3GBQA

Solution nmr structure of the grb2 n-terminal sh3 domain complexed with a ten-residue peptide derived from sos direct refinement against noes, j-couplings, and 1h and 13c chemical shifts, minimized average structure
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
57
structure length
57
Chain Sequence
MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GRB2
publication title Solution structure of the Grb2 N-terminal SH3 domain complexed with a ten-residue peptide derived from SOS: direct refinement against NOEs, J-couplings and 1H and 13C chemical shifts.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (signal transduction/peptide)
total genus 8
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1996-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3gbqA00
2DF6A 2RF0A 1VA7A 2D1XA 1RLQC 2VWFA 2EBPA 3EG0A 5HCKA 1ZUUA 4OMOA 3REAB 2A08A 1CKBA 2E5KA 2O9VA 2DA9A 2DMOA 4OMPA 1PNJA 2LJ0A 1AOJA 4WCIA 3VS3A 4JZ3A 1NYGA 1GBRA 2DRKA 4LN2A 1H8KA 1GCQC 1ZUKA 2NWMA 4A63B 1YP5A 3M0PA 2O88A 2V1QA 4J9DA 1AWXA 2F2VA 4J9BA 2GQIA 1JQQA 1HSQA 1QKWA 2PZ1A 4KRTA 4FSSA 1TUDA 2MOXA 2JMCA 1NLOC 1M3AA 2CT4A 1GBQA 2DBKA 1Y57A 2RQWA 4J9IA 1MV0B 1X2KA 2L3QA 1B07A 1UHFA 2EGAA 3UA6A 1QLYA 2P4RA 1ARKA 2EYWA 2KYBA 1H92A 1T0JA 1AZGB 3VS0A 2EKHA 2K79A 1NEGA 2LX7A 2YT6A 2ROLA 2DL3A 4M4ZA 1T3SA 1UG1A 1TUCA 2YUQA 2RMOA 3IQLA 2YUNA 5FW9A 1VYUA 2DE0X 1E6GA 3EG2A 3JV3A 4CC3A 2D8JA 5IH2A 2RPNA 3EG1A 1YNZA 1GL5A 2ENMA 1X6BA 1QWEA 4GLMA 2G6FX 2V1RA 1WFWA 1OOTA 3EHQA 2LMJA 1GFDA 1T0HA 1IO6A 2A37A 2O9SA 4J9FA 1M3BA 2F2WA 2C0IA 3VS6A 3I35A 2BZXA 2FPEA 2L0AA 4RTWA 2EYZA 1G2BA 1UJ0A 2LQNA 2SRCA 2YUOA 1A0NB 1PKSA 1U06A 2K7AA 1XOVA 1I0CA 3I5SA 1WX6A 4AG1C 4JPBW 4JZ4A 1S1NA 2HDAA 1MV3A 2L3SA 4DEYA 1RUWA 2O2OA 3CQTA 2DJQA 1X43A 4QT7A 2YSQA 1YN8A 2NUZA 2YUPA 1AVZC 3UF4A 2FEIA 1UJYA 2OI3A 1UECA 2RN8A 4D8KA 2C0TA 2JTEA 2K3BA 2DNUA 4OMNA 2LNHB 1LCKA 1UGVA 2BZ8A 4ZNXA 1G83A 2W10A 1JXMA 2LJ1A 1CSKA 1PRMC 2AKLA 1WA7A 1BB9A 3M0TA 4GBQA 3VS4A 3NMZC 2HEQA 2XMFA 3VS7A 2K6DA 4JJBA 2FO0A 1RLPC 1AWOA 4HVWA 3PE0A 3M0UA 3TVTA 3SHWA 3C0CA 1KJWA 4DEXA 1W1FA 2X3XD 3H0HA 2J06A 2X3WD 1BK2A 3M0RA 3U23A 2M51A 1OPLA 1H3HA 1JEGA 1KSWA 1QKXA 2AKKA 3QWXX 2HSPA 3VS5A 1M8MA 2HBWA 1WXTA 1GCPA 1X2QA 1I1JA 2JS0A 2W0ZA 2LCSA 4X1VA 4CC7A 1WI7A 3ULRB 2GNCA 2ABLA 1YWPA 2J6KA 5IHKA 2EPDA 2DL5A 1YWOA 2EVRA 2KT1A 4OMLA 2DL4A 4Z8AA 5I11A 2GGRA 1WDXA 1FMKA 2MCNA 2DL7A 2J05A 2HCKA 2ED1A 1PKTA 2KRNA 4HVUA 3LH5A 1KFZA 2CDTA 5ECAA 2DVJA 2JT4A 3O5ZA 1SRMA 3PVLA 1WXBA 1NG2A 1WXUA 1K76A 4LNPA 2AZSA 2KR3A 5GJWB 1X27A 1K0SA 4IIMA 1PRLC 2VVKA 2KE9A 3R6NA 2A36A 1OEBA 5IXBA 2IIMA 3VRZA 4LUDA 4ORZA 2EGEA 1ABQA 3ZL7C 1CKAA 2J7IA 1UTIA 2GBQA 1WYXA 2KXCA 1B3QA 1K1ZA 2QDLA 2D0NA 1M30A 2FPFA 1Z9ZA 5IHNA 3NHNA 1JXOA 1Z9QA 1I07A 2DL8A 4RTUA 1SHGA 1SRLA 2CH4W 1NM7A 3EG3A 2KNBB 3FJ5A 2D8HA 1E6HA 3I5RA 2RNAA 3VS1A 4AFUC 1SSHA 3KFVA 2F2XA 3NGPA 4F14A 1W70A 2CUDA 1K0XA 3EGUA 4RTZA 4AFZC 1ZX6A 1J3TA 2C0OA 1ABOA 3UA7A 3GBQA 1QCFA 2KYMA 1K9AA 2JW4A 4IIOA 3QWYA 2KRSA 2O31A 4F16A 1E7OA 2B86A 2DM1A 2H8HA 4JJDA 2DYBA 1SPKA 1JO8A 2RQTA 2KROA 4R0KA 2DILA 1ZSGA 1AWWA 4HXJA 5FWCA 1Y0MA 1OV3A 2OAWA 1NYFA 3H0FA 3I9QA 2YDLA 4E6RA 2CH4A 3TSWA 1PWTA 5I22A 2CREA 1W6XA 2A28A 4RTYA 1NLPC 4RTXA 5IHIA 2PTKA 3UATA 2DRMA 2GTJA 3VRYA 2L2PA 4CC4B 4J9CA 4OMMA 1AEYA 1RI9A 2RQUA 2RQRA 4J9HA 1ZLMA 1T3LA 2FPDA 1M3CA 2ESWA 2JXBA 3RBBB 4RTTA 1QWFA 1MUZA 2JM9A 1N5ZA 1AD5A 4F17A 3THKA 1HJDA 4EIKA 2KEAA 1UHCA 1ZUYA 1PHTA 2EQIA 4Z88A 3REBB 2KGTA 4AFSC 4AFQC 5IXFA 2LZ6B 1BBZA 2LQWA 1U5SA 2KT8A 1WIEA 5L23A 2JM8A 2JS2A 2KBTA 4RUGA 2K9GA 4JJCA 2OJ2A 1VYVA 4Y92A 4LE9A 2ROTA 1HD3A 2K2MA 2DBMA 2EYYA 2GTOA 4J9EA 2M0YA 2RQVA 4AG2C 2BTTA 2CT3A 2SEMA 5FWBA 2FG0A 4K11A 3PVQA 1BU1A 1NEBA 2EW3A 1UFFA 3EHRA 1WLPB 4D8DA 4LUEA 1V1CA 1X69A 2AZVA 4HVVA 1UDLA 2FRYA 2BZYA 3A98A 4HCKA 3TSZA 1FYNA 2CSQA 3NPFA 5EC7A 1U3OA 3H0IA 1GCQA 4Z89A 2MIOA 2ECZA 3VS2A 1GFCA 2DX1A 2KRMA 4CC2A 1ZBJA 2J6FA 1OPKA 1EFNA 1SHFA 2JMAA 1UE9A 3RNJA 2CUBA 1YCSB 1M27C 4J9GA 1VYTA 2FRWA 3M0SA 1AWJA 2J6OA 2LP5A 1TG0A 2CSIA 2EYXA 2LJ3A 2EGCA 1UUEA 1X6GA 1SEMA 2KXDA 4OMQA 4RTVA 3H41A 3SEMA 1K4US 2L3PA 4ESRA 1GRIA 2AK5A 2I0NA 1JU5C 2ED0A 3M0QA 1AZEA 1KIKA 2VKNA 2DLPA 2PNIA 5GJVB
chains in the Genus database with same CATH superfamily
4DA4A 1VA7A 2DPPB 3CCSA 4Q5WA 4LD9K 1QVFA 4C8QA 2EBPA 4A53A 2Y4XA 5HCKA 3HKSA 4IUVA 1ZUUA 3REAB 2VASA 2QQBA 2D9TA 1WNLA 1YIJT 5C0MA 2RO0A 4IUTA 1VIFA 2DD5A 4QQGA 4GY5A 1AOJA 4WTOB 4WCIA 2DIQA 4LDXA 3VS3A 1RACB 1NYGA 3OYCA 1GBRA 2QA4T 1M9SA 3GLXA 1IXDA 1H8KA 1MNDA 1GCQC 4OB0B 3CCUA 5KYWB 4M78F 4BDYA 3CCST 2HNIA 2O88A 4J9DA 2KK4A 2NLUA 4F04B 1Q82R 2F1LA 2F2VA 4J9BA 5GAOm 2GQIA 1HSQA 2O4XA 4EDUA 1TH7A 2JMCA 1NLOC 4O5VA 1VQ5T 3FRNA 4B9XA 2RQWA 3VU3C 2PU9B 3RIRA 2R57A 3TREA 2P4RA 4M78C 1H3ZA 1YFNA 2EKHA 2QAZA 3EGXA 2YT6A 3CXCA 2ROLA 4XTWA 2DL3A 4XTZA 4C92E 4M4ZA 2FZCB 1TUCA 1N6AA 3CCUT 4C92B 4PJJA 2YLCA 3IQLA 4DBQA 5FW9A 1VQNA 2K3YA 4UC4A 5CKEA 3MJXA 2BUDA 1VQLQ 2RPNA 3EG1A 1Q7YR 5AT1B 2RJFA 2DXUA 3H8ZA 2G6FX 2KMTA 5GANd 3GPLA 1VQ4Q 2JTMA 1B34B 1T0HA 3PTAA 1MMNA 4QW2A 4J9FA 4X9DA 2FPEA 3VYHB 2L0AA 5HK3A 4RTWA 1G2BA 1K8AC 2KI7A 2LQNA 1VQ8T 1A0NB 3JCMg 1UB4A 3KBGA 1U1TA 4R56A 4BE2A 2K7AA 1VQNT 1VQ7A 4AG1C 3RMQA 1VQ6Q 5GAN3 4OB3B 4JPBW 4JUVA 4C8QG 1RUWA 1XJWB 2EJGA 3OB9A 2H3JA 2QQSA 2Z0WA 2GF7A 1X43A 5CO7A 1BI1A 2YUPA 2QGFB 3UF4A 3I55A 3VJPA 2GQVA 5CCAA 4J7IA 4M7DC 3HTRA 4KUDK 3QBYA 4OB2B 4C0DB 2C0TA 4ZTFA 1LPLA 3MPUB 3CD6Q 2LNHB 2VXFA 4FT2A 4BY6C 1BCMA 4LDUA 3G4SA 1SSFA 4Y91A 3MP1A 4EMHA 3CBOA 3NMZC 5CKDA 4J83A 3JCMe 2G3RA 3OYLA 4FYXB 3VS7A 4JLIA 5GAOq 1VQMQ 1G5VA 2FO0A 3G6EQ 1K73C 1AWOA 3GNGA 3PE0A 5GMKh 3MEVA 3OA6A 1KJWA 3I55T 1RL2A 3H0HA 1OX9A 3U23A 5GANh 3RMSA 2M51A 3QHSA 2CKKA 5KYXB 1JEGA 5IT9E 1QKXA 2K5IA 3UWNA 4M7AA 1VQKQ 1TXQA 3QPHA 1KQSA 2HSEB 3V7SA 1GCPA 2AHJB 1X2QA 2JS0A 2W0ZA 5CQXA 3CCLQ 4CC7A 5LL6S 1WI7A 4E7KA 4N4IA 2GNCA 4M7DA 2J6KA 2ZGWA 2EPDA 1RAGB 4F7UA 4N4HA 1YWOA 2KT1A 4BDZA 3EH1A 3ASKA 5LJ5g 4R55A 2GGRA 1WDXA 2MCNA 2YLBA 5KH6A 2J05A 5GMKj 4IKFA 2A7YA 2CDTA 5ECAA 2PUKB 4IUUA 3O5ZA 