3GBQA

Solution nmr structure of the grb2 n-terminal sh3 domain complexed with a ten-residue peptide derived from sos direct refinement against noes, j-couplings, and 1h and 13c chemical shifts, minimized average structure
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
57
structure length
57
Chain Sequence
b'MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GRB2
publication title Solution structure of the Grb2 N-terminal SH3 domain complexed with a ten-residue peptide derived from SOS: direct refinement against NOEs, J-couplings and 1H and 13C chemical shifts.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (signal transduction/peptide)
total genus 8
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1996-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3gbqA00
1CKAA 2AKLA 1BB9A 2QDLA 3M0SA 4D8DA 1WLPB 1PHTA 3I5SA 2J6FA 3QWYA 1UJYA 4RTWA 1YNZA 3UA6A 1GFCA 2PNIA 2KT1A 4LUEA 4CC2A 1GCPA 2HEQA 4J9HA 1OV3A 1GFDA 2CDTA 2L3PA 1E7OA 1OEBA 2EYZA 3EGUA 2CUDA 2JM9A 3ZL7C 2K79A 2BZXA 4OMLA 4CC7A 1UGVA 1SHFA 1RLPC 2D8JA 1NEBA 2L2PA 2CH4A 2ED1A 2O9SA 5FWCA 4J9EA 1AZGB 2EGCA 1NYFA 2EVRA 2X3XD 2ROLA 2AZVA 1NLOC 4JZ4A 1A0NB 4J9DA 4Z88A 3TVTA 1ZUUA 3M0RA 1H3HA 2O2OA 4WCIA 2DILA 3H0FA 2YUNA 1ABQA 2GQIA 1AWJA 1LCKA 2DX1A 2DYBA 2W10A 1K1ZA 2HDAA 5IXBA 1UUEA 4OMNA 2OI3A 2FEIA 2GGRA 2FRWA 2GTJA 1NM7A 3SEMA 1TUDA 2VKNA 1X2KA 2XMFA 2JW4A 1QCFA 1AOJA 2BZ8A 2GNCA 1NLPC 2SEMA 4JZ3A 1U5SA 4Y92A 3PE0A 1W70A 3THKA 2J6KA 1YWOA 4M4ZA 1E6HA 1B3QA 1PWTA 1AWOA 2GTOA 1M3BA 1KSWA 3M0TA 2K7AA 3VS0A 2SRCA 3EG3A 1K0XA 2LQWA 2F2VA 1VYTA 5IHIA 2KT8A 2CUBA 3VS1A 1H8KA 2JS0A 2F2WA 4AFUC 4FSSA 4HVVA 2DL3A 4E6RA 1HJDA 3RNJA 2DE0X 1SRMA 1QKXA 1Z9QA 2JS2A 1FYNA 2PZ1A 3PVQA 2A28A 2KXCA 1M3CA 1KIKA 1VA7A 1EFNA 2KBTA 2CH4W 1XOVA 2YDLA 1T3LA 2AZSA 1MUZA 1UHCA 4F14A 1RLQC 2FG0A 3LH5A 2DNUA 2RF0A 3FJ5A 1M30A 2OJ2A 1QWEA 2FPDA 2W0ZA 2KRSA 1X69A 4OMMA 1I07A 1WXBA 2RN8A 1KJWA 1ZLMA 1WYXA 1X6BA 1Z9ZA 5IXFA 3NPFA 1CSKA 3NHNA 2JXBA 2YUOA 1K76A 2L3SA 2DRMA 1KFZA 2G6FX 3I5RA 2A37A 2KE9A 3R6NA 1ARKA 4J9BA 2K6DA 1PKSA 3KFVA 4OMOA 1OPLA 3ULRB 5I22A 3TSWA 1WIEA 2FPFA 2LCSA 4X1VA 2NUZA 2FO0A 1M8MA 4QT7A 2H8HA 5HCKA 1RUWA 3I35A 2O9VA 1OPKA 2YUQA 4A63B 3VS4A 1X2QA 3C0CA 2D8HA 4AFQC 2DL4A 1ZX6A 4AG2C 1WXUA 4RTYA 2CSQA 4J9IA 2KXDA 1BBZA 2YSQA 1W6XA 4HCKA 3REBB 4ORZA 1J3TA 4IIOA 2RNAA 2CT4A 3VS5A 2ENMA 3JV3A 4J9FA 4Z89A 3M0PA 1X27A 1HSQA 1ZBJA 3VS3A 1V1CA 2ESWA 1JEGA 2FRYA 1I0CA 1S1NA 2OAWA 2DVJA 2LJ0A 2EKHA 2LJ1A 1AVZC 3SHWA 2P4RA 4JJCA 1G2BA 5IHNA 4D8KA 2KRMA 4HVUA 2EW3A 4LUDA 4CC3A 3VS6A 1Y57A 2L3QA 4AFSC 2GBQA 5FW9A 2DJQA 1YN8A 3UF4A 2KNBB 1U3OA 1IO6A 1ZSGA 1AWWA 1GCQC 4HVWA 4RTTA 4AFZC 2RPNA 2DRKA 5ECAA 4J9CA 2LNHB 2NWMA 4ZNXA 2RQWA 2EPDA 1ZUKA 2MIOA 2DBMA 3M0QA 4RTUA 2LZ6B 4OMQA 1SEMA 2DBKA 1SPKA 2ABLA 4LNPA 3PVLA 1PRMC 1WXTA 2HBWA 4AG1C 3H41A 1TUCA 3EHQA 1UJ0A 3H0IA 1QKWA 1JU5C 4DEXA 3EG2A 1AEYA 3IQLA 1QLYA 2YT6A 5GJWB 2MCNA 3A98A 3VRZA 2RQRA 2DL8A 1SSHA 1BK2A 2C0TA 2JM8A 4JJBA 4F16A 2ED0A 2DL5A 1T0JA 2E5KA 1AD5A 2JMCA 2LJ3A 2RMOA 1JXOA 1K0SA 1N5ZA 1CKBA 2JMAA 4KRTA 4GBQA 1NEGA 2K2MA 2DLPA 2A08A 2PTKA 1G83A 1T3SA 1AZEA 1U06A 4GLMA 2A36A 1M27C 5FWBA 1UE9A 5I11A 3O5ZA 2BZYA 2D1XA 2ECZA 3REAB 3EG1A 4IIMA 2DL7A 1K9AA 2I0NA 4R0KA 2YUPA 1UDLA 2J7IA 1ABOA 3UA7A 3I9QA 3RBBB 4EIKA 2KROA 1UHFA 1PRLC 2EYYA 2KYBA 1SRLA 2O88A 2L0AA 5IH2A 2DM1A 1SHGA 4RTXA 1JXMA 2LP5A 1UECA 5GJVB 2BTTA 4CC4B 1UTIA 4DEYA 1WA7A 2J05A 2KGTA 2LQNA 2V1RA 2LMJA 2DF6A 1GCQA 2RQUA 4HXJA 4F17A 2CREA 4RTZA 4OMPA 3NGPA 1H92A 1WI7A 3CQTA 5IHKA 1E6GA 2EGEA 2EQIA 1YWPA 1UG1A 2AKKA 2DA9A 2JTEA 1GBQA 3H0HA 1JQQA 2MOXA 4LE9A 1HD3A 1VYVA 1WFWA 3VRYA 2B86A 1ZUYA 1NG2A 3GBQA 4Z8AA 2EGAA 2KR3A 3TSZA 2RQVA 2DMOA 1GL5A 1X6GA 4JPBW 1AWXA 2RQTA 4J9GA 2KRNA 2KYMA 2LX7A 1K4US 2CSIA 1W1FA 1YP5A 2CT3A 4RUGA 5L23A 2EYWA 1YCSB 2IIMA 2ROTA 3EG0A 4K11A 1FMKA 2M51A 3VS2A 1Y0MA 1WX6A 1BU1A 1UFFA 1MV3A 2EYXA 3U23A 2AK5A 2FPEA 1B07A 1OOTA 1WDXA 2F2XA 2V1QA 1JO8A 2J06A 2M0YA 2C0OA 1VYUA 3EHRA 2J6OA 2K3BA 1GRIA 1MV0B 5EC7A 3UATA 4LN2A 1GBRA 2K9GA 2VVKA 3M0UA 1I1JA 1X43A 1M3AA 3QWXX 2EBPA 2VWFA 2X3WD 1RI9A 3NMZC 4RTVA 2O31A 2KEAA 2HCKA 1PKTA 2D0NA 3VS7A 1TG0A 1T0HA 2C0IA 1QWFA 2HSPA 4JJDA 1PNJA 4ESRA 1NYGA 2JT4A
chains in the Genus database with same CATH superfamily
4OB1B 2QDLA 2E3IA 5LJ3f 3G71A 4IUVA 3QWYA 2EQJA 4RTWA 3UA6A 4FYYB 2K57A 4M78B 4J9HA 1OEBA 2EYZA 3ZFJA 1Q82C 1RAGB 1YJ9T 1RLPC 1WQ7A 1OQKA 4PJOA 2X3XD 3QZ9B 1AT1B 2AHJB 3NTIA 1A0NB 3I56T 1TOVA 3OYNA 1YIJA 1JJ2A 3CCEQ 4WTOB 3TVTA 3CC2T 1VUBA 3FJPA 2ZPBB 3M0RA 1H3HA 2O2OA 3QKJA 4WCIA 4M7DA 3H0FA 3VYGA 2YUNA 4JDSA 2DX1A 3OS0A 1JBMA 1RABB 1UUEA 5KYYA 1K8AU 2OI3A 2FEIA 3BE3A 1NZ9A 2DTIA 2GTJA 2VKNA 3EFSA 5FU7B 1LNXA 2XMFA 3CC7A 3CCQQ 1NLPC 2OTLA 4Y92A 1B3QA 2R57A 1PWTA 1VQMT 3G4SA 2MK5A 1WGSA 4Z02A 1YIJQ 1XJWB 1M3BA 4PJJA 3GLXA 3G6EQ 1VQ5Q 3VS0A 4EMHA 3OBWA 5LL6S 2LQWA 3MEAA 4NOYA 2QQRA 1D1AA 4B9WA 4BY6B 3VS1A 1V76A 2JS0A 2F2WA 4PL6A 3FC3A 4FSSA 1KD1U 2COZA 2P4TA 2DL3A 2QQBA 2QG9B 4E7SA 1I5OB 1QKXA 1YBYA 1FYNA 2PZ1A 3PVQA 2A28A 4ZGDB 4M75C 2KXCA 1M3CA 1QVFA 4XTZA 4BDYA 1MMNA 1VA7A 1Q7YR 1VIFA 1F1BB 1BYMA 2GFAA 4PFOA 2CH4W 1XOVA 3M56A 4C0DB 2QTVA 1UHCA 2RHXA 2COWA 4RMOA 1B7TA 2OJ2A 2FPDA 1Q81R 4M7AD 2OTJT 1Y07A 2W0ZA 5LJ5g 4C8QB 1IHWA 1VQPT 1ZSZB 1ZLMA 5CKEA 3OW2P 1Z9ZA 2JNGA 3NPFA 2JXBA 4OP0A 3JCMf 1KFZA 2VXEA 1EIFA 2AT1B 5C6SA 4OMOA 2JN0A 5LJ5d 1OPLA 1D1CA 4XU3A 5I22A 4DQ2A 3TSWA 3H8ZA 5CKBA 1VQOA 2LCSA 4C92C 4X1VA 4NL3A 2NUZA 2FO0A 4ZGEB 1RUWA 3I35A 3MP8A 1YJ9Q 2NUTB 4A63B 5GMKh 1BKBA 3QJYA 4FT4A 3JAME 1WXUA 4RCCA 2KSSA 2CZ1B 1VQMA 3I56Q 3DKMA 2DXUA 2DKGA 2CSQA 4M7DD 4TVRA 2LDMA 3L2QA 4OB2B 3CC2Q 3X28B 2D6FA 3MO8A 3CPWP 3SWNA 4PJMA 2CT4A 3V7RA 1YHQT 5GAMg 3CBPA 3JV3A 4M78C 1FX7A 3KBGA 2GFUA 1M1GA 2X51A 1HSQA 1RAHB 1JEGA 4C0FA 3CXCS 5C0MA 1VIEA 2LJ0A 3MPUB 2PVOB 2DYIA 4NL2A 5GAMd 3QBYA 1VQMQ 2P4RA 1KQ1A 5LJ5f 4VUBA 4HVUA 4E2FB 2EW3A 3VS6A 4F7UF 1UEBA 3UPUA 2GBQA 3MEWA 2DJQA 5FW9A 3WXMB 3GIBA 3DB3A 3E9FA 2QDYB 2KNBB 2MAMA 2E10A 1VQPA 5FU6B 1AWWA 2RPNA 2FVUA 4OVAA 4DOWA 3RMQA 1FMVA 2RD1A 3CCRA 2DETA 