3GBSA

Crystal structure of aspergillus oryzae cutinase
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
187
structure length
187
Chain Sequence
LTGGDELRDGPCKPITFIFARASTEPGLLGISTGPAVCNRLKLARSGDVACQGVGPRYTADLPSNALPEGTSQAAIAEAQGLFEQAVSKCPDTQIVAGGYSQGTAVMNGAIKRLSADVQDKIKGVVLFGYTRNAQERGQIANFPKDKVKVYCAVGDLVCLGTLIVAPPHFSYLSDTGDASDFLLSQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional studies of Aspergillus oryzae cutinase: enhanced thermostability and hydrolytic activity of synthetic ester and polyester degradation.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
molecule keywords Cutinase 1
total genus 67
structure length 187
sequence length 187
ec nomenclature ec 3.1.1.74: Cutinase.
pdb deposition date 2009-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01083 Cutinase Cutinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3gbsA00
2OCLA 3C8DA 5EIAA 1WHSA 3R0VA 5A71A 2WUDA 1DX4A 1CPYA 4OB6A 2XUGA 3QPAA 1OCEA 2CZQA 4X71A 3STYA 4MWTA 2QR5A 5FPQA 1OXMA 2QT9A 4IO0A 4HRYA 4Q3LA 2C7BA 2PSJA 4J0GA 4F21A 4CCYB 3VKFA 1TKRA 2WTMA 4J03A 1GQRA 3PUIA 2BJHA 5AKLA 2V98A 4B9AA 2CBGA 4AB1A 2XLBA 1XRMA 4MQMA 3G9UA 1U65A 1MAHA 4W1PA 5CT6A 4KAJA 4J0HA 4IH4A 1VE7A 4E14A 3A2LA 4H7IA 5ALZA 4W1QA 5I7UA 1CUEA 2IIVA 1W6RA 2O7RA 3FWHA 4CCYA 2GBGA 1XZDA 1CUXA 2AJDA 3Q8WA 4U2GA 3PI6A 3K6KA 3LLCA 4WFKA 1DWQA 2WSLA 4KE6A 1QIKA 3H0CA 2WM2A 1IUPA 5LZ8A 4KR0A 4L9AA 3D2BA 4EY4A 5ALOA 1YS2X 4WY5A 3ZLUA 5AKYA 4Y2TA 1AGYA 1A8SA 5IVKA 1WB6A 2VJAA 2QJWA 2Q0XA 1TCCA 4UBIA 2QMQA 1QONA 3C8HA 3QZUA 3H04A 4X95A 1LPSA 1QIJA 3QMVA 1TCAA 4K6KA 3OPMA 1QGED 5SYNA 5JD4A 1FFAA 3D5EA 4GXNA 1X70A 1G4HA 1ZI9A 3PICA 3R3UA 1WOMA 1JT2A 5AJHA 3TRDA 3DQZA 3QYJA 5LKRA 2ZYSA 1N8SA 2QM0A 4FNGA 1GXSA 1TK3A 4GW3A 4BDTA 1U8EA 1ISPA 2V96A 1N1MA 1ORVA 1R9MA 5T4HA 2GYVA 4TPKA 1R88A 1RWQA 3IUMA 3E4DA 5HF8A 5JZSA 5CT8A 3WLAA 1G5FA 1TRHA 4ZXFA 5K3FA 5LZ2A 4UUQA 2OXEA 1IUOA 3RARA 1LLFA 2VJBA 2O2IA 4NZZA 2WJ6A 3TGLA 3G0CA 5FKJA 4OYLA 4JNCA 4X6YA 2XQGA 2H7YA 3GBSA 3PF9A 2R8BA 1CUIA 2O7VA 5ALHA 1MX1A 4LXHA 5HKBA 1YA4A 4B80A 1J07A 3C5VA 3QITA 2XUAA 2YASA 1XKTA 5ALXA 5BOVA 3OOSA 1DINA 1VLQA 3WWCA 