3FIFA 3PVLA 2QASA 1NG2A 4LNPA 3A8LB 1R8OB 1QVFS 4IIMA 3J80E 2R58A 3CC2Q 5CIUA 2MF2A 2PVOB 1O75A 4XQ3A 3CCEQ 2X4JA 4AMCA 4KH1B 2X35A 3M4YA 5LJ5h 2DZCA 1VQLA 1Q86R 4M78G 4V2SA 1ABQA 1CKAA 3OS5A 1UTIA 1KG1A 1EX4A 4C0FA 2E65A 1YCYA 1WYXA 5LJ3h 2Y90A 4XTYA 1K9MC 2YRDA 1KC8R 5GAMg 1Z9ZA 2QTVA 4C92C 5GANf 1Z9QA 5CQYA 2CH4W 2OTJA 3FJ5A 1E6HA 1IGQA 2RNAA 3JCMX 5A0DA 3KFVA 1W70A 2NUPA 2CUDA 1K0XA 1J3TA 1RADB 4N0AC 2C0OA 5DY9A 2JZ2A 2DVEA 4IIOA 3OW2A 3JSCA 1VQLT 2B86A 2DM1A 5LJ5j 1WZOA 2R5MA 1VOMA 3X26B 3L2VA 3HFNA 1ZA2B 3QKJA 2KROA 1VQ4T 3CMAQ 4HXJA 4RG2A 2X4WA 4PFPA 3CXCS 4J5YA 3WXMB 3H0FA 2VYTA 4E6RA 2OTJT 1YI2Q 2CP6A 3QIIA 8ATCB 2QG9B 2A28A 3OY9A 1VQPQ 3CC7Q 1NLPC 5IHIA 4LXCA 1K8AU 2GTJA 1I4K1 2R5AA 4C92A 3JCMW 2LC4A 4J9CA 2RQRA 3OYYA 1VQ6T 3OSSC 4C8QE 2FPDA 2ESWA 2QGGA 1D09B 2CS7A 2JJ9A 3RKXA 1MUZA 3P8DA 4C8QB 2LNVA 1MGQA 5GAMj 1I5OB 3GIBA 3LWHA 3LYIA 4C0DC 4F7UG 4CI0C 3QDFA 4EIKA 1G8XA 1Q86C 3L2RA 4M7AD 2JN0A 3A5ZB 1UGSB 4Z88A 3REBB 5IXFA 1Y96A 1BBZA 1U5SA 2EIFA 1S72A 2KT8A 1WIEA 2EQJA 2RM4A 4M7DD 2JVVA 1C0MA 3OMCA 4LE9A 2ROTA 4J9EA 2YHTA 3OYMA 3ZEHA 1VQOA 2O4XB 3RKYA 5FWBA 4FSXA 2FG0A 3CPWS 1GXIE 1VQMT 2E3IA 4JRIA 4PLIA 3G6ET 1RAIB 2RHUA 1K73U 5GAN6 2K3XA 4FT4A 3BFMA 1UDLA 1P92A 2YWWA 5GMKl 1G3YA 1FYNA 3TCJA 4FYVB 1UGQB 1UGRB 3JCMc 1M1FA 3RDVA 1BIBA 3EGXB 4C5HA 5CK9A 2MIOA 3VS2A 4CC2A 4PK4A 2KRMA 1KHCA 3DB4A 1VQKT 2QXFA 1OZ2A 1SHFA 5D6YA 2FZKB 2JMAA 1YCSB 2QA4Q 3PMTA 1M27C 3CCLT 4J6WA 3CC2A 1VYTA 3LGFA 3QYHB 3SWNC 4DBRA 4PL6A 1AWJA 3CCSQ 2ZPIB 1RI0A 2EYXA 3CCQA 1D3BA 1EIFA 1UUEA 1X6GA 3X25B 1SEMA 4OMQA 3H41A 4OB1B 1K4US 1RAEB 3G1JA 3META 1AZEA 1KIKA 2DLPA 3C95A 1KQSS 1XNIA 2D1XA 1YHQA 1G3WA 3EG9A 4XK8E 4NL2A 4C5IA 1WHKA 3EG0A 1M2VA 3CC2T 3CCUQ 4C92G 3T9NA 2A08A 3PNWC 2HL5C 4RMOA 3CCQT 2RA2A 4IUQA 3OYHA 2DA9A 4BUGA 3GP8A 4JZ3A 3EFRA 2HQXA 3SWNA 2DRKA 4QVZA 4LN2A 3N5BB 3BDLA 3S3MA 3M0PA 5FROA 1YHQT 3JB9H 1AWXA 4PFZA 4PJLA 2EWNA 4KRTA 1IZ6A 4FSSA 4LD6A 2MOXA 3JAME 1GBQA 2DTIA 2RHXA 2WSEE 1VQNQ 1X2KA 2L3QA 2V8IA 3FC3A 4C8QF 2VB6A 4M77A 3CMAT 3VS0A 1X01A 2DD4A 3X28B 2LX7A 4A4FA 4PJOD 2PUOB 1W2BS 2DXBA 3QUIA 1UG1A 2QQRA 1M2OA 3GF5A 1YI2T 1VUBA 2XHCA 2RMOA 1N27A 1VQPT 3CC7T 4M7AE 4MDXA 2DE0X 2XKOC 2FYKA 1MHNA 4NOYA 4CC3A 1KD1R 2D8JA 4M7AB 5IH2A 1YNZA 2ENMA 3C4SA 1QWEA 4PJMA 2MK5A 1VQ7Q 4M7DE 1QW1A 2LMJA 1GFDA 4JRQA 1MNEA 4F7UE 4M7DB 2O9SA 4F7UB 1M3BA 4CRIA 4BY6B 3I35A 3C12A 4FW1A 2E64A 3INZA 2SRCA 1PKSA 1WHJA 2BKDN 2RHZA 1U06A 5I2SA 3I5SA 1YJ9A 1WX6A 1AHJB 2RJDA 4JZ4A 2HDAA 4XTVA 3L1AA 4DEYA 2EJFA 1M4ZA 3G4SQ 2RK1A 3L2QA 3CQTA 4QT7A 3V7RA 2NUZA 5FRMA 1LOJA 2GCXA 2RK2A 1N8RC 2OI3A 3G71A 2RN8A 1HK9A 3QDRB 3TU4K 2K3BA 1M1KR 3OYBA 1UGVA 2BZ8A 4ZNXA 2XIDA 5GAOl 2AKLA 4O6JA 2ZCFB 1BB9A 3M0TA 3VS4A 5DM7R 3OYNA 2NUPB 2HEQA 2XMFA 4JLGA 2JNGA 1HXDA 4E2FB 2H3EB 1OU8A 3HHTB 5D6XA 1D1AA 3TVTA 1YJWA 2LVMA 2X3XD 2ZPGB 4RCCA 1TU0B 4FL6A 5CKBA 1KSWA 4KGXB 3QWXX 2VXEA 3D7SB 2A0FB 2ZPBB 4DBHA 3JCMQ 4HT8A 1I1JA 2V8JA 2LCSA 1WHHA 2OTLA 2DAQA 4C5EA 2ABLA 3JCMd 3OMGA 3SB2A 5FU6B 2P0QA 5IHKA 4FCYA 2EVRA 4M77D 1M90C 1M5Q1 1YJWT 1NJIC 3BY7A 5L8RE 1PKTA 2EYQA 2KRNA 2P84A 4HVUA 3VKIA 3QSUA 2DVJA 3CCJQ 1PC0A 5A2QE 5GAOp 4A4KA 1K76A 3E19A 3OS1A 2AZSA 2KR3A 5GJWB 1PRLC 4RG8A 4PJOE 2KE9A 2OTJQ 2A36A 4XAXB 4LUDA 1Y96B 4ORZA 1M1KC 4PJOB 2EGEA 3X24B 3ZL7C 2LTOA 4LDYA 3MEWA 2P0PA 1K1ZA 3A8OB 3UPUA 4M7DF 1JJ2A 2FPFA 3MEUA 3JB9D 5IHNA 4BI4A 1I07A 4F7UF 3CC4A 1SRLA 1KQ2A 5GAN5 2V26A 1SSHA 2F2XA 3NGPA 1Q82C 1YITA 4M7AC 2LCLA 2EQUA 3HRTA 1ABOA 3M58A 2XD0A 2GFAA 3QWYA 4P5NA 4F16A 4XU1A 1LVKA 2RH2A 1BI0A 1TS9A 1AT1B 4MZPA 3MEAA 1VQ7T 2QI2A 5GANg 3TQ7P 1Y0MA 1C6VX 1OV3A 2OAWA 1NYFA 3S3OA 4MMLA 3OYKA 3CC4T 2QK0A 1D3BB 1WJQA 4X34A 5GMKi 2CH4A 1D0ZA 5HK0A 4M75A 1TTHB 2KDSA 4WF2A 2KY9A 2QYZA 4RTXA 2PTKA 5DLOA 4KH0B 3UATA 5KYYA 4E47A 1Q7YC 1XQHA 2L2PA 1QVGA 1OULA 4OMMA 4QQ6A 3G7ZA 3P8HA 3EG9B 3RBBB 2F5TX 4RTTA 3CMEA 1S72Q 1QWFA 3BW1A 2MPXC 1M2VB 3CBMA 3G4ST 2MWPA 3P8BB 1OU9A 1AD5A 3OYAA 4FM4B 1I8FA 3THKA 1HJDA 1ZBXA 4XU0A 6AT1B 2VGMA 5GMKe 2K5FA 1VQOQ 2EQIA 3VUBA 3A1PA 5D7UA 2KGTA 4AFSC 4PNOA 1UEBA 3M4GA 1N8RU 2L5QA 2RJEA 5GAMd 4OGEA 2ATCB 3SWNB 2JS2A 3MCAB 4YTLA 1HYOA 1QP3A 2LT4A 2OJ2A 4Y92A 5LJ3g 2GTOA 5GAOn 2AIRB 4AG2C 3CMET 2BTTA 1NPPA 5GANj 2CT3A 1KHIA 3F70A 4C92F 1JRIA 4K11A 1BU1A 2DXCA 3HPWA 3JCMf 3L42A 3O8VA 1X69A 4HVVA 5J3BA 4M77E 3OYEA 3WVEB 3CCQQ 4J6XA 1VQ9A 4II1A 1V76A 3H0IA 4M77B 5GAN8 2ECZA 3CCJA 1GFCA 2DX1A 1RAHB 1ZBJA 5FU6C 2KAFA 4QVCA 3RNJA 4J9GA 3HFOA 1V29B 5IN1A 5LJ5e 3QXEB 1YHQQ 2CSIA 4OF1A 2LJ3A 3H6ZA 3I56A 1QVFP 3QG1A 3RR6A 4RTVA 3QYGB 1Q81R 3LLRA 1M90U 2DYIA 2I0NA 4L5GA 3MKDA 2CP3A 2ED0A 3Q1JA 1VQ9T 2PNIA 1NJIU 2DF6A 3CCRA 3OS0A 3CCJT 2RF0A 5I21A 4PJOC 3HL8A 1QCOA 2QEXA 2RHIA 1RLQC 2ZPFB 5LJ3j 2VWFA 4BE0A 2I2LA 3QZ5B 5D6WA 2WSFE 1KK7A 4MMKA 3EGDB 5GAMe 2E5KA 3M9QA 4QQDA 3I56T 2O9VA 2DMOA 3CBPA 1BKBA 4OMPA 2OAUA 1PNJA 4M7AG 2X4XA 1U1SA 4FYYB 5A0GA 2LJ0A 4M75D 4DOWA 1OI1A 4MZMA 3M55A 1D0XA 5J39A 3CCRT 1D1BA 4A63B 2MI6A 4ANJA 2HAXA 5GAN2 4M7DG 3URGA 4IURA 2XDDA 4ELZC 2QEXT 4NL3A 2V1QA 2P4TA 4HT9A 1Q82U 5CR2A 1QKWA 3CXCP 3M53A 1YJNA 2EQMA 1TUDA 4TVRA 2CT4A 1M3AA 2RHYA 1Y57A 2ZZDA 3ZFJA 2E70A 1KC8C 5I2MA 1B07A 1JJ2S 3UA6A 4PJOA 1QLYA 1ARKA 2KYBA 1H92A 1T0JA 4E7HA 3TEEA 1NEGA 2E6NA 4J6YA 3AHUA 2PVGB 3M59A 2YUQA 2YUNA 3E9GA 1VYUA 1E6GA 3EG2A 3JV3A 3NTIA 3OQ5A 1IHVA 5GAMf 1GL5A 1Q7YU 1YJ9Q 2MWOA 2LQ8A 3EHQA 3JCMV 1S72T 2A37A 2KSSA 1KQ1A 3R6OA 2E41A 2C0IA 3VS6A 3DKMA 1OZ3A 1I81A 1VQOT 1UJ0A 1PD1A 2IPOB 3MP6A 5CKFA 2KVQG 2V8KA 4M77F 3CPWP 1QVPA 1IB8A 4HA8A 1QVGS 2K4YA 3SDZA 3G71Q 2DTHA 2X4YA 2CZ6B 4BD3A 2HD0A 1S1NA 2EFIA 1MV3A 2L3SA 4VUBA 3WVDB 1WPYA 5C6SA 2X9HA 2DJQA 2FL7A 3J7AF 3M54A 3SD4A 2YSQA 2ZPEB 4M77C 1G3SA 2FEIA 4HCCA 1UJYA 2CYZB 2XG8D 1PSFA 4OMNA 1YJWQ 3MHXA 1G83A 1JXMA 3PIOA 1EZZB 1K9MU 5M9OA 2YRCA 4OMFB 2YRVA 4A4GA 1KQSP 5HY6A 4L6V5 4HVWA 2OTLQ 2RI3A 3M0UA 1OYXA 3C0CA 1W1FA 3DB3A 4PJOG 3RESA 2J06A 2X3WD 2C06A 3CCVA 3EFSA 1OPLA 4LDWA 1H3HA 5KCOA 3L2UA 2IVWA 5CKHA 2AKKA 2PVDB 5FU7B 4M75E 1M8MA 4BACA 4X1VA 2DFUA 4M75B 2DETA 4BI8B 2M02A 2LT1A 4PFOA 4XU2A 4L59A 5KYYB 4E7JA 2LCCA 