4C0ZA 4OGCA 2DBMA 4RTUA 2BE7D 2LZ6B 5GAOl 4CRIA 2ABLA 3PFSA 3PVLA 1WXTA 2EAYA 1RL2A 4E7LA 1OULA 1UJ0A 3H0IA 2JTMA 4JRPA 4WF2A 3OW2S 1QKWA 2EIFA 3OMCA 1M1KC 2OTJQ 4QQ6A 1VQPQ 3OB9A 2FB7A 1BK2A 4JJBA 3S6WA 2PQWA 5GAMf 2LT4A 1M4ZA 2H3EB 2LJ3A 3PNWC 5CIUA 2ZCFB 2E64A 4EMKA 5LJ3j 1MHNA 3E2UA 3FB9A 1YHQA 5GANh 1SG5A 4GBQA 3CPFA 2ZZDA 2GQVA 4F04B 1NEGA 1KQSS 2GF7A 2A08A 4CI0C 1G83A 4C5HA 4PKCC 4GLMA 4PJOE 2A36A 5FWBA 3META 2L8DA 1OI1A 3JCMP 1BI3A 2BZYA 2ECZA 3EG1A 2DO3A 4IIMA 1BI1A 4B9XA 2DL7A 1K9AA 2WSEE 2YUPA 2J7IA 5CVIA 1ZSZC 1Y96B 2XDDA 3UA7A 1D0ZA 4EIKA 4IUPA 2KROA 1PRLC 4J7IA 1SRLA 4JLIA 4PNOA 2XDPA 4XQ3A 1S72A 1U1SA 4RTXA 3EFRA 2VASA 1VQKA 4M77A 1YHQQ 5CKHA 4ANJA 1UECA 3MP6A 1WA7A 2J05A 1M9SA 1R8OB 2V1RA 3HRUA 1W2BA 4MDWA 1YITT 5D7UA 4OMPA 3NGPA 3QUIA 3PT9A 2RA2A 5KYXB 1WI7A 3X26B 2HBPA 1E6GA 2EGEA 4PJLA 1YWPA 3TCJA 2DZ9A 2DA9A 2JTEA 3BW1A 4LE9A 2CGHA 1VQLA 2L3RA 3SB2A 4L5GA 2DMOA 2F5KA 4JPBW 1AWXA 4J9GA 1PD0A 2KYMA 2LX7A 1K4US 1W1FA 1YP5A 1YCSB 2AIRB 1ZA1B 2CP2A 2ROTA 4JRQA 1HXDA 6AT1B 4J6YA 1QCOA 2QEXA 4M7AG 4LD9K 1WPYA 2AK5A 2FPEA 2F2XA 1OOTA 2V1QA 2XK0A 2PUKB 2J06A 2M0YA 2MWOA 2EYQA 2K3BA 1VQ4A 1K73U 2E70A 2PUOB 5FU6C 4LN2A 2K9GA 4RKUE 3L2RA 1BI0A 1I1JA 4M75F 5GAN8 5GAN2 3V7CA 2KDSA 3NMZC 1K9MU 5KCOA 1M8VA 2HCKA 4BD3A 2C0IA 2HSPA 2WSFE 1P92A 1PC0A 3HFNA 1VQ6A 4M7DG 1CKAA 2RI2A 4XU0A 3S3OA 4JS5A 2AKLA 1WLPB 4ZGJB 3I5SA 1WQWA 3N5BB 2KVQG 1WHMA 1N27A 1O9SA 2F69A 1B34B 1GFCA 1OV3A 1GFDA 2L3PA 5FLXE 3EGUA 3A1PA 1N6AA 1VQ9T 3DB4A 4E7KA 2HSEB 2CH4A 4R55A 5FWCA 2M9UA 1KC8R 1K8AR 2ROLA 2AZVA 3BDLA 1VQNT 4LD6A 3MCAB 1BIAA 4BI4A 1ZUUA 5CQXA 1YITQ 3J81E 2GQIA 1K1ZA 2HDAA 5LJ5j 3OYFA 5IXBA 5CO7A 1FXXA 1TSFA 3CCST 1TUDA 3HRSA 5GANf 1MNDA 2EQKA 4KBMB 1VQ7T 4JZ3A 1U5SA 1KD1R 1XTDA 4OF1A 2HZYA 2E3HA 3OYDA 1E6HA 2FZCB 3ER0A 4M78F 5GAN7 2GTOA 1TS9A 2K7AA 2I2LA 2SRCA 3A8GB 9ATCB 3A8OB 1VYTA 2MWPA 4KH1B 5D6WA 2V8JA 2A7YA 4E6RA 1PM3A 1G5VA 3RNJA 3QXEB 2RI5A 1RI0A 4FT2A 1QP2A 5GAN3 2KBTA 1VQ8T 3JRZA 1RACB 3E9GA 1H641 2R58A 2AZSA 2DEUA 4FW1A 2ATCB 5GAMj 1RLQC 2FG0A 3LH5A 2DNUA 2RF0A 2K3XA 4KH0B 3RMSA 1QWEA 4JRKA 3TQ7P 3OYKA 1X69A 4OMMA 1WXBA 2RN8A 4C92A 4M7AA 1SF9A 3L1AA 2YUOA 3CCEA 2G6FX 3WVEB 1Q86U 4J9BA 1NJIU 3KFVA 3HKSA 3LGFA 3M9QA 4XU1A 3KXTA 3MEUA 3CMET 2YLCA 3CCSA 3M4GA 2H8HA 5HCKA 3NTHA 1VQ9Q 1Y7XA 5KH6A 1OPKA 1N9RA 2K4YA 3VS4A 2LRQA 2MF2A 3CCQA 3CCJT 2DL4A 2RJDA 4LDUA 4AG2C 2LQ8A 1OX8A 4PJOB 3HRTA 3EG9A 1VQNQ 3JCMW 3M53A 4ZN1A 2HQHA 3C94A 4J9IA 2QTXA 1BBZA 3HL8A 1KQ2A 2D9TA 2EJFA 1BCMA 4HCKA 3G6EA 1VQ5A 4M7DB 1M90U 4IIOA 4C8QF 3L2VA 2ZPHB 3M55A 3FIFA 3VS5A 3JCMg 1FWZA 3CCSQ 3JCMJ 5KYYB 3A5ZB 3QJ6A 1BIBA 3BFMA 2RJCA 4JJNK 3JB9H 1ZBJA 3VS3A 1VQ7Q 2CP7A 2ESWA 2FRYA 2RK2A 2ZPFB 3JCMd 2OAWA 2DVJA 1WHGA 3SHWA 4QVCA 3CD6T 2NYSA 4M75D 5IHNA 2ZGWA 2KRMA 4CC3A 2RHYA 3VV0A 3CXCP 4EDUA 2PU9B 4JRIA 4KULA 1N8RC 1ZQ1A 2L89A 1I5LA 2XICA 1U3OA 4MMKA 1ZSGA 5GAN4 2DRKA 2H3JA 4DOVA 2HQXA 2DPPB 2NLUA 4C5IA 3GNGA 1PCXA 2VUBA 5CKFA 2BUDA 1VQ8Q 2CP5A 1HK9A 4BB7A 2JVVA 2A3LA 3H41A 4ZN3A 3EHQA 2EJ9A 2O4XA 2E65A 1YJ9A 3MKDA 3C12A 2XI9A 2DFUA 2HL3A 4C92D 1AEYA 2MCNA 3A98A 3CCMT 1Q82U 3VRZA 3I56A 4PFPA 2V8IA 2DL5A 3CC2A 2JOYA 2WACA 2E5KA 3QYHB 5HK0A 1AD5A 4M77G 4ATOA 1N5ZA 1CKBA 2M0OA 5AT1B 3OYEA 3CMEQ 1X75C 1TXQA 3M5AA 4N4GA 1M2VA 1NPPA 2XU8A 3A8LB 5LJ3e 2DLPA 2HMAA 4QKUA 3INZA 5IN1A 3NFCA 3MHXA 3OBYA 4N0AC 3GNFB 5I11A 4FM4B 3CCJQ 3RKYA 1QVPA 5DLQE 4M78D 3REAB 1N9SA 1KQSP 4R0KA 3CD6A 1IREB 1ABOA 5J3BA 4X34A 1UGQB 3RBBB 1OU9A 2FZKB 2O88A 2L0AA 5IH2A 5CCAA 3SWNB 3QHSA 1SHGA 3EFOA 2LP5A 3VUBA 2VYTA 3OS2A 2Y90A 4CC4B 3ZBDA 2DK3A 1YI2T 5CAIA 2LMJA 1UB4A 2X4XA 5J26A 1Q81C 1GCQA 3RDVA 4HXJA 3UWNA 4ELYC 3CD6Q 4PJOC 2X9HA 2IVWA 4E7ZA 3OW2A 1UG1A 2AKKA 1G8XA 4LXCA 2MOXA 4QQDA 1HD3A 2FYKA 2OTJA 3VRYA 1ZUYA 4BE1A 3GBQA 1M5Q1 2EGAA 2KR3A 3TSZA 4DBQA 1GL5A 1X6GA 3PIPA 2RM4A 3QDRB 2P0KA 3EGXA 1K73R 3AHUA 2CT3A 2IIMA 1ZHIA 1FMKA 5FU7C 4OGEA 1Y71A 4FYVB 5GAOr 3GOXA 1UFFA 2MI6A 1MV3A 3MJXA 2VGNA 4FSXA 1WDXA 3PIOA 1JO8A 1K9MR 1X6OA 5KYNA 3HP9A 4JS4A 4M7AE 2RI3A 3CCMQ 3GPLA 1MV0B 5EC7A 3S3NA 3UATA 3CPWA 2FL7A 4BY6C 2QA4T 1DJ7B 3X25B 3V8KA 1YJNT 2P0QA 3M58A 4FIBA 3M57A 4O5VA 1X43A 1M3AA 4IUUA 4C8QD 4XAXB 2VWFA 4EMKB 4L59A 3JCMe 4LDXA 2KEAA 1WHHA 3VS7A 1EX4A 4PJNA 4A4EA 4DBFA 3CCVT 3JB9J 4C0DC 2C06A 4C5GA 4JJDA 3H9NA 1KHIA 2JT4A 3G7ZA 1QVGP 1D09B 1BB9A 3M0SA 4D8DA 2EWNA 2J6FA 2EQMA 4YTLA 4C8QC 3SFMA 2X4JA 2RH2A 1YNZA 2JTFA 2OX7A 4M7DE 2PNIA 2E4HA 1Q81U 3EH1A 2KAFA 4F7UA 2CDTA 1E7OA 3CCUT 2XKOC 4XTVA 1YJWT 2L5QA 2K79A 4CC7A 1UGVA 1SHFA 3HHTB 1NEBA 2L2PA 1AHJB 2ED1A 2O9SA 2DTOA 1NYFA 4M77B 4GY5A 3RERA 4JZ4A 1YI2Q 3FEOA 4IUQA 1D3BA 3H6ZA 4J9DA 4M75G 5KYWA 2NUPA 2RB6A 3A8MB 2DILA 1ABQA 1M1FA 4HA8A 3DLLA 2ZPEB 1LCKA 2W10A 5DM7R 2O01E 3TREA 4OMNA 2GGRA 2FRWA 3SEMA 1WJQA 3EGDA 2E6ZA 2XD0A 1X2KA 4XTYA 5LJ5e 1WHKA 1LOJA 1PSEA 2HD0A 4MZMA 1AOJA 2DTHA 4KGXB 3CBOA 1MMGA 4KGVB 3PE0A 3THKA 2ZPGB 5FRMA 2J6KA 1YWOA 1M1KU 4M4ZA 1AWOA 2LT1A 4E7HA 3VU3C 3OYMA 5GAOm 3F70A 3LX7A 2M1HA 1WJSA 3MEVA 4C92G 2A0FB 2IG0A 3CCVA 2JZ2A 2CUBA 3VJPA 1H8KA 4HVVA 5LJ3h 5DLOA 1LVKA 1OZ3A 1SRMA 1QW1A 3L2ZA 3OYYA 1KIKA 1WHLA 2QA4Q 4Y91A 4ME7A 1YJNQ 2R5AA 2YDLA 1LPLA 1T3LA 1Q86R 5GANg 4A4HA 1NJIR 8AT1B 3CCUA 4MDXA 2CZ7B 3L42A 3CCLT 3FJ5A 5J39A 5GAMe 3JCMQ 1QVGS 1I07A 2KY9A 3CCVQ 3FLGA 5GANd 1WYXA 1PG5B 1X6BA 4M78G 5IXFA 3O8VA 1CSKA 3NHNA 1K76A 1MNEA 2DRMA 1IXDA 3I5RA 2KE9A 2XHCA 3R6NA 1ARKA 4BI3A 1PKSA 1YITA 3ULRB 2QAZA 2RO0A 2CP0A 3JCMX 3GP8A 1WIEA 3M59A 3SDZA 2FPFA 2QQAA 4OB3B 3CCUQ 1YJWQ 1M90R 1G3SA 2O9VA 4KUDK 2YUQA 3C0CA 2D8HA 4AFQC 2JUFA 2K5LA 4EMKC 5GMKl 3CEYA 4RTYA 4Y28E 3VUZA 1TWBA 2K3YA 2KXDA 1MMAA 1C0MA 3JCMb 1TUGB 3I55T 3REBB 4ORZA 4EMGA 1J3TA 2RNAA 1UGSB 2MMPA 2HKQB 2QGFB 2RHZA 3OYAA 1TU0B 4QW2A 2QGGA 4J9FA 4Z89A 3M0PA 2Z0WA 4HT8A 1V1CA 1R0CB 3LW5E 2LJ1A 1AVZC 2FZGB 3G71T 1G2BA 2OAUA 1Y57A 2L3QA 4AFSC 3CCLA 5GAN6 4M75A 5GMKe 2DXTA 4J5YA 3UF4A 1G3YA 3JB9F 1RAFB 1IO6A 5A0LA 4PJOF 3X24B 4C5EA 2LNHB 2NWMA 1RAIB 3G1JA 2EPDA 2CP3A 4FU6A 1ZUKA 2MIOA 1Q82R 3M0QA 4LDYA 5KYUA 2YWWA 2M02A 4M7DF 1KC8C 1K8AC 5KE3A 1SPKA 5HY6A 3LLRA 2D0QB 