2ROQA 2XUKA 4F0JA 1XQWA 4UHHA 2HA5A 4QLOA 2VATA 3AZOA 3HABA 3DKRA 5ALEA 2QOEA 3AJAA 5AO9A 3UMJA 5CBKA 3BF7A 5DNVA 2VSQA 4AMZA 3P2MA 5FP0A 5E4TA 4QDUA 3KD2A 1FFDA 4S0XA 2HA4A 3G0BA 3FAKA 1B6GA 2XMBA 1XZBA 4Y2XA 5HFNA 2I3DA 3L1IA 2PPLA 2BUCA 3F97A 2EDAA 3G0IA 4MEBA 4AO7A 1QZ3A 3K2IA 2ZVDA 4PSCA 4DTCA 2ECFA 4HZGA 3EQ9A 4F5ZA 4BCBA 2G63A 2BAGA 3R3WA 2D0DA 2RHTA 5K3AA 3MVEA 4DMHA 2VJCA 4DM7A 1CLEA 2HFJA 4G8CA 2RI6A 4AO8A 3FBWA 1ZIXA 4K6GA 4NS4A 1UK9A 2C0QA 3SWWA 3WK6A 1EDBA 2I03A 2XMCA 3BIXA 5JZ9A 2Y6UA 2R11A 2XMSA 2BUAA 2ZJFA 1CUUA 2C0PA 2WFLA 3BJMA 3WWEA 4Y2QA 3WKEA 4D9JA 4X00A 4U2CA 4JUIA 1MU0A 5T4BA 1XZIA 1JI3A 1CFJA 4J7AA 2W6CX 1LZKA 2XUIA 3T52A 1DT5A 1ZD2P 2PM8A 1CUZA 2WQZA 1ZIYA 4P08A 3O4IA 3HACA 3UUFA 3VJKA 2WFZA 3V1LA 3B3QA 3PF8A 2HA6A 3R41A 5AM4A 2GYWA 4QA9A 4N8DA 4MYSA 1NU6A 4PQEA 4J0KA 3ANTA 1ACJA 3JW8A 1R1DA 3WWDA 2CKMA 4M0EA 1FFCA 2B9VA 4X91A 4BCDA 2XUDA 4X7BA 2OGZA 3C6XA 3H1AA 3D7RA 4RPCA 3R3XA 1Y7IA 1MTZA 1MPXA 2HRRA 5EI5A 5AK3A 1GKLA 1WCYA 3ICVA 1GGVA 3F98A 4YK7A 3WA7A 5KREA 4I19A 3V48A 2BFNA 4C4XA 1FSSA 1QIIA 5JAOA 3E0XA 2I78A 5CXUA 5JAUA 3A70A 2OG1A 1CR6A 1Y7HA 2Z3WA 2XB6A 3GROA 4UFPA 5DTJA 4MWSA 3SX4A 4W9RA 4RE5A 1Q83A 2PSEA 3ESCA 5FPPA 1IZ8A 4G5XA 2WU4A 1ODCA 1DQYA 1Q0ZA 5HQ3B 4C01A 5FRDA 2J4FA 1CQWA 3OURA 1NU8A 3AILA 1TCBA 5ALVA 1VZ2A 2PUJA 4OB8A 4AO6A 1IMJA 2Z5GA 4UBJA 4EY8A 2VAVA 5FDFA 2OCKA 4M0FA 2H1IA 1VJ5A 4G8DA 4PF1A 4OCZA 4FLFA 1THGA 2YYSA 1DQZA 3WIBA 1JFRA 4Q3KA 5T4EA 3FLBA 3W9UA 3WKCA 2HA3A 1FFEA 4QE3A 3H19A 2JGFA 1YASA 1UOOA 1K5PA 4GBGA 1DTEA 5AIBA 4N5HX 5ALTA 1ACLA 3LP5A 1QFMA 5K3DA 2GYUA 2FX5A 1UK8A 4ZGBA 4BTLA 1Q84A 2VQ6A 3WI7A 1FJ2A 3BF8A 5K3BA 2YXPX 3NUZA 1CUJA 1QE3A 5ALSA 5ALUA 3NOXA 3WA6A 1LZLA 4DNPA 5EGNA 3A2MA 2EDCA 1ETHA 1MJ5A 2QKYA 4QEKA 3HSSA 3CCCA 1L7QA 2AJBA 2DSNA 5HF6A 3M3DA 2ES4A 3WL5A 4ETWA 1UKCA 3W9BA 4OPMA 3I2IA 4UHCA 4GHWA 4GECA 1GKKA 2XMGA 2JGLA 3OC0A 1SCQA 3QBJA 4H7EA 4DNQA 4C4YA 1ZGCA 2WJ4A 2QTBA 1BCRA 4Q82A 4EY7A 4ZV9A 2OGSA 1VKHA 3F8SA 2VAXA 2XQKA 2B61A 3JYHA 4Y2YA 2FJPA 3QPDA 4FNMA 5HFAA 1P0IA 3T4UA 1BN7A 2J3DA 3FYUA 1P0QA 1GZ7A 2HDWA 2ZSIA 2H9YA 2PSDA 5C81A 1GPLA 5JANA 1JKMA 1H23A 4IH1A 