2DL5A 2COWA 3OBYA 4Z8AA 5I11A 3OW2S 1FMKA 3FEOA 3CCVT 3VYGA 1BCOA 1KFZA 2QDYB 2JT4A 1SRMA 1WXBA 4EMKB 1K0SA 1X27A 2B8AA 3JCMJ 1NZ9A 2CZ7B 3CC4Q 2VVKA 3R6NA 1OEBA 2IIMA 3OSVA 3VRZA 3FJPA 3GNFB 1YITQ 1FMVA 1Q86U 3A8HB 1W2BP 2J7IA 1D1CA 2GBQA 1N9SA 3EGDA 1B3QA 5J26A 1WHLA 3S3NA 2QDLA 1KC8U 1G3TA 3NHNA 1JXOA 2P0KA 1BI2A 3H9NA 1SHGA 2E4HA 1QCNA 1NM7A 3EG3A 2KNBB 3LH0A 2CGHA 4AFUC 4F14A 2ZAEA 1NE8A 4BI3A 1WHMA 1YIJA 4RCBA 3EGUA 4AFZC 1ZX6A 1BI3A 5KYUA 2KYMA 2BE9B 4C0GA 2A3LA 4MZTA 3UT1A 5GAN4 1PM3A 3MP8A 1FXXA 2XI9A 2DZ9A 4JJDA 1ZSZC 1YJ9T 1SPKA 1JO8A 2BE7D 4IUPA 1W4SA 3CCMA 2DILA 4N4GA 2M9UA 3QJYA 4JJNK 3PMIA 1PSEA 1R0CB 3J81E 1X75C 2YDLA 3CMEQ 1PWTA 4ATOA 1YBYA 4J8OA 1VQ5A 2HQHA 1KD1C 5CVIA 3LGLA 1K8AR 3VRYA 3BDUA 4DQ2A 1TWBA 3G71T 1T3LA 4M77G 2JXBA 4A4EA 1LJOA 4J7FA 5KCHA 3OYGA 1X6OA 5IAYA 2DEUA 3CCMT 5KE2A 4F17A 3OYDA 3OYIA 3V7CA 4FIBA 2CP0A 4DOVA 4C5GA 2JOYA 1PHTA 4A4HA 2FVUA 2DEQA 2KQWA 2RI2A 4FU6A 2LZ6B 1ZSZA 2LQWA 4JS5A 4OVAA 1H641 2K2VA 4NS5A 4JJCA 3KUFA 4M75F 2CP5A 2XDBA 1VQ9Q 1VYVA 2M16A 1HD3A 3C94A 2K2MA 1NBEB 2DBMA 2EYYA 2XDPA 4KBMB 4PLLA 4RKUE 2SEMA 1VQ8A 1QQJA 3JB9G 3PVQA 2EQKA 2EW3A 2VV5A 1UFFA 7AT1B 2OTLT 3E2UA 1K73R 4D8DA 4HKEA 4LUEA 5FU7C 4M7AF 2FRYA 3DLLA 3QZ9B 2F69A 2CSQA 4EPCA 4ELYC 5EC7A 1OQKA 4M75C 5GAN7 3I56Q 4KGZB 1GCQA 1M8VA 2RB6A 5CAIA 2J6FA 1OPKA 1EFNA 1UE9A 2CUBA 3RERA 1VIEA 3JB9I 3V8KA 4FW2A 2L89A 1MMGA 3CCRQ 1N9RA 2FRWA 2XU8A 3M0SA 3PIPA 2QEXQ 1B7TA 2LP5A 1TG0A 2HMAA 4E7ZA 2EGCA 2KXDA 4JRKA 3SEMA 4M78A 1GRIA 4ZN3A 4EMKC 1JU5C 3S6WA 2VKNA 4XU3A 1RAFB 5KYNA 4OGCA 2WACA 1SKUB 1U8RA 3CPWA 2FHDA 2LDMA 3JCMh 1Q95G 3ER0A 2E3HA 4OMOA 4GLKA 1YITT 5LJ5d 1QMCA 2YXYA 3DLMA 1CKBA 1ZQ1A 1PG5B 1SF9A 4JDSA 4C8QD 4Y28E 1YJNQ 1LNXA 5LJ3d 2XK0A 1K9MR 4BB7A 1JB0E 1JBMA 4B6MA 2VC8A 1ZUKA 2NWMA 2E5QA 1YP5A 4ZGJB 2CZ1B 2COYA 1JQQA 4ZGDB 2PZ1A 4EMKA 2DBKA 4J9IA 4QVDA 1QP2A 1MV0B 2JTFA 5GANe 1UHFA 2EGAA 2LQKA 1WQWA 2CP7A 2VUBA 2EYWA 1AZGB 2E1HA 2PQWA 2NUTB 3OYFA 2QTXA 2K79A 1T3SA 5GAOr 3VV0A 2WSCE 3NTHA 3EFOA 1KD1U 2COZA 3UDCA 2Y4YA 2DXTA 3E9FA 1X6BA 4GLMA 2HKQB 2V1RA 1WFWA 1OOTA 2LRQA 2E6ZA 4KUIA 5DLQE 4B9WA 1IO6A 1DJ7B 3PT9A 1NPRA 2F2WA 4MDWA 2BZXA 4PJOF 2K57A 2EYZA 2YUOA 2XICA 1XOVA 1I0CA 1WQ7A 3EAEA 1TSFA 4LDVA 1VQ4A 5LJ3e 3EH2A 1OX8A 3JB9J 2F5KA 3M57A 1C1AA 4Z02A 4X9CA 3RUXA 3X20B 2O2OA 1M1GA 4M78D 1W2BA 1BIAA 4KGVB 2D6FA 4M75G 3CPFA 1YN8A 2AT1B 5KE3A 1AVZC 5KYWA 2EJ9A 3FB9A 4ZGEB 1MMAA 1VQ6A 3HSBA 1UECA 4A54A 3OBWA 4D8KA 5GAMh 3L2WA 2D0QB 2JTEA 2FZGB 2DNUA 4OP0A 1Y7XA 1M1KU 1LCKA 4D6WA 4C0ZA 3CCVQ 2W10A 1CSKA 1PRMC 1R0BG 2LJ1A 1WA7A 4GBQA 5EG2A 1I5LA 3GOXA 3FLGA 3OYJA 2K6DA 5KYUB 4JJBA 3HP9A 1WHGA 3HRSA 1RLPC 1ZA1B 3SHWA 3CD6A 3ZBDA 4DEXA 5LJ5f 4PKCC 1TUGB 1BK2A 3M0RA 5FLXE 2HKNA 3V8JA 4BE1A 3RKWA 3KXTA 5LJ3f 2HSPA 3VS5A 3PGGA 4E7IA 4XTUA 2HBWA 3MO8A 1VQMA 1WXTA 4N0AA 2VGNA 3G6EA 2ZPHB 3ULRB 2MAMA 2MMPA 1B34A 1YWPA 1Q81C 4OMLA 1IRXA 2LX9A 3VUZA 2E10A 3SFMA 2DL4A 3CD6T 1VQKA 1F1BB 3AT1B 2DL7A 1YJNT 2HCKA 1ZHIA 2ED1A 1WJRA 3CCLA 3LH5A 2K5LA 2EKOA 2CZ0B 1WXUA 1IGUA 1MMDA 1JJ2P 1TOVA 3M56A 5IXBA 3A8MB 2DK3A 4ZTJA 1ZSZB 2JUFA 2NYSA 4EMGA 1Y71A 2E12A 1YIJQ 1BYMA 3A8GB 2KXCA 2OX7A 2D0NA 1M30A 2DL8A 4RTUA 3E1SA 2D8HA 5GMKm 3CCEA 3I5RA 3VS1A 3CCMQ 2QQ9A 2L3RA 2X51A 2DERA 4HCBA 1PD0A 4RTZA 5AYFA 3UA7A 3GBQA 1QCFA 1K9AA 4ME7A 2JW4A 1VQ5Q 1Y07A 2KRSA 2O31A 1E7OA 2H8HA 2DO3A 5HKCA 1D0YA 2DYBA 3QJ6A 2O01E 3NFCA 4KULA 4XTXA 2RQTA 4R0KA 4E7LA 1ZSGA 1AWWA 5FWCA 5KYXA 4HCZA 1QVGP 3JB9F 2DTOA 2HBPA 3QO3A 3I9QA 1RAAB 4FYWB 4M78E 3TSWA 3CCET 5I22A 2NUTA 1WGSA 2CREA 2QQAA 1W6XA 5A0LA 4M78B 4RTYA 4AT1B 2DIGA 3LX7A 3M5AA 2DRMA 1UGPB 1RABB 3NTKA 9ATCB 4CC4B 3CMAA 1AEYA 1RI9A 2RQUA 2M0OA 4J9HA 1ZLMA 1M3CA 1ACMB 2EAYA 2JM9A 1YI2A 4C92D 2MYSA 2HZYA 1N5ZA 1R77A 3CC7A 1FMWA 1VQPA 2DKGA 3JCMP 4QKUA 2KEAA 1UHCA 1VQ8Q 3BE3A 1ZUYA 1IREB 1PCXA 4AFQC 1N8RR 1SG5A 2CP2A 5L23A 2JM8A 4ZN1A 1FWZA 2KBTA 2RI5A 4RUGA 2K9GA 2RJCA 2GFUA 3ME9A 3LWIA 3OS2A 2M0YA 2RD1A 2RQVA 4JRPA 2HQEA 1NEBA 3FDRA 4KT0E 3V8LA 3EHRA 1WJSA 1WLPB 4C8QC 1V1CA 2AZVA 3TSZA 3A98A 2BZYA 4HCKA 1XTDA 3CEYA 4DBFA 3NPFA 1U3OA 4E7SA 8AT1B 4Z89A 3PFSA 4PJNA 2FB7A 2HL3A 2DJZA 2IG0A 3OW2P 2L8DA 1O9SA 5FRNA 3EFOB 3HRUA 3LW5E 2J6OA 4JS4A 3L2ZA 3JRZA 2BIVA 3I55Q 2M1HA 1FX7A 1Q81U 2L3PA 4ESRA 1M90R 2AK5A 3M0QA 3JCMb 1IHWA 2QA4A 5GJVB 1NJIR
chains in the Genus database with same CATH topology
2DF6A 2RF0A 1VA7A 2D1XA 1RLQC 2VWFA 2EBPA 3EG0A 5HCKA 1ZUUA 4OMOA 3REAB 2A08A 1CKBA 2E5KA 2O9VA 2DA9A 2DMOA 4OMPA 1PNJA 2LJ0A 1AOJA 4WCIA 3VS3A 4JZ3A 1NYGA 1GBRA 2DRKA 4LN2A 1H8KA 1GCQC 1ZUKA 2NWMA 4A63B 1YP5A 3M0PA 2O88A 2V1QA 4J9DA 1AWXA 2F2VA 4J9BA 2GQIA 1JQQA 1HSQA 1QKWA 2PZ1A 4KRTA 4FSSA 1TUDA 2MOXA 2JMCA 1NLOC 1M3AA 2CT4A 1GBQA 2DBKA 1Y57A 2RQWA 4J9IA 1MV0B 1X2KA 2L3QA 1B07A 1UHFA 2EGAA 3UA6A 1QLYA 2P4RA 1ARKA 2EYWA 2KYBA 1H92A 1T0JA 1AZGB 3VS0A 2EKHA 2K79A 1NEGA 2LX7A 2YT6A 2ROLA 2DL3A 4M4ZA 1T3SA 1UG1A 1TUCA 2YUQA 2RMOA 3IQLA 2YUNA 5FW9A 1VYUA 2DE0X 1E6GA 3EG2A 3JV3A 4CC3A 2D8JA 5IH2A 2RPNA 3EG1A 1YNZA 1GL5A 2ENMA 1X6BA 1QWEA 4GLMA 2G6FX 2V1RA 1WFWA 1OOTA 3EHQA 2LMJA 1GFDA 1T0HA 1IO6A 2A37A 2O9SA 4J9FA 1M3BA 2F2WA 2C0IA 3VS6A 3I35A 2BZXA 2FPEA 2L0AA 4RTWA 2EYZA 1G2BA 1UJ0A 2LQNA 2SRCA 2YUOA 1A0NB 1PKSA 1U06A 2K7AA 1XOVA 1I0CA 3I5SA 1WX6A 4AG1C 4JPBW 4JZ4A 1S1NA 2HDAA 1MV3A 2L3SA 4DEYA 1RUWA 2O2OA 3CQTA 2DJQA 1X43A 4QT7A 2YSQA 1YN8A 2NUZA 2YUPA 1AVZC 3UF4A 2FEIA 1UJYA 2OI3A 1UECA 2RN8A 4D8KA 2C0TA 2JTEA 2K3BA 2DNUA 4OMNA 2LNHB 1LCKA 1UGVA 2BZ8A 4ZNXA 1G83A 2W10A 1JXMA 2LJ1A 1CSKA 1PRMC 2AKLA 1WA7A 1BB9A 3M0TA 4GBQA 3VS4A 3NMZC 2HEQA 2XMFA 3VS7A 2K6DA 4JJBA 2FO0A 1RLPC 1AWOA 4HVWA 3PE0A 3M0UA 3TVTA 3SHWA 3C0CA 1KJWA 4DEXA 1W1FA 2X3XD 3H0HA 2J06A 2X3WD 1BK2A 3M0RA 3U23A 2M51A 1OPLA 1H3HA 1JEGA 1KSWA 1QKXA 2AKKA 3QWXX 2HSPA 3VS5A 1M8MA 2HBWA 1WXTA 1GCPA 1X2QA 1I1JA 2JS0A 2W0ZA 2LCSA 4X1VA 4CC7A 1WI7A 3ULRB 2GNCA 2ABLA 1YWPA 2J6KA 5IHKA 2EPDA 2DL5A 1YWOA 2EVRA 2KT1A 4OMLA 2DL4A 4Z8AA 5I11A 2GGRA 1WDXA 1FMKA 2MCNA 2DL7A 2J05A 2HCKA 2ED1A 1PKTA 2KRNA 4HVUA 3LH5A 1KFZA 2CDTA 5ECAA 2DVJA 2JT4A 3O5ZA 1SRMA 3PVLA 1WXBA 1NG2A 1WXUA 