4BI8B 3ME9A 1PRMC 2XG8D 1LJOA 2HBWA 2CP6A 1JJ2P 3D7SB 4FW2A 2FHDA 1VQ9A 2R5MA 3CCLQ 2QASA 1SSFA 1JU5C 4DEXA 3EG2A 2DEQA 3IQLA 1QLYA 3GF5A 3VYHB 5GJWB 5CR2A 3CC7T 2RQRA 2OTLT 2KQWA 2BE9B 2DL8A 1QQJA 4C92B 1VQNA 4OB0B 4M7AB 1D1BA 2C0TA 2JM8A 4F16A 2ED0A 1KG1A 1R0BG 3QPHA 2MYSA 4N0AA 3G4ST 2ZAEA 1T0JA 5GAN5 1IRXA 2JMCA 2COYA 4FYXB 1V29B 1JXOA 3C4SA 1KD1C 3CBMA 2JMAA 3L2WA 2QYZA 2K2MA 2VV5A 5I21A 2K5IA 4M77E 4DA4A 1T3SA 1AZEA 1M27C 1M2OA 3O5ZA 1VQ7A 5LJ5h 3QZ5B 5GMKm 4HCCA 4IUTA 1C6VX 5FROA 1UDLA 1VOMA 3EG9B 4M78A 5EG2A 3OYIA 3TEEA 2QI2A 3I55Q 1QVFP 2RJEA 4N4IA 3OYJA 1UHFA 2EYYA 2KYBA 4L6V5 2CYZB 1JXMA 1H3ZA 4JLGA 3CC4T 3HPWA 5GJVB 2V26A 4DBRA 1UTIA 2F5TX 2LQNA 3FRNA 1I4K1 4BUGA 2DF6A 1I81A 3RIRA 1WHJA 2RQUA 3OY9A 3LWHA 1VQ8A 1XNIA 4DBHA 3G71Q 2CREA 5GANe 5GMKj 4RTZA 1I8FA 1H92A 1VQOT 1KC8U 5IHKA 4O6JA 2X4WA 1D0YA 1GBQA 4KT0E 3HTRA 2Y4XA 2B86A 4GLKA 2DAQA 1NG2A 5GAMh 5A0DA 2DIGA 3OYLA 2KRNA 4MMLA 1IGUA 2CZ6B 2CSIA 5L23A 4RUGA 1JJ2S 3EG0A 4K11A 2M51A 1WX6A 1BU1A 3CMEA 1RAAB 1UGRB 3OYCA 4KGZB 7AT1B 3BDUA 2YRVA 1C1AA 2O4XB 2DIQA 3CCJA 1VYUA 1OX9A 3UT1A 3CC7Q 2CKKA 5I2SA 1GRIA 2OTLQ 3UDCA 3RESA 3QSUA 4F7UG 3M0UA 3G4SQ 3HFOA 3V8JA 3QWXX 3RUXA 2X3WD 3CC4A 1HYOA 4RTVA 4C8QA 3L2UA 2HNIA 1SKUB 2LCCA 2D0NA 1ZSZA 1TG0A 1T0HA 2YRCA 1M2VB 4XTUA 4P5NA 1O75A 2RJFA 1WJRA 4ESRA 1RADB 3CCRT 4KUIA 3E19A 4BE2A 1QVFS 3CXCA 1G3TA 1PHTA 2G3RA 1JB0E 1UJYA 4CC2A 2F1LA 2KT1A 4LUEA 1GCPA 2HEQA 3NTKA 4M7AC 3JB9D 2CUDA 2JM9A 3ZL7C 2QK0A 2NUTA 2BZXA 4OMLA 4PJOD 2D8JA 1ZA2B 1Q7YC 1QP3A 3QDFA 3CC4Q 1MMDA 3P8HA 3EFOB 1AZGB 2EGCA 4J9EA 2XIDA 1N8RU 4D6WA 2EVRA 1XQHA 1RAEB 1NLOC 5GANj 4Z88A 2YXYA 1M1KR 4J6WA 5GAOp 1AWJA 2DYBA 4II1A 4LDVA 3DLMA 4M75E 1VQOQ 1U1TA 1EZZB 3URGA 1NM7A 4IKFA 2K5FA 3CCMA 2JW4A 1QCFA 2BZ8A 2GNCA 4M7DC 2SEMA 2IPOB 1W70A 1NE8A 3ZEHA 3OYGA 3EGXB 1KSWA 4QQGA 3M0TA 1WZOA 1MGQA 3EG3A 1KHCA 1K0XA 2F2VA 1S72T 4M77F 5IHIA 2KT8A 1VQKT 1UGPB 2CS7A 2VB6A 1QCNA 2WSCE 4AFUC 1KQSA 3JSCA 4N4HA 3J7AF 1HJDA 4ZTJA 2HAXA 2DE0X 2KMTA 4C92E 1Z9QA 2JS2A 4C0GA 1EFNA 1IHVA 3QO3A 3T9NA 3M4YA 3JCMV 1MUZA 2HQEA 5GMKi 2QQ9A 3OSVA 4F14A 2E1HA 5IAYA 1W2BP 2RK1A 2X4YA 3CMAT 4IURA 1M30A 3J80E 5A2QE 2KRSA 8ATCB 2Y4YA 2XDBA 1KJWA 1VQLT 1YI2A 2RHIA 1Q7YU 4J7FA 3CCRQ 5CK9A 2L3SA 2A37A 4PFZA 1ACMB 1BCOA 4PK4A 2K6DA 4J8OA 5FRNA 2DD5A 4M78E 5GAOn 2KK4A 1YCYA 3JCMc 2DD4A 4HCZA 1TTHB 2QEXT 1KK7A 1M8MA 4QT7A 1K73C 4B6MA 4F7UB 5HKCA 1X2QA 4AT1B 3OA6A 1ZX6A 3MP1A 1VQ4T 3CPWS 4ELZC 1Y96A 3OYBA 4XU2A 1K9MC 3V8LA 1D3BB 2QXFA 5DY9A 2LQKA 2K2VA 2YSQA 3PMIA 5KYWB 3PGGA 1W6XA 2NUPB 2DZCA 2LX9A 2QQSA 5AYFA 4R56A 1PSFA 3M54A 3PTAA 4NS5A 2ENMA 3LH0A 1QMCA 3R6OA 2VXFA 3P8BB 4A4KA 2DERA 3EGDB 1R77A 1PD1A 1OYXA 1X27A 1GXIE 1VQ6T 3SWNC 1I0CA 1S1NA 2QA4A 2EKHA 5A0GA 1YJNA 4JJCA 2V8KA 5KYXA 3RKXA 4D8KA 4LUDA 4MZPA 1YN8A 3CMAA 1FMWA 2HL5C 3TU4K 1IB8A 1S72Q 1QVGA 1VQKQ 4E7JA 1GCQC 4HVWA 4RTTA 4AFZC 4FCYA 4HT9A 1U8RA 5ECAA 4J9CA 4EPCA 4ZNXA 2RQWA 2KI7A 4OMFB 3Q1JA 2LCLA 2BKDN 4QVDA 4RG8A 4BDZA 4OMQA 1SEMA 2DBKA 1W2BS 3LGLA 4E7IA 3FDRA 4LNPA 1G3WA 4AG1C 4J83A 1YJWA 3HSBA 1TUCA 4C8QE 2PVGB 2M16A 3PMTA 3CMAQ 2RHUA 2BIVA 4XTXA 5GAOq 4FL6A 2YT6A 3VKIA 1VQLQ 3S3MA 4FYWB 3OS1A 1SSHA 2LNVA 2P0PA 4MZTA 2CZ0B 5IT9E 3JB9G 5KE2A 2RMOA 1K0SA 2E12A 2JJ9A 4PJOG 1ZBXA 4KRTA 2QEXQ 4BACA 5D6XA 2PTKA 2VGMA 3OYHA 1U06A 4PLLA 4QVZA 1UE9A 5KCHA 2D1XA 1VQ4Q 2E6NA 4A54A 2I0NA 1YFNA 5CKDA 1D0XA 1B34A 1W4SA 1OZ2A 3EAEA 4X9DA 3I9QA 2GCXA 4M77D 2LTOA 3OSSC 2HKNA 2DM1A 4LDWA 2EJGA 5I2MA 1Q86C 3JB9I 4C92F 2BTTA 1NJIC 4XTWA 4M7AF 4DEYA 3AT1B 2KGTA 3C95A 2DVEA 4PLIA 3RR6A 1JRIA 3CCET 1VQ6Q 3OQ5A 2P84A 2PVDB 4E47A 4F17A 4M77C 4XK8E 4X9CA 3LYIA 4Q5WA 3CQTA 3EH2A 3QG1A 3OS5A 1Q95G 2EQIA 2VC8A 3H0HA 2YHTA 5LJ3g 4M75B 1JQQA 1TH7A 1VYVA 2B8AA 1WFWA 2DXCA 4AMCA 3JCMh 4Z8AA 1NBEB 3CCQT 4UC4A 2RQVA 5M9OA 2YRDA 2RQTA 4J6XA 1M90C 5LJ3d 3V7SA 2YLBA 4A53A 3E1SA 3X20B 2EYWA 3RKWA 3SD4A 2E41A 1YIJT 1X01A 3WVDB 5KYUB 4C8QG 3VS2A 1Y0MA 3LWIA 3G6ET 4BE0A 1VQ5T 4RG2A 3P8DA 3OMGA 5L8RE 2EYXA 3U23A 4ZTFA 3QYGB 1IGQA 2E5QA 1B07A 4A4FA 2MPXC 2C0OA 3EHRA 5D6YA 2LVMA 3ASKA 2J6OA 1NPRA 1WNLA 2X35A 2EFIA 3A8HB 5CQYA 1OU8A 1GBRA 2VVKA 3QIIA 4RCBA 3I55A 2LC4A 2ZPIB 3BY7A 2EBPA 3KUFA 4JUVA 1RI9A 4F7UE 4HCBA 2O31A 4A4GA 2EKOA 4V2SA 5HK3A 1PKTA 2DXBA 1QWFA 1PNJA 2DJZA 1IZ6A 1NYGA 2EQUA 4HKEA 1BI2A 1N8RR
chains in the Genus database with same CATH topology
1CKAA 2AKLA 1BB9A 2QDLA 3M0SA 4D8DA 1WLPB 1PHTA 3I5SA 2J6FA 3QWYA 1UJYA 4RTWA 1YNZA 3UA6A 1GFCA 2PNIA 2KT1A 4LUEA 4CC2A 1GCPA 2HEQA 4J9HA 1OV3A 1GFDA 2CDTA 2L3PA 1E7OA 1OEBA 2EYZA 3EGUA 2CUDA 2JM9A 3ZL7C 2K79A 2BZXA 4OMLA 4CC7A 1UGVA 1SHFA 1RLPC 2D8JA 1NEBA 2L2PA 2CH4A 2ED1A 2O9SA 5FWCA 4J9EA 1AZGB 2EGCA 1NYFA 2EVRA 2X3XD 2ROLA 2AZVA 1NLOC 4JZ4A 1A0NB 4J9DA 4Z88A 3TVTA 1ZUUA 3M0RA 1H3HA 2O2OA 4WCIA 2DILA 3H0FA 2YUNA 1ABQA 2GQIA 1AWJA 1LCKA 2DX1A 2DYBA 2W10A 1K1ZA 2HDAA 5IXBA 1UUEA 4OMNA 2OI3A 2FEIA 2GGRA 2FRWA 2GTJA 1NM7A 3SEMA 1TUDA 2VKNA 1X2KA 2XMFA 2JW4A 1QCFA 1AOJA 2BZ8A 2GNCA 1NLPC 2SEMA 4JZ3A 1U5SA 4Y92A 3PE0A 1W70A 3THKA 2J6KA 1YWOA 4M4ZA 1E6HA 1B3QA 1PWTA 1AWOA 2GTOA 1M3BA 1KSWA 3M0TA 2K7AA 3VS0A 2SRCA 3EG3A 1K0XA 2LQWA 2F2VA 1VYTA 5IHIA 2KT8A 2CUBA 3VS1A 1H8KA 2JS0A 2F2WA 4AFUC 4FSSA 4HVVA 2DL3A 4E6RA 1HJDA 3RNJA 2DE0X 1SRMA 1QKXA 1Z9QA 2JS2A 1FYNA 2PZ1A 3PVQA 2A28A 2KXCA 1M3CA 1KIKA 1VA7A 1EFNA 2KBTA 2CH4W 1XOVA 2YDLA 1T3LA 2AZSA 1MUZA 1UHCA 4F14A 1RLQC 2FG0A 3LH5A 2DNUA 2RF0A 3FJ5A 1M30A 2OJ2A 1QWEA 2FPDA 2W0ZA 2KRSA 1X69A 4OMMA 1I07A 1WXBA 2RN8A 1KJWA 1ZLMA 1WYXA 1X6BA 1Z9ZA 5IXFA 3NPFA 1CSKA 3NHNA 2JXBA 2YUOA 1K76A 2L3SA 2DRMA 1KFZA 2G6FX 3I5RA 2A37A 2KE9A 3R6NA 1ARKA 4J9BA 2K6DA 1PKSA 3KFVA 4OMOA 1OPLA 3ULRB 5I22A 3TSWA 1WIEA 2FPFA 2LCSA 4X1VA 2NUZA 2FO0A 1M8MA 4QT7A 2H8HA 5HCKA 1RUWA 3I35A 2O9VA 1OPKA 2YUQA 4A63B 3VS4A 1X2QA 3C0CA 2D8HA 4AFQC 2DL4A 1ZX6A 4AG2C 1WXUA 4RTYA 2CSQA 4J9IA 2KXDA 1BBZA 2YSQA 1W6XA 4HCKA 3REBB 4ORZA 1J3TA 4IIOA 2RNAA 2CT4A 3VS5A 2ENMA 3JV3A 4J9FA 4Z89A 3M0PA 1X27A 1HSQA 1ZBJA 3VS3A 1V1CA 2ESWA 1JEGA 2FRYA 1I0CA 1S1NA 2OAWA 2DVJA 2LJ0A 2EKHA 2LJ1A 1AVZC 3SHWA 2P4RA 4JJCA 1G2BA 5IHNA 4D8KA 