1CUSA 5ALJA 1LGYA 3H2IA 4BBZA 4BZZA 3IDAA 3BDVA 3WWOA 2AJ8A 2ACKA 1DU4A 3ICWA 5IH7A 1UK6A 3C70A 3ZWQA 3IUQA 4GEGA 4KE7A 1KU0A 1R50A 1EI9A 1R3DA 4FFWA 4HXGA 4BAZA 1W76A 2JEYA 3LS2A 4IH9A 1SC9A 3WK8A 2VT6A 1QO9A 1EVEA 2XI4A 2C4HA 4Y2RA 1BU8A 2PVSA 1F6WA 1FFBA 4GWLA 5LZ5A 2HADA 1IZ7A 5ALFA 1X2EA 5LZ4A 5YASA 1T2NA 4Y2VA 3FVTA 4WY8A 3M81A 4XJVA 4UBOA 3NGMA 1XQXA 1G66A 5CMLA 4W1SA 1C4XA 5AK6A 2XMDA 5ALPA 3RKSA 1CUWA 5CT9A 3I1IA 4EB0A 1VOTA 4DMFA 1XQVA 2WFLB 3WL8A 1SCIA 4B81A 3FVRA 4XVCA 4FFVA 4BP8A 3IB3A 3DOHA 2C5GA 2WU3A 3W2TA 4KACA 5DTIA 1EINA 4KE8A 4Y2UA 1UOQA 2DR0A 3VDXA 4MYDA 3BDIA 4OU5A 3WYDA 3H1BA 4W1RA 1TIBA 2GBCA 1QLWA 3KOOA 5AM0A 1GPKA 4BAGA 3BWXA 1W4LA 1ZD5A 1VXOA 3BL8A 5KWJA 4X6UA 4O08A 4K2AA 1MAAA 5LIPA 5AK5A 2HA2A 2O2HA 4X93A 3I2JA 5HQ3A 1L7RA 4X97A 2B4KA 1WB4A 3QPCA 2XE4A 2JGEA 3R3ZA 1HKHA 2DHDA 5C7YA 4QWMA 4J0JA 4QZVA 4G1FA 2BGRA 5CXXA 2OPHA 3WL6A 1K6EA 2NW6A 1BROA 4FKBA 4NVRA 2WIJA 1EHYA 3DYVA 4KAFA 4AZ3A 5ISMA 1CUDA 5AKZA 4HXFB 3FCYA 3HJUA 4MQLA 1BEEA 3ILSA 5AICA 5AOBA 4PSDA 2Y6VA 1IVYA 1YAJA 2WUGA 2XUHA 3QM1A 1VXRA 4LHEA 2XMZA 4H77A 5AI9A 5HCUA 1OILA 2JGKA 1M33A 4JYMA 4FWBA 4CFSA 4RE6A 2DQZA 3WZLA 4C88A 5AI5A 5T4FA 4U2DA 5FLKA 2DCMA 2ZJ6A 5AKIA 3V1KA 1E3QA 4L72A 3QMWA 1BN6A 4KEAA 1XKLA 3WK4A 1QTIA 4OUKX 1UWCA 2XUPA 1E66A 5ALGA 4PW0A 5DJ5A 4UBKA 4BTVA 2GZRA 2WHPA 3GFFA 1WHTA 2DHCA 3EBLA 4QDXA 4BE9A 1CUVA 3WJ2A 3W05A 1CVLA 2RHWA 3ANSA 4BE4A 3PE6A 3I2GA 3ESDA 3UUEA 1AMNA 3PDCA 5I9IA 4INZA 3I2HA 3WKDA 4WFIA 5AIAA 1UOPA 1ZICA 3R3VA 3O4GA 3O9MA 3I2KA 5JASA 4DYHA 4AMYA 1MO2A 1DX6A 3KXPA 2X8BA 4OD0A 1XZMA 5DYTA 4WCVA 4DNFA 1EB8A 2PBLA 2QVBA 3IUNA 1LPBB 2JIDA 3IUJA 1MX5A 2Y2UA 3G9TA 4FOLA 1EVQA 3HI4A 3DNMA 3KWFA 1ODSA 1HDEA 5AI0A 4DSZA 4OU4A 2JEZA 3WJ1A 1VE6A 5ALLA 3U0VA 4KJXA 1UKAA 5IVDA 4LXGA 4EUSA 3STVA 1YB7A 2AJLI 3G9ZA 5HF9A 3ESBA 1X2BA 1PV1A 2PU5A 4UFOA 4DSAA 3D0KA 3E3AA 4B85A 5A2GA 1EK2A 4Y2JA 4J0DA 4RGYA 4WDRA 2QS9A 2XDWA 1CUFA 3DLTA 4CI9A 1KU6A 4BVKA 2VA9A 1MNAA 3STWA 2ACEA 4N8SA 4XIIA 1PFQA 2I3ZA 3FOBA 2VJDA 1XZHA 3VJLA 3AIKA 5AKJA 2QZPA 4WJLA 2PSHA 1XZGA 5A7HA 4PNZA 3BE8A 4V2IA 1CUCA 5ALRA 1CIJA 4L0CA 2OLEA 1EDDA 3I1YA 5LKAA 