1K76A 4LNPA 2AZSA 2KR3A 5GJWB 1X27A 1K0SA 4IIMA 1PRLC 2VVKA 2KE9A 3R6NA 2A36A 1OEBA 5IXBA 2IIMA 3VRZA 4LUDA 4ORZA 2EGEA 1ABQA 3ZL7C 1CKAA 2J7IA 1UTIA 2GBQA 1WYXA 2KXCA 1B3QA 1K1ZA 2QDLA 2D0NA 1M30A 2FPFA 1Z9ZA 5IHNA 3NHNA 1JXOA 1Z9QA 1I07A 2DL8A 4RTUA 1SHGA 1SRLA 2CH4W 1NM7A 3EG3A 2KNBB 3FJ5A 2D8HA 1E6HA 3I5RA 2RNAA 3VS1A 4AFUC 1SSHA 3KFVA 2F2XA 3NGPA 4F14A 1W70A 2CUDA 1K0XA 3EGUA 4RTZA 4AFZC 1ZX6A 1J3TA 2C0OA 1ABOA 3UA7A 3GBQA 1QCFA 2KYMA 1K9AA 2JW4A 4IIOA 3QWYA 2KRSA 2O31A 4F16A 1E7OA 2B86A 2DM1A 2H8HA 4JJDA 2DYBA 1SPKA 1JO8A 2RQTA 2KROA 4R0KA 2DILA 1ZSGA 1AWWA 4HXJA 5FWCA 1Y0MA 1OV3A 2OAWA 1NYFA 3H0FA 3I9QA 2YDLA 4E6RA 2CH4A 3TSWA 1PWTA 5I22A 2CREA 1W6XA 2A28A 4RTYA 1NLPC 4RTXA 5IHIA 2PTKA 3UATA 2DRMA 2GTJA 3VRYA 2L2PA 4CC4B 4J9CA 4OMMA 1AEYA 1RI9A 2RQUA 2RQRA 4J9HA 1ZLMA 1T3LA 2FPDA 1M3CA 2ESWA 2JXBA 3RBBB 4RTTA 1QWFA 1MUZA 2JM9A 1N5ZA 1AD5A 4F17A 3THKA 1HJDA 4EIKA 2KEAA 1UHCA 1ZUYA 1PHTA 2EQIA 4Z88A 3REBB 2KGTA 4AFSC 4AFQC 5IXFA 2LZ6B 1BBZA 2LQWA 1U5SA 2KT8A 1WIEA 5L23A 2JM8A 2JS2A 2KBTA 4RUGA 2K9GA 4JJCA 2OJ2A 1VYVA 4Y92A 4LE9A 2ROTA 1HD3A 2K2MA 2DBMA 2EYYA 2GTOA 4J9EA 2M0YA 2RQVA 4AG2C 2BTTA 2CT3A 2SEMA 5FWBA 2FG0A 4K11A 3PVQA 1BU1A 1NEBA 2EW3A 1UFFA 3EHRA 1WLPB 4D8DA 4LUEA 1V1CA 1X69A 2AZVA 4HVVA 1UDLA 2FRYA 2BZYA 3A98A 4HCKA 3TSZA 1FYNA 2CSQA 3NPFA 5EC7A 1U3OA 3H0IA 1GCQA 4Z89A 2MIOA 2ECZA 3VS2A 1GFCA 2DX1A 2KRMA 4CC2A 1ZBJA 2J6FA 1OPKA 1EFNA 1SHFA 2JMAA 1UE9A 3RNJA 2CUBA 1YCSB 1M27C 4J9GA 1VYTA 2FRWA 3M0SA 1AWJA 2J6OA 2LP5A 1TG0A 2CSIA 2EYXA 2LJ3A 2EGCA 1UUEA 1X6GA 1SEMA 2KXDA 4OMQA 4RTVA 3H41A 3SEMA 1K4US 2L3PA 4ESRA 1GRIA 2AK5A 2I0NA 1JU5C 2ED0A 3M0QA 1AZEA 1KIKA 2VKNA 2DLPA 2PNIA 5GJVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DF6 A;  2RF0 A;  1VA7 A;  2D1X A;  1RLQ C;  2VWF A;  2EBP A;  3EG0 A;  5HCK A;  1ZUU A;  4OMO A;  3REA B;  2A08 A;  1CKB A;  2E5K A;  2O9V A;  2DA9 A;  2DMO A;  4OMP A;  1PNJ A;  2LJ0 A;  1AOJ A;  4WCI A;  3VS3 A;  4JZ3 A;  1NYG A;  1GBR A;  2DRK A;  4LN2 A;  1H8K A;  1GCQ C;  1ZUK A;  2NWM A;  4A63 B;  1YP5 A;  3M0P A;  2O88 A;  2V1Q A;  4J9D A;  1AWX A;  2F2V A;  4J9B A;  2GQI A;  1JQQ A;  1HSQ A;  1QKW A;  2PZ1 A;  4KRT A;  4FSS A;  1TUD A;  2MOX A;  2JMC A;  1NLO C;  1M3A A;  2CT4 A;  1GBQ A;  2DBK A;  1Y57 A;  2RQW A;  4J9I A;  1MV0 B;  1X2K A;  2L3Q A;  1B07 A;  1UHF A;  2EGA A;  3UA6 A;  1QLY A;  2P4R A;  1ARK A;  2EYW A;  2KYB A;  1H92 A;  1T0J A;  1AZG B;  3VS0 A;  2EKH A;  2K79 A;  1NEG A;  2LX7 A;  2YT6 A;  2ROL A;  2DL3 A;  4M4Z A;  1T3S A;  1UG1 A;  1TUC A;  2YUQ A;  2RMO A;  3IQL A;  2YUN A;  5FW9 A;  1VYU A;  2DE0 X;  1E6G A;  3EG2 A;  3JV3 A;  4CC3 A;  2D8J A;  5IH2 A;  2RPN A;  3EG1 A;  1YNZ A;  1GL5 A;  2ENM A;  1X6B A;  1QWE A;  4GLM A;  2G6F X;  2V1R A;  1WFW A;  1OOT A;  3EHQ A;  2LMJ A;  1GFD A;  1T0H A;  1IO6 A;  2A37 A;  2O9S A;  4J9F A;  1M3B A;  2F2W A;  2C0I A;  3VS6 A;  3I35 A;  2BZX A;  2FPE A;  2L0A A;  4RTW A;  2EYZ A;  1G2B A;  1UJ0 A;  2LQN A;  2SRC A;  2YUO A;  1A0N B;  1PKS A;  1U06 A;  2K7A A;  1XOV A;  1I0C A;  3I5S A;  1WX6 A;  4AG1 C;  4JPB W;  4JZ4 A;  1S1N A;  2HDA A;  1MV3 A;  2L3S A;  4DEY A;  1RUW A;  2O2O A;  3CQT A;  2DJQ A;  1X43 A;  4QT7 A;  2YSQ A;  1YN8 A;  2NUZ A;  2YUP A;  1AVZ C;  3UF4 A;  2FEI A;  1UJY A;  2OI3 A;  1UEC A;  2RN8 A;  4D8K A;  2C0T A;  2JTE A;  2K3B A;  2DNU A;  4OMN A;  2LNH B;  1LCK A;  1UGV A;  2BZ8 A;  4ZNX A;  1G83 A;  2W10 A;  1JXM A;  2LJ1 A;  1CSK A;  1PRM C;  2AKL A;  1WA7 A;  1BB9 A;  3M0T A;  4GBQ A;  3VS4 A;  3NMZ C;  2HEQ A;  2XMF A;  3VS7 A;  2K6D A;  4JJB A;  2FO0 A;  1RLP C;  1AWO A;  4HVW A;  3PE0 A;  3M0U A;  3TVT A;  3SHW A;  3C0C A;  1KJW A;  4DEX A;  1W1F A;  2X3X D;  3H0H A;  2J06 A;  2X3W D;  1BK2 A;  3M0R A;  3U23 A;  2M51 A;  1OPL A;  1H3H A;  1JEG A;  1KSW A;  1QKX A;  2AKK A;  3QWX X;  2HSP A;  3VS5 A;  1M8M A;  2HBW A;  1WXT A;  1GCP A;  1X2Q A;  1I1J A;  2JS0 A;  2W0Z A;  2LCS A;  4X1V A;  4CC7 A;  1WI7 A;  3ULR B;  2GNC A;  2ABL A;  1YWP A;  2J6K A;  5IHK A;  2EPD A;  2DL5 A;  1YWO A;  2EVR A;  2KT1 A;  4OML A;  2DL4 A;  4Z8A A;  5I11 A;  2GGR A;  1WDX A;  1FMK A;  2MCN A;  2DL7 A;  2J05 A;  2HCK A;  2ED1 A;  1PKT A;  2KRN A;  4HVU A;  3LH5 A;  1KFZ A;  2CDT A;  5ECA A;  2DVJ A;  2JT4 A;  3O5Z A;  1SRM A;  3PVL A;  1WXB A;  1NG2 A;  1WXU A;  1K76 A;  4LNP A;  2AZS A;  2KR3 A;  5GJW B;  1X27 A;  1K0S A;  4IIM A;  1PRL C;  2VVK A;  2KE9 A;  3R6N A;  2A36 A;  1OEB A;  5IXB A;  2IIM A;  3VRZ A;  4LUD A;  4ORZ A;  2EGE A;  1ABQ A;  3ZL7 C;  1CKA A;  2J7I A;  1UTI A;  2GBQ A;  1WYX A;  2KXC A;  1B3Q A;  1K1Z A;  2QDL A;  2D0N A;  1M30 A;  2FPF A;  1Z9Z A;  5IHN A;  3NHN A;  1JXO A;  1Z9Q A;  1I07 A;  2DL8 A;  4RTU A;  1SHG A;  1SRL A;  2CH4 W;  1NM7 A;  3EG3 A;  2KNB B;  3FJ5 A;  2D8H A;  1E6H A;  3I5R A;  2RNA A;  3VS1 A;  4AFU C;  1SSH A;  3KFV A;  2F2X A;  3NGP A;  4F14 A;  1W70 A;  2CUD A;  1K0X A;  3EGU A;  4RTZ A;  4AFZ C;  1ZX6 A;  1J3T A;  2C0O A;  1ABO A;  3UA7 A;  3GBQ A;  1QCF A;  2KYM A;  1K9A A;  2JW4 A;  4IIO A;  3QWY A;  2KRS A;  2O31 A;  4F16 A;  1E7O A;  2B86 A;  2DM1 A;  2H8H A;  4JJD A;  2DYB A;  1SPK A;  1JO8 A;  2RQT A;  2KRO A;  4R0K A;  2DIL A;  1ZSG A;  1AWW A;  4HXJ A;  5FWC A;  1Y0M A;  1OV3 A;  2OAW A;  1NYF A;  3H0F A;  3I9Q A;  2YDL A;  4E6R A;  2CH4 A;  3TSW A;  1PWT A;  5I22 A;  2CRE A;  1W6X A;  2A28 A;  4RTY A;  1NLP C;  4RTX A;  5IHI A;  2PTK A;  3UAT A;  2DRM A;  2GTJ A;  3VRY A;  2L2P A;  4CC4 B;  4J9C A;  4OMM A;  1AEY A;  1RI9 A;  2RQU A;  2RQR A;  4J9H A;  1ZLM A;  1T3L A;  2FPD A;  1M3C A;  2ESW A;  2JXB A;  3RBB B;  4RTT A;  1QWF A;  1MUZ A;  2JM9 A;  1N5Z A;  1AD5 A;  4F17 A;  3THK A;  1HJD A;  4EIK A;  2KEA A;  1UHC A;  1ZUY A;  1PHT A;  2EQI A;  4Z88 A;  3REB B;  2KGT A;  4AFS C;  4AFQ C;  5IXF A;  2LZ6 B;  1BBZ A;  2LQW A;  1U5S A;  2KT8 A;  1WIE A;  5L23 A;  2JM8 A;  2JS2 A;  2KBT A;  4RUG A;  2K9G A;  4JJC A;  2OJ2 A;  1VYV A;  4Y92 A;  4LE9 A;  2ROT A;  1HD3 A;  2K2M A;  2DBM A;  2EYY A;  2GTO A;  4J9E A;  2M0Y A;  2RQV A;  4AG2 C;  2BTT A;  2CT3 A;  2SEM A;  5FWB A;  2FG0 A;  4K11 A;  3PVQ A;  1BU1 A;  1NEB A;  2EW3 A;  1UFF A;  3EHR A;  1WLP B;  4D8D A;  4LUE A;  1V1C A;  1X69 A;  2AZV A;  4HVV A;  1UDL A;  2FRY A;  2BZY A;  3A98 A;  4HCK A;  3TSZ A;  1FYN A;  2CSQ A;  3NPF A;  5EC7 A;  1U3O A;  3H0I A;  1GCQ A;  4Z89 A;  2MIO A;  2ECZ A;  3VS2 A;  1GFC A;  2DX1 A;  2KRM A;  4CC2 A;  1ZBJ A;  2J6F A;  1OPK A;  1EFN A;  1SHF A;  2JMA A;  1UE9 A;  3RNJ A;  2CUB A;  1YCS B;  1M27 C;  4J9G A;  1VYT A;  2FRW A;  3M0S A;  1AWJ A;  2J6O A;  2LP5 A;  1TG0 A;  2CSI A;  2EYX A;  2LJ3 A;  2EGC A;  1UUE A;  1X6G A;  1SEM A;  2KXD A;  4OMQ A;  4RTV A;  3H41 A;  3SEM A;  1K4U S;  2L3P A;  4ESR A;  1GRI A;  2AK5 A;  2I0N A;  1JU5 C;  2ED0 A;  3M0Q A;  1AZE A;  1KIK A;  2VKN A;  2DLP A;  2PNI A;  5GJV B; 
