4X1VA 2CS7A 3HRSA 4M78E 4X9DA 2XG8D 4DBHA 2RK2A 1YJNA 1Y71A 2VGMA 1PSEA 4VUBA 4A4FA 3CCRQ 4ESRA 3JCMP 1KQ2A 1G83A 2ZPFB 4M77F 5DLQE 4QT7A 3H9NA 4E7SA 3CCLQ 5D6XA 2LNVA 1AWJA 1W70A 2HKQB 2GNCA 5A0DA 1VQLQ 3OYGA 3RMQA 4C8QA 4C92C 4C0ZA 2YLCA 2CP3A 1Q7YU 2KYMA 2E41A 4BD3A 2QK0A 1KJWA 2E6NA 1M3AA 2XDBA 1JBMA 4EDUA 4CC2A 3OQ5A 3KFVA 3L2RA 1Z9QA 2RO0A 2LC4A 1CSKA 1G3TA 1AWXA 3JAME 2K79A 1K76A 2PZ1A 2FPFA 4O5VA 2HAXA 2CUDA 2DL4A 2DX1A 1UTIA 3E2UA 1VYVA 4FT4A 1FWZA 2RQWA 3PVLA 4OGCA 1H8KA 1ZSZB 2QA4T 1U06A 4NS5A 2RI3A 3CC7A 2A7YA 1BYMA 2OX7A 5GAMd 1YITT 4PNOA 1JQQA 4Z88A 1VQNQ 3M55A 2VUBA 3I56T 2CP0A 1TOVA 2LP5A 4FYWB 1WJSA 1I5LA 4V2SA 2EVRA 2X4YA 1OU8A 1VQKA 1XTDA 2F5TX 2DMOA 2ROLA 1QKWA 2DF6A 2LQKA 1KK7A 5KYYB 1ZQ1A 3FJ5A 3PGGA 4M7AB 5GAOp 3JCMX 3BFMA 4C8QG 1G3YA 3L2VA 3CCUQ 1EX4A 1PSFA 3L2QA 2DRMA 4MZTA 3NHNA 1YJ9Q 1BI1A 4OMQA 1WHKA 4ZGJB 3CCRA 1JO8A 3IQLA 3G6EQ 5FRMA 2RJDA 3VRYA 3OYYA 4A4KA 2YRVA 1YJWQ 1Q86R 2K7AA 3CCLA 5J3BA 5LJ5h 4M7AE 4M78A 1X6OA 4PJOE 5GJVB 4N0AC 3JCMh 1VQLA 5IAYA 3QWYA 1T3SA 1W4SA 1KQ1A 3M57A 5KYXB 1VQMT 5I11A 5M9OA 4CI0C 4JZ4A 1ARKA 3EHRA 1YI2Q 3QBYA 1UB4A 2L5QA 1VQ6Q 2FEIA 5IHIA 1WI7A 2OTJT 4A54A 2XI9A 3O8VA 2P0QA 1LOJA 2CP5A 3A8HB 5IXFA 1D0YA 3C94A 3EG9B 2EQKA 4JJNK 4BI8B 1MUZA 2YRDA 3CMAT 2QQBA 3G4SQ 4BB7A 1ABOA 4X34A 1TG0A 2ATCB 2RQUA 4AFUC 4FU6A 4J9FA 3ER0A 2EQMA 2QQAA 4C8QC 1SKUB 1EIFA 1D3BB 1WFWA 3HPWA 4RMOA 1X2QA 2I0NA 3V8LA 4DQ2A 1Y96A 3CQTA 2BIVA 4L5GA 5GAOl 3GPLA 5FROA 3BW1A 3EG2A 3R6NA 2RHIA 4M75G 3EG3A 1JJ2A 5C6SA 2RJFA 3PFSA 3META 4LDYA 3OSSC 2D8HA 4RCCA 3A8GB 1KG1A 2DXUA 4HT8A 1MNDA 4GBQA 1ZSZA 1Q7YC 1YJ9A 2VYTA 4RTTA 1FMWA 2HQXA 4WTOB 4OMMA 1W1FA 2CREA 3G6EA 2DIGA 1TWBA 3REBB 1VA7A 1YJWA 2V8IA 1W2BA 2RQVA 2XDPA 3J81E 1FX7A 2RMOA 4FW1A 2K57A 4FL6A 2EIFA 4OMOA 4KUIA 3QWXX 2VC8A 3BDLA 4XTYA 2DETA 3VYGA 3QDFA 1XNIA 1NEBA 2IIMA 1QKXA 1BIAA 2JS0A 3OW2P 4J7FA 5GAOq 2P4RA 2KRMA 2LJ1A 1IB8A 4M7AA 1YI2A 4PJOA 5LJ3f 5FW9A 3HFOA 2VV5A 1VQ6A 3PE0A 5GAOm 1PKTA 2EQUA 2VXEA 4M77G 1WNLA 5GAN8 1QMCA 1UEBA 4HCCA 2KEAA 1YCYA 3LH5A 3TSWA 3JB9I 1BI2A 4C0GA 2X9HA 2CSQA 2HL3A 2JTEA 3CCVT 4GLKA 3G4SA 3LWHA 3OYCA 1S72Q 4C8QD 1BB9A 2JT4A 1OZ3A 2LX9A 1SHGA 2JM8A 4M78C 5HKCA 3P8HA 4OGEA 4PJNA 1C6VX 3LGLA 5KYXA 2OJ2A 4FT2A 2BZ8A 2LX7A 2X4WA 3M0SA 1Q81U 1IZ6A 2B86A 1QWFA 1M90R 1TUGB 5GAOr 2HBWA 3RMSA 4JJCA 1GXIE 3DLMA 4R0KA 2EQIA 5FWBA 2HBPA 2EBPA 3EG9A 2RI2A 4LN2A 3GIBA 3RUXA 1PRMC 1VQ5A 1NJIU 1ZUKA 4DEYA 3X24B 3CBMA 1K4US 1E7OA 3PVQA 4OB3B 1B34A 3QKJA 2MPXC 2EKHA 2DZCA 1NG2A 2EYYA 3SEMA 4ELYC 1HYOA 1EFNA 2FO0A 2KRSA 2O4XB 1GCQA 1GL5A 1NEGA 3VV0A 4M7AG 2LCSA 4PJOG 1KD1U 1LNXA 4FCYA 4HCZA 3EGDA 4OMLA 1QCOA 4Y91A 2H3JA 4XQ3A 1BI0A 2LZ6B 1NE8A 2J6KA 3MO8A 3HHTB 2GTJA 1JJ2S 3CPFA 2VGNA 5GMKe 2RHXA 4BI4A 2KMTA 1FMVA 3OMGA 2XU8A 3QUIA 3S6WA 4EMHA 3VRZA 1VQ8Q 5IHNA 3OYAA 5FRNA 4EPCA 2WSFE 4RTWA 2EAYA 3VS1A 3M4YA 2EWNA 1VQOA 1YIJT 3SHWA 1M8VA 2QDLA 2V1RA 2EJGA 2O2OA 2EYWA 3QZ5B 4J5YA 1W2BS 1ZSZC 3CMEQ 4RKUE 4M78D 1QVFA 4DEXA 2DRKA 1SG5A 2K5FA 2LRQA 1ZBJA 3OYHA 4DOWA 2CZ6B 2D0NA 1GFCA 3EFOA 3CC2Q 2P0PA 3RBBB 3J80E 1VIFA 4ZN1A 4C8QF 2P84A 2GQVA 1VQ7T 1UG1A 3PTAA 4OMPA 2KGTA 3LLRA 4PLLA 4FYXB 3NPFA 2QXFA 3C95A 4M7AC 3H0HA 1K0XA 1OPLA 4PJOC 2KVQG 1M8MA 1Y07A 2HL5C 2JN0A 3C0CA 1K8AR 1Y57A 4FM4B 4F16A 3N5BB 1WXUA 2EW3A 3TQ7P 3ASKA 2AZSA 4ZN3A 4J9CA 2G6FX 4EMKB 5J39A 1WXBA 2K5IA 1RI0A 5GAMg 1V29B 3OSVA 2F2WA 2EGAA 5GAMe 4F7UF 2DL3A 2HSPA 2LJ0A 2LQWA 4BE1A 3NTKA 2JTFA 4FSSA 3H0IA 1I5OB 3OW2A 3UDCA 8AT1B 2K3XA 5GMKj 4IKFA 3JCMb 2IPOB 2DO3A 2EYQA 2X4XA 1ZA2B 3AHUA 1Q7YR 3LGFA 4J83A 4RG2A 2DTOA 1WYXA 3E9GA 3PIPA 4F04B 5CKHA 1N8RR 3KXTA 1MMGA 3R6OA 2HQHA 2A37A 3M59A 4HCBA 1WGSA 3E19A 3QJYA 3JV3A 2CYZB 1UFFA 4IUTA 4QQGA 3RKYA 3GNGA 4JLGA 2L3RA 1U1TA 3JCMf 1PCXA 2CGHA 1Q81C 2XIDA 2O4XA 2KK4A 4RTZA 2O88A 2YUPA 3S3OA 2L3SA 3A8MB 3CMEA 2JXBA 2C0IA 2QA4Q 4HXJA 4C0DB 2JS2A 1GCQC 3UATA 2RA2A 5A2QE 1BKBA 3FC3A 1K9MR 2XKOC 2R57A 1YITQ 4M78F 4KULA 3I56Q 1UGQB 1X43A 3CC2A 1VOMA 1NJIC 1GBRA 1VUBA 4KBMB 4M7DB 4M7AD 1G5VA 1KC8R 4PJOD 4PJJA 2RHUA 3MP8A 3CC4T 1K73U 2J05A 4A4HA 4LDUA 1Q82U 2RJEA 2DPPB 1QVFS 4FYVB 1RAGB 5CKEA 1X6GA 3GP8A 3A8LB 1H641 1M1KC 4M7DE 1O9SA 1VQ4Q 1NM7A 3PNWC 5GAMj 3OYEA 1AWOA 2KNBB 4M4ZA 2A0FB 1ZBXA 2QQ9A 2M51A 3I5SA 3RDVA 4PJMA 1JJ2P 3UF4A 5EC7A 1BCOA 2HSEB 2WSCE 1VQMQ 2JNGA 3THKA 2DVJA 4JRIA 2DIQA 1TS9A 1LPLA 4QVCA 2OTJQ 1VYTA 4AFZC 3M54A 1W2BP 3BDUA 4OMFB 3OS5A 3CXCP 2FZGB 4DBFA 2RM4A 2YSQA 2P0KA 4HVVA 3CMAQ 2VXFA 2NUPB 4O6JA 2RN8A 1U1SA 2EPDA 4XTXA 1OX8A 3LYIA 3OW2S 2A36A 5L23A 2VWFA 2F69A 4C5IA 4LXCA 2QA4A 5FWCA 2Y4XA 3LX7A 4IUUA 5L8RE 4XU3A 5FLXE 4F7UA 1YITA 4XU2A 5LJ3g 5KE3A 2DM1A 3I56A 2FRYA 3CCST 5LJ3e 1MV3A 2L0AA 2GQIA 2DXTA 2OAUA 2AIRB 4M7AF 1ZLMA 4L6V5 2M1HA 4PJOF 3GBQA 1N9SA 2M0OA 2KRNA 2HMAA 2QTVA 5FU6B 3EAEA 3P8BB 2JZ2A 4AG1C 3CCET 4RCBA 3REAB 5J26A 9ATCB 1SF9A 4J9GA 1AEYA 4KRTA 1VQ4A 1D1AA 2YHTA 3CC7T 4XAXB 4JPBW 1M27C 1M2VB 4IIOA 4MMLA 3SFMA 2C0TA 2QI2A 4DBQA 3JRZA 3VYHB 1T0JA 2NUZA 2NUTB 