3LCRA 4A23A 2H7CA 2G4LA 3WYNA 4IQ4A 3C5WP 4X3CA 5AI6A 1T4MA 3ZLTA 2AJCA 5EHNA 5CURA 3KWJA 3FYTA 3I6MA 3H2HA 3BIWA 3C6ZA 1CUHA 3K9BA 1AKNA 1VA5A 4U2BA 5A7GA 1QIEA 2Z8ZA 1EA5A 5LZ9A 3DD5A 3AIMA 2VTVA 4X85A 1D07A 4ROTA 2EEPA 5DNWA 3GUUA 5BV7A 5ALDA 1VZ3A 3HRHA 4UBLA 3W06A 1H2WA 3ZLVA 1RP1A 2XQFA 2XUOA 4MEAA 4DGQA 3G02A 2HIHA 2OAGA 1ZD4A 4DNOA 5DLPA 2E3JA 3DKKA 2HFKA 5C8ZA 2DHEA 1YS1X 3CN7A 5CT4A 3IIIA 3WQHA 2PSFA 3V9AA 2CJPA 4A16A 4H7DA 4QDOA 3GELA 3S8YA 4UBNA 3CCBA 2QUAA 4P93A 5AP9A 3AFIA 5C8VA 4OSEA 4AQDA 2X5XA 3C43A 2J4CA 3AZQA 2FJ0A 1JJFA 4U2EA 3DEAA 2QXTA 3TEJA 3FNBA 2PL5A 5JD5A 1BS9A 1EDEA 1UK7A 2ZJ7A 1JU3A 3N0TA 1MX9A 1HL7A 4C87A 4HXEB 4UHBA 5ALMA 5CH5A 4QDTA 5A6VA 1ZGBA 3M82A 3ZV7A 3MUNA 5HZGA 3SK0A 3B5EA 2HU7A 2V97A 4B0PA 3STXA 4J0IA 4OB7A 1HQDA 1JJBA 1F0PA 4YPVA 1R4ZA 1WB5A 5DYWA 1LPNA 1TQHA 3SC2A 4BCCA 1XZFA 2WIGA 2BCEA 4HAIA 1B41A 4LYEA 2WG2A 4KE9A 4H0CA 1ZOIA 4FDMA 5HK9A 2YH2A 5F4ZA 5AI4A 5A7FA 4G4JA 2WIDA 2JBWA 2FUKA 4IHAA 3WK7A 3O9VA 1W1IA 1ZI8A 1XRNA 2B20A 2X76A 1XROA 1EX9A 2WILA 4K5QA 2WJ3A 2HHAA 1G42A 4LYDA 4C89A 3G0DA 1DWPA 4LXIA 3H2GA 4EY6A 4Q1VA 2WFMA 5IKXA 4G8BA 2HRQA 1BRTA 3D3NA 5DNUA 1XFDA 1C7IA 5LLSA 4B6GA 1U4NA 1H2YA 3Q0TA 4LKOA 4B9EA 3FSGD 3IA2A 3VJMA 1C7JA 5AHXA 3QH4A 5ALIA 4MXDA 3DOIA 1LPAB 2W22A 3IBTA 4H7HA 1W52X 3G8YA 4PO3X 1K4YA 3WZMA 2OCIA 1ZJ4A 1CUYA 2WKWA 3HXKA 3EF3A 3OG9A 2XMRA 5AOAA 1XQYA 4UBMA 4Q05A 4A5SA 5ALQA 3D2AA 5J3JA 3STUA 3A2NA 2RAUA 3O0DA 2QXUA 4Y2SA 5H3HA 2IX9A 4X6XA 3V1MA 3TJMA 3G0GA 3U1TA 2V9ZA 1CUBA 1CRLA 1XRPA 2RONA 4P9NA 5A62A 4FTWA 3AUKA 3R40A 4XX1A 3D4LA 5IVHA 1WM1A 1YB6A 1QIDA 3DDUA 4Y7DA 2K2QB 5EHQA 1NX9A 5AKEA 1LPPA 3G9XA 4C6HA 4B83A 2H7XA 1KEZA 2HA7A 3D2CA 4HVTA 1XLVA 4ZWNA 1HPLA 3WIOA 2C58A 4EHBA 4XWGA 1O6GA 1QFSA 3GA7A 4G4IA 4BC0A 5K3EA 1A8QA 1UT6A 1SFRA 4B7ZA 4BAUA 1EB9A 5EIHA 5JARA 4AZ0A 1S8OA 2G5TA 1O6FA 2IITA 1U2EA 3C87A 1ZI6A 5JYCA 2ORYA 4AN1A 1EXWA 3EIOA 4BB0A 3R3YA 1PJAA 5JD6A 4YASA 1YA8A 4H7JA 3HLKA 5HK8A 4BZWA 2VT7A 3EQ7A 2GBIA 4JYPA 2P8SA 7YASA 2ZYIA 2Z8XA 1QIHA 1JMKC 1YAHA 4BDSA 3FYUC 4F60A 4X90A 2PUHA 3CN9A 3H2KA 4KYVA 5E4YA 4Y9SA 5JAPA 2CUTA 5C8XA 3O4HA 4B82A 2JGIA 1CV2A 