#chains in the Genus database with same CATH topology
 4DA4 A;  1VA7 A;  2DPP B;  3CCS A;  4Q5W A;  4LD9 K;  1QVF A;  4C8Q A;  2EBP A;  4A53 A;  2Y4X A;  5HCK A;  3HKS A;  4IUV A;  1ZUU A;  3REA B;  2VAS A;  2QQB A;  2D9T A;  1WNL A;  1YIJ T;  5C0M A;  2RO0 A;  4IUT A;  1VIF A;  2DD5 A;  4QQG A;  4GY5 A;  1AOJ A;  4WTO B;  4WCI A;  2DIQ A;  4LDX A;  3VS3 A;  1RAC B;  1NYG A;  3OYC A;  1GBR A;  2QA4 T;  1M9S A;  3GLX A;  1IXD A;  1H8K A;  1MND A;  1GCQ C;  4OB0 B;  3CCU A;  5KYW B;  4M78 F;  4BDY A;  3CCS T;  2HNI A;  2O88 A;  4J9D A;  2KK4 A;  2NLU A;  4F04 B;  1Q82 R;  2F1L A;  2F2V A;  4J9B A;  5GAO m;  2GQI A;  1HSQ A;  2O4X A;  4EDU A;  1TH7 A;  2JMC A;  1NLO C;  4O5V A;  1VQ5 T;  3FRN A;  4B9X A;  2RQW A;  3VU3 C;  2PU9 B;  3RIR A;  2R57 A;  3TRE A;  2P4R A;  4M78 C;  1H3Z A;  1YFN A;  2EKH A;  2QAZ A;  3EGX A;  2YT6 A;  3CXC A;  2ROL A;  4XTW A;  2DL3 A;  4XTZ A;  4C92 E;  4M4Z A;  2FZC B;  1TUC A;  1N6A A;  3CCU T;  4C92 B;  4PJJ A;  2YLC A;  3IQL A;  4DBQ A;  5FW9 A;  1VQN A;  2K3Y A;  4UC4 A;  5CKE A;  3MJX A;  2BUD A;  1VQL Q;  2RPN A;  3EG1 A;  1Q7Y R;  5AT1 B;  2RJF A;  2DXU A;  3H8Z A;  2G6F X;  2KMT A;  5GAN d;  3GPL A;  1VQ4 Q;  2JTM A;  1B34 B;  1T0H A;  3PTA A;  1MMN A;  4QW2 A;  4J9F A;  4X9D A;  2FPE A;  3VYH B;  2L0A A;  5HK3 A;  4RTW A;  1G2B A;  1K8A C;  2KI7 A;  2LQN A;  1VQ8 T;  1A0N B;  3JCM g;  1UB4 A;  3KBG A;  1U1T A;  4R56 A;  4BE2 A;  2K7A A;  1VQN T;  1VQ7 A;  4AG1 C;  3RMQ A;  1VQ6 Q;  5GAN 3;  4OB3 B;  4JPB W;  4JUV A;  4C8Q G;  1RUW A;  1XJW B;  2EJG A;  3OB9 A;  2H3J A;  2QQS A;  2Z0W A;  2GF7 A;  1X43 A;  5CO7 A;  1BI1 A;  2YUP A;  2QGF B;  3UF4 A;  3I55 A;  3VJP A;  2GQV A;  5CCA A;  4J7I A;  4M7D C;  3HTR A;  4KUD K;  3QBY A;  4OB2 B;  4C0D B;  2C0T A;  4ZTF A;  1LPL A;  3MPU B;  3CD6 Q;  2LNH B;  2VXF A;  4FT2 A;  4BY6 C;  1BCM A;  4LDU A;  3G4S A;  1SSF A;  4Y91 A;  3MP1 A;  4EMH A;  3CBO A;  3NMZ C;  5CKD A;  4J83 A;  3JCM e;  2G3R A;  3OYL A;  4FYX B;  3VS7 A;  4JLI A;  5GAO q;  1VQM Q;  1G5V A;  2FO0 A;  3G6E Q;  1K73 C;  1AWO A;  3GNG A;  3PE0 A;  5GMK h;  3MEV A;  3OA6 A;  1KJW A;  3I55 T;  1RL2 A;  3H0H A;  1OX9 A;  3U23 A;  5GAN h;  3RMS A;  2M51 A;  3QHS A;  2CKK A;  5KYX B;  1JEG A;  5IT9 E;  1QKX A;  2K5I A;  3UWN A;  4M7A A;  1VQK Q;  1TXQ A;  3QPH A;  1KQS A;  2HSE B;  3V7S A;  1GCP A;  2AHJ B;  1X2Q A;  2JS0 A;  2W0Z A;  5CQX A;  3CCL Q;  4CC7 A;  5LL6 S;  1WI7 A;  4E7K A;  4N4I A;  2GNC A;  4M7D A;  2J6K A;  2ZGW A;  2EPD A;  1RAG B;  4F7U A;  4N4H A;  1YWO A;  2KT1 A;  4BDZ A;  3EH1 A;  3ASK A;  5LJ5 g;  4R55 A;  2GGR A;  1WDX A;  2MCN A;  2YLB A;  5KH6 A;  2J05 A;  5GMK j;  4IKF A;  2A7Y A;  2CDT A;  5ECA A;  2PUK B;  4IUU A;  3O5Z A;  3FIF A;  3PVL A;  2QAS A;  1NG2 A;  4LNP A;  3A8L B;  1R8O B;  1QVF S;  4IIM A;  3J80 E;  2R58 A;  3CC2 Q;  5CIU A;  2MF2 A;  2PVO B;  1O75 A;  4XQ3 A;  3CCE Q;  2X4J A;  4AMC A;  4KH1 B;  2X35 A;  3M4Y A;  5LJ5 h;  2DZC A;  1VQL A;  1Q86 R;  4M78 G;  4V2S A;  1ABQ A;  1CKA A;  3OS5 A;  1UTI A;  1KG1 A;  1EX4 A;  4C0F A;  2E65 A;  1YCY A;  1WYX A;  5LJ3 h;  2Y90 A;  4XTY A;  1K9M C;  2YRD A;  1KC8 R;  5GAM g;  1Z9Z A;  2QTV A;  4C92 C;  5GAN f;  1Z9Q A;  5CQY A;  2CH4 W;  2OTJ A;  3FJ5 A;  1E6H A;  1IGQ A;  2RNA A;  3JCM X;  5A0D A;  3KFV A;  1W70 A;  2NUP A;  2CUD A;  1K0X A;  1J3T A;  1RAD B;  4N0A C;  2C0O A;  5DY9 A;  2JZ2 A;  2DVE A;  4IIO A;  3OW2 A;  3JSC A;  1VQL T;  2B86 A;  2DM1 A;  5LJ5 j;  1WZO A;  2R5M A;  1VOM A;  3X26 B;  3L2V A;  3HFN A;  1ZA2 B;  3QKJ A;  2KRO A;  1VQ4 T;  3CMA Q;  4HXJ A;  4RG2 A;  2X4W A;  4PFP A;  3CXC S;  4J5Y A;  3WXM B;  3H0F A;  2VYT A;  4E6R A;  2OTJ T;  1YI2 Q;  2CP6 A;  3QII A;  8ATC B;  2QG9 B;  2A28 A;  3OY9 A;  1VQP Q;  3CC7 Q;  1NLP C;  5IHI A;  4LXC A;  1K8A U;  2GTJ A;  1I4K 1;  2R5A A;  4C92 A;  3JCM W;  2LC4 A;  4J9C A;  2RQR A;  3OYY A;  1VQ6 T;  3OSS C;  4C8Q E;  2FPD A;  2ESW A;  2QGG A;  1D09 B;  2CS7 A;  2JJ9 A;  3RKX A;  1MUZ A;  3P8D A;  4C8Q B;  2LNV A;  1MGQ A;  5GAM j;  1I5O B;  3GIB A;  3LWH A;  3LYI A;  4C0D C;  4F7U G;  4CI0 C;  3QDF A;  4EIK A;  1G8X A;  1Q86 C;  3L2R A;  4M7A D;  2JN0 A;  3A5Z B;  1UGS B;  4Z88 A;  3REB B;  5IXF A;  1Y96 A;  1BBZ A;  1U5S A;  2EIF A;  1S72 A;  2KT8 A;  1WIE A;  2EQJ A;  2RM4 A;  4M7D D;  2JVV A;  1C0M A;  3OMC A;  4LE9 A;  2ROT A;  4J9E A;  2YHT A;  3OYM A;  3ZEH A;  1VQO A;  2O4X B;  3RKY A;  5FWB A;  4FSX A;  2FG0 A;  3CPW S;  1GXI E;  1VQM T;  2E3I A;  4JRI A;  4PLI A;  3G6E T;  1RAI B;  2RHU A;  1K73 U;  5GAN 6;  2K3X A;  4FT4 A;  3BFM A;  1UDL A;  1P92 A;  2YWW A;  5GMK l;  1G3Y A;  1FYN A;  3TCJ A;  4FYV B;  1UGQ B;  1UGR B;  3JCM c;  1M1F A;  3RDV A;  1BIB A;  3EGX B;  4C5H A;  5CK9 A;  2MIO A;  3VS2 A;  4CC2 A;  4PK4 A;  2KRM A;  1KHC A;  3DB4 A;  1VQK T;  2QXF A;  1OZ2 A;  1SHF A;  5D6Y A;  2FZK B;  2JMA A;  1YCS B;  2QA4 Q;  3PMT A;  1M27 C;  3CCL T;  4J6W A;  3CC2 A;  1VYT A;  3LGF A;  3QYH B;  3SWN C;  4DBR A;  4PL6 A;  1AWJ A;  3CCS Q;  2ZPI B;  1RI0 A;  2EYX A;  3CCQ A;  1D3B A;  1EIF A;  1UUE A;  1X6G A;  3X25 B;  1SEM A;  4OMQ A;  3H41 A;  4OB1 B;  1K4U S;  1RAE B;  3G1J A;  3MET A;  1AZE A;  1KIK A;  2DLP A;  3C95 A;  1KQS S;  1XNI A;  2D1X A;  1YHQ A;  1G3W A;  3EG9 A;  4XK8 E;  4NL2 A;  4C5I A;  1WHK