3Q1JA 4B9XA 2O9VA 1V1CA 3OYFA 2RQTA 4BE0A 1WQ7A 2QGFB 4M7DA 3AT1B 3SWNB 3X20B 2E6ZA 3VS6A 4A4EA 2KT1A 2FZCB 3OY9A 4E6RA 2DBKA 4IUVA 4NOYA 2FYKA 1D0ZA 1OYXA 1IHWA 4LNPA 3M0TA 3EH2A 5CIUA 1GFDA 2FVUA 2PQWA 4DBRA 4HT9A 2FG0A 1MMNA 1AHJB 2K3BA 2M9UA 4F7UG 3JCMW 5FU7B 4MMKA 3DLLA 2RQRA 2PVGB 1NLOC 5AT1B 3CCVQ 3JCMJ 1TTHB 1V76A 4ATOA 2OTLT 4JLIA 1I0CA 3OA6A 1Z9ZA 3MEWA 3RERA 1RAHB 1K73C 3RNJA 3WVEB 3TEEA 4D8DA 2XK0A 1Q82C 5LJ3j 5HK0A 3JCMV 4A53A 2MYSA 5GAN7 1AOJA 2V8KA 3CCQT 4F17A 3NGPA 1QVFP 2C0OA 2QQSA 2BUDA 5IH2A 2DNUA 3QO3A 2H8HA 1VQNA 2ZPBB 3EG1A 4XU0A 2NUPA 3ZEHA 2L2PA 5GANh 2JTMA 2KXCA 2COYA 5CKFA 4E7JA 3QXEB 2DJQA 2YXYA 5GMKh 1WHLA 5GJWB 4M78G 3EHQA 3OYNA 3D7SB 4LD9K 2QDYB 1GBQA 1TU0B 3CCUA 2PNIA 4KGXB 5C0MA 2CP2A 1M1FA 2RJCA 2ESWA 2O9SA 1KD1R 2BE7D 6AT1B 2WSEE 1YWOA 3CEYA 3L1AA 3OMCA 2JJ9A 1U3OA 1X01A 4OMNA 3E1SA 3H0FA 4F14A 1ZSGA 1UGRB 4IURA 3CXCA 3CCJT 1GRIA 1PC0A 1TH7A 3V7RA 5GAN5 5KYYA 2ECZA 3QZ9B 1YIJQ 2GCXA 4DA4A 5CCAA 4XTVA 5LJ3d 3OS2A 3LW5E 3VS7A 3MP1A 1RAIB 2ED0A 4J9HA 4UC4A 3SD4A 4C0DC 1HJDA 3FEOA 2R5MA 2PTKA 3CCVA 4B6MA 1JB0E 3SWNA 5KYUB 4ZGEB 2COWA 1RL2A 2KT8A 2EQJA 4J7IA 1ZHIA 3FB9A 3QPHA 3OBWA 4YTLA 4M7DC 3HKSA 4C92B 5I22A 2GFAA 4XTWA 2DVEA 5GAMh 1I4K1 3HP9A 1RAAB 3L42A 3MHXA 4C5GA 2QYZA 4D8KA 3WXMB 4D6WA 1UE9A 4R56A 3OYIA 4JRQA 3CD6T 4LD6A 4C92E 2ZPHB 2DERA 2EGEA 5D7UA 2PVDB 3G4ST 3QHSA 2DTHA 4BUGA 2ROTA 4RTXA 1SRLA 1LVKA 2YT6A 2PUOB 3TU4K 5CR2A 1BU1A 3CCMT 3CBPA 2VB6A 2QAZA 3O5ZA 4J9BA 1YN8A 4B9WA 1PD0A 4ANJA 1QCNA 2RHZA 3G1JA 1IREB 4ORZA 2BKDN 1D3BA 1ZA1B 2GBQA 4PJLA 1XJWB 2XHCA 3L2ZA 2E65A 1M1KU 3OYDA 2JOYA 1VQ5T 2EFIA 1I81A 1WHJA 3MPUB 4FIBA 1KSWA 4PKCC 1SSFA 4AT1B 2E3IA 2E1HA 1WQWA 3TREA 3OS0A 2YUQA 1PM3A 3CPWA 2KE9A 2CZ1B 5KE2A 1H3HA 3VKIA 1NYGA 4QVZA 2E5QA 3OYBA 4M7DD 1I1JA 2ZCFB 4LUEA 3V8JA 1E6GA 3QYGB 3QSUA 2FPDA 2E10A 1IGQA 3CXCS 1VQ9T 4DOVA 4N4GA 1ABQA 3JCMc 1HD3A 3PT9A 1XOVA 2DAQA 2LVMA 1HXDA 1S72A 2QEXT 3CC4Q 2LNHB 3VS0A 2ENMA 3M9QA 1VQOT 3RR6A 4MZMA 2XMFA 3FRNA 2J06A 3I9QA 2DEQA 2MMPA 3EFRA 1SRMA 4JUVA 1Q82R 2MWOA 3PMTA 5HK3A 1RADB 2ZZDA 2DE0X 3M0PA 1OOTA 1OV3A 1WA7A 2DYIA 2CP7A 4CRIA 2LDMA 2KR3A 2MI6A 4KGZB 1AZGB 2KDSA 4OB0B 1KFZA 5CQXA 1I8FA 3JB9J 1K9AA 3SWNC 3S3NA 2R5AA 2RB6A 1A0NB 1SEMA 2COZA 4Y92A 1SSHA 3GOXA 2DK3A 1M90U 2LJ3A 1JU5C 4ZNXA 1ZUYA 4C8QB 5I2MA 3TVTA 1AZEA 4JJDA 3EGXB 2Y4YA 3VUZA 1LJOA 1MGQA 3V7SA 4CC3A 3J7AF 1X6BA 4PFOA 4L59A 1AT1B 4BACA 2RK1A 3HTRA 2K2VA 1R0CB 4ZTJA 1MMAA 2RI5A 5D6YA 4IIMA 1BI3A 2CH4A 4PFPA 3HRUA 3H41A 3UPUA 2L8DA 1NPPA 4E47A 5LJ3h 1VQPT 2E12A 2CZ7B 4OB2B 5LJ5d 2QQRA 1VQ8A 2DD5A 2KI7A 1QP3A 3V8KA 3JCMd 2O01E 1G2BA 5LJ5f 1UGSB 2KXDA
chains in the Genus database with same CATH topology
1IO6A 3CQTA 2DM1A 2FRYA 1X27A 4GLMA 3EG2A 2HDAA 1MV3A 2BTTA 2GQIA 2L0AA 3R6NA 4Z89A 3EG3A 1PRLC 3U23A 1CKBA 2D8HA 1ZLMA 4HVUA 4LE9A 3GBQA 4GBQA 2KRNA 2RPNA 4AG1C 1YNZA 1AD5A 4RTTA 2LQNA 3REAB 1FMKA 4OMMA 1W1FA 2CREA 2A28A 4J9GA 1AEYA 2RF0A 3REBB 4KRTA 1VA7A 2W0ZA 3I5RA 1UHFA 2RQVA 1H92A 1N5ZA 1M27C 4IIOA 4JPBW 2RMOA 2C0TA 1RI9A 2MIOA 4OMOA 3EG0A 2KROA 1T0JA 3QWXX 1QCFA 2CDTA 2NUZA 3VS4A 2O9VA 1V1CA 2HEQA 2RQTA 3A98A 1NEBA 2OI3A 2IIMA 1QKXA 2JS0A 1W6XA 2P4RA 1OPKA 2CH4W 3VS6A 1WLPB 2KT1A 2KRMA 2LJ1A 4E6RA 2DBKA 2MOXA 5FW9A 1M3CA 3PE0A 1PKTA 4LNPA 5HCKA 1TUCA 3M0TA 4J9EA 2JW4A 3M0RA 1GFDA 1PKSA 2JM9A 2KEAA 3LH5A 3TSWA 4K11A 1HSQA 1YWPA 2CSQA 2FG0A 4HCKA 1TUDA 1RLPC 2JTEA 3VS2A 1I07A 2K3BA 1BB9A 1B3QA 2JT4A 1S1NA 2RQRA 4AFSC 1SHGA 1NLOC 2JM8A 1UGVA 1LCKA 2DBMA 2JMCA 2OJ2A 1I0CA 2GGRA 1Z9ZA 4J9IA 2BZ8A 2DYBA 2LX7A 3M0SA 5IHKA 2B86A 3RNJA 1QWFA 4D8DA 1SHFA 2J6OA 2L3PA 2OAWA 2HBWA 4JJCA 2CUBA 4CC4B 1OEBA 1T0HA 2EQIA 4R0KA 5FWBA 2FPEA 2EBPA 2ED1A 1AOJA 1NYFA 4LN2A 4F17A 3NGPA 3M0UA 4AG2C 1PRMC 1UJYA 2AKKA 2C0OA 2DL7A 3I35A 2YUNA 2F2VA 5IH2A 1ZUKA 4DEYA 2DNUA 2H8HA 1PWTA 1K4US 1E7OA 2DL5A 4RTVA 3PVQA 3EG1A 5ECAA 3TSZA 2DILA 3UA7A 2L2PA 2EKHA 1MV0B 1NG2A 2EYYA 3SEMA 2KXCA 1EFNA 2FO0A 2KRSA 2KBTA 2VKNA 2DJQA 1GCQA 1GL5A 1NEGA 2KYBA 4RTUA 2VVKA 2LCSA 5GJWB 1UUEA 3EHQA 1GBQA 4OMLA 2L3QA 2FRWA 1X69A 4RUGA 1FYNA 2LZ6B 2PNIA 2J6KA 2X3XD 2O31A 2GTJA 2K6DA 2YUOA 2HCKA 2ESWA 2JMAA 2O9SA 3ULRB 1YWOA 1M30A 2GTOA 2J6FA 1BBZA 1U3OA 4OMNA 3H0FA 3VRZA 4AFQC 5IHNA 4F14A 1YCSB 2MCNA 4RTWA 1VYUA 1ZSGA 3VS1A 1GRIA 3SHWA 1WIEA 2QDLA 2EYXA 2V1RA 3ZL7C 2E5KA 2ECZA 2O2OA 2EYWA 1BK2A 1Y0MA 3VS7A 1UDLA 1B07A 4DEXA 2CSIA 2DRKA 4Z8AA 2ED0A 4J9HA 1ZBJA 1HJDA 2D0NA 1JXMA 1RUWA 4HVWA 1GFCA 2PTKA 3RBBB 1WDXA 2KT8A 2CT3A 1UG1A 4OMPA 2KGTA 2BZYA 4X1VA 2AKLA 3UA6A 3NPFA 5I22A 3H0HA 1K0XA 1OPLA 1M8MA 3C0CA 1Y57A 4ESRA 4F16A 2A08A 1G83A 1WXUA 3VS5A 2RNAA 1K0SA 2EW3A 4QT7A 2AZSA 4J9CA 2G6FX 1AWJA 1JXOA 1W70A 2K9GA 2SRCA 4LUDA 4D8KA 1M3BA 1UE9A 2GNCA 2D8JA 1WXBA 1PHTA 2EGEA 1AWWA 1PNJA 2F2WA 2EYZA 2EGAA 1WX6A 2DL3A 2HSPA 2LJ0A 2ROTA 2KYMA 2LQWA 1KJWA 4J9DA 4RTXA 1SRLA 1M3AA 2YT6A 4FSSA 3H0IA 1ZUUA 4CC2A 1BU1A 3KFVA 3O5ZA 4J9BA 1YN8A 1Z9QA 2LMJA 2YDLA 1WXTA 1CSKA 4ORZA 2EGCA 1WYXA 3VS3A 1AWXA 4EIKA 