2QJRA 4GI1A 1ZJ5A 2O2GA 5BWCA 5BWBA 5CW2A 2ZYRA 3RLIA 1ZD3A 4H18A 1LBSA 2JGMA 5EFZA 1LBTA 4E15A 4K6HA 2OQIA 2VEOA 3EQ8A 1MT3A 1ODTC 1E8NA 1R9NA 4UFNA 5AKKA 5CRIA 3KSRA 1QOZA 4FLMA 5JAHA 1TAHA 5ESRA 2PKYX 5ALKA 2WG1A 1DT3A 4QLAA 2BKLA 3S2ZA 4J0CA 4L3WA 2OQVA 1CUGA 3FLAA 5CH8A 4DLNA 2LIPA 4ARAA 3C6BA 3STTA 1Y37A 1A7UA 5K3FB 3BJRA 2DQYA 4KAAA 2Y1KA 3WK9A 1AQLA 5AKGA 1QIMA 3DYIA 4TVKA 4BC1A 5CTAA 3WKBA 5LYYA 4EBBA 4EA6A 5JALA 4YX9A 4MJ3A 4BVJA 1WPXA 2G5PA 1XRLA 3HEAA 1BCSA 1VA4A 1EK1A 1AZWA 2DFPA 6YASA 1L7AA 5D3KA 1Z68A 3RK4A 2BUBA 3DJYA 4ZRDA 3MUOA 5FUMA 1E8MA 2CB9A 3DCNA 4LIPD 1UKBA 2WG0A 4BVLA 4I3FA 1CUAA 1QJ4A 1MN6A 3L1JA 4FLEA 5JATA 3M83A 1AC5A 1BEZA 2WUFA 3PFBA 4W63A 3HYSA 4QWWA 2WHPB 1AUOA 1GT6A 5ALWA 4CCWA 2WIFA 3N2ZB 3LIPA 4Q3OA 5HKAA 4Q34A 4TGLA 3HZOA 2PU7A 2ZYHA 3D59A 2J3QA 3I6ZA 2VF2A 1E8DA 3WWPA 5AM5A 5JZBA 5EIEA 2QRUA 2CMFA 5ALNA 1JJIA 4PV7A 5E4JA 3RM3A 5AH0A 1XZAA 4QNNA 3LIIA 4G9EA 1DWOA 3ZI7A 4NMWA 2PX6A 1A8UA 1LPOA 2RIPA 3ESAA 4ZV7A 2AXEA 1JMYA 4BATA 1XZJA 5D6OA 3NWOA 1LPMA 2RGUA 4CIBA 3VVMA 3H18A 1EH5A 3WL7A 4B0OA 3DL4A 4BRZA 2C5FA 1WPRA 3V1NA 3AZPA 5EHXA 3IURA 1E5TA 3O4JA 3DS8A 4CIAA 2JGJA 3O95A 3F9CA 2XUQA 5KWIA 4C4ZA 5AM3A 1XZCA 5K5EA 1F0NA 4M0MA 3GZJA 5DWDA 5AKHA 1UFOA 1GQSA 3WK5A 1A88A 5LP1A 1K63A 1BE0A 3I2FA 5ALYA 4UPDA 4G4GA 4AXBA 5D3ZA 3G7NA 2HU5A 4J3JA 4H7KA 3F96A 4BRSA 1HBJA 4ZI5A 4AN0A 3W04A 1UXOA 1YSCA 1XZEA 4H7FA 4E11A 5JIBA 5SYMA 5E2IA 2ZSHA 2WLSA 5JADA 4ITVA 1I6WA 4WDQA 4EY5A 4H35A 1XZLA 3C45A 1K8QA 1USWA 4BP9A 4FBMA 3PFCA 2QUBA 2HA0A 2HL6A 2WUEA 2JF0A 1GPNA 1ORWA 2HM7A 5IVIA 2OCGA 3KDAA 2Y2VA 5AKXA 4FMPA 1XLWA 1H2XA 2XMQA 4ZREA 3DL7A 2WIKA 2OGTA 5HF5A 2XQJA 3E1GA 4FHZA 5CH3A 1CEXA 4DIUA 4E46A 5AOCA 3WMRA 3H2JA 5CT5A 2HU8A 3QMMA 2WHRA 4QDZA 1XZKA 1XLUA 2XUFA 4CG3A 1QIGA 3FYUB 5EHZA 5AK4A 5AM2A 1N5RA 3PUHA 4X94A 2XLCA 1UZAA 3B12A 5LZ7A 2OAEA 4WFJA 1E89A 4GLBA 3AINA 5AM1A 2Z3ZA 3A6ZA 3FSGA 3I28A 4Z49A 3WKAA 1H2ZA 3I6YA 1IUNA 4HRXA 5FXMA 4CG1A 4EZIA 1Q0RA 4OYYA 4DMCA 4P92A 3F67A 3AIOA 1MNQA 4B84A 3OM8A 4PSUA 4DMKA 3ED1A 1F8UA 1THTA 4CG2A 4GDMA 2ONCA 3IULA 4U2FA 1AURA 2WTNA 1XRRA 3FCXA 1W75A 1HLGA 1AX9A 4Y2PA 5FV4A 