A;  3EG0 A;  1M2V A;  3CC2 T;  3CCU Q;  4C92 G;  3T9N A;  2A08 A;  3PNW C;  2HL5 C;  4RMO A;  3CCQ T;  2RA2 A;  4IUQ A;  3OYH A;  2DA9 A;  4BUG A;  3GP8 A;  4JZ3 A;  3EFR A;  2HQX A;  3SWN A;  2DRK A;  4QVZ A;  4LN2 A;  3N5B B;  3BDL A;  3S3M A;  3M0P A;  5FRO A;  1YHQ T;  3JB9 H;  1AWX A;  4PFZ A;  4PJL A;  2EWN A;  4KRT A;  1IZ6 A;  4FSS A;  4LD6 A;  2MOX A;  3JAM E;  1GBQ A;  2DTI A;  2RHX A;  2WSE E;  1VQN Q;  1X2K A;  2L3Q A;  2V8I A;  3FC3 A;  4C8Q F;  2VB6 A;  4M77 A;  3CMA T;  3VS0 A;  1X01 A;  2DD4 A;  3X28 B;  2LX7 A;  4A4F A;  4PJO D;  2PUO B;  1W2B S;  2DXB A;  3QUI A;  1UG1 A;  2QQR A;  1M2O A;  3GF5 A;  1YI2 T;  1VUB A;  2XHC A;  2RMO A;  1N27 A;  1VQP T;  3CC7 T;  4M7A E;  4MDX A;  2DE0 X;  2XKO C;  2FYK A;  1MHN A;  4NOY A;  4CC3 A;  1KD1 R;  2D8J A;  4M7A B;  5IH2 A;  1YNZ A;  2ENM A;  3C4S A;  1QWE A;  4PJM A;  2MK5 A;  1VQ7 Q;  4M7D E;  1QW1 A;  2LMJ A;  1GFD A;  4JRQ A;  1MNE A;  4F7U E;  4M7D B;  2O9S A;  4F7U B;  1M3B A;  4CRI A;  4BY6 B;  3I35 A;  3C12 A;  4FW1 A;  2E64 A;  3INZ A;  2SRC A;  1PKS A;  1WHJ A;  2BKD N;  2RHZ A;  1U06 A;  5I2S A;  3I5S A;  1YJ9 A;  1WX6 A;  1AHJ B;  2RJD A;  4JZ4 A;  2HDA A;  4XTV A;  3L1A A;  4DEY A;  2EJF A;  1M4Z A;  3G4S Q;  2RK1 A;  3L2Q A;  3CQT A;  4QT7 A;  3V7R A;  2NUZ A;  5FRM A;  1LOJ A;  2GCX A;  2RK2 A;  1N8R C;  2OI3 A;  3G71 A;  2RN8 A;  1HK9 A;  3QDR B;  3TU4 K;  2K3B A;  1M1K R;  3OYB A;  1UGV A;  2BZ8 A;  4ZNX A;  2XID A;  5GAO l;  2AKL A;  4O6J A;  2ZCF B;  1BB9 A;  3M0T A;  3VS4 A;  5DM7 R;  3OYN A;  2NUP B;  2HEQ A;  2XMF A;  4JLG A;  2JNG A;  1HXD A;  4E2F B;  2H3E B;  1OU8 A;  3HHT B;  5D6X A;  1D1A A;  3TVT A;  1YJW A;  2LVM A;  2X3X D;  2ZPG B;  4RCC A;  1TU0 B;  4FL6 A;  5CKB A;  1KSW A;  4KGX B;  3QWX X;  2VXE A;  3D7S B;  2A0F B;  2ZPB B;  4DBH A;  3JCM Q;  4HT8 A;  1I1J A;  2V8J A;  2LCS A;  1WHH A;  2OTL A;  2DAQ A;  4C5E A;  2ABL A;  3JCM d;  3OMG A;  3SB2 A;  5FU6 B;  2P0Q A;  5IHK A;  4FCY A;  2EVR A;  4M77 D;  1M90 C;  1M5Q 1;  1YJW T;  1NJI C;  3BY7 A;  5L8R E;  1PKT A;  2EYQ A;  2KRN A;  2P84 A;  4HVU A;  3VKI A;  3QSU A;  2DVJ A;  3CCJ Q;  1PC0 A;  5A2Q E;  5GAO p;  4A4K A;  1K76 A;  3E19 A;  3OS1 A;  2AZS A;  2KR3 A;  5GJW B;  1PRL C;  4RG8 A;  4PJO E;  2KE9 A;  2OTJ Q;  2A36 A;  4XAX B;  4LUD A;  1Y96 B;  4ORZ A;  1M1K C;  4PJO B;  2EGE A;  3X24 B;  3ZL7 C;  2LTO A;  4LDY A;  3MEW A;  2P0P A;  1K1Z A;  3A8O B;  3UPU A;  4M7D F;  1JJ2 A;  2FPF A;  3MEU A;  3JB9 D;  5IHN A;  4BI4 A;  1I07 A;  4F7U F;  3CC4 A;  1SRL A;  1KQ2 A;  5GAN 5;  2V26 A;  1SSH A;  2F2X A;  3NGP A;  1Q82 C;  1YIT A;  4M7A C;  2LCL A;  2EQU A;  3HRT A;  1ABO A;  3M58 A;  2XD0 A;  2GFA A;  3QWY A;  4P5N A;  4F16 A;  4XU1 A;  1LVK A;  2RH2 A;  1BI0 A;  1TS9 A;  1AT1 B;  4MZP A;  3MEA A;  1VQ7 T;  2QI2 A;  5GAN g;  3TQ7 P;  1Y0M A;  1C6V X;  1OV3 A;  2OAW A;  1NYF A;  3S3O A;  4MML A;  3OYK A;  3CC4 T;  2QK0 A;  1D3B B;  1WJQ A;  4X34 A;  5GMK i;  2CH4 A;  1D0Z A;  5HK0 A;  4M75 A;  1TTH B;  2KDS A;  4WF2 A;  2KY9 A;  2QYZ A;  4RTX A;  2PTK A;  5DLO A;  4KH0 B;  3UAT A;  5KYY A;  4E47 A;  1Q7Y C;  1XQH A;  2L2P A;  1QVG A;  1OUL A;  4OMM A;  4QQ6 A;  3G7Z A;  3P8H A;  3EG9 B;  3RBB B;  2F5T X;  4RTT A;  3CME A;  1S72 Q;  1QWF A;  3BW1 A;  2MPX C;  1M2V B;  3CBM A;  3G4S T;  2MWP A;  3P8B B;  1OU9 A;  1AD5 A;  3OYA A;  4FM4 B;  1I8F A;  3THK A;  1HJD A;  1ZBX A;  4XU0 A;  6AT1 B;  2VGM A;  5GMK e;  2K5F A;  1VQO Q;  2EQI A;  3VUB A;  3A1P A;  5D7U A;  2KGT A;  4AFS C;  4PNO A;  1UEB A;  3M4G A;  1N8R U;  2L5Q A;  2RJE A;  5GAM d;  4OGE A;  2ATC B;  3SWN B;  2JS2 A;  3MCA B;  4YTL A;  1HYO A;  1QP3 A;  2LT4 A;  2OJ2 A;  4Y92 A;  5LJ3 g;  2GTO A;  5GAO n;  2AIR B;  4AG2 C;  3CME T;  2BTT A;  1NPP A;  5GAN j;  2CT3 A;  1KHI A;  3F70 A;  4C92 F;  1JRI A;  4K11 A;  1BU1 A;  2DXC A;  3HPW A;  3JCM f;  3L42 A;  3O8V A;  1X69 A;  4HVV A;  5J3B A;  4M77 E;  3OYE A;  3WVE B;  3CCQ Q;  4J6X A;  1VQ9 A;  4II1 A;  1V76 A;  3H0I A;  4M77 B;  5GAN 8;  2ECZ A;  3CCJ A;  1GFC A;  2DX1 A;  1RAH B;  1ZBJ A;  5FU6 C;  2KAF A;  4QVC A;  3RNJ A;  4J9G A;  3HFO A;  1V29 B;  5IN1 A;  5LJ5 e;  3QXE B;  1YHQ Q;  2CSI A;  4OF1 A;  2LJ3 A;  3H6Z A;  3I56 A;  1QVF P;  3QG1 A;  3RR6 A;  4RTV A;  3QYG B;  1Q81 R;  3LLR A;  1M90 U;  2DYI A;  2I0N A;  4L5G A;  3MKD A;  2CP3 A;  2ED0 A;  3Q1J A;  1VQ9 T;  2PNI A;  1NJI U;  2DF6 A;  3CCR A;  3OS0 A;  3CCJ T;  2RF0 A;  5I21 A;  4PJO C;  3HL8 A;  1QCO A;  2QEX A;  2RHI A;  1RLQ C;  2ZPF B;  5LJ3 j;  2VWF A;  4BE0 A;  2I2L A;  3QZ5 B;  5D6W A;  2WSF E;  1KK7 A;  4MMK A;  3EGD B;  5GAM e;  2E5K A;  3M9Q A;  4QQD A;  3I56 T;  2O9V A;  2DMO A;  3CBP A;  1BKB A;  4OMP A;  2OAU A;  1PNJ A;  4M7A G;  2X4X A;  1U1S A;  4FYY B;  5A0G A;  2LJ0 A;  4M75 D;  4DOW A;  1OI1 A;  4MZM A;  3M55 A;  1D0X A;  5J39 A;  3CCR T;  1D1B A;  4A63 B;  2MI6 A;  4ANJ A;  2HAX A;  5GAN 2;  4M7D G;  3URG A;  4IUR A;  2XDD A;  4ELZ C;  2QEX T;  4NL3 A;  2V1Q A;  2P4T A;  4HT9 A;  1Q82 U;  5CR2 A;  1QKW A;  3CXC P;  3M53 A;  1YJN A;  2EQM A;  1TUD A;  4TVR A;  2CT4 A;  1M3A A;  2RHY A;  1Y57 A;  2ZZD A;  3ZFJ A;  2E70 A;  1KC8 C;  5I2M A;  1B07 A;  1JJ2 S;  3UA6 A;  4PJO A;  1QLY A;  1ARK A;  2KYB A;  1H92 A;  1T0J A;  4E7H A;  3TEE A;  1NEG A;  2E6N A;  4J6Y A;  3AHU A;  2PVG B;  3M59 A;  2YUQ A;  2YUN A;  3E9G A;  1VYU A;  1E6G A;  3EG2 A;  3JV3 A;  3NTI A;  3OQ5 A;  1IHV A;  5GAM f;  1GL5 A;  1Q7Y U;  1YJ9 Q;  2MWO A;  2LQ8 A;  3EHQ A;  3JCM V;  1S72 T;  2A37 A;  2KSS A;  1KQ1 A;  3R6O A;  2E41 A;  2C0I A;  3VS6 A;  3DKM A;  1OZ3 A;  1I81 A;  1VQO T;  1UJ0 A;  1PD1 A;  2IPO B;  3MP6 A;  5CKF A;  2KVQ G;  2V8K A;  4M77 F;  3CPW P;  1QVP A;  1IB8 A;  4HA8 A;  1QVG S;  2K4Y A;  3SDZ A;  3G71 Q;  2DTH A;  2X4Y A;  2CZ6 B;  4BD3 A;  2HD0 A;  1S1N A;  2EFI A;  1MV3 A;  2L3S A;  4VUB A;  3WVD B;  1WPY A;  5C6S A;  2X9H A;  2DJQ A;  2FL7 A;  3J7A F;  3M54 A;  3SD4 A;  2YSQ A;  2ZPE B;  4M77 C;  1G3S A;  2FEI A;  4HCC A;  1UJY A;  2CYZ B;  2XG8 D;  1PSF A;  4OMN A;  1YJW Q;  3MHX A;  1G83 A;  1JXM A;  3PIO