2KRMA 4HVUA 2EW3A 4LUDA 4CC3A 3VS6A 1Y57A 2L3QA 4AFSC 2GBQA 5FW9A 2DJQA 1YN8A 3UF4A 2KNBB 1U3OA 1IO6A 1ZSGA 1AWWA 1GCQC 4HVWA 4RTTA 4AFZC 2RPNA 2DRKA 5ECAA 4J9CA 2LNHB 2NWMA 4ZNXA 2RQWA 2EPDA 1ZUKA 2MIOA 2DBMA 3M0QA 4RTUA 2LZ6B 4OMQA 1SEMA 2DBKA 1SPKA 2ABLA 4LNPA 3PVLA 1PRMC 1WXTA 2HBWA 4AG1C 3H41A 1TUCA 3EHQA 1UJ0A 3H0IA 1QKWA 1JU5C 4DEXA 3EG2A 1AEYA 3IQLA 1QLYA 2YT6A 5GJWB 2MCNA 3A98A 3VRZA 2RQRA 2DL8A 1SSHA 1BK2A 2C0TA 2JM8A 4JJBA 4F16A 2ED0A 2DL5A 1T0JA 2E5KA 1AD5A 2JMCA 2LJ3A 2RMOA 1JXOA 1K0SA 1N5ZA 1CKBA 2JMAA 4KRTA 4GBQA 1NEGA 2K2MA 2DLPA 2A08A 2PTKA 1G83A 1T3SA 1AZEA 1U06A 4GLMA 2A36A 1M27C 5FWBA 1UE9A 5I11A 3O5ZA 2BZYA 2D1XA 2ECZA 3REAB 3EG1A 4IIMA 2DL7A 1K9AA 2I0NA 4R0KA 2YUPA 1UDLA 2J7IA 1ABOA 3UA7A 3I9QA 3RBBB 4EIKA 2KROA 1UHFA 1PRLC 2EYYA 2KYBA 1SRLA 2O88A 2L0AA 5IH2A 2DM1A 1SHGA 4RTXA 1JXMA 2LP5A 1UECA 5GJVB 2BTTA 4CC4B 1UTIA 4DEYA 1WA7A 2J05A 2KGTA 2LQNA 2V1RA 2LMJA 2DF6A 1GCQA 2RQUA 4HXJA 4F17A 2CREA 4RTZA 4OMPA 3NGPA 1H92A 1WI7A 3CQTA 5IHKA 1E6GA 2EGEA 2EQIA 1YWPA 1UG1A 2AKKA 2DA9A 2JTEA 1GBQA 3H0HA 1JQQA 2MOXA 4LE9A 1HD3A 1VYVA 1WFWA 3VRYA 2B86A 1ZUYA 1NG2A 3GBQA 4Z8AA 2EGAA 2KR3A 3TSZA 2RQVA 2DMOA 1GL5A 1X6GA 4JPBW 1AWXA 2RQTA 4J9GA 2KRNA 2KYMA 2LX7A 1K4US 2CSIA 1W1FA 1YP5A 2CT3A 4RUGA 5L23A 2EYWA 1YCSB 2IIMA 2ROTA 3EG0A 4K11A 1FMKA 2M51A 3VS2A 1Y0MA 1WX6A 1BU1A 1UFFA 1MV3A 2EYXA 3U23A 2AK5A 2FPEA 1B07A 1OOTA 1WDXA 2F2XA 2V1QA 1JO8A 2J06A 2M0YA 2C0OA 1VYUA 3EHRA 2J6OA 2K3BA 1GRIA 1MV0B 5EC7A 3UATA 4LN2A 1GBRA 2K9GA 2VVKA 3M0UA 1I1JA 1X43A 1M3AA 3QWXX 2EBPA 2VWFA 2X3WD 1RI9A 3NMZC 4RTVA 2O31A 2KEAA 2HCKA 1PKTA 2D0NA 3VS7A 1TG0A 1T0HA 2C0IA 1QWFA 2HSPA 4JJDA 1PNJA 4ESRA 1NYGA 2JT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CKA A;  2AKL A;  1BB9 A;  2QDL A;  3M0S A;  4D8D A;  1WLP B;  1PHT A;  3I5S A;  2J6F A;  3QWY A;  1UJY A;  4RTW A;  1YNZ A;  3UA6 A;  1GFC A;  2PNI A;  2KT1 A;  4LUE A;  4CC2 A;  1GCP A;  2HEQ A;  4J9H A;  1OV3 A;  1GFD A;  2CDT A;  2L3P A;  1E7O A;  1OEB A;  2EYZ A;  3EGU A;  2CUD A;  2JM9 A;  3ZL7 C;  2K79 A;  2BZX A;  4OML A;  4CC7 A;  1UGV A;  1SHF A;  1RLP C;  2D8J A;  1NEB A;  2L2P A;  2CH4 A;  2ED1 A;  2O9S A;  5FWC A;  4J9E A;  1AZG B;  2EGC A;  1NYF A;  2EVR A;  2X3X D;  2ROL A;  2AZV A;  1NLO C;  4JZ4 A;  1A0N B;  4J9D A;  4Z88 A;  3TVT A;  1ZUU A;  3M0R A;  1H3H A;  2O2O A;  4WCI A;  2DIL A;  3H0F A;  2YUN A;  1ABQ A;  2GQI A;  1AWJ A;  1LCK A;  2DX1 A;  2DYB A;  2W10 A;  1K1Z A;  2HDA A;  5IXB A;  1UUE A;  4OMN A;  2OI3 A;  2FEI A;  2GGR A;  2FRW A;  2GTJ A;  1NM7 A;  3SEM A;  1TUD A;  2VKN A;  1X2K A;  2XMF A;  2JW4 A;  1QCF A;  1AOJ A;  2BZ8 A;  2GNC A;  1NLP C;  2SEM A;  4JZ3 A;  1U5S A;  4Y92 A;  3PE0 A;  1W70 A;  3THK A;  2J6K A;  1YWO A;  4M4Z A;  1E6H A;  1B3Q A;  1PWT A;  1AWO A;  2GTO A;  1M3B A;  1KSW A;  3M0T A;  2K7A A;  3VS0 A;  2SRC A;  3EG3 A;  1K0X A;  2LQW A;  2F2V A;  1VYT A;  5IHI A;  2KT8 A;  2CUB A;  3VS1 A;  1H8K A;  2JS0 A;  2F2W A;  4AFU C;  4FSS A;  4HVV A;  2DL3 A;  4E6R A;  1HJD A;  3RNJ A;  2DE0 X;  1SRM A;  1QKX A;  1Z9Q A;  2JS2 A;  1FYN A;  2PZ1 A;  3PVQ A;  2A28 A;  2KXC A;  1M3C A;  1KIK A;  1VA7 A;  1EFN A;  2KBT A;  2CH4 W;  1XOV A;  2YDL A;  1T3L A;  2AZS A;  1MUZ A;  1UHC A;  4F14 A;  1RLQ C;  2FG0 A;  3LH5 A;  2DNU A;  2RF0 A;  3FJ5 A;  1M30 A;  2OJ2 A;  1QWE A;  2FPD A;  2W0Z A;  2KRS A;  1X69 A;  4OMM A;  1I07 A;  1WXB A;  2RN8 A;  1KJW A;  1ZLM A;  1WYX A;  1X6B A;  1Z9Z A;  5IXF A;  3NPF A;  1CSK A;  3NHN A;  2JXB A;  2YUO A;  1K76 A;  2L3S A;  2DRM A;  1KFZ A;  2G6F X;  3I5R A;  2A37 A;  2KE9 A;  3R6N A;  1ARK A;  4J9B A;  2K6D A;  1PKS A;  3KFV A;  4OMO A;  1OPL A;  3ULR B;  5I22 A;  3TSW A;  1WIE A;  2FPF A;  2LCS A;  4X1V A;  2NUZ A;  2FO0 A;  1M8M A;  4QT7 A;  2H8H A;  5HCK A;  1RUW A;  3I35 A;  2O9V A;  1OPK A;  2YUQ A;  4A63 B;  3VS4 A;  1X2Q A;  3C0C A;  2D8H A;  4AFQ C;  2DL4 A;  1ZX6 A;  4AG2 C;  1WXU A;  4RTY A;  2CSQ A;  4J9I A;  2KXD A;  1BBZ A;  2YSQ A;  1W6X A;  4HCK A;  3REB B;  4ORZ A;  1J3T A;  4IIO A;  2RNA A;  2CT4 A;  3VS5 A;  2ENM A;  3JV3 A;  4J9F A;  4Z89 A;  3M0P A;  1X27 A;  1HSQ A;  1ZBJ A;  3VS3 A;  1V1C A;  2ESW A;  1JEG A;  2FRY A;  1I0C A;  1S1N A;  2OAW A;  2DVJ A;  2LJ0 A;  2EKH A;  2LJ1 A;  1AVZ C;  3SHW A;  2P4R A;  4JJC A;  1G2B A;  5IHN A;  4D8K A;  2KRM A;  4HVU A;  2EW3 A;  4LUD A;  4CC3 A;  3VS6 A;  1Y57 A;  2L3Q A;  4AFS C;  2GBQ A;  5FW9 A;  2DJQ A;  1YN8 A;  3UF4 A;  2KNB B;  1U3O A;  1IO6 A;  1ZSG A;  1AWW A;  1GCQ C;  4HVW A;  4RTT A;  4AFZ C;  2RPN A;  2DRK A;  5ECA A;  4J9C A;  2LNH B;  2NWM A;  4ZNX A;  2RQW A;  2EPD A;  1ZUK A;  2MIO A;  2DBM A;  3M0Q A;  4RTU A;  2LZ6 B;  4OMQ A;  1SEM A;  2DBK A;  1SPK A;  2ABL A;  4LNP A;  3PVL A;  1PRM C;  1WXT A;  2HBW A;  4AG1 C;  3H41 A;  1TUC A;  3EHQ A;  1UJ0 A;  3H0I A;  1QKW A;  1JU5 C;  4DEX A;  3EG2 A;  1AEY A;  3IQL A;  1QLY A;  2YT6 A;  5GJW B;  2MCN A;  3A98 A;  3VRZ A;  2RQR A;  2DL8 A;  1SSH A;  1BK2 A;  2C0T A;  2JM8 A;  4JJB A;  4F16 A;  2ED0 A;  2DL5 A;  1T0J A;  2E5K A;  1AD5 A;  2JMC A;  2LJ3 A;  2RMO A;  1JXO A;  1K0S A;  1N5Z A;  1CKB A;  2JMA A;  4KRT A;  4GBQ A;  1NEG A;  2K2M A;  2DLP A;  2A08 A;  2PTK A;  1G83 A;  1T3S A;  1AZE A;  1U06 A;  4GLM A;  2A36 A;  1M27 C;  5FWB A;  1UE9 A;  5I11 A;  3O5Z A;  2BZY A;  2D1X A;  2ECZ A;  3REA B;  3EG1 A;  4IIM A;  2DL7 A;  1K9A A;  2I0N A;  4R0K A;  2YUP A;  1UDL A;  2J7I A;  1ABO A;  3UA7 A;  3I9Q A;  3RBB B;  4EIK A;  2KRO A;  1UHF A;  1PRL C;  2EYY A;  2KYB A;  1SRL A;  2O88 A;  2L0A A;  5IH2 A;  2DM1 A;  1SHG A;  4RTX A;  1JXM A;  2LP5 A;  1UEC A;  5GJV B;  2BTT A;  4CC4 B;  1UTI A;  4DEY A;  1WA7 A;  2J05 A;  2KGT A;  2LQN A;  2V1R A;  2LMJ A;  2DF6 A;  1GCQ A;  2RQU A;  4HXJ A;  4F17 A;  2CRE A;  4RTZ A;  4OMP A;  3NGP A;  1H92 A;  1WI7 A;  3CQT A;  5IHK A;  1E6G A;  2EGE A;  2EQI A;  1YWP A;  1UG1 A;  2AKK A;  2DA9 A;  2JTE A;  1GBQ A;  3H0H A;  1JQQ A;  2MOX A;  4LE9 A;  1HD3 A;  1VYV A;  1WFW A;  3VRY A;  2B86 A;  1ZUY A;  1NG2 A;  3GBQ A;  4Z8A A;  2EGA A;  2KR3 A;  3TSZ A;  2RQV A;  2DMO A;  1GL5 A;  1X6G A;  4JPB W;  1AWX A;  2RQT A;  4J9G A;  2KRN A;  2KYM A;  2LX7 A;  1K4U S;  2CSI A;  1W1F A;  1YP5 A;  2CT3 A;  4RUG A;  5L23 A;  2EYW A;  1YCS B;  2IIM A;  2ROT A;  3EG0 A;  4K11 A;  1FMK A;  2M51 A;  3VS2 A;  1Y0M A;  1WX6 A;  1BU1 A;  1UFF A;  1MV3 A;  2EYX A;  3U23 A;  2AK5 A;  2FPE A;  1B07 A;  1OOT A;  1WDX A;  2F2X A;  2V1Q A;  1JO8 A;  2J06 A;  2M0Y A;  2C0O A;  1VYU A;  3EHR A;  2J6O A;  2K3B A;  1GRI A;  1MV0 B;  5EC7 A;  3UAT A;  4LN2 A;  1GBR A;  2K9G A;  2VVK A;  3M0U A;  1I1J A;  1X43 A;  1M3A A;  3QWX X;  2EBP A;  2VWF A;  2X3W D;  1RI9 A;  3NMZ C;  4RTV A;  2O31 A;  2KEA A;  2HCK A;  1PKT A;  2D0N A;  3VS7 A;  1TG0 A;  1T0H A;  2C0I A;  1QWF A;  2HSP A;  4JJD A;  1PNJ A;  4ESR A;  1NYG A;  2JT4 A; 