2F2XA 2GBQA 1K76A 2K79A 2PZ1A 4JZ3A 2FPFA 1YP5A 2A37A 1UECA 2CUDA 2DL4A 2DX1A 1UTIA 3JV3A 1VYVA 1UFFA 4WCIA 2RQWA 2CT4A 1H8KA 3NMZC 3PVLA 2DL8A 1U06A 1KSWA 4RTZA 2O88A 2YUPA 1U5SA 1ZX6A 1J3TA 2L3SA 1JQQA 2JXBA 2C0IA 2YUQA 4HXJA 4Z88A 2KE9A 2JS2A 1GCQC 3UATA 2DA9A 2LP5A 1H3HA 1NYGA 2EVRA 1CKAA 2V1QA 2DMOA 2ROLA 1QKWA 2DF6A 1I1JA 4LUEA 1X43A 1GBRA 1E6GA 2FPDA 3FJ5A 3M0QA 1ABQA 1HD3A 1XOVA 2J05A 2NWMA 2DRMA 3NHNA 1QWEA 2LNHB 4OMQA 3VS0A 1JO8A 2ENMA 3IQLA 1X6GA 3VRYA 2J7IA 2XMFA 2ABLA 2J06A 1UHCA 1NM7A 3I9QA 2K7AA 1SRMA 1AWOA 2KNBB 1NLPC 1X2KA 4M4ZA 5GJVB 1RLQC 2DE0X 3M0PA 1OOTA 3QWYA 1K1ZA 2M51A 3I5SA 1OV3A 1WA7A 1T3SA 4JJBA 2SEMA 4A63B 5I11A 2KR3A 4JZ4A 1ARKA 1AZGB 3UF4A 1KFZA 3EHRA 5EC7A 2X3WD 1QLYA 1K9AA 2FEIA 5IHIA 1WI7A 1A0NB 1E6HA 1SEMA 4Y92A 1SSHA 3THKA 5IXFA 2AK5A 5IXBA 2DVJA 2LJ3A 1JU5C 4ZNXA 1ZUYA 2K2MA 1KIKA 3TVTA 1AZEA 1SPKA 4JJDA 4RTYA 2D1XA 1VYTA 4AFZC 1MUZA 1UJ0A 4CC3A 1ABOA 1X6BA 1TG0A 2DLPA 2YSQA 1T3LA 2RQUA 2AZVA 4HVVA 4AFUC 3EGUA 2RN8A 2EPDA 1AVZC 4IIMA 4J9FA 1JEGA 2CH4A 2A36A 5L23A 2VWFA 3H41A 4CC7A 2W10A 1WFWA 1X2QA 2I0NA 5FWCA 1GCPA 2BZXA 1G2BA 2M0YA 2KXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IO6 A;  3CQT A;  2DM1 A;  2FRY A;  1X27 A;  4GLM A;  3EG2 A;  2HDA A;  1MV3 A;  2BTT A;  2GQI A;  2L0A A;  3R6N A;  4Z89 A;  3EG3 A;  1PRL C;  3U23 A;  1CKB A;  2D8H A;  1ZLM A;  4HVU A;  4LE9 A;  3GBQ A;  4GBQ A;  2KRN A;  2RPN A;  4AG1 C;  1YNZ A;  1AD5 A;  4RTT A;  2LQN A;  3REA B;  1FMK A;  4OMM A;  1W1F A;  2CRE A;  2A28 A;  4J9G A;  1AEY A;  2RF0 A;  3REB B;  4KRT A;  1VA7 A;  2W0Z A;  3I5R A;  1UHF A;  2RQV A;  1H92 A;  1N5Z A;  1M27 C;  4IIO A;  4JPB W;  2RMO A;  2C0T A;  1RI9 A;  2MIO A;  4OMO A;  3EG0 A;  2KRO A;  1T0J A;  3QWX X;  1QCF A;  2CDT A;  2NUZ A;  3VS4 A;  2O9V A;  1V1C A;  2HEQ A;  2RQT A;  3A98 A;  1NEB A;  2OI3 A;  2IIM A;  1QKX A;  2JS0 A;  1W6X A;  2P4R A;  1OPK A;  2CH4 W;  3VS6 A;  1WLP B;  2KT1 A;  2KRM A;  2LJ1 A;  4E6R A;  2DBK A;  2MOX A;  5FW9 A;  1M3C A;  3PE0 A;  1PKT A;  4LNP A;  5HCK A;  1TUC A;  3M0T A;  4J9E A;  2JW4 A;  3M0R A;  1GFD A;  1PKS A;  2JM9 A;  2KEA A;  3LH5 A;  3TSW A;  4K11 A;  1HSQ A;  1YWP A;  2CSQ A;  2FG0 A;  4HCK A;  1TUD A;  1RLP C;  2JTE A;  3VS2 A;  1I07 A;  2K3B A;  1BB9 A;  1B3Q A;  2JT4 A;  1S1N A;  2RQR A;  4AFS C;  1SHG A;  1NLO C;  2JM8 A;  1UGV A;  1LCK A;  2DBM A;  2JMC A;  2OJ2 A;  1I0C A;  2GGR A;  1Z9Z A;  4J9I A;  2BZ8 A;  2DYB A;  2LX7 A;  3M0S A;  5IHK A;  2B86 A;  3RNJ A;  1QWF A;  4D8D A;  1SHF A;  2J6O A;  2L3P A;  2OAW A;  2HBW A;  4JJC A;  2CUB A;  4CC4 B;  1OEB A;  1T0H A;  2EQI A;  4R0K A;  5FWB A;  2FPE A;  2EBP A;  2ED1 A;  1AOJ A;  1NYF A;  4LN2 A;  4F17 A;  3NGP A;  3M0U A;  4AG2 C;  1PRM C;  1UJY A;  2AKK A;  2C0O A;  2DL7 A;  3I35 A;  2YUN A;  2F2V A;  5IH2 A;  1ZUK A;  4DEY A;  2DNU A;  2H8H A;  1PWT A;  1K4U S;  1E7O A;  2DL5 A;  4RTV A;  3PVQ A;  3EG1 A;  5ECA A;  3TSZ A;  2DIL A;  3UA7 A;  2L2P A;  2EKH A;  1MV0 B;  1NG2 A;  2EYY A;  3SEM A;  2KXC A;  1EFN A;  2FO0 A;  2KRS A;  2KBT A;  2VKN A;  2DJQ A;  1GCQ A;  1GL5 A;  1NEG A;  2KYB A;  4RTU A;  2VVK A;  2LCS A;  5GJW B;  1UUE A;  3EHQ A;  1GBQ A;  4OML A;  2L3Q A;  2FRW A;  1X69 A;  4RUG A;  1FYN A;  2LZ6 B;  2PNI A;  2J6K A;  2X3X D;  2O31 A;  2GTJ A;  2K6D A;  2YUO A;  2HCK A;  2ESW A;  2JMA A;  2O9S A;  3ULR B;  1YWO A;  1M30 A;  2GTO A;  2J6F A;  1BBZ A;  1U3O A;  4OMN A;  3H0F A;  3VRZ A;  4AFQ C;  5IHN A;  4F14 A;  1YCS B;  2MCN A;  4RTW A;  1VYU A;  1ZSG A;  3VS1 A;  1GRI A;  3SHW A;  1WIE A;  2QDL A;  2EYX A;  2V1R A;  3ZL7 C;  2E5K A;  2ECZ A;  2O2O A;  2EYW A;  1BK2 A;  1Y0M A;  3VS7 A;  1UDL A;  1B07 A;  4DEX A;  2CSI A;  2DRK A;  4Z8A A;  2ED0 A;  4J9H A;  1ZBJ A;  1HJD A;  2D0N A;  1JXM A;  1RUW A;  4HVW A;  1GFC A;  2PTK A;  3RBB B;  1WDX A;  2KT8 A;  2CT3 A;  1UG1 A;  4OMP A;  2KGT A;  2BZY A;  4X1V A;  2AKL A;  3UA6 A;  3NPF A;  5I22 A;  3H0H A;  1K0X A;  1OPL A;  1M8M A;  3C0C A;  1Y57 A;  4ESR A;  4F16 A;  2A08 A;  1G83 A;  1WXU A;  3VS5 A;  2RNA A;  1K0S A;  2EW3 A;  4QT7 A;  2AZS A;  4J9C A;  2G6F X;  1AWJ A;  1JXO A;  1W70 A;  2K9G A;  2SRC A;  4LUD A;  4D8K A;  1M3B A;  1UE9 A;  2GNC A;  2D8J A;  1WXB A;  1PHT A;  2EGE A;  1AWW A;  1PNJ A;  2F2W A;  2EYZ A;  2EGA A;  1WX6 A;  2DL3 A;  2HSP A;  2LJ0 A;  2ROT A;  2KYM A;  2LQW A;  1KJW A;  4J9D A;  4RTX A;  1SRL A;  1M3A A;  2YT6 A;  4FSS A;  3H0I A;  1ZUU A;  4CC2 A;  1BU1 A;  3KFV A;  3O5Z A;  4J9B A;  1YN8 A;  1Z9Q A;  2LMJ A;  2YDL A;  1WXT A;  1CSK A;  4ORZ A;  2EGC A;  1WYX A;  3VS3 A;  1AWX A;  4EIK A;  2F2X A;  2GBQ A;  1K76 A;  2K79 A;  2PZ1 A;  4JZ3 A;  2FPF A;  1YP5 A;  2A37 A;  1UEC A;  2CUD A;  2DL4 A;  2DX1 A;  1UTI A;  3JV3 A;  1VYV A;  1UFF A;  4WCI A;  2RQW A;  2CT4 A;  1H8K A;  3NMZ C;  3PVL A;  2DL8 A;  1U06 A;  1KSW A;  4RTZ A;  2O88 A;  2YUP A;  1U5S A;  1ZX6 A;  1J3T A;  2L3S A;  1JQQ A;  2JXB A;  2C0I A;  2YUQ A;  4HXJ A;  4Z88 A;  2KE9 