A;  1EZZ B;  1K9M U;  5M9O A;  2YRC A;  4OMF B;  2YRV A;  4A4G A;  1KQS P;  5HY6 A;  4L6V 5;  4HVW A;  2OTL Q;  2RI3 A;  3M0U A;  1OYX A;  3C0C A;  1W1F A;  3DB3 A;  4PJO G;  3RES A;  2J06 A;  2X3W D;  2C06 A;  3CCV A;  3EFS A;  1OPL A;  4LDW A;  1H3H A;  5KCO A;  3L2U A;  2IVW A;  5CKH A;  2AKK A;  2PVD B;  5FU7 B;  4M75 E;  1M8M A;  4BAC A;  4X1V A;  2DFU A;  4M75 B;  2DET A;  4BI8 B;  2M02 A;  2LT1 A;  4PFO A;  4XU2 A;  4L59 A;  5KYY B;  4E7J A;  2LCC A;  2DL5 A;  2COW A;  3OBY A;  4Z8A A;  5I11 A;  3OW2 S;  1FMK A;  3FEO A;  3CCV T;  3VYG A;  1BCO A;  1KFZ A;  2QDY B;  2JT4 A;  1SRM A;  1WXB A;  4EMK B;  1K0S A;  1X27 A;  2B8A A;  3JCM J;  1NZ9 A;  2CZ7 B;  3CC4 Q;  2VVK A;  3R6N A;  1OEB A;  2IIM A;  3OSV A;  3VRZ A;  3FJP A;  3GNF B;  1YIT Q;  1FMV A;  1Q86 U;  3A8H B;  1W2B P;  2J7I A;  1D1C A;  2GBQ A;  1N9S A;  3EGD A;  1B3Q A;  5J26 A;  1WHL A;  3S3N A;  2QDL A;  1KC8 U;  1G3T A;  3NHN A;  1JXO A;  2P0K A;  1BI2 A;  3H9N A;  1SHG A;  2E4H A;  1QCN A;  1NM7 A;  3EG3 A;  2KNB B;  3LH0 A;  2CGH A;  4AFU C;  4F14 A;  2ZAE A;  1NE8 A;  4BI3 A;  1WHM A;  1YIJ A;  4RCB A;  3EGU A;  4AFZ C;  1ZX6 A;  1BI3 A;  5KYU A;  2KYM A;  2BE9 B;  4C0G A;  2A3L A;  4MZT A;  3UT1 A;  5GAN 4;  1PM3 A;  3MP8 A;  1FXX A;  2XI9 A;  2DZ9 A;  4JJD A;  1ZSZ C;  1YJ9 T;  1SPK A;  1JO8 A;  2BE7 D;  4IUP A;  1W4S A;  3CCM A;  2DIL A;  4N4G A;  2M9U A;  3QJY A;  4JJN K;  3PMI A;  1PSE A;  1R0C B;  3J81 E;  1X75 C;  2YDL A;  3CME Q;  1PWT A;  4ATO A;  1YBY A;  4J8O A;  1VQ5 A;  2HQH A;  1KD1 C;  5CVI A;  3LGL A;  1K8A R;  3VRY A;  3BDU A;  4DQ2 A;  1TWB A;  3G71 T;  1T3L A;  4M77 G;  2JXB A;  4A4E A;  1LJO A;  4J7F A;  5KCH A;  3OYG A;  1X6O A;  5IAY A;  2DEU A;  3CCM T;  5KE2 A;  4F17 A;  3OYD A;  3OYI A;  3V7C A;  4FIB A;  2CP0 A;  4DOV A;  4C5G A;  2JOY A;  1PHT A;  4A4H A;  2FVU A;  2DEQ A;  2KQW A;  2RI2 A;  4FU6 A;  2LZ6 B;  1ZSZ A;  2LQW A;  4JS5 A;  4OVA A;  1H64 1;  2K2V A;  4NS5 A;  4JJC A;  3KUF A;  4M75 F;  2CP5 A;  2XDB A;  1VQ9 Q;  1VYV A;  2M16 A;  1HD3 A;  3C94 A;  2K2M A;  1NBE B;  2DBM A;  2EYY A;  2XDP A;  4KBM B;  4PLL A;  4RKU E;  2SEM A;  1VQ8 A;  1QQJ A;  3JB9 G;  3PVQ A;  2EQK A;  2EW3 A;  2VV5 A;  1UFF A;  7AT1 B;  2OTL T;  3E2U A;  1K73 R;  4D8D A;  4HKE A;  4LUE A;  5FU7 C;  4M7A F;  2FRY A;  3DLL A;  3QZ9 B;  2F69 A;  2CSQ A;  4EPC A;  4ELY C;  5EC7 A;  1OQK A;  4M75 C;  5GAN 7;  3I56 Q;  4KGZ B;  1GCQ A;  1M8V A;  2RB6 A;  5CAI A;  2J6F A;  1OPK A;  1EFN A;  1UE9 A;  2CUB A;  3RER A;  1VIE A;  3JB9 I;  3V8K A;  4FW2 A;  2L89 A;  1MMG A;  3CCR Q;  1N9R A;  2FRW A;  2XU8 A;  3M0S A;  3PIP A;  2QEX Q;  1B7T A;  2LP5 A;  1TG0 A;  2HMA A;  4E7Z A;  2EGC A;  2KXD A;  4JRK A;  3SEM A;  4M78 A;  1GRI A;  4ZN3 A;  4EMK C;  1JU5 C;  3S6W A;  2VKN A;  4XU3 A;  1RAF B;  5KYN A;  4OGC A;  2WAC A;  1SKU B;  1U8R A;  3CPW A;  2FHD A;  2LDM A;  3JCM h;  1Q95 G;  3ER0 A;  2E3H A;  4OMO A;  4GLK A;  1YIT T;  5LJ5 d;  1QMC A;  2YXY A;  3DLM A;  1CKB A;  1ZQ1 A;  1PG5 B;  1SF9 A;  4JDS A;  4C8Q D;  4Y28 E;  1YJN Q;  1LNX A;  5LJ3 d;  2XK0 A;  1K9M R;  4BB7 A;  1JB0 E;  1JBM A;  4B6M A;  2VC8 A;  1ZUK A;  2NWM A;  2E5Q A;  1YP5 A;  4ZGJ B;  2CZ1 B;  2COY A;  1JQQ A;  4ZGD B;  2PZ1 A;  4EMK A;  2DBK A;  4J9I A;  4QVD A;  1QP2 A;  1MV0 B;  2JTF A;  5GAN e;  1UHF A;  2EGA A;  2LQK A;  1WQW A;  2CP7 A;  2VUB A;  2EYW A;  1AZG B;  2E1H A;  2PQW A;  2NUT B;  3OYF A;  2QTX A;  2K79 A;  1T3S A;  5GAO r;  3VV0 A;  2WSC E;  3NTH A;  3EFO A;  1KD1 U;  2COZ A;  3UDC A;  2Y4Y A;  2DXT A;  3E9F A;  1X6B A;  4GLM A;  2HKQ B;  2V1R A;  1WFW A;  1OOT A;  2LRQ A;  2E6Z A;  4KUI A;  5DLQ E;  4B9W A;  1IO6 A;  1DJ7 B;  3PT9 A;  1NPR A;  2F2W A;  4MDW A;  2BZX A;  4PJO F;  2K57 A;  2EYZ A;  2YUO A;  2XIC A;  1XOV A;  1I0C A;  1WQ7 A;  3EAE A;  1TSF A;  4LDV A;  1VQ4 A;  5LJ3 e;  3EH2 A;  1OX8 A;  3JB9 J;  2F5K A;  3M57 A;  1C1A A;  4Z02 A;  4X9C A;  3RUX A;  3X20 B;  2O2O A;  1M1G A;  4M78 D;  1W2B A;  1BIA A;  4KGV B;  2D6F A;  4M75 G;  3CPF A;  1YN8 A;  2AT1 B;  5KE3 A;  1AVZ C;  5KYW A;  2EJ9 A;  3FB9 A;  4ZGE B;  1MMA A;  1VQ6 A;  3HSB A;  1UEC A;  4A54 A;  3OBW A;  4D8K A;  5GAM h;  3L2W A;  2D0Q B;  2JTE A;  2FZG B;  2DNU A;  4OP0 A;  1Y7X A;  1M1K U;  1LCK A;  4D6W A;  4C0Z A;  3CCV Q;  2W10 A;  1CSK A;  1PRM C;  1R0B G;  2LJ1 A;  1WA7 A;  4GBQ A;  5EG2 A;  1I5L A;  3GOX A;  3FLG A;  3OYJ A;  2K6D A;  5KYU B;  4JJB A;  3HP9 A;  1WHG A;  3HRS A;  1RLP C;  1ZA1 B;  3SHW A;  3CD6 A;  3ZBD A;  4DEX A;  5LJ5 f;  4PKC C;  1TUG B;  1BK2 A;  3M0R A;  5FLX E;  2HKN A;  3V8J A;  4BE1 A;  3RKW A;  3KXT A;  5LJ3 f;  2HSP A;  3VS5 A;  3PGG A;  4E7I A;  4XTU A;  2HBW A;  3MO8 A;  1VQM A;  1WXT A;  4N0A A;  2VGN A;  3G6E A;  2ZPH B;  3ULR B;  2MAM A;  2MMP A;  1B34 A;  1YWP A;  1Q81 C;  4OML A;  1IRX A;  2LX9 A;  3VUZ A;  2E10 A;  3SFM A;  2DL4 A;  3CD6 T;  1VQK A;  1F1B B;  3AT1 B;  2DL7 A;  1YJN T;  2HCK A;  1ZHI A;  2ED1 A;  1WJR A;  3CCL A;  3LH5 A;  2K5L A;  2EKO A;  2CZ0 B;  1WXU A;  1IGU A;  1MMD A;  1JJ2 P;  1TOV A;  3M56 A;  5IXB A;  3A8M B;  2DK3 A;  4ZTJ A;  1ZSZ B;  2JUF A;  2NYS A;  4EMG A;  1Y71 A;  2E12 A;  1YIJ Q;  1BYM A;  3A8G B;  2KXC A;  2OX7 A;  2D0N A;  1M30 A;  2DL8 A;  4RTU A;  3E1S A;  2D8H A;  5GMK m;  3CCE A;  3I5R A;  3VS1 A;  3CCM Q;  2QQ9 A;  2L3R A;  2X51 A;  2DER A;  4HCB A;  1PD0 A;  4RTZ A;  5AYF A;  3UA7 A;  3GBQ A;  1QCF A;  1K9A A;  4ME7 A;  2JW4 A;  1VQ5 Q;  1Y07 A;  2KRS A;  2O31 A;  1E7O A;  2H8H A;  2DO3 A;  5HKC A;  1D0Y A;  2DYB A;  3QJ6 A;  2O01 E;  3NFC A;  4KUL A;  4XTX A;  2RQT A;  4R0K A;  4E7L A;  1ZSG A;  1AWW A;  5FWC A;  5KYX A;  4HCZ A;  1QVG P;  3JB9 F;  2DTO A;  2HBP A;  3QO3 A;  3I9Q A;  1RAA B;  4FYW B;  4M78 E;  3TSW A;  3CCE T;  5I22 A;  2NUT A;  1WGS A;  2CRE A;  2QQA A;  1W6X A;  5A0L A;  4M78 B;  4RTY A;  4AT1 B;  2DIG A;  3LX7 A;  3M5A A;  2DRM A;  1UGP B;  1RAB B;  3NTK A;  9ATC B;  4CC4 B;  3CMA A;  1AEY A;  1RI9 A;  2RQU A;  2M0O A;  4J9H A;  1ZLM A;  1M3C A;  1ACM B;  2EAY A;  2JM9 A;  1YI2 A;  4C92 D;  2MYS A;  2HZY A;  1N5Z A;  1R77 A;  3CC7 A;  1FMW A;  1VQP A;  2DKG A;  3JCM P;  4QKU A;  2KEA A;  1UHC A;  1VQ8 Q;  3BE3 A;  1ZUY A;  1IRE B;  1PCX A;  4AFQ C;  1N8R R;  1SG5 A;  2CP2 A;  5L23 A;  2JM8 A;  4ZN1 A;  1FWZ A;  2KBT A;  2RI5 A;  4RUG A;  2K9G A;  2RJC A;  2GFU A;  3ME9 A;  3LWI A;  3OS2 A;  2M0Y A;  2RD1 A;  2RQV A;  4JRP A;  2HQE A;  1NEB A;  3FDR A;  4KT0 E;  3V8L A;  3EHR A;  1WJS A;  1WLP B;  4C8Q C;  1V1C A;  2AZV A;  3TSZ A;  3A98 A;  2BZY A;  4HCK A;  1XTD A;  3CEY A;  4DBF A;  3NPF A;  1U3O A;  4E7S A;  8AT1 B;  4Z89 A;  3PFS A;  4PJN A;  2FB7 A;  2HL3 A;  2DJZ A;  2IG0 A;  3OW2 P;  2L8D A;  1O9S A;  5FRN A;  3EFO B;  3HRU A;  3LW5 E;  2J6O A;  4JS4 A;  3L2Z A;  3JRZ A;  2BIV A;  3I55 Q;  2M1H A;  1FX7 A;  1Q81 U;  2L3P A;  4ESR A;  1M90 R;  2AK5 A;  3M0Q A;  3JCM b;  1IHW A;  2QA4 A;  5GJV B;  1NJI R; 