#chains in the Genus database with same CATH topology
 4OB1 B;  2QDL A;  2E3I A;  5LJ3 f;  3G71 A;  4IUV A;  3QWY A;  2EQJ A;  4RTW A;  3UA6 A;  4FYY B;  2K57 A;  4M78 B;  4J9H A;  1OEB A;  2EYZ A;  3ZFJ A;  1Q82 C;  1RAG B;  1YJ9 T;  1RLP C;  1WQ7 A;  1OQK A;  4PJO A;  2X3X D;  3QZ9 B;  1AT1 B;  2AHJ B;  3NTI A;  1A0N B;  3I56 T;  1TOV A;  3OYN A;  1YIJ A;  1JJ2 A;  3CCE Q;  4WTO B;  3TVT A;  3CC2 T;  1VUB A;  3FJP A;  2ZPB B;  3M0R A;  1H3H A;  2O2O A;  3QKJ A;  4WCI A;  4M7D A;  3H0F A;  3VYG A;  2YUN A;  4JDS A;  2DX1 A;  3OS0 A;  1JBM A;  1RAB B;  1UUE A;  5KYY A;  1K8A U;  2OI3 A;  2FEI A;  3BE3 A;  1NZ9 A;  2DTI A;  2GTJ A;  2VKN A;  3EFS A;  5FU7 B;  1LNX A;  2XMF A;  3CC7 A;  3CCQ Q;  1NLP C;  2OTL A;  4Y92 A;  1B3Q A;  2R57 A;  1PWT A;  1VQM T;  3G4S A;  2MK5 A;  1WGS A;  4Z02 A;  1YIJ Q;  1XJW B;  1M3B A;  4PJJ A;  3GLX A;  3G6E Q;  1VQ5 Q;  3VS0 A;  4EMH A;  3OBW A;  5LL6 S;  2LQW A;  3MEA A;  4NOY A;  2QQR A;  1D1A A;  4B9W A;  4BY6 B;  3VS1 A;  1V76 A;  2JS0 A;  2F2W A;  4PL6 A;  3FC3 A;  4FSS A;  1KD1 U;  2COZ A;  2P4T A;  2DL3 A;  2QQB A;  2QG9 B;  4E7S A;  1I5O B;  1QKX A;  1YBY A;  1FYN A;  2PZ1 A;  3PVQ A;  2A28 A;  4ZGD B;  4M75 C;  2KXC A;  1M3C A;  1QVF A;  4XTZ A;  4BDY A;  1MMN A;  1VA7 A;  1Q7Y R;  1VIF A;  1F1B B;  1BYM A;  2GFA A;  4PFO A;  2CH4 W;  1XOV A;  3M56 A;  4C0D B;  2QTV A;  1UHC A;  2RHX A;  2COW A;  4RMO A;  1B7T A;  2OJ2 A;  2FPD A;  1Q81 R;  4M7A D;  2OTJ T;  1Y07 A;  2W0Z A;  5LJ5 g;  4C8Q B;  1IHW A;  1VQP T;  1ZSZ B;  1ZLM A;  5CKE A;  3OW2 P;  1Z9Z A;  2JNG A;  3NPF A;  2JXB A;  4OP0 A;  3JCM f;  1KFZ A;  2VXE A;  1EIF A;  2AT1 B;  5C6S A;  4OMO A;  2JN0 A;  5LJ5 d;  1OPL A;  1D1C A;  4XU3 A;  5I22 A;  4DQ2 A;  3TSW A;  3H8Z A;  5CKB A;  1VQO A;  2LCS A;  4C92 C;  4X1V A;  4NL3 A;  2NUZ A;  2FO0 A;  4ZGE B;  1RUW A;  3I35 A;  3MP8 A;  1YJ9 Q;  2NUT B;  4A63 B;  5GMK h;  1BKB A;  3QJY A;  4FT4 A;  3JAM E;  1WXU A;  4RCC A;  2KSS A;  2CZ1 B;  1VQM A;  3I56 Q;  3DKM A;  2DXU A;  2DKG A;  2CSQ A;  4M7D D;  4TVR A;  2LDM A;  3L2Q A;  4OB2 B;  3CC2 Q;  3X28 B;  2D6F A;  3MO8 A;  3CPW P;  3SWN A;  4PJM A;  2CT4 A;  3V7R A;  1YHQ T;  5GAM g;  3CBP A;  3JV3 A;  4M78 C;  1FX7 A;  3KBG A;  2GFU A;  1M1G A;  2X51 A;  1HSQ A;  1RAH B;  1JEG A;  4C0F A;  3CXC S;  5C0M A;  1VIE A;  2LJ0 A;  3MPU B;  2PVO B;  2DYI A;  4NL2 A;  5GAM d;  3QBY A;  1VQM Q;  2P4R A;  1KQ1 A;  5LJ5 f;  4VUB A;  4HVU A;  4E2F B;  2EW3 A;  3VS6 A;  4F7U F;  1UEB A;  3UPU A;  2GBQ A;  3MEW A;  2DJQ A;  5FW9 A;  3WXM B;  3GIB A;  3DB3 A;  3E9F A;  2QDY B;  2KNB B;  2MAM A;  2E10 A;  1VQP A;  5FU6 B;  1AWW A;  2RPN A;  2FVU A;  4OVA A;  4DOW A;  3RMQ A;  1FMV A;  2RD1 A;  3CCR A;  2DET A;  4C0Z A;  4OGC A;  2DBM A;  4RTU A;  2BE7 D;  2LZ6 B;  5GAO l;  4CRI A;  2ABL A;  3PFS A;  3PVL A;  1WXT A;  2EAY A;  1RL2 A;  4E7L A;  1OUL A;  1UJ0 A;  3H0I A;  2JTM A;  4JRP A;  4WF2 A;  3OW2 S;  1QKW A;  2EIF A;  3OMC A;  1M1K C;  2OTJ Q;  4QQ6 A;  1VQP Q;  3OB9 A;  2FB7 A;  1BK2 A;  4JJB A;  3S6W A;  2PQW A;  5GAM f;  2LT4 A;  1M4Z A;  2H3E B;  2LJ3 A;  3PNW C;  5CIU A;  2ZCF B;  2E64 A;  4EMK A;  5LJ3 j;  1MHN A;  3E2U A;  3FB9 A;  1YHQ A;  5GAN h;  1SG5 A;  4GBQ A;  3CPF A;  2ZZD A;  2GQV A;  4F04 B;  1NEG A;  1KQS S;  2GF7 A;  2A08 A;  4CI0 C;  1G83 A;  4C5H A;  4PKC C;  4GLM A;  4PJO E;  2A36 A;  5FWB A;  3MET A;  2L8D A;  1OI1 A;  3JCM P;  1BI3 A;  2BZY A;  2ECZ A;  3EG1 A;  2DO3 A;  4IIM A;  1BI1 A;  4B9X A;  2DL7 A;  1K9A A;  2WSE E;  2YUP A;  2J7I A;  5CVI A;  1ZSZ C;  1Y96 B;  2XDD A;  3UA7 A;  1D0Z A;  4EIK A;  4IUP A;  2KRO A;  1PRL C;  4J7I A;  1SRL A;  4JLI A;  4PNO A;  2XDP A;  4XQ3 A;  1S72 A;  1U1S A;  4RTX A;  3EFR A;  2VAS A;  1VQK A;  4M77 A;  1YHQ Q;  5CKH A;  4ANJ A;  1UEC A;  3MP6 A;  1WA7 A;  2J05 A;  1M9S A;  1R8O B;  2V1R A;  3HRU A;  1W2B A;  4MDW A;  1YIT T;  5D7U A;  4OMP A;  3NGP A;  3QUI A;  3PT9 A;  2RA2 A;  5KYX B;  1WI7 A;  3X26 B;  2HBP A;  1E6G A;  2EGE A;  4PJL A;  1YWP A;  3TCJ A;  2DZ9 A;  2DA9 A;  2JTE A;  3BW1 A;  4LE9 A;  2CGH A;  1VQL A;  2L3R A;  3SB2 A;  4L5G A;  2DMO A;  2F5K A;  4JPB W;  1AWX A;  4J9G A;  1PD0 A;  2KYM A;  2LX7 A;  1K4U S;  1W1F A;  1YP5 A;  1YCS B;  2AIR B;  1ZA1 B;  2CP2 A;  2ROT A;  4JRQ A;  1HXD A;  6AT1 B;  4J6Y A;  1QCO A;  2QEX A;  4M7A G;  4LD9 K;  1WPY A;  2AK5 A;  2FPE A;  2F2X A;  1OOT A;  2V1Q A;  2XK0 A;  2PUK B;  2J06 A;  2M0Y A;  2MWO A;  2EYQ A;  2K3B A;  1VQ4 A;  1K73 U;  2E70 A;  2PUO B;  5FU6 C;  4LN2 A;  2K9G A;  4RKU E;  3L2R A;  1BI0 A;  1I1J A;  4M75 F;  5GAN 8;  5GAN 2;  3V7C A;  2KDS A;  3NMZ C;  1K9M U;  5KCO A;  1M8V A;  2HCK A;  4BD3 A;  2C0I A;  2HSP A;  2WSF E;  1P92 A;  1PC0 A;  3HFN A;  1VQ6 A;  4M7D G;  1CKA A;  2RI2 A;  4XU0 A;  3S3O A;  4JS5 A;  2AKL A;  1WLP B;  4ZGJ B;  3I5S A;  1WQW A;  3N5B B;  2KVQ G;  1WHM A;  1N27 A;  1O9S A;  2F69 A;  1B34 B;  1GFC A;  1OV3 A;  1GFD A;  2L3P A;  5FLX E;  3EGU A;  3A1P A;  1N6A A;  1VQ9 T;  3DB4 A;  4E7K A;  2HSE B;  2CH4 A;  4R55 A;  5FWC A;  2M9U A;  1KC8 R;  1K8A R;  2ROL A;  2AZV A;  3BDL A;  1VQN T;  4LD6 A;  3MCA B;  1BIA A;  4BI4 A;  1ZUU A;  5CQX A;  1YIT Q;  3J81 E;  2GQI A;  1K1Z A;  2HDA A;  5LJ5 j;  3OYF A;  5IXB A;  5CO7 A;  1FXX A;  1TSF A;  3CCS T;  1TUD A;  3HRS