1SOMA 2BGNA 1N5MA 1J1IA 2GZSA 2WHQA 3OTQA 3QVMA 4KRYA 4N8EA 1J2EA 4KRXA 4FBLA 1LNSA 2XUJA 3CXUA 4HS9A 3IVMA 4X92A 3VVLA 1YCDA 1JU4A 5KBYA 4UHDA 4BYMA 1P0MA 5I8PA 3H17A 2D5LA 1QO7A 1QTRA 3VXKA 3X3HA 3L1HA 3ZPXA 4AX4A 1CQZA 4N5IX 1P0PA 1QIFA 3JWEA 4RNCA 3YASA 5DYYA 1XRQA 5D7BA 4G9GA 5AI8A 3MGAA 4JH0A 2GBFA 3VISA 1YR2A 2CEKA 2XQIA 3FLEA 3HC7A 2XT0A 4UHEA 4ARBA 4JEIA 2UZ0A 3C6YA 1J06A 1H22A 4HTAA 4I4CA 5K3CA 3BXPA 1SCKA 5FOQA 4UHFA 1RYYA
chains in the Genus database with same CATH superfamily
2VP9A 4EGJA 1HM5A 5EIAA 3T5BA 1CS4C 3M4JA 4AX8A 1RQNA 2ZREA 2RDMA 3E9QA 4WLUA 1U28C 2VLIA 3KOMA 3JAKB 2J9XB 1W581 1WD7A 2AA3A 3SBDA 4AWXA 1I10A 3JD1A 4F2DA 3U6BA 3IQIX 2IPAB 4TV8F 3H8SA 1HV8A 1CPYA 1XEXB 3CWQA 1IJEA 2VNJA 2Z95A 4KYTA 2XNKA 3ILHA 3OIGA 4G0PA 1PAUA 3JD2A 5BSFA 2XUGA 1WAMA 2V74B 3FE2A 3V4PB 1M2OA 3T12A 1IEWA 4CEJA 2C9MA 5C3UA 1V1JA 1E79A 4YR9A 4CF7A 1AXGA 1QH8B 5I7AA 5HUHA 2ZIFA 2AQIA 3AFNA 3K92A 4HRAA 4JLUA 3PP8A 1QVAA 3MGKA 1NZJA 4PFKA 2QN7A 5EJEA 5C53B 3BCHA 3VX3A 5TQVA 3FYDA 2BFDA 1EWTA 4ZHSA 4Q4AB 4UTNA 2VDNB 3QE0A 1B42A 1KAOA 3GVXA 3SHOA 1XFAA 2C84A 2QRKA 5CJPA 4EPTA 3EIUA 1R27A 2WAAA 1Q0QA 3JX9A 1A5AB 2C7BA 2MYPA 5F2OA 1BXZA 4J0GA 5TNXA 4CCYB 1OH7A 1VKRA 2JKZA 2WTMA 3MTIA 4J03A 4XTCS 5KKAA 5LA6F 4MVJM 4DDUA 4WKPA 3TI7A 1N6IA 1HH4A 1YL6A 2JJ2D 3LBNA 3PUIA 2BJHA 4AULA 1RWXA 4ARZA 2ZLBA 5AKLA 2ZM5A 2JGDB 3TAHA 3L01A 3RRJA 3WYCA 1EFDN 2O8EA 5JV5A 4MARA 2XQVA 1PK8A 5FOXA 1PEYA 1FA9A 1HRDA 3ZWBA 1XRMA 4EQ6B 4C5BA 2ZZKA 3G9UA 4Z7NB 1KYQA 5ESDA 4BVGA 2XCTB 4JLNA 3K9HA 3KV1A 3PHGA 1XVUA 1NMXA 4J0HA 4WK0B 1MIOB 4IH4A 3WLNA 3ZI4A 5L7TA 1OFHA 2X14A 2Y05A 2NXCA 3KU1A 3E53A 4H31A 2H8KA 2HMTA 1FUUA 1K6JA 3MWKA 4MV6A 5IJZA 1IM8A 3QBDA 2VLBA 2BJVA 3ODGA 5ALZA 2FZ4A 4DSNA 4YCMA 5CYGA 5I7UA 1MO3A 1D04A 3HXOA 3T5CA 2IIVA 5F1YA 2GRUA 1GILA 1B26A 4XSVA 4XDHA 5J2TB 2O7RA 1J5XA 2VH5R 4RVSA 3N9IA 2ZBVA 3E8XA 3UAXA 1U9YA 5KU1A 2G5CA 5T7BA 1PR2A 2A7XA 4COOA 1XZDA 2OBBA 1IHXA 1QGZA 2O50A 2WHEA 1XU4A 2FW1A 4H6PA 3RSOA 4BVAA 1B73A 4GWKA 4RD0A 4M8KA 2ZAMA 1JHMA 2ZBGA 3KYIB 1FYXA 3SNHA 3IT2A 1RS0A 4FQ8A 3D81A 4I55A 1AU9A 1EFRA 2B7BA 1FMTA 3INRA 1S2GA 1JAXA 1NV9A 3LBFA 