#chains in the Genus database with same CATH homology
 2DF6 A;  2RF0 A;  1VA7 A;  2D1X A;  1RLQ C;  2VWF A;  2EBP A;  3EG0 A;  5HCK A;  1ZUU A;  4OMO A;  3REA B;  2A08 A;  1CKB A;  2E5K A;  2O9V A;  2DA9 A;  2DMO A;  4OMP A;  1PNJ A;  2LJ0 A;  1AOJ A;  4WCI A;  3VS3 A;  4JZ3 A;  1NYG A;  1GBR A;  2DRK A;  4LN2 A;  1H8K A;  1GCQ C;  1ZUK A;  2NWM A;  4A63 B;  1YP5 A;  3M0P A;  2O88 A;  2V1Q A;  4J9D A;  1AWX A;  2F2V A;  4J9B A;  2GQI A;  1JQQ A;  1HSQ A;  1QKW A;  2PZ1 A;  4KRT A;  4FSS A;  1TUD A;  2MOX A;  2JMC A;  1NLO C;  1M3A A;  2CT4 A;  1GBQ A;  2DBK A;  1Y57 A;  2RQW A;  4J9I A;  1MV0 B;  1X2K A;  2L3Q A;  1B07 A;  1UHF A;  2EGA A;  3UA6 A;  1QLY A;  2P4R A;  1ARK A;  2EYW A;  2KYB A;  1H92 A;  1T0J A;  1AZG B;  3VS0 A;  2EKH A;  2K79 A;  1NEG A;  2LX7 A;  2YT6 A;  2ROL A;  2DL3 A;  4M4Z A;  1T3S A;  1UG1 A;  1TUC A;  2YUQ A;  2RMO A;  3IQL A;  2YUN A;  5FW9 A;  1VYU A;  2DE0 X;  1E6G A;  3EG2 A;  3JV3 A;  4CC3 A;  2D8J A;  5IH2 A;  2RPN A;  3EG1 A;  1YNZ A;  1GL5 A;  2ENM A;  1X6B A;  1QWE A;  4GLM A;  2G6F X;  2V1R A;  1WFW A;  1OOT A;  3EHQ A;  2LMJ A;  1GFD A;  1T0H A;  1IO6 A;  2A37 A;  2O9S A;  4J9F A;  1M3B A;  2F2W A;  2C0I A;  3VS6 A;  3I35 A;  2BZX A;  2FPE A;  2L0A A;  4RTW A;  2EYZ A;  1G2B A;  1UJ0 A;  2LQN A;  2SRC A;  2YUO A;  1A0N B;  1PKS A;  1U06 A;  2K7A A;  1XOV A;  1I0C A;  3I5S A;  1WX6 A;  4AG1 C;  4JPB W;  4JZ4 A;  1S1N A;  2HDA A;  1MV3 A;  2L3S A;  4DEY A;  1RUW A;  2O2O A;  3CQT A;  2DJQ A;  1X43 A;  4QT7 A;  2YSQ A;  1YN8 A;  2NUZ A;  2YUP A;  1AVZ C;  3UF4 A;  2FEI A;  1UJY A;  2OI3 A;  1UEC A;  2RN8 A;  4D8K A;  2C0T A;  2JTE A;  2K3B A;  2DNU A;  4OMN A;  2LNH B;  1LCK A;  1UGV A;  2BZ8 A;  4ZNX A;  1G83 A;  2W10 A;  1JXM A;  2LJ1 A;  1CSK A;  1PRM C;  2AKL A;  1WA7 A;  1BB9 A;  3M0T A;  4GBQ A;  3VS4 A;  3NMZ C;  2HEQ A;  2XMF A;  3VS7 A;  2K6D A;  4JJB A;  2FO0 A;  1RLP C;  1AWO A;  4HVW A;  3PE0 A;  3M0U A;  3TVT A;  3SHW A;  3C0C A;  1KJW A;  4DEX A;  1W1F A;  2X3X D;  3H0H A;  2J06 A;  2X3W D;  1BK2 A;  3M0R A;  3U23 A;  2M51 A;  1OPL A;  1H3H A;  1JEG A;  1KSW A;  1QKX A;  2AKK A;  3QWX X;  2HSP A;  3VS5 A;  1M8M A;  2HBW A;  1WXT A;  1GCP A;  1X2Q A;  1I1J A;  2JS0 A;  2W0Z A;  2LCS A;  4X1V A;  4CC7 A;  1WI7 A;  3ULR B;  2GNC A;  2ABL A;  1YWP A;  2J6K A;  5IHK A;  2EPD A;  2DL5 A;  1YWO A;  2EVR A;  2KT1 A;  4OML A;  2DL4 A;  4Z8A A;  5I11 A;  2GGR A;  1WDX A;  1FMK A;  2MCN A;  2DL7 A;  2J05 A;  2HCK A;  2ED1 A;  1PKT A;  2KRN A;  4HVU A;  3LH5 A;  1KFZ A;  2CDT A;  5ECA A;  2DVJ A;  2JT4 A;  3O5Z A;  1SRM A;  3PVL A;  1WXB A;  1NG2 A;  1WXU A;  1K76 A;  4LNP A;  2AZS A;  2KR3 A;  5GJW B;  1X27 A;  1K0S A;  4IIM A;  1PRL C;  2VVK A;  2KE9 A;  3R6N A;  2A36 A;  1OEB A;  5IXB A;  2IIM A;  3VRZ A;  4LUD A;  4ORZ A;  2EGE A;  1ABQ A;  3ZL7 C;  1CKA A;  2J7I A;  1UTI A;  2GBQ A;  1WYX A;  2KXC A;  1B3Q A;  1K1Z A;  2QDL A;  2D0N A;  1M30 A;  2FPF A;  1Z9Z A;  5IHN A;  3NHN A;  1JXO A;  1Z9Q A;  1I07 A;  2DL8 A;  4RTU A;  1SHG A;  1SRL A;  2CH4 W;  1NM7 A;  3EG3 A;  2KNB B;  3FJ5 A;  2D8H A;  1E6H A;  3I5R A;  2RNA A;  3VS1 A;  4AFU C;  1SSH A;  3KFV A;  2F2X A;  3NGP A;  4F14 A;  1W70 A;  2CUD A;  1K0X A;  3EGU A;  4RTZ A;  4AFZ C;  1ZX6 A;  1J3T A;  2C0O A;  1ABO A;  3UA7 A;  3GBQ A;  1QCF A;  2KYM A;  1K9A A;  2JW4 A;  4IIO A;  3QWY A;  2KRS A;  2O31 A;  4F16 A;  1E7O A;  2B86 A;  2DM1 A;  2H8H A;  4JJD A;  2DYB A;  1SPK A;  1JO8 A;  2RQT A;  2KRO A;  4R0K A;  2DIL A;  1ZSG A;  1AWW A;  4HXJ A;  5FWC A;  1Y0M A;  1OV3 A;  2OAW A;  1NYF A;  3H0F A;  3I9Q A;  2YDL A;  4E6R A;  2CH4 A;  3TSW A;  1PWT A;  5I22 A;  2CRE A;  1W6X A;  2A28 A;  4RTY A;  1NLP C;  4RTX A;  5IHI A;  2PTK A;  3UAT A;  2DRM A;  2GTJ A;  3VRY A;  2L2P A;  4CC4 B;  4J9C A;  4OMM A;  1AEY A;  1RI9 A;  2RQU A;  2RQR A;  4J9H A;  1ZLM A;  1T3L A;  2FPD A;  1M3C A;  2ESW A;  2JXB A;  3RBB B;  4RTT A;  1QWF A;  1MUZ A;  2JM9 A;  1N5Z A;  1AD5 A;  4F17 A;  3THK A;  1HJD A;  4EIK A;  2KEA A;  1UHC A;  1ZUY A;  1PHT A;  2EQI A;  4Z88 A;  3REB B;  2KGT A;  4AFS C;  4AFQ C;  5IXF A;  2LZ6 B;  1BBZ A;  2LQW A;  1U5S A;  2KT8 A;  1WIE A;  5L23 A;  2JM8 A;  2JS2 A;  2KBT A;  4RUG A;  2K9G A;  4JJC A;  2OJ2 A;  1VYV A;  4Y92 A;  4LE9 A;  2ROT A;  1HD3 A;  2K2M A;  2DBM A;  2EYY A;  2GTO A;  4J9E A;  2M0Y A;  2RQV A;  4AG2 C;  2BTT A;  2CT3 A;  2SEM A;  5FWB A;  2FG0 A;  4K11 A;  3PVQ A;  1BU1 A;  1NEB A;  2EW3 A;  1UFF A;  3EHR A;  1WLP B;  4D8D A;  4LUE A;  1V1C A;  1X69 A;  2AZV A;  4HVV A;  1UDL A;  2FRY A;  2BZY A;  3A98 A;  4HCK A;  3TSZ A;  1FYN A;  2CSQ A;  3NPF A;  5EC7 A;  1U3O A;  3H0I A;  1GCQ A;  4Z89 A;  2MIO A;  2ECZ A;  3VS2 A;  1GFC A;  2DX1 A;  2KRM A;  4CC2 A;  1ZBJ A;  2J6F A;  1OPK A;  1EFN A;  1SHF A;  2JMA A;  1UE9 A;  3RNJ A;  2CUB A;  1YCS B;  1M27 C;  4J9G A;  1VYT A;  2FRW A;  3M0S A;  1AWJ A;  2J6O A;  2LP5 A;  1TG0 A;  2CSI A;  2EYX A;  2LJ3 A;  2EGC A;  1UUE A;  1X6G A;  1SEM A;  2KXD A;  4OMQ A;  4RTV A;  3H41 A;  3SEM A;  1K4U S;  2L3P A;  4ESR A;  1GRI A;  2AK5 A;  2I0N A;  1JU5 C;  2ED0 A;  3M0Q A;  1AZE A;  1KIK A;  2VKN A;  2DLP A;  2PNI A;  5GJV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...