A;  5GAN f;  1MND A;  2EQK A;  4KBM B;  1VQ7 T;  4JZ3 A;  1U5S A;  1KD1 R;  1XTD A;  4OF1 A;  2HZY A;  2E3H A;  3OYD A;  1E6H A;  2FZC B;  3ER0 A;  4M78 F;  5GAN 7;  2GTO A;  1TS9 A;  2K7A A;  2I2L A;  2SRC A;  3A8G B;  9ATC B;  3A8O B;  1VYT A;  2MWP A;  4KH1 B;  5D6W A;  2V8J A;  2A7Y A;  4E6R A;  1PM3 A;  1G5V A;  3RNJ A;  3QXE B;  2RI5 A;  1RI0 A;  4FT2 A;  1QP2 A;  5GAN 3;  2KBT A;  1VQ8 T;  3JRZ A;  1RAC B;  3E9G A;  1H64 1;  2R58 A;  2AZS A;  2DEU A;  4FW1 A;  2ATC B;  5GAM j;  1RLQ C;  2FG0 A;  3LH5 A;  2DNU A;  2RF0 A;  2K3X A;  4KH0 B;  3RMS A;  1QWE A;  4JRK A;  3TQ7 P;  3OYK A;  1X69 A;  4OMM A;  1WXB A;  2RN8 A;  4C92 A;  4M7A A;  1SF9 A;  3L1A A;  2YUO A;  3CCE A;  2G6F X;  3WVE B;  1Q86 U;  4J9B A;  1NJI U;  3KFV A;  3HKS A;  3LGF A;  3M9Q A;  4XU1 A;  3KXT A;  3MEU A;  3CME T;  2YLC A;  3CCS A;  3M4G A;  2H8H A;  5HCK A;  3NTH A;  1VQ9 Q;  1Y7X A;  5KH6 A;  1OPK A;  1N9R A;  2K4Y A;  3VS4 A;  2LRQ A;  2MF2 A;  3CCQ A;  3CCJ T;  2DL4 A;  2RJD A;  4LDU A;  4AG2 C;  2LQ8 A;  1OX8 A;  4PJO B;  3HRT A;  3EG9 A;  1VQN Q;  3JCM W;  3M53 A;  4ZN1 A;  2HQH A;  3C94 A;  4J9I A;  2QTX A;  1BBZ A;  3HL8 A;  1KQ2 A;  2D9T A;  2EJF A;  1BCM A;  4HCK A;  3G6E A;  1VQ5 A;  4M7D B;  1M90 U;  4IIO A;  4C8Q F;  3L2V A;  2ZPH B;  3M55 A;  3FIF A;  3VS5 A;  3JCM g;  1FWZ A;  3CCS Q;  3JCM J;  5KYY B;  3A5Z B;  3QJ6 A;  1BIB A;  3BFM A;  2RJC A;  4JJN K;  3JB9 H;  1ZBJ A;  3VS3 A;  1VQ7 Q;  2CP7 A;  2ESW A;  2FRY A;  2RK2 A;  2ZPF B;  3JCM d;  2OAW A;  2DVJ A;  1WHG A;  3SHW A;  4QVC A;  3CD6 T;  2NYS A;  4M75 D;  5IHN A;  2ZGW A;  2KRM A;  4CC3 A;  2RHY A;  3VV0 A;  3CXC P;  4EDU A;  2PU9 B;  4JRI A;  4KUL A;  1N8R C;  1ZQ1 A;  2L89 A;  1I5L A;  2XIC A;  1U3O A;  4MMK A;  1ZSG A;  5GAN 4;  2DRK A;  2H3J A;  4DOV A;  2HQX A;  2DPP B;  2NLU A;  4C5I A;  3GNG A;  1PCX A;  2VUB A;  5CKF A;  2BUD A;  1VQ8 Q;  2CP5 A;  1HK9 A;  4BB7 A;  2JVV A;  2A3L A;  3H41 A;  4ZN3 A;  3EHQ A;  2EJ9 A;  2O4X A;  2E65 A;  1YJ9 A;  3MKD A;  3C12 A;  2XI9 A;  2DFU A;  2HL3 A;  4C92 D;  1AEY A;  2MCN A;  3A98 A;  3CCM T;  1Q82 U;  3VRZ A;  3I56 A;  4PFP A;  2V8I A;  2DL5 A;  3CC2 A;  2JOY A;  2WAC A;  2E5K A;  3QYH B;  5HK0 A;  1AD5 A;  4M77 G;  4ATO A;  1N5Z A;  1CKB A;  2M0O A;  5AT1 B;  3OYE A;  3CME Q;  1X75 C;  1TXQ A;  3M5A A;  4N4G A;  1M2V A;  1NPP A;  2XU8 A;  3A8L B;  5LJ3 e;  2DLP A;  2HMA A;  4QKU A;  3INZ A;  5IN1 A;  3NFC A;  3MHX A;  3OBY A;  4N0A C;  3GNF B;  5I11 A;  4FM4 B;  3CCJ Q;  3RKY A;  1QVP A;  5DLQ E;  4M78 D;  3REA B;  1N9S A;  1KQS P;  4R0K A;  3CD6 A;  1IRE B;  1ABO A;  5J3B A;  4X34 A;  1UGQ B;  3RBB B;  1OU9 A;  2FZK B;  2O88 A;  2L0A A;  5IH2 A;  5CCA A;  3SWN B;  3QHS A;  1SHG A;  3EFO A;  2LP5 A;  3VUB A;  2VYT A;  3OS2 A;  2Y90 A;  4CC4 B;  3ZBD A;  2DK3 A;  1YI2 T;  5CAI A;  2LMJ A;  1UB4 A;  2X4X A;  5J26 A;  1Q81 C;  1GCQ A;  3RDV A;  4HXJ A;  3UWN A;  4ELY C;  3CD6 Q;  4PJO C;  2X9H A;  2IVW A;  4E7Z A;  3OW2 A;  1UG1 A;  2AKK A;  1G8X A;  4LXC A;  2MOX A;  4QQD A;  1HD3 A;  2FYK A;  2OTJ A;  3VRY A;  1ZUY A;  4BE1 A;  3GBQ A;  1M5Q 1;  2EGA A;  2KR3 A;  3TSZ A;  4DBQ A;  1GL5 A;  1X6G A;  3PIP A;  2RM4 A;  3QDR B;  2P0K A;  3EGX A;  1K73 R;  3AHU A;  2CT3 A;  2IIM A;  1ZHI A;  1FMK A;  5FU7 C;  4OGE A;  1Y71 A;  4FYV B;  5GAO r;  3GOX A;  1UFF A;  2MI6 A;  1MV3 A;  3MJX A;  2VGN A;  4FSX A;  1WDX A;  3PIO A;  1JO8 A;  1K9M R;  1X6O A;  5KYN A;  3HP9 A;  4JS4 A;  4M7A E;  2RI3 A;  3CCM Q;  3GPL A;  1MV0 B;  5EC7 A;  3S3N A;  3UAT A;  3CPW A;  2FL7 A;  4BY6 C;  2QA4 T;  1DJ7 B;  3X25 B;  3V8K A;  1YJN T;  2P0Q A;  3M58 A;  4FIB A;  3M57 A;  4O5V A;  1X43 A;  1M3A A;  4IUU A;  4C8Q D;  4XAX B;  2VWF A;  4EMK B;  4L59 A;  3JCM e;  4LDX A;  2KEA A;  1WHH A;  3VS7 A;  1EX4 A;  4PJN A;  4A4E A;  4DBF A;  3CCV T;  3JB9 J;  4C0D C;  2C06 A;  4C5G A;  4JJD A;  3H9N A;  1KHI A;  2JT4 A;  3G7Z A;  1QVG P;  1D09 B;  1BB9 A;  3M0S A;  4D8D A;  2EWN A;  2J6F A;  2EQM A;  4YTL A;  4C8Q C;  3SFM A;  2X4J A;  2RH2 A;  1YNZ A;  2JTF A;  2OX7 A;  4M7D E;  2PNI A;  2E4H A;  1Q81 U;  3EH1 A;  2KAF A;  4F7U A;  2CDT A;  1E7O A;  3CCU T;  2XKO C;  4XTV A;  1YJW T;  2L5Q A;  2K79 A;  4CC7 A;  1UGV A;  1SHF A;  3HHT B;  1NEB A;  2L2P A;  1AHJ B;  2ED1 A;  2O9S A;  2DTO A;  1NYF A;  4M77 B;  4GY5 A;  3RER A;  4JZ4 A;  1YI2 Q;  3FEO A;  4IUQ A;  1D3B A;  3H6Z A;  4J9D A;  4M75 G;  5KYW A;  2NUP A;  2RB6 A;  3A8M B;  2DIL A;  1ABQ A;  1M1F A;  4HA8 A;  3DLL A;  2ZPE B;  1LCK A;  2W10 A;  5DM7 R;  2O01 E;  3TRE A;  4OMN A;  2GGR A;  2FRW A;  3SEM A;  1WJQ A;  3EGD A;  2E6Z A;  2XD0 A;  1X2K A;  4XTY A;  5LJ5 e;  1WHK A;  1LOJ A;  1PSE A;  2HD0 A;  4MZM A;  1AOJ A;  2DTH A;  4KGX B;  3CBO A;  1MMG A;  4KGV B;  3PE0 A;  3THK A;  2ZPG B;  5FRM A;  2J6K A;  1YWO A;  1M1K U;  4M4Z A;  1AWO A;  2LT1 A;  4E7H A;  3VU3 C;  3OYM A;  5GAO m;  3F70 A;  3LX7 A;  2M1H A;  1WJS A;  3MEV A;  4C92 G;  2A0F B;  2IG0 A;  3CCV A;  2JZ2 A;  2CUB A;  3VJP A;  1H8K A;  4HVV A;  5LJ3 h;  5DLO A;  1LVK A;  1OZ3 A;  1SRM A;  1QW1 A;  3L2Z A;  3OYY A;  1KIK A;  1WHL A;  2QA4 Q;  4Y91 A;  4ME7 A;  1YJN Q;  2R5A A;  2YDL A;  1LPL A;  1T3L A;  1Q86 R;  5GAN g;  4A4H A;  1NJI R;  8AT1 B;  3CCU A;  4MDX A;  2CZ7 B;  3L42 A;  3CCL T;  3FJ5 A;  5J39 A;  5GAM e;  3JCM Q;  1QVG S;  1I07 A;  2KY9 A;  3CCV Q;  3FLG A;  5GAN d;  1WYX A;  1PG5 B;  1X6B A;  4M78 G;  5IXF A;  3O8V A;  1CSK A;  3NHN A;  1K76 A;  1MNE A;  2DRM A;  1IXD A;  3I5R A;  2KE9 A;  2XHC A;  3R6N A;  1ARK A;  4BI3 A;  1PKS A;  1YIT A;  3ULR B;  2QAZ A;  2RO0 A;  2CP0 A;  3JCM X;  3GP8 A;  1WIE A;  3M59 A;  3SDZ A;  2FPF A;  2QQA A;  4OB3 B;  3CCU Q;  1YJW Q;  1M90 R;  1G3S A;  2O9V A;  4KUD K;  2YUQ A;  3C0C A;  2D8H A;  4AFQ C;  2JUF A;  2K5L A;  4EMK C;  5GMK l;  3CEY A;  4RTY A;  4Y28 E;  3VUZ A;  1TWB A;  2K3Y A;  2KXD A;  1MMA A;  1C0M A;  3JCM b;  1TUG B;  3I55 T;  3REB B;  4ORZ A;  4EMG A;  1J3T A;  2RNA A;  1UGS B;  2MMP A;  2HKQ B;  2QGF B;  2RHZ A;  3OYA A;  1TU0 B;  4QW2 A;  2QGG A;  4J9F A;  4Z89 A;  3M0P A;  2Z0W