A;  2JS2 A;  1GCQ C;  3UAT A;  2DA9 A;  2LP5 A;  1H3H A;  1NYG A;  2EVR A;  1CKA A;  2V1Q A;  2DMO A;  2ROL A;  1QKW A;  2DF6 A;  1I1J A;  4LUE A;  1X43 A;  1GBR A;  1E6G A;  2FPD A;  3FJ5 A;  3M0Q A;  1ABQ A;  1HD3 A;  1XOV A;  2J05 A;  2NWM A;  2DRM A;  3NHN A;  1QWE A;  2LNH B;  4OMQ A;  3VS0 A;  1JO8 A;  2ENM A;  3IQL A;  1X6G A;  3VRY A;  2J7I A;  2XMF A;  2ABL A;  2J06 A;  1UHC A;  1NM7 A;  3I9Q A;  2K7A A;  1SRM A;  1AWO A;  2KNB B;  1NLP C;  1X2K A;  4M4Z A;  5GJV B;  1RLQ C;  2DE0 X;  3M0P A;  1OOT A;  3QWY A;  1K1Z A;  2M51 A;  3I5S A;  1OV3 A;  1WA7 A;  1T3S A;  4JJB A;  2SEM A;  4A63 B;  5I11 A;  2KR3 A;  4JZ4 A;  1ARK A;  1AZG B;  3UF4 A;  1KFZ A;  3EHR A;  5EC7 A;  2X3W D;  1QLY A;  1K9A A;  2FEI A;  5IHI A;  1WI7 A;  1A0N B;  1E6H A;  1SEM A;  4Y92 A;  1SSH A;  3THK A;  5IXF A;  2AK5 A;  5IXB A;  2DVJ A;  2LJ3 A;  1JU5 C;  4ZNX A;  1ZUY A;  2K2M A;  1KIK A;  3TVT A;  1AZE A;  1SPK A;  4JJD A;  4RTY A;  2D1X A;  1VYT A;  4AFZ C;  1MUZ A;  1UJ0 A;  4CC3 A;  1ABO A;  1X6B A;  1TG0 A;  2DLP A;  2YSQ A;  1T3L A;  2RQU A;  2AZV A;  4HVV A;  4AFU C;  3EGU A;  2RN8 A;  2EPD A;  1AVZ C;  4IIM A;  4J9F A;  1JEG A;  2CH4 A;  2A36 A;  5L23 A;  2VWF A;  3H41 A;  4CC7 A;  2W10 A;  1WFW A;  1X2Q A;  2I0N A;  5FWC A;  1GCP A;  2BZX A;  1G2B A;  2M0Y A;  2KXD A; 
#chains in the Genus database with same CATH topology
 1IO6 A;  3TCJ A;  1HK9 A;  1X27 A;  4KH0 B;  2BTT A;  1QVP A;  4BY6 B;  2LQ8 A;  4M7D F;  3HSB A;  3CCS Q;  3U23 A;  3QG1 A;  1CKB A;  2DXB A;  4AMC A;  1TXQ A;  4HVU A;  4LE9 A;  3UT1 A;  3CPW S;  3CC4 A;  2RPN A;  4QKU A;  1YNZ A;  1AD5 A;  2LQN A;  2RH2 A;  3I55 T;  1FMK A;  1YHQ T;  1D09 B;  2A28 A;  2RF0 A;  2M02 A;  3A8O B;  3CCE Q;  3G71 T;  4PK4 A;  2MIO A;  3EG0 A;  2CDT A;  8ATC B;  2HEQ A;  5I21 A;  2DKG A;  4FW2 A;  3OBY A;  4IUQ A;  3GLX A;  3JSC A;  4Z02 A;  3ZFJ A;  4M75 B;  3MEV A;  2YRC A;  2ZPI B;  2E3H A;  2FL7 A;  1TUC A;  2XDD A;  1N6A A;  4J9E A;  2ZGW A;  5GAN f;  1PKS A;  2JM9 A;  1K8A U;  5KH6 A;  1YWP A;  3NFC A;  5GMK i;  4HCK A;  2MF2 A;  1M2O A;  1RLP C;  1TUD A;  1WJQ A;  3VJP A;  2M16 A;  3NTH A;  3MEU A;  3M53 A;  1B3Q A;  2DFU A;  4M75 E;  2LCL A;  4AFS C;  2CKK A;  1LCK A;  2JMC A;  2R58 A;  2KY9 A;  2GGR A;  4J9I A;  1BCM A;  2DYB A;  1M1G A;  1Y7X A;  5IHK A;  1YJN T;  5KCO A;  2A3L A;  4EMK A;  5D6W A;  2OTL Q;  1OUL A;  4ZGD B;  1SHF A;  4OVA A;  1RAB B;  2L3P A;  4JDS A;  3JB9 G;  4IUP A;  3QII A;  3M5A A;  4CC4 B;  2CUB A;  3DB3 A;  2DJZ A;  1QVG P;  4M77 B;  2IG0 A;  3EGX A;  4II1 A;  3I35 A;  2DL7 A;  2F2V A;  3CCQ Q;  1PWT A;  1OZ2 A;  1N8R U;  5A0G A;  3CCS A;  5ECA A;  3L2U A;  1MHN A;  4J6X A;  2X4J A;  3UA7 A;  1MV0 B;  1Y96 B;  1BIB A;  3A1P A;  1KQS A;  3MCA B;  2QG9 B;  1D1C A;  3KUF A;  2VKN A;  2HD0 A;  4M77 E;  3CBO A;  2Y90 A;  5CQY A;  3FDR A;  1IHV A;  2HNI A;  2K3Y A;  4RTU A;  3S3M A;  3PMI A;  1NPR A;  1UUE A;  3RKW A;  5AYF A;  4E7H A;  3M56 A;  2L3Q A;  1M90 C;  2FRW A;  4XTZ A;  1G3S A;  2P4T A;  4OF1 A;  4RUG A;  3CCE A;  1FYN A;  1K9M U;  1D0X A;  2X3X D;  2K6D A;  2YUO A;  2HCK A;  3INZ A;  3ULR B;  2EJ9 A;  5IN1 A;  1G8X A;  5GAM f;  4AFQ C;  4KH1 B;  2DZ9 A;  3OYJ A;  2DXC A;  4JS4 A;  1KC8 U;  1YCS B;  2MCN A;  4MZP A;  4Q5W A;  1VYU A;  4A4G A;  5DY9 A;  2ZPE B;  1WIE A;  1X75 C;  3ZL7 C;  3PIO A;  1VQK T;  3CCJ Q;  3JCM Q;  3VU3 C;  2KAF A;  1B07 A;  4PJO B;  3H6Z A;  1VQM A;  2YWW A;  3BY7 A;  1JXM A;  1RUW A;  2H3E B;  1VIE A;  2MK5 A;  1VQ4 T;  2RHY A;  2OTJ A;  4XU1 A;  4MDW A;  4C92 D;  1M9S A;  3HL8 A;  3CCR T;  2OTL A;  4M75 A;  2AKL A;  2AT1 B;  3UA6 A;  1N9R A;  1NZ9 A;  4N4H A;  3CMA A;  3CCL T;  2F1L A;  3CPW P;  1G3W A;  3LH0 A;  2A08 A;  1VQL T;  3VS5 A;  2RNA A;  1K0S A;  2K9G A;  1JXO A;  2SRC A;  4LUD A;  3RIR A;  1M3B A;  3CCQ A;  2D6F A;  2D8J A;  4NL2 A;  2K4Y A;  5I2S A;  1PHT A;  2XD0 A;  1AWW A;  1PNJ A;  2EYZ A;  3CD6 Q;  3M4G A;  1Q81 R;  1WX6 A;  1OQK A;  2DTI A;  5DLO A;  4J9D A;  1FXX A;  3ME9 A;  4E7L A;  2QAS A;  1ZUU A;  3E9F A;  4ME7 A;  1B34 B;  4EMK C;  2E4H A;  2KSS A;  3C4S A;  2E64 A;  2LMJ A;  2YDL A;  1WXT A;  1K8A C;  1C0M A;  4M7D G;  4M77 A;  5CVI A;  3CCM Q;  1NJI R;  2EGC A;  5GAO n;  3VS3 A;  4EIK A;  2F2X A;  4JZ3 A;  1YP5 A;  1UEC A;  1R0B G;  3EGD B;  1KQS S;  2LT4 A;  3JB9 D;  4JRK A;  4WCI A;  2CT4 A;  1WHG A;  3MEA A;  3NMZ C;  2DL8 A;  1VQN T;  5CKD A;  1VQ5 Q;  2BE9 B;  1U5S A;  1ZX6 A;  1M1K R;  1J3T A;  2GF7 A;  3CCJ A;  3FJP A;  2DA9 A;  3FIF A;  3EFS A;  2DD4 A;  4BI3 A;  5CK9 A;  1CKA A;  2V1Q A;  3SB2 A;  2K5L A;  3VUB A;  2EJF A;  3P8D A;  1QVG A;  3CCU T;  3L2W A;  1N8R C;  1YJ9 T;  1M5Q 1;  3M0Q A;  3X26 B;  2I2L A;  4BY6 C;  4JRP A;  1M2V A;  1Q86 U;  2QGG A;  2NWM A;  3G6E T;  3EFO B;  4HA8 A;  4C92 F;  1VQ9 Q;  1QWE A;  2NUT A;  1YJW T;  2X35 A;  5KYW B;  1QQJ A;  2QEX Q;  1D1B A;  2J7I A;  2ABL A;  4E7I A;  1UHC A;  4QQ6 A;  1RAE B;  5KYN A;  4FSX A;  4C5H