2DP4E 5JXIA 2WSLA 4KE6A 5AVJA 2WM2A 3JD4A 4MDFA 2IOYA 4KSYA 2R7LA 3ADCA 4C07A 4RY8A 1WIWA 2QRZA 2VXBA 4CMEA 4ZCLA 1HT3A 2X6TA 2GS9A 1AGRA 5DM2A 4RHEA 4GDFA 1PQUA 1SCUA 4JZKA 1DUIA 1N9GB 1S2MA 4L9AA 4M0UA 4MINA 4QXRA 4AK9A 3MRVA 5HIKA 1ISFA 1V48A 4AS1A 5KHLB 2HSGA 4QGFA 5D1HA 4JV5B 4WY5A 1M7HA 3EHEA 4QVIA 2G72A 4IDEA 5IMSA 5JDIC 4YRBA 4YRDA 2WSYB 3QFTA 1K0UA 3REQA 3ZE8A 4LJ5A 1GFIA 3HVIA 4QHTA 2O57A 2I2AA 1H8ED 2XTAA 1M8JA 1WB6A 1XU7A 5IVKA 4FR2A 1IXRC 4KNWA 2D2EA 1M0EA 3KVNA 1QONA 4O4IA 5AVXA 3PEVA 2V0CA 1U9JA 4Z8YA 2XRMA 3CWCA 5DVZA 1LPSA 1BE8A 1OXUA 3BUSA 4MS1B 1VG1A 1OLUB 1PVOA 3ADDA 4FYWA 2VPXA 4RAQA 1V9CA 1Z0AA 1JZSA 3N7TA 1O94C 4KLAA 1EYZA 4KQFA 4NU5A 1RKVA 4HS4A 1O94D 1Q91A 1K7XB 4CM7A 4TL8A 5CW1A 4PN3A 1T10A 5A3JA 2Z04A 5C35A 2QN9A 3UGQA 1ZUNA 3H8VA 5A5FA 5IKOA 3QUQA 3AC0A 3EIQA 2WNIA 2AKEA 3MD9A 2AUNA 3FGZA 3T3NA 4WKCA 2CV2A 1UBGA 4FDLA 4YAUA 2QLLA 5JPDA 4JHXA 4EDFA 1JYSA 1TAGA 1ZUD1 2CXQA 2Q1YA 2R6ZA 1MQ9A 3DZIA 1QH0A 3U3OA 4HDSA 4L73A 4ILEA 4DV0B 2J87A 2EYQA 2G06A 1CYDA 4GNKA 4P83A 3X2FA 3O3CA 1FJGB 4JP3A 2AFRA 1NQ5A 3KXDA 3QYJA 4TWBA 5BUCA 5LKRA 3G2IA 2ZYSA 3JQFC 4PHCA 3K0FA 1O57A 4RPGA 3ZCVA 3S8EA 4ZO6A 2QZZA 3TBHA 2GO1A 2UZ3A 3FETA 5TPZD 4TRRA 2ID8A 3MJRA 2VH1A 3HKBA 4YJ2A 2BY4A 1UBFA 1U8EA 1W9HA 4LSZA 2J7PA 2CGEA 3OFJA 3PT9A 1OH8A 4HNRA 5BSTA 4GLLA 5G1OA 1RJDA 2VZLA 4F86A 2ZAOA 2B0JA 3B3FA 5BN4A 4HSEA 5E7JA 1DIHA 2OUKA 3TSOA 3HB1A 1JG7A 2JLSA 3HVJA 1FQWA 1RACA 2IDMA 2Z6AA 1CJTC 1RZUA 1B93A 1RWQA 3IUMA 3CYFA 3I9V1 3QF4A 4I66A 1G8KA 5A0FA 3E4DA 3Q7SA 3VYRB 1X7HA 5HF8A 4BKRA 5JZSA 1ZKDA 2R87A 3WLAA 4C6SA 4D9FA 4LJ9A 1ZWKA 2PWPA 4GBJA 1J21A 5EJFA 3UPUA 1Z4OA 4LPKA 4TKLA 2AMYA 3NG1A 5SZJA 3RARA 3N8DA 5BW6B 4RJTA 1IOZA 1JJAA 4PLPA 2CNKA 5ENDA 3G23A 3IA7A 1UDBA 1U8CB 2PXCA 3TSYA 3PC8A 2GZ1A 4BXOB 1CDOA 3H6HA 3ORQA 1HLDA 4M1QA 3G0CA 4NAVA 5FKJA 4JNCA 1GAQA 4OI4A 4X6YA 2ZJOA 1IVSA 1J2UA 2CWWA 4D8XA 3ANMA 5I4IA 5CK4A 5JW6A 4FDAA 3ZZTA 2XTZA 3U49A 1EIWA 1CUIA 2TMYA 3K16A 1MX1A 1KEEB 4LXHA 4NMXB 4RIFA 4GYKA 4UUBA 1YA4A 5LB4A 3A6HA 4DC9A 3ZIDA 3DKIA 4F2GA 1ECJA 2WB2A 3SKXA 4E51A 2XUAA 5F64A 3ZXUB 2IS6A 1BWPA 3QPVA 2YASA 1PNTA 4JX9A 5KQRA 