A;  4HT8 A;  1V1C A;  1R0C B;  3LW5 E;  2LJ1 A;  1AVZ C;  2FZG B;  3G71 T;  1G2B A;  2OAU A;  1Y57 A;  2L3Q A;  4AFS C;  3CCL A;  5GAN 6;  4M75 A;  5GMK e;  2DXT A;  4J5Y A;  3UF4 A;  1G3Y A;  3JB9 F;  1RAF B;  1IO6 A;  5A0L A;  4PJO F;  3X24 B;  4C5E A;  2LNH B;  2NWM A;  1RAI B;  3G1J A;  2EPD A;  2CP3 A;  4FU6 A;  1ZUK A;  2MIO A;  1Q82 R;  3M0Q A;  4LDY A;  5KYU A;  2YWW A;  2M02 A;  4M7D F;  1KC8 C;  1K8A C;  5KE3 A;  1SPK A;  5HY6 A;  3LLR A;  2D0Q B;  4BI8 B;  3ME9 A;  1PRM C;  2XG8 D;  1LJO A;  2HBW A;  2CP6 A;  1JJ2 P;  3D7S B;  4FW2 A;  2FHD A;  1VQ9 A;  2R5M A;  3CCL Q;  2QAS A;  1SSF A;  1JU5 C;  4DEX A;  3EG2 A;  2DEQ A;  3IQL A;  1QLY A;  3GF5 A;  3VYH B;  5GJW B;  5CR2 A;  3CC7 T;  2RQR A;  2OTL T;  2KQW A;  2BE9 B;  2DL8 A;  1QQJ A;  4C92 B;  1VQN A;  4OB0 B;  4M7A B;  1D1B A;  2C0T A;  2JM8 A;  4F16 A;  2ED0 A;  1KG1 A;  1R0B G;  3QPH A;  2MYS A;  4N0A A;  3G4S T;  2ZAE A;  1T0J A;  5GAN 5;  1IRX A;  2JMC A;  2COY A;  4FYX B;  1V29 B;  1JXO A;  3C4S A;  1KD1 C;  3CBM A;  2JMA A;  3L2W A;  2QYZ A;  2K2M A;  2VV5 A;  5I21 A;  2K5I A;  4M77 E;  4DA4 A;  1T3S A;  1AZE A;  1M27 C;  1M2O A;  3O5Z A;  1VQ7 A;  5LJ5 h;  3QZ5 B;  5GMK m;  4HCC A;  4IUT A;  1C6V X;  5FRO A;  1UDL A;  1VOM A;  3EG9 B;  4M78 A;  5EG2 A;  3OYI A;  3TEE A;  2QI2 A;  3I55 Q;  1QVF P;  2RJE A;  4N4I A;  3OYJ A;  1UHF A;  2EYY A;  2KYB A;  4L6V 5;  2CYZ B;  1JXM A;  1H3Z A;  4JLG A;  3CC4 T;  3HPW A;  5GJV B;  2V26 A;  4DBR A;  1UTI A;  2F5T X;  2LQN A;  3FRN A;  1I4K 1;  4BUG A;  2DF6 A;  1I81 A;  3RIR A;  1WHJ A;  2RQU A;  3OY9 A;  3LWH A;  1VQ8 A;  1XNI A;  4DBH A;  3G71 Q;  2CRE A;  5GAN e;  5GMK j;  4RTZ A;  1I8F A;  1H92 A;  1VQO T;  1KC8 U;  5IHK A;  4O6J A;  2X4W A;  1D0Y A;  1GBQ A;  4KT0 E;  3HTR A;  2Y4X A;  2B86 A;  4GLK A;  2DAQ A;  1NG2 A;  5GAM h;  5A0D A;  2DIG A;  3OYL A;  2KRN A;  4MML A;  1IGU A;  2CZ6 B;  2CSI A;  5L23 A;  4RUG A;  1JJ2 S;  3EG0 A;  4K11 A;  2M51 A;  1WX6 A;  1BU1 A;  3CME A;  1RAA B;  1UGR B;  3OYC A;  4KGZ B;  7AT1 B;  3BDU A;  2YRV A;  1C1A A;  2O4X B;  2DIQ A;  3CCJ A;  1VYU A;  1OX9 A;  3UT1 A;  3CC7 Q;  2CKK A;  5I2S A;  1GRI A;  2OTL Q;  3UDC A;  3RES A;  3QSU A;  4F7U G;  3M0U A;  3G4S Q;  3HFO A;  3V8J A;  3QWX X;  3RUX A;  2X3W D;  3CC4 A;  1HYO A;  4RTV A;  4C8Q A;  3L2U A;  2HNI A;  1SKU B;  2LCC A;  2D0N A;  1ZSZ A;  1TG0 A;  1T0H A;  2YRC A;  1M2V B;  4XTU A;  4P5N A;  1O75 A;  2RJF A;  1WJR A;  4ESR A;  1RAD B;  3CCR T;  4KUI A;  3E19 A;  4BE2 A;  1QVF S;  3CXC A;  1G3T A;  1PHT A;  2G3R A;  1JB0 E;  1UJY A;  4CC2 A;  2F1L A;  2KT1 A;  4LUE A;  1GCP A;  2HEQ A;  3NTK A;  4M7A C;  3JB9 D;  2CUD A;  2JM9 A;  3ZL7 C;  2QK0 A;  2NUT A;  2BZX A;  4OML A;  4PJO D;  2D8J A;  1ZA2 B;  1Q7Y C;  1QP3 A;  3QDF A;  3CC4 Q;  1MMD A;  3P8H A;  3EFO B;  1AZG B;  2EGC A;  4J9E A;  2XID A;  1N8R U;  4D6W A;  2EVR A;  1XQH A;  1RAE B;  1NLO C;  5GAN j;  4Z88 A;  2YXY A;  1M1K R;  4J6W A;  5GAO p;  1AWJ A;  2DYB A;  4II1 A;  4LDV A;  3DLM A;  4M75 E;  1VQO Q;  1U1T A;  1EZZ B;  3URG A;  1NM7 A;  4IKF A;  2K5F A;  3CCM A;  2JW4 A;  1QCF A;  2BZ8 A;  2GNC A;  4M7D C;  2SEM A;  2IPO B;  1W70 A;  1NE8 A;  3ZEH A;  3OYG A;  3EGX B;  1KSW A;  4QQG A;  3M0T A;  1WZO A;  1MGQ A;  3EG3 A;  1KHC A;  1K0X A;  2F2V A;  1S72 T;  4M77 F;  5IHI A;  2KT8 A;  1VQK T;  1UGP B;  2CS7 A;  2VB6 A;  1QCN A;  2WSC E;  4AFU C;  1KQS A;  3JSC A;  4N4H A;  3J7A F;  1HJD A;  4ZTJ A;  2HAX A;  2DE0 X;  2KMT A;  4C92 E;  1Z9Q A;  2JS2 A;  4C0G A;  1EFN A;  1IHV A;  3QO3 A;  3T9N A;  3M4Y A;  3JCM V;  1MUZ A;  2HQE A;  5GMK i;  2QQ9 A;  3OSV A;  4F14 A;  2E1H A;  5IAY A;  1W2B P;  2RK1 A;  2X4Y A;  3CMA T;  4IUR A;  1M30 A;  3J80 E;  5A2Q E;  2KRS A;  8ATC B;  2Y4Y A;  2XDB A;  1KJW A;  1VQL T;  1YI2 A;  2RHI A;  1Q7Y U;  4J7F A;  3CCR Q;  5CK9 A;  2L3S A;  2A37 A;  4PFZ A;  1ACM B;  1BCO A;  4PK4 A;  2K6D A;  4J8O A;  5FRN A;  2DD5 A;  4M78 E;  5GAO n;  2KK4 A;  1YCY A;  3JCM c;  2DD4 A;  4HCZ A;  1TTH B;  2QEX T;  1KK7 A;  1M8M A;  4QT7 A;  1K73 C;  4B6M A;  4F7U B;  5HKC A;  1X2Q A;  4AT1 B;  3OA6 A;  1ZX6 A;  3MP1 A;  1VQ4 T;  3CPW S;  4ELZ C;  1Y96 A;  3OYB A;  4XU2 A;  1K9M C;  3V8L A;  1D3B B;  2QXF A;  5DY9 A;  2LQK A;  2K2V A;  2YSQ A;  3PMI A;  5KYW B;  3PGG A;  1W6X A;  2NUP B;  2DZC A;  2LX9 A;  2QQS A;  5AYF A;  4R56 A;  1PSF A;  3M54 A;  3PTA A;  4NS5 A;  2ENM A;  3LH0 A;  1QMC A;  3R6O A;  2VXF A;  3P8B B;  4A4K A;  2DER A;  3EGD B;  1R77 A;  1PD1 A;  1OYX A;  1X27 A;  1GXI E;  1VQ6 T;  3SWN C;  1I0C A;  1S1N A;  2QA4 A;  2EKH A;  5A0G A;  1YJN A;  4JJC A;  2V8K A;  5KYX A;  3RKX A;  4D8K A;  4LUD A;  4MZP A;  1YN8 A;  3CMA A;  1FMW A;  2HL5 C;  3TU4 K;  1IB8 A;  1S72 Q;  1QVG A;  1VQK Q;  4E7J A;  1GCQ C;  4HVW A;  4RTT A;  4AFZ C;  4FCY A;  4HT9 A;  1U8R A;  5ECA A;  4J9C A;  4EPC A;  4ZNX A;  2RQW A;  2KI7 A;  4OMF B;  3Q1J A;  2LCL A;  2BKD N;  4QVD A;  4RG8 A;  4BDZ A;  4OMQ A;  1SEM A;  2DBK A;  1W2B S;  3LGL A;  4E7I A;  3FDR A;  4LNP A;  1G3W A;  4AG1 C;  4J83 A;  1YJW A;  3HSB A;  1TUC A;  4C8Q E;  2PVG B;  2M16 A;  3PMT A;  3CMA Q;  2RHU A;  2BIV A;  4XTX A;  5GAO q;  4FL6 A;  2YT6 A;  3VKI A;  1VQL Q;  3S3M A;  4FYW B;  3OS1 A;  1SSH A;  2LNV A;  2P0P A;  4MZT A;  2CZ0 B;  5IT9 E;  3JB9 G;  5KE2 A;  2RMO A;  1K0S A;  2E12 A;  2JJ9 A;  4PJO G;  1ZBX A;  4KRT A;  2QEX Q;  4BAC A;  5D6X A;  2PTK A;  2VGM A;  3OYH A;  1U06 A;  4PLL A;  4QVZ A;  1UE9 A;  5KCH A;  2D1X A;  1VQ4 Q;  2E6N A;  4A54 A;  2I0N A;  1YFN A;  5CKD A;  1D0X A;  1B34 A;  1W4S A;  1OZ2 A;  3EAE A;  4X9D A;  3I9Q A;  2GCX A;  4M77 D;  2LTO A;  3OSS C;  2HKN A;  2DM1 A;  4LDW A;  2EJG A;  5I2M A;  1Q86 C;  3JB9 I;  4C92 F;  2BTT A;  1NJI C;  4XTW A;  4M7A F;  4DEY A;  3AT1 B;  2KGT A;  3C95 A;  2DVE A;  4PLI A;  3RR6 A;  1JRI A;  3CCE T;  1VQ6 Q;  3OQ5 A;  2P84 A;  2PVD B;  4E47 A;  4F17 A;  4M77 C;  4XK8 E;  4X9C A;  3LYI A;  4Q5W A;  3CQT A;  3EH2 A;  3QG1 A;  3OS5 A;  1Q95 G;  2EQI A;  2VC8 A;  3H0H A;  2YHT A;  5LJ3 g;  4M75 B;  1JQQ A;  1TH7 A;  1VYV A;  2B8A A;  1WFW A;  2DXC A;  4AMC A;  3JCM h;  4Z8A A;  1NBE B;  3CCQ T;  4UC4 A;  2RQV A;  5M9O A;  2YRD A;  2RQT A;  4J6X A;  1M90 C;  5LJ3 d;  3V7S A;  2YLB A;  4A53 A;  3E1S A;  3X20 B;  2EYW A;  3RKW A;  3SD4 A;  2E41 A;  1YIJ T;  1X01 A;  3WVD B;  5KYU B;  4C8Q G;  3VS2 A;  1Y0M A;  3LWI A;  3G6E T;  4BE0 A;  1VQ5 T;  4RG2 A;  3P8D A;  3OMG A;  5L8R E;  2EYX A;  3U23 A;  4ZTF A;  3QYG B;  1IGQ A;  2E5Q A;  1B07 A;  4A4F A;  2MPX C;  2C0O A;  3EHR A;  5D6Y A;  2LVM A;  3ASK A;  2J6O A;  1NPR A;  1WNL A;  2X35 A;  2EFI A;  3A8H B;  5CQY A;  1OU8 A;  1GBR A;  2VVK A;  3QII A;  4RCB A;  3I55 A;  2LC4 A;  2ZPI B;  3BY7 A;  2EBP A;  3KUF A;  4JUV A;  1RI9 A;  4F7U E;  4HCB A;  2O31 A;  4A4G A;  2EKO A;  4V2S A;  5HK3 A;  1PKT A;  2DXB A;  1QWF A;  1PNJ A;  2DJZ A;  1IZ6 A;  1NYG A;  2EQU A;  4HKE A;  1BI2 A;  1N8R R; 