A;  1MNE A;  2ZPG B;  4ZTF A;  1NLP C;  1X2K A;  4BE2 A;  1K9M C;  2XIC A;  1VQO Q;  1RLQ C;  1C1A A;  3MKD A;  4QQD A;  4E7K A;  1VQ7 Q;  1K1Z A;  3DB4 A;  4MDX A;  4JJB A;  1YI2 T;  1R8O B;  1WPY A;  2SEM A;  5DM7 R;  4NL3 A;  4A63 B;  1ACM B;  5LJ5 g;  1R77 A;  3CD6 A;  1VQ6 T;  3MJX A;  4KGV B;  3MP6 A;  3JCM g;  1KC8 C;  5LJ5 e;  2MWP A;  2X3W D;  1QLY A;  4PLI A;  2MAM A;  3JCM e;  1QP2 A;  1E6H A;  4WF2 A;  5GMK l;  2AK5 A;  5IXB A;  4M75 C;  4LDV A;  2K2M A;  1KIK A;  1SPK A;  1UGP B;  4RTY A;  4LDX A;  2D1X A;  4KUD K;  3GNF B;  3CCM A;  3H8Z A;  3KBG A;  4QVD A;  1UJ0 A;  4BDY A;  1NBE B;  2LCC A;  4J8O A;  5GAN 3;  2DLP A;  1T3L A;  2AZV A;  3OYL A;  4XTU A;  2LTO A;  3EGU A;  2HZY A;  4FYY B;  1B7T A;  1AVZ C;  1YFN A;  1JEG A;  3JB9 F;  2QTX A;  3F70 A;  4X9C A;  5LL6 S;  1EZZ B;  4CC7 A;  2W10 A;  3C12 A;  3DKM A;  2JVV A;  2NYS A;  1GCP A;  4P5N A;  2BZX A;  3RES A;  1VQP Q;  2M0Y A;  2LT1 A;  3RKX A;  1KHC A;  4J6Y A;  4GLM A;  1OI1 A;  2HDA A;  2C06 A;  4M77 C;  1YIJ A;  4Z89 A;  5GAN g;  1PRL C;  2D0Q B;  5GMK m;  5GAN 2;  2HQE A;  5GAN e;  1PD1 A;  1VQ9 A;  4QW2 A;  4BDZ A;  2G3R A;  4R55 A;  2PU9 B;  2QEX A;  2F5K A;  4C0F A;  1O75 A;  2W0Z A;  1WHM A;  3I5R A;  2V26 A;  1UHF A;  1H92 A;  1N5Z A;  2CP6 A;  4OB1 B;  3V7C A;  3I55 Q;  1YHQ Q;  1RI9 A;  1QVG S;  2KRO A;  1QCF A;  5LJ5 j;  1VQ7 A;  3VS4 A;  3BE3 A;  3A98 A;  1IGU A;  1RAC B;  3OS1 A;  2OI3 A;  1W6X A;  3G71 Q;  1WZO A;  3GF5 A;  3A5Z B;  3NTI A;  5FU6 C;  1K73 R;  3JB9 H;  1OPK A;  2CH4 W;  1WLP B;  4M75 D;  4E2F B;  2MOX A;  3EH1 A;  3WVD B;  1M3C A;  3UWN A;  1IXD A;  1KQS P;  3LWI A;  5IT9 E;  2IVW A;  2EKO A;  4OP0 A;  5HCK A;  2GFU A;  1JRI A;  2L89 A;  4LDW A;  4TVR A;  2JW4 A;  1QW1 A;  3M0R A;  5CO7 A;  5KYW A;  1S72 T;  4K11 A;  1HSQ A;  5KYU A;  4N4I A;  2Z0W A;  1IRX A;  3VS2 A;  1I07 A;  2X51 A;  4PL6 A;  2ZAE A;  4C92 A;  1S1N A;  1UGV A;  4C5E A;  2DBM A;  1OU9 A;  1WJR A;  1M4Z A;  3OB9 A;  4Y28 E;  1KHI A;  1N27 A;  4PFZ A;  1Q86 C;  5KCH A;  1U8R A;  2JUF A;  3T9N A;  2J6O A;  3OYK A;  1YJN Q;  2OAW A;  3HFN A;  4M77 D;  3G7Z A;  1OEB A;  1T0H A;  3ZBD A;  1VQP A;  2FPE A;  2ED1 A;  1NYF A;  3URG A;  5FU7 C;  4C8Q E;  2AHJ B;  2FB7 A;  1P92 A;  3FLG A;  3M0U A;  4AG2 C;  5GAN j;  1UJY A;  2AKK A;  2KQW A;  2YUN A;  4J6W A;  4EMG A;  2DL5 A;  3SDZ A;  4RTV A;  2CZ0 B;  3M58 A;  3TSZ A;  1OX9 A;  2DIL A;  4F7U B;  2RD1 A;  2D9T A;  7AT1 B;  3QYH B;  2FHD A;  1DJ7 B;  2KBT A;  2DEU A;  2KYB A;  4HKE A;  2VVK A;  2V8J A;  3HRT A;  4XK8 E;  5A0L A;  5EG2 A;  1X69 A;  3I55 A;  1YHQ A;  4F7U E;  2O31 A;  5HY6 A;  1VQ8 T;  1YBY A;  2JMA A;  1H3Z A;  3X25 B;  2GTO A;  1M30 A;  2J6F A;  1BBZ A;  2YLB A;  3G71 A;  4RG8 A;  1Q95 G;  4C92 G;  2PVO B;  2NLU A;  2HKN A;  1PG5 B;  1WHH A;  3X28 B;  4M75 F;  3CME T;  3QJ6 A;  2WAC A;  2EYX A;  3CC7 Q;  2B8A A;  4GY5 A;  3QDR B;  2E5K A;  1F1B B;  2E70 A;  1BK2 A;  1Y0M A;  4N0A A;  1UDL A;  1TSF A;  3CC2 T;  2CSI A;  4Z8A A;  1XQH A;  4M78 B;  1VQK Q;  5GAN 6;  4JS5 A;  4E7Z A;  4HVW A;  5GAN d;  2VAS A;  4ELZ C;  2FZK B;  5CKB A;  4KT0 E;  2PUK B;  1KD1 C;  1WDX A;  1MMD A;  1RAF B;  2CT3 A;  5CAI A;  3OYM A;  5GAN 4;  2BZY A;  4X1V A;  2CS7 A;  3HRS A;  4M78 E;  4X9D A;  2XG8 D;  4DBH A;  2RK2 A;  1YJN A;  1Y71 A;  2VGM A;  1PSE A;  4VUB A;  4A4F A;  3CCR Q;  4ESR A;  3JCM P;  1KQ2 A;  1G83 A;  2ZPF B;  4M77 F;  5DLQ E;  4QT7 A;  3H9N A;  4E7S A;  3CCL Q;  5D6X A;  2LNV A;  1AWJ A;  1W70 A;  2HKQ B;  2GNC A;  5A0D A;  1VQL Q;  3OYG A;  3RMQ A;  4C8Q A;  4C92 C;  4C0Z A;  2YLC A;  2CP3 A;  1Q7Y U;  2KYM A;  2E41 A;  4BD3 A;  2QK0 A;  1KJW A;  2E6N A;  1M3A A;  2XDB A;  1JBM A;  4EDU A;  4CC2 A;  3OQ5 A;  3KFV A;  3L2R A;  1Z9Q A;  2RO0 A;  2LC4 A;  1CSK A;  1G3T A;  1AWX A;  3JAM E;  2K79 A;  1K76 A;  2PZ1 A;  2FPF A;  4O5V A;  2HAX A;  2CUD A;  2DL4 A;  2DX1 A;  1UTI A;  3E2U A;  1VYV A;  4FT4 A;  1FWZ A;  2RQW A;  3PVL A;  4OGC A;  1H8K A;  1ZSZ B;  2QA4 T;  1U06 A;  4NS5 A;  2RI3 A;  3CC7 A;  2A7Y A;  1BYM A;  2OX7 A;  5GAM d;  1YIT T;  4PNO A;  1JQQ A;  4Z88 A;  1VQN Q;  3M55 A;  2VUB A;  3I56 T;  2CP0 A;  1TOV A;  2LP5 A;  4FYW B;  1WJS A;  1I5L A;  4V2S A;  2EVR A;  2X4Y A;  1OU8 A;  1VQK A;  1XTD A;  2F5T X;  2DMO A;  2ROL A;  1QKW A;  2DF6 A;  2LQK A;  1KK7 A;  5KYY B;  1ZQ1 A;  3FJ5 A;  3PGG A;  4M7A B;  5GAO p;  3JCM X;  3BFM A;  4C8Q G;  1G3Y A;  3L2V A;  3CCU Q;  1EX4 A;  1PSF A;  3L2Q A;  2DRM A;  4MZT A;  3NHN A;  1YJ9 Q;  1BI1 A;  4OMQ A;  1WHK A;  4ZGJ B;  3CCR A;  1JO8 A;  3IQL A;  3G6E Q;  5FRM A;  2RJD A;  3VRY A;  3OYY A;  4A4K A;  2YRV A;  1YJW Q;  1Q86 R;  2K7A A;  3CCL A;  5J3B A;  5LJ5 h;  4M7A E;  4M78 A;  1X6O A;  4PJO E;  5GJV B;  4N0A C;  3JCM h;  1VQL A;  5IAY A;  3QWY A;  1T3S A;  1W4S A;  1KQ1 A;  3M57 A;  5KYX B;  1VQM T;  5I11 A;  5M9O A;  4CI0 C;  4JZ4 A;  1ARK A;  3EHR A;  1YI2 Q;  3QBY A;  1UB4 A;  2L5Q A;  1VQ6 Q;  2FEI A;  