5ALXA 1Z63A 3GZTB 4L4SA 1UC5B 2PFKA 3TBFA 4S1TA 2NU9A 1VLQA 3AY7A 1W25A 2CJXA 2NVBA 3PKZA 4QFMA 1NNSA 1UODA 2VDJA 4MYTA 4RGQA 3IPYA 5ILQA 1DQPA 3TBKA 1RLMA 4QLOA 1G8HA 3C5EA 2REQB 2P2NA 4OQQA 1PR6A 4AZ3B 4H6VA 3AJAA 1SIBE 2C20A 4AKHA 1WP4A 2KBEA 4AMZA 3DAGA 3MJVA 2AV6A 3U1BA 2CLLB 5FP0A 1SQ5A 3DR5A 1JSLA 2AQKA 3JPYA 1ZA2A 4Q03A 5E4TA 3V55A 1FFDA 4MWGA 3RHFA 2JGNA 3T7TA 1JB9A 2PEZA 4HZUB 4YJGB 5D5PA 4Z4QA 3VYTB 2QU8A 4HQFA 1D2EA 1TI7A 2WHXA 3MMZA 3HUEA 1X80A 5K6RA 1GWNA 1VE5A 2J1LA 4Y2XA 3ZNOA 5HFNA 3RVNA 2C97A 4C76A 1OMOA 2OM2A 3A3KA 2Z6QA 1KRXA 1KQNA 3VMMA 3UGTA 2GH1A 3WMEA 3GP8A 2Q0SA 2C82A 4NXMB 2F9FA 3UJBA 1JB1A 1GUBA 2ZT5A 3F97A 4B47A 4MMZB 2AMVA 3VSEA 1VPLA 4MEBA 2MSNA 2B8EA 4AO7A 2QAGA 1I7PA 3ILYA 1IU9A 1SBZA 3K2IA 4G5QA 1PE0A 3OZWA 1EDZA 4D8UA 1E92A 2IIPA 2G70A 2II6A 3HSKA 1Z37A 2R4QA 3CUTA 1B8UA 5ESWA 1CF9A 4OK6A 1AUQA 3B1XA 4CMGA 4C7XA 4DXDA 1NF3A 5KJCA 3OT4A 3AR2A 5EYPB 3BWVA 1NYTA 1TZJA 3GYBA 2NAFA 3IB6A 5J5VA 3PQ4A 2G63A 2PMCA 1MVOA 4P84A 5K3SA 4I0WB 4EB6B 2H0AA 1QHSA 1YQDA 3IR5A 3R3WA 1QWOA 5KWVA 1M2KA 1GNRA 1OVMA 4Y98A 4NJEA 5IEBA 3ZE1B 4DMHA 4KXFB 1T6BY 1OX6A 2H08A 2PZJA 4HH1A 4ATNA 1USVA 3DDWA 2Q6LA 2OILA 2RI6A 4AO8A 2PS0A 3FBWA 1ZIXA 5JCPA 1OFIA 1Z0SA 4J1NA 2BGGA 3OOWA 4JL8A 4NYIQ 3SC3A 2IU4A 3ZH2A 4B5KA 5I4CA 1EFTA 1ZL2A 2I03A 2XMCA 3BIXA 1DTSA 1TYCA 3HI6A 4ZVTA 3H5IA 1QRTA 3OIFA 1OKKD 2XMSA 2BUAA 4OQMA 1U3VA 4KQHA 1S6YA 3BSFA 3SHVA 5AUPB 5K8CA 2QJOA 2RARA 2P6NA 3PNPA 4RWEA 4BN0A 2R8ZA 1BKDR 2P75A 1W8IA 3OJEA 1DCMA 1TT5B 3PHJA 3WKEA 1NF2A 1Q77A 4LJ4A 4DF3A 4A6EA 1G3MA 1NW3A 3WFJA 2VJKA 4F1JA 3TCNA 3U3RA 5BVHA 1DDOA 1NKTA 5B7GA 1MU0A 1IBRA 5T4BA 1YF3A 1CFJA 2R8PA 4B3DA 4KBGA 1U7UA 3R9XA 3ZVLA 2YHSA 2A9QA 2V5AA 1PNRA 4HSGA 1CWUA 3M6UA 2RGYA 4WVFA 4ISCA 1HI9A 3DQQA 3GJSA 3X43A 4RLQA 3TFOA 4NH0A 3VJKA 2FRDC 4Y3UA 1N5IA 1KKLA 3DXYA 3UJAA 2JZOA 3B3QA 3CONA 3V1LA 2HA6A 1Y9JA 2RGDA 4RGBA 4MW6A 3ZWVA 4QJBA 3WNQA 3W5AA 1C5KA 1KDRA 4QA9A 1VL8A 2NTYC 3NUQA 5J4HA 2YOFA 3ANTA 4B6PA 2WSSD 3SI7A 1ACJA 1OT5A 1Z75A 2OAQ1 1PUXA 1BGVA 3AB7A 3AK4A 4KC0A 3TFQA 5BMVA 3JW8A 1R1DA 5LP6A 1P9OA 1JG4A 1U8XX 5AXAA 4XUDA 4ANFA 5JI2E 5LOVA 4TWIA 3CZ5A 