#chains in the Genus database with same CATH homology
 1CKA A;  2AKL A;  1BB9 A;  2QDL A;  3M0S A;  4D8D A;  1WLP B;  1PHT A;  3I5S A;  2J6F A;  3QWY A;  1UJY A;  4RTW A;  1YNZ A;  3UA6 A;  1GFC A;  2PNI A;  2KT1 A;  4LUE A;  4CC2 A;  1GCP A;  2HEQ A;  4J9H A;  1OV3 A;  1GFD A;  2CDT A;  2L3P A;  1E7O A;  1OEB A;  2EYZ A;  3EGU A;  2CUD A;  2JM9 A;  3ZL7 C;  2K79 A;  2BZX A;  4OML A;  4CC7 A;  1UGV A;  1SHF A;  1RLP C;  2D8J A;  1NEB A;  2L2P A;  2CH4 A;  2ED1 A;  2O9S A;  5FWC A;  4J9E A;  1AZG B;  2EGC A;  1NYF A;  2EVR A;  2X3X D;  2ROL A;  2AZV A;  1NLO C;  4JZ4 A;  1A0N B;  4J9D A;  4Z88 A;  3TVT A;  1ZUU A;  3M0R A;  1H3H A;  2O2O A;  4WCI A;  2DIL A;  3H0F A;  2YUN A;  1ABQ A;  2GQI A;  1AWJ A;  1LCK A;  2DX1 A;  2DYB A;  2W10 A;  1K1Z A;  2HDA A;  5IXB A;  1UUE A;  4OMN A;  2OI3 A;  2FEI A;  2GGR A;  2FRW A;  2GTJ A;  1NM7 A;  3SEM A;  1TUD A;  2VKN A;  1X2K A;  2XMF A;  2JW4 A;  1QCF A;  1AOJ A;  2BZ8 A;  2GNC A;  1NLP C;  2SEM A;  4JZ3 A;  1U5S A;  4Y92 A;  3PE0 A;  1W70 A;  3THK A;  2J6K A;  1YWO A;  4M4Z A;  1E6H A;  1B3Q A;  1PWT A;  1AWO A;  2GTO A;  1M3B A;  1KSW A;  3M0T A;  2K7A A;  3VS0 A;  2SRC A;  3EG3 A;  1K0X A;  2LQW A;  2F2V A;  1VYT A;  5IHI A;  2KT8 A;  2CUB A;  3VS1 A;  1H8K A;  2JS0 A;  2F2W A;  4AFU C;  4FSS A;  4HVV A;  2DL3 A;  4E6R A;  1HJD A;  3RNJ A;  2DE0 X;  1SRM A;  1QKX A;  1Z9Q A;  2JS2 A;  1FYN A;  2PZ1 A;  3PVQ A;  2A28 A;  2KXC A;  1M3C A;  1KIK A;  1VA7 A;  1EFN A;  2KBT A;  2CH4 W;  1XOV A;  2YDL A;  1T3L A;  2AZS A;  1MUZ A;  1UHC A;  4F14 A;  1RLQ C;  2FG0 A;  3LH5 A;  2DNU A;  2RF0 A;  3FJ5 A;  1M30 A;  2OJ2 A;  1QWE A;  2FPD A;  2W0Z A;  2KRS A;  1X69 A;  4OMM A;  1I07 A;  1WXB A;  2RN8 A;  1KJW A;  1ZLM A;  1WYX A;  1X6B A;  1Z9Z A;  5IXF A;  3NPF A;  1CSK A;  3NHN A;  2JXB A;  2YUO A;  1K76 A;  2L3S A;  2DRM A;  1KFZ A;  2G6F X;  3I5R A;  2A37 A;  2KE9 A;  3R6N A;  1ARK A;  4J9B A;  2K6D A;  1PKS A;  3KFV A;  4OMO A;  1OPL A;  3ULR B;  5I22 A;  3TSW A;  1WIE A;  2FPF A;  2LCS A;  4X1V A;  2NUZ A;  2FO0 A;  1M8M A;  4QT7 A;  2H8H A;  5HCK A;  1RUW A;  3I35 A;  2O9V A;  1OPK A;  2YUQ A;  4A63 B;  3VS4 A;  1X2Q A;  3C0C A;  2D8H A;  4AFQ C;  2DL4 A;  1ZX6 A;  4AG2 C;  1WXU A;  4RTY A;  2CSQ A;  4J9I A;  2KXD A;  1BBZ A;  2YSQ A;  1W6X A;  4HCK A;  3REB B;  4ORZ A;  1J3T A;  4IIO A;  2RNA A;  2CT4 A;  3VS5 A;  2ENM A;  3JV3 A;  4J9F A;  4Z89 A;  3M0P A;  1X27 A;  1HSQ A;  1ZBJ A;  3VS3 A;  1V1C A;  2ESW A;  1JEG A;  2FRY A;  1I0C A;  1S1N A;  2OAW A;  2DVJ A;  2LJ0 A;  2EKH A;  2LJ1 A;  1AVZ C;  3SHW A;  2P4R A;  4JJC A;  1G2B A;  5IHN A;  4D8K A;  2KRM A;  4HVU A;  2EW3 A;  4LUD A;  4CC3 A;  3VS6 A;  1Y57 A;  2L3Q A;  4AFS C;  2GBQ A;  5FW9 A;  2DJQ A;  1YN8 A;  3UF4 A;  2KNB B;  1U3O A;  1IO6 A;  1ZSG A;  1AWW A;  1GCQ C;  4HVW A;  4RTT A;  4AFZ C;  2RPN A;  2DRK A;  5ECA A;  4J9C A;  2LNH B;  2NWM A;  4ZNX A;  2RQW A;  2EPD A;  1ZUK A;  2MIO A;  2DBM A;  3M0Q A;  4RTU A;  2LZ6 B;  4OMQ A;  1SEM A;  2DBK A;  1SPK A;  2ABL A;  4LNP A;  3PVL A;  1PRM C;  1WXT A;  2HBW A;  4AG1 C;  3H41 A;  1TUC A;  3EHQ A;  1UJ0 A;  3H0I A;  1QKW A;  1JU5 C;  4DEX A;  3EG2 A;  1AEY A;  3IQL A;  1QLY A;  2YT6 A;  5GJW B;  2MCN A;  3A98 A;  3VRZ A;  2RQR A;  2DL8 A;  1SSH A;  1BK2 A;  2C0T A;  2JM8 A;  4JJB A;  4F16 A;  2ED0 A;  2DL5 A;  1T0J A;  2E5K A;  1AD5 A;  2JMC A;  2LJ3 A;  2RMO A;  1JXO A;  1K0S A;  1N5Z A;  1CKB A;  2JMA A;  4KRT A;  4GBQ A;  1NEG A;  2K2M A;  2DLP A;  2A08 A;  2PTK A;  1G83 A;  1T3S A;  1AZE A;  1U06 A;  4GLM A;  2A36 A;  1M27 C;  5FWB A;  1UE9 A;  5I11 A;  3O5Z A;  2BZY A;  2D1X A;  2ECZ A;  3REA B;  3EG1 A;  4IIM A;  2DL7 A;  1K9A A;  2I0N A;  4R0K A;  2YUP A;  1UDL A;  2J7I A;  1ABO A;  3UA7 A;  3I9Q A;  3RBB B;  4EIK A;  2KRO A;  1UHF A;  1PRL C;  2EYY A;  2KYB A;  1SRL A;  2O88 A;  2L0A A;  5IH2 A;  2DM1 A;  1SHG A;  4RTX A;  1JXM A;  2LP5 A;  1UEC A;  5GJV B;  2BTT A;  4CC4 B;  1UTI A;  4DEY A;  1WA7 A;  2J05 A;  2KGT A;  2LQN A;  2V1R A;  2LMJ A;  2DF6 A;  1GCQ A;  2RQU A;  4HXJ A;  4F17 A;  2CRE A;  4RTZ A;  4OMP A;  3NGP A;  1H92 A;  1WI7 A;  3CQT A;  5IHK A;  1E6G A;  2EGE A;  2EQI A;  1YWP A;  1UG1 A;  2AKK A;  2DA9 A;  2JTE A;  1GBQ A;  3H0H A;  1JQQ A;  2MOX A;  4LE9 A;  1HD3 A;  1VYV A;  1WFW A;  3VRY A;  2B86 A;  1ZUY A;  1NG2 A;  3GBQ A;  4Z8A A;  2EGA A;  2KR3 A;  3TSZ A;  2RQV A;  2DMO A;  1GL5 A;  1X6G A;  4JPB W;  1AWX A;  2RQT A;  4J9G A;  2KRN A;  2KYM A;  2LX7 A;  1K4U S;  2CSI A;  1W1F A;  1YP5 A;  2CT3 A;  4RUG A;  5L23 A;  2EYW A;  1YCS B;  2IIM A;  2ROT A;  3EG0 A;  4K11 A;  1FMK A;  2M51 A;  3VS2 A;  1Y0M A;  1WX6 A;  1BU1 A;  1UFF A;  1MV3 A;  2EYX A;  3U23 A;  2AK5 A;  2FPE A;  1B07 A;  1OOT A;  1WDX A;  2F2X A;  2V1Q A;  1JO8 A;  2J06 A;  2M0Y A;  2C0O A;  1VYU A;  3EHR A;  2J6O A;  2K3B A;  1GRI A;  1MV0 B;  5EC7 A;  3UAT A;  4LN2 A;  1GBR A;  2K9G A;  2VVK A;  3M0U A;  1I1J A;  1X43 A;  1M3A A;  3QWX X;  2EBP A;  2VWF A;  2X3W D;  1RI9 A;  3NMZ C;  4RTV A;  2O31 A;  2KEA A;  2HCK A;  1PKT A;  2D0N A;  3VS7 A;  1TG0 A;  1T0H A;  2C0I A;  1QWF A;  2HSP A;  4JJD A;  1PNJ A;  4ESR A;  1NYG A;  2JT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...