5IHI A;  1WI7 A;  2OTJ T;  4A54 A;  2XI9 A;  3O8V A;  2P0Q A;  1LOJ A;  2CP5 A;  3A8H B;  5IXF A;  1D0Y A;  3C94 A;  3EG9 B;  2EQK A;  4JJN K;  4BI8 B;  1MUZ A;  2YRD A;  3CMA T;  2QQB A;  3G4S Q;  4BB7 A;  1ABO A;  4X34 A;  1TG0 A;  2ATC B;  2RQU A;  4AFU C;  4FU6 A;  4J9F A;  3ER0 A;  2EQM A;  2QQA A;  4C8Q C;  1SKU B;  1EIF A;  1D3B B;  1WFW A;  3HPW A;  4RMO A;  1X2Q A;  2I0N A;  3V8L A;  4DQ2 A;  1Y96 A;  3CQT A;  2BIV A;  4L5G A;  5GAO l;  3GPL A;  5FRO A;  3BW1 A;  3EG2 A;  3R6N A;  2RHI A;  4M75 G;  3EG3 A;  1JJ2 A;  5C6S A;  2RJF A;  3PFS A;  3MET A;  4LDY A;  3OSS C;  2D8H A;  4RCC A;  3A8G B;  1KG1 A;  2DXU A;  4HT8 A;  1MND A;  4GBQ A;  1ZSZ A;  1Q7Y C;  1YJ9 A;  2VYT A;  4RTT A;  1FMW A;  2HQX A;  4WTO B;  4OMM A;  1W1F A;  2CRE A;  3G6E A;  2DIG A;  1TWB A;  3REB B;  1VA7 A;  1YJW A;  2V8I A;  1W2B A;  2RQV A;  2XDP A;  3J81 E;  1FX7 A;  2RMO A;  4FW1 A;  2K57 A;  4FL6 A;  2EIF A;  4OMO A;  4KUI A;  3QWX X;  2VC8 A;  3BDL A;  4XTY A;  2DET A;  3VYG A;  3QDF A;  1XNI A;  1NEB A;  2IIM A;  1QKX A;  1BIA A;  2JS0 A;  3OW2 P;  4J7F A;  5GAO q;  2P4R A;  2KRM A;  2LJ1 A;  1IB8 A;  4M7A A;  1YI2 A;  4PJO A;  5LJ3 f;  5FW9 A;  3HFO A;  2VV5 A;  1VQ6 A;  3PE0 A;  5GAO m;  1PKT A;  2EQU A;  2VXE A;  4M77 G;  1WNL A;  5GAN 8;  1QMC A;  1UEB A;  4HCC A;  2KEA A;  1YCY A;  3LH5 A;  3TSW A;  3JB9 I;  1BI2 A;  4C0G A;  2X9H A;  2CSQ A;  2HL3 A;  2JTE A;  3CCV T;  4GLK A;  3G4S A;  3LWH A;  3OYC A;  1S72 Q;  4C8Q D;  1BB9 A;  2JT4 A;  1OZ3 A;  2LX9 A;  1SHG A;  2JM8 A;  4M78 C;  5HKC A;  3P8H A;  4OGE A;  4PJN A;  1C6V X;  3LGL A;  5KYX A;  2OJ2 A;  4FT2 A;  2BZ8 A;  2LX7 A;  2X4W A;  3M0S A;  1Q81 U;  1IZ6 A;  2B86 A;  1QWF A;  1M90 R;  1TUG B;  5GAO r;  2HBW A;  3RMS A;  4JJC A;  1GXI E;  3DLM A;  4R0K A;  2EQI A;  5FWB A;  2HBP A;  2EBP A;  3EG9 A;  2RI2 A;  4LN2 A;  3GIB A;  3RUX A;  1PRM C;  1VQ5 A;  1NJI U;  1ZUK A;  4DEY A;  3X24 B;  3CBM A;  1K4U S;  1E7O A;  3PVQ A;  4OB3 B;  1B34 A;  3QKJ A;  2MPX C;  2EKH A;  2DZC A;  1NG2 A;  2EYY A;  3SEM A;  4ELY C;  1HYO A;  1EFN A;  2FO0 A;  2KRS A;  2O4X B;  1GCQ A;  1GL5 A;  1NEG A;  3VV0 A;  4M7A G;  2LCS A;  4PJO G;  1KD1 U;  1LNX A;  4FCY A;  4HCZ A;  3EGD A;  4OML A;  1QCO A;  4Y91 A;  2H3J A;  4XQ3 A;  1BI0 A;  2LZ6 B;  1NE8 A;  2J6K A;  3MO8 A;  3HHT B;  2GTJ A;  1JJ2 S;  3CPF A;  2VGN A;  5GMK e;  2RHX A;  4BI4 A;  2KMT A;  1FMV A;  3OMG A;  2XU8 A;  3QUI A;  3S6W A;  4EMH A;  3VRZ A;  1VQ8 Q;  5IHN A;  3OYA A;  5FRN A;  4EPC A;  2WSF E;  4RTW A;  2EAY A;  3VS1 A;  3M4Y A;  2EWN A;  1VQO A;  1YIJ T;  3SHW A;  1M8V A;  2QDL A;  2V1R A;  2EJG A;  2O2O A;  2EYW A;  3QZ5 B;  4J5Y A;  1W2B S;  1ZSZ C;  3CME Q;  4RKU E;  4M78 D;  1QVF A;  4DEX A;  2DRK A;  1SG5 A;  2K5F A;  2LRQ A;  1ZBJ A;  3OYH A;  4DOW A;  2CZ6 B;  2D0N A;  1GFC A;  3EFO A;  3CC2 Q;  2P0P A;  3RBB B;  3J80 E;  1VIF A;  4ZN1 A;  4C8Q F;  2P84 A;  2GQV A;  1VQ7 T;  1UG1 A;  3PTA A;  4OMP A;  2KGT A;  3LLR A;  4PLL A;  4FYX B;  3NPF A;  2QXF A;  3C95 A;  4M7A C;  3H0H A;  1K0X A;  1OPL A;  4PJO C;  2KVQ G;  1M8M A;  1Y07 A;  2HL5 C;  2JN0 A;  3C0C A;  1K8A R;  1Y57 A;  4FM4 B;  4F16 A;  3N5B B;  1WXU A;  2EW3 A;  3TQ7 P;  3ASK A;  2AZS A;  4ZN3 A;  4J9C A;  2G6F X;  4EMK B;  5J39 A;  1WXB A;  2K5I A;  1RI0 A;  5GAM g;  1V29 B;  3OSV A;  2F2W A;  2EGA A;  5GAM e;  4F7U F;  2DL3 A;  2HSP A;  2LJ0 A;  2LQW A;  4BE1 A;  3NTK A;  2JTF A;  4FSS A;  3H0I A;  1I5O B;  3OW2 A;  3UDC A;  8AT1 B;  2K3X A;  5GMK j;  4IKF A;  3JCM b;  2IPO B;  2DO3 A;  2EYQ A;  2X4X A;  1ZA2 B;  3AHU A;  1Q7Y R;  3LGF A;  4J83 A;  4RG2 A;  2DTO A;  1WYX A;  3E9G A;  3PIP A;  4F04 B;  5CKH A;  1N8R R;  3KXT A;  1MMG A;  3R6O A;  2HQH A;  2A37 A;  3M59 A;  4HCB A;  1WGS A;  3E19 A;  3QJY A;  3JV3 A;  2CYZ B;  1UFF A;  4IUT A;  4QQG A;  3RKY A;  3GNG A;  4JLG A;  2L3R A;  1U1T A;  3JCM f;  1PCX A;  2CGH A;  1Q81 C;  2XID A;  2O4X A;  2KK4 A;  4RTZ A;  2O88 A;  2YUP A;  3S3O A;  2L3S A;  3A8M B;  3CME A;  2JXB A;  2C0I A;  2QA4 Q;  4HXJ A;  4C0D B;  2JS2 A;  1GCQ C;  3UAT A;  2RA2 A;  5A2Q E;  1BKB A;  3FC3 A;  1K9M R;  2XKO C;  2R57 A;  1YIT Q;  4M78 F;  4KUL A;  3I56 Q;  1UGQ B;  1X43 A;  3CC2 A;  1VOM A;  1NJI C;  1GBR A;  1VUB A;  4KBM B;  4M7D B;  4M7A D;  1G5V A;  1KC8 R;  4PJO D;  4PJJ A;  2RHU A;  3MP8 A;  3CC4 T;  1K73 U;  2J05 A;  4A4H A;  4LDU A;  1Q82 U;  2RJE A;  2DPP B;  1QVF S;  4FYV B;  1RAG B;  5CKE A;  1X6G A;  3GP8 A;  3A8L B;  1H64 1;  1M1K C;  4M7D E;  1O9S A;  1VQ4 Q;  1NM7 A;  3PNW C;  5GAM j;  3OYE A;  1AWO A;  2KNB B;  4M4Z A;  2A0F B;  1ZBX A;  2QQ9 A;  2M51 A;  3I5S A;  3RDV A;  4PJM A;  1JJ2 P;  3UF4 A;  5EC7 A;  1BCO A;  2HSE B;  2WSC E;  1VQM Q;  2JNG A;  3THK A;  2DVJ A;  4JRI A;  2DIQ A;  1TS9 A;  1LPL A;  4QVC A;  2OTJ Q;  1VYT A;  4AFZ C;  3M54 A;  1W2B P;  3BDU A;  4OMF B;  3OS5 A;  3CXC P;  2FZG B;  4DBF A;  2RM4 A;  2YSQ A;  2P0K A;  4HVV A;  3CMA Q;  2VXF A;  2NUP B;  4O6J A;  2RN8 A;  1U1S A;  2EPD A;  4XTX A;  1OX8 A;  3LYI A;  3OW2 S;  2A36 A;  5L23 A;  2VWF A;  2F69 A;  4C5I A;  4LXC A;  2QA4 A;  5FWC A;  2Y4X A;  3LX7 A;  4IUU A;  5L8R E;  4XU3 A;  5FLX E;  4F7U A;  1YIT A;  4XU2 A;  5LJ3 g;  5KE3 A;  2DM1 A;  3I56 A;  2FRY A;  3CCS T;  5LJ3 e;  1MV3 A;  2L0A A;  2GQI A;  2DXT A;  2OAU A;  2AIR B;  4M7A F;  1ZLM A;  4L6V 5;  2M1H A;  4PJO F;  3GBQ A;  1N9S A;  2M0O A;  2KRN A;  2HMA A;  2QTV A;  5FU6 B;  3EAE A;  3P8B B;  2JZ2 A;  4AG1 C;  3CCE T;  4RCB A;  3REA B;  5J26 A;  9ATC B;  1SF9 A;  4J9G A;  1AEY A;  4KRT A;  1VQ4 A;  1D1A A;  2YHT A;  3CC7 T;  4XAX B;  4JPB W;  1M27 C;  1M2V B;  4IIO A;  4MML A;  3SFM A;  2C0T A;  2QI2 A;  4DBQ A;  3JRZ A;  3VYH B;  1T0J A;  2NUZ A;  2NUT B;  3Q1J A;  4B9X A;  2O9V A;  1V1C A;  3OYF A;  2RQT A;  4BE0 A;  1WQ7 A;  2QGF B;  4M7D A;  3AT1 B;  3SWN B;  3X20 B;  2E6Z A;  3VS6 A;  4A4E A;  2KT1 A;  2FZC B;  3OY9 A;  4E6R A;  2DBK A;  4IUV A;  4NOY A;  2FYK A;  1D0Z A;  1OYX A;  1IHW A;  4LNP A;  3M0T A;  3EH2 A;  5CIU A;  1GFD A;  2FVU A;  2PQW A;  4DBR A;  4HT9 A;  2FG0 A;  1MMN A;  1AHJ B;  2K3B A;  2M9U A;  4F7U G;  3JCM W;  5FU7 B;  4MMK A;  3DLL A;  2RQR A;  2PVG B;  1NLO C;  5AT1 B;  3CCV Q;  3JCM J;  1TTH B;  1V76 A;  4ATO A;  2OTL T;  4JLI A;  1I0C A;  3OA6 A;  1Z9Z A;  3MEW A;  3RER A;  1RAH B;  1K73 C;  3RNJ A;  3WVE B;  3TEE A;  4D8D A;  2XK0 A;  1Q82 C;  5LJ3 j;  5HK0 A;  3JCM V;  4A53 A;  2MYS A;  5GAN 7;  1AOJ A;  2V8K A;  3CCQ T;  4F17 A;  3NGP A;  1QVF P;  2C0O A;  2QQS A;  2BUD A;  5IH2 A;  2DNU A;  3QO3 A;  2H8H A;  1VQN A;  2ZPB B;  3EG1 A;  4XU0 A;  2NUP A;  3ZEH A;  2L2P A;  5GAN h;  2JTM A;  2KXC A;  2COY A;  5CKF A;  4E7J A;  3QXE B;  2DJQ A;  2YXY A;  5GMK h;  1WHL A;  5GJW B;  4M78 G;  3EHQ A;  3OYN A;  3D7S B;  4LD9 K;  2QDY B;  1GBQ A;  1TU0 B;  3CCU A;  2PNI A;  4KGX B;  5C0M A;  2CP2 A;  1M1F A;  2RJC A;  2ESW A;  2O9S A;  1KD1 R;  2BE7 D;  6AT1 B;  2WSE E;  1YWO A;  3CEY A;  3L1A A;  3OMC A;  2JJ9 A;  1U3O A;  1X01 A;  4OMN A;  3E1S A;  3H0F A;  4F14 A;  1ZSG A;  1UGR B;  4IUR A;  3CXC A;  3CCJ T;  1GRI A;  1PC0 A;  1TH7 A;  3V7R A;  5GAN 5;  5KYY A;  2ECZ A;  3QZ9 B;  1YIJ Q;  2GCX A;  4DA4 A;  5CCA A;  4XTV A;  5LJ3 d;  3OS2 A;  3LW5 E;  3VS7 A;  3MP1 A;  1RAI B;  2ED0 A;  4J9H A;  4UC4 A;  3SD4 A;  4C0D C;  1HJD A;  3FEO A;  2R5M A;  2PTK A;  3CCV A;  4B6M A;  1JB0 E;  3SWN A;  5KYU B;  4ZGE B;  2COW A;  1RL2 A;  2KT8 A;  2EQJ A;  4J7I A;  1ZHI A;  3FB9 A;  3QPH A;  3OBW A;  4YTL A;  4M7D C;  3HKS A;  4C92 B;  5I22 A;  2GFA A;  4XTW A;  2DVE A;  5GAM h;  1I4K 1;  3HP9 A;  1RAA B;  3L42 A;  3MHX A;  4C5G A;  2QYZ A;  4D8K A;  3WXM B;  4D6W A;  1UE9 A;  4R56 A;  3OYI A;  4JRQ A;  3CD6 T;  4LD6 A;  4C92 E;  2ZPH B;  2DER A;  2EGE A;  5D7U A;  2PVD B;  3G4S T;  3QHS A;  2DTH A;  4BUG A;  2ROT A;  4RTX A;  1SRL A;  1LVK A;  2YT6 A;  2PUO B;  3TU4 K;  5CR2 A;  1BU1 A;  3CCM T;  3CBP A;  2VB6 A;  2QAZ A;  3O5Z A;  4J9B A;  1YN8 A;  4B9W A;  1PD0 A;  4ANJ A;  1QCN A;  2RHZ A;  3G1J A;  1IRE B;  4ORZ A;  2BKD N;  1D3B A;  1ZA1 B;  2GBQ A;  4PJL A;  1XJW B;  2XHC A;  3L2Z A;  2E65 A;  1M1K U;  3OYD A;  2JOY A;  1VQ5 T;  2EFI A;  1I81 A;  1WHJ A;  3MPU B;  4FIB A;  1KSW A;  4PKC C;  1SSF A;  4AT1 B;  2E3I A;  2E1H A;  1WQW A;  3TRE A;  3OS0 A;  2YUQ A;  1PM3 A;  3CPW A;  2KE9 A;  2CZ1 B;  5KE2 A;  1H3H A;  3VKI A;  1NYG A;  4QVZ A;  2E5Q A;  3OYB A;  4M7D D;  1I1J A;  2ZCF B;  4LUE A;  3V8J A;  1E6G A;  3QYG B;  3QSU A;  2FPD A;  2E10 A;  1IGQ A;  3CXC S;  1VQ9 T;  4DOV A;  4N4G A;  1ABQ A;  3JCM c;  1HD3 A;  3PT9 A;  1XOV A;  2DAQ A;  2LVM A;  1HXD A;  1S72 A;  2QEX T;  3CC4 Q;  2LNH B;  3VS0 A;  2ENM A;  3M9Q A;  1VQO T;  3RR6 A;  4MZM A;  2XMF A;  3FRN A;  2J06 A;  3I9Q A;  2DEQ A;  2MMP A;  3EFR A;  1SRM A;  4JUV A;  1Q82 R;  2MWO A;  3PMT A;  5HK3 A;  1RAD B;  2ZZD A;  2DE0 X;  3M0P A;  1OOT A;  1OV3 A;  1WA7 A;  2DYI A;  2CP7 A;  4CRI A;  2LDM A;  2KR3 A;  2MI6 A;  4KGZ B;  1AZG B;  2KDS A;  4OB0 B;  1KFZ A;  5CQX A;  1I8F A;  3JB9 J;  1K9A A;  3SWN C;  3S3N A;  2R5A A;  2RB6 A;  1A0N B;  1SEM A;  2COZ A;  4Y92 A;  1SSH A;  3GOX A;  2DK3 A;  1M90 U;  2LJ3 A;  1JU5 C;  4ZNX A;  1ZUY A;  4C8Q B;  5I2M A;  3TVT A;  1AZE A;  4JJD A;  3EGX B;  2Y4Y A;  3VUZ A;  1LJO A;  1MGQ A;  3V7S A;  4CC3 A;  3J7A F;  1X6B A;  4PFO A;  4L59 A;  1AT1 B;  4BAC A;  2RK1 A;  3HTR A;  2K2V A;  1R0C B;  4ZTJ A;  1MMA A;  2RI5 A;  5D6Y A;  4IIM A;  1BI3 A;  2CH4 A;  4PFP A;  3HRU A;  3H41 A;  3UPU A;  2L8D A;  1NPP A;  4E47 A;  5LJ3 h;  1VQP T;  2E12 A;  2CZ7 B;  4OB2 B;  5LJ5 d;  2QQR A;  1VQ8 A;  2DD5 A;  2KI7 A;  1QP3 A;  3V8K A;  3JCM d;  2O01 E;  1G2B A;  5LJ5 f;  1UGS B;  2KXD A; 
#chains in the Genus database with same CATH homology
 1IO6 A;  3CQT A;  2DM1 A;  2FRY A;  1X27 A;  4GLM A;  3EG2 A;  2HDA A;  1MV3 A;  2BTT A;  2GQI A;  2L0A A;  3R6N A;  4Z89 A;  3EG3 A;  1PRL C;  3U23 A;  1CKB A;  2D8H A;  1ZLM A;  4HVU A;  4LE9 A;  3GBQ A;  4GBQ A;  2KRN A;  2RPN A;  4AG1 C;  1YNZ A;  1AD5 A;  4RTT A;  2LQN A;  3REA B;  1FMK A;  4OMM A;  1W1F A;  2CRE A;  2A28 A;  4J9G A;  1AEY A;  2RF0 A;  3REB B;  4KRT A;  1VA7 A;  2W0Z A;  3I5R A;  1UHF A;  2RQV A;  1H92 A;  1N5Z A;  1M27 C;  4IIO A;  4JPB W;  2RMO A;  2C0T A;  1RI9 A;  2MIO A;  4OMO A;  3EG0 A;  2KRO A;  1T0J A;  3QWX X;  1QCF A;  2CDT A;  2NUZ A;  3VS4 A;  2O9V A;  1V1C A;  2HEQ A;  2RQT A;  3A98 A;  1NEB A;  2OI3 A;  2IIM A;  1QKX A;  2JS0 A;  1W6X A;  2P4R A;  1OPK A;  2CH4 W;  3VS6 A;  1WLP B;  2KT1 A;  2KRM A;  2LJ1 A;  4E6R A;  2DBK A;  2MOX A;  5FW9 A;  1M3C A;  3PE0 A;  1PKT A;  4LNP A;  5HCK A;  1TUC A;  3M0T A;  4J9E A;  2JW4 A;  3M0R A;  1GFD A;  1PKS A;  2JM9 A;  2KEA A;  3LH5 A;  3TSW A;  4K11 A;  1HSQ A;  1YWP A;  2CSQ A;  2FG0 A;  4HCK A;  1TUD A;  1RLP C;  2JTE A;  3VS2 A;  1I07 A;  2K3B A;  1BB9 A;  1B3Q A;  2JT4 A;  1S1N A;  2RQR A;  4AFS C;  1SHG A;  1NLO C;  2JM8 A;  1UGV A;  1LCK A;  2DBM A;  2JMC A;  2OJ2 A;  1I0C A;  2GGR A;  1Z9Z A;  4J9I A;  2BZ8 A;  2DYB A;  2LX7 A;  3M0S A;  5IHK A;  2B86 A;  3RNJ A;  1QWF A;  4D8D A;  1SHF A;  2J6O A;  2L3P A;  2OAW A;  2HBW A;  4JJC A;  2CUB A;  4CC4 B;  1OEB A;  1T0H A;  2EQI A;  4R0K A;  5FWB A;  2FPE A;  2EBP A;  2ED1 A;  1AOJ A;  1NYF A;  4LN2 A;  4F17 A;  3NGP A;  3M0U A;  4AG2 C;  1PRM C;  1UJY A;  2AKK A;  2C0O A;  2DL7 A;  3I35 A;  2YUN A;  2F2V A;  5IH2 A;  1ZUK A;  4DEY A;  2DNU A;  2H8H A;  1PWT A;  1K4U S;  1E7O A;  2DL5 A;  4RTV A;  3PVQ A;  3EG1 A;  5ECA A;  3TSZ A;  2DIL A;  3UA7 A;  2L2P A;  2EKH A;  1MV0 B;  1NG2 A;  2EYY A;  3SEM A;  2KXC A;  1EFN A;  2FO0 A;  2KRS A;  2KBT A;  2VKN A;  2DJQ A;  1GCQ A;  1GL5 A;  1NEG A;  2KYB A;  4RTU A;  2VVK A;  2LCS A;  5GJW B;  1UUE A;  3EHQ A;  1GBQ A;  4OML A;  2L3Q A;  2FRW A;  1X69 A;  4RUG A;  1FYN A;  2LZ6 B;  2PNI A;  2J6K A;  2X3X D;  2O31 A;  2GTJ A;  2K6D A;  2YUO A;  2HCK A;  2ESW A;  2JMA A;  2O9S A;  3ULR B;  1YWO A;  1M30 A;  2GTO A;  2J6F A;  1BBZ A;  1U3O A;  4OMN A;  3H0F A;  3VRZ A;  4AFQ C;  5IHN A;  4F14 A;  1YCS B;  2MCN A;  4RTW A;  1VYU A;  1ZSG A;  3VS1 A;  1GRI A;  3SHW A;  1WIE A;  2QDL A;  2EYX A;  2V1R A;  3ZL7 C;  2E5K A;  2ECZ A;  2O2O A;  2EYW A;  1BK2 A;  1Y0M A;  3VS7 A;  1UDL A;  1B07 A;  4DEX A;  2CSI A;  2DRK A;  4Z8A A;  2ED0 A;  4J9H A;  1ZBJ A;  1HJD A;  2D0N A;  1JXM A;  1RUW A;  4HVW A;  1GFC A;  2PTK A;  3RBB B;  1WDX A;  2KT8 A;  2CT3 A;  1UG1 A;  4OMP A;  2KGT A;  2BZY A;  4X1V A;  2AKL A;  3UA6 A;  3NPF A;  5I22 A;  3H0H A;  1K0X A;  1OPL A;  1M8M A;  3C0C A;  1Y57 A;  4ESR A;  4F16 A;  2A08 A;  1G83 A;  1WXU A;  3VS5 A;  2RNA A;  1K0S A;  2EW3 A;  4QT7 A;  2AZS A;  4J9C A;  2G6F X;  1AWJ A;  1JXO A;  1W70 A;  2K9G A;  2SRC A;  4LUD A;  4D8K A;  1M3B A;  1UE9 A;  2GNC A;  2D8J A;  1WXB A;  1PHT A;  2EGE A;  1AWW A;  1PNJ A;  2F2W A;  2EYZ A;  2EGA A;  1WX6 A;  2DL3 A;  2HSP A;  2LJ0 A;  2ROT A;  2KYM A;  2LQW A;  1KJW A;  4J9D A;  4RTX A;  1SRL A;  1M3A A;  2YT6 A;  4FSS A;  3H0I A;  1ZUU A;  4CC2 A;  1BU1 A;  3KFV A;  3O5Z A;  4J9B A;  1YN8 A;  1Z9Q A;  2LMJ A;  2YDL A;  1WXT A;  1CSK A;  4ORZ A;  2EGC A;  1WYX A;  3VS3 A;  1AWX A;  4EIK A;  2F2X A;  2GBQ A;  1K76 A;  2K79 A;  2PZ1 A;  4JZ3 A;  2FPF A;  1YP5 A;  2A37 A;  1UEC A;  2CUD A;  2DL4 A;  2DX1 A;  1UTI A;  3JV3 A;  1VYV A;  1UFF A;  4WCI A;  2RQW A;  2CT4 A;  1H8K A;  3NMZ C;  3PVL A;  2DL8 A;  1U06 A;  1KSW A;  4RTZ A;  2O88 A;  2YUP A;  1U5S A;  1ZX6 A;  1J3T A;  2L3S A;  1JQQ A;  2JXB A;  2C0I A;  2YUQ A;  4HXJ A;  4Z88 A;  2KE9 A;  2JS2 A;  1GCQ C;  3UAT A;  2DA9 A;  2LP5 A;  1H3H A;  1NYG A;  2EVR A;  1CKA A;  2V1Q A;  2DMO A;  2ROL A;  1QKW A;  2DF6 A;  1I1J A;  4LUE A;  1X43 A;  1GBR A;  1E6G A;  2FPD A;  3FJ5 A;  3M0Q A;  1ABQ A;  1HD3 A;  1XOV A;  2J05 A;  2NWM A;  2DRM A;  3NHN A;  1QWE A;  2LNH B;  4OMQ A;  3VS0 A;  1JO8 A;  2ENM A;  3IQL A;  1X6G A;  3VRY A;  2J7I A;  2XMF A;  2ABL A;  2J06 A;  1UHC A;  1NM7 A;  3I9Q A;  2K7A A;  1SRM A;  1AWO A;  2KNB B;  1NLP C;  1X2K A;  4M4Z A;  5GJV B;  1RLQ C;  2DE0 X;  3M0P A;  1OOT A;  3QWY A;  1K1Z A;  2M51 A;  3I5S A;  1OV3 A;  1WA7 A;  1T3S A;  4JJB A;  2SEM A;  4A63 B;  5I11 A;  2KR3 A;  4JZ4 A;  1ARK A;  1AZG B;  3UF4 A;  1KFZ A;  3EHR A;  5EC7 A;  2X3W D;  1QLY A;  1K9A A;  2FEI A;  5IHI A;  1WI7 A;  1A0N B;  1E6H A;  1SEM A;  4Y92 A;  1SSH A;  3THK A;  5IXF A;  2AK5 A;  5IXB A;  2DVJ A;  2LJ3 A;  1JU5 C;  4ZNX A;  1ZUY A;  2K2M A;  1KIK A;  3TVT A;  1AZE A;  1SPK A;  4JJD A;  4RTY A;  2D1X A;  1VYT A;  4AFZ C;  1MUZ A;  1UJ0 A;  4CC3 A;  1ABO A;  1X6B A;  1TG0 A;  2DLP A;  2YSQ A;  1T3L A;  2RQU A;  2AZV A;  4HVV A;  4AFU C;  3EGU A;  2RN8 A;  2EPD A;  1AVZ C;  4IIM A;  4J9F A;  1JEG A;  2CH4 A;  2A36 A;  5L23 A;  2VWF A;  3H41 A;  4CC7 A;  2W10 A;  1WFW A;  1X2Q A;  2I0N A;  5FWC A;  1GCP A;  2BZX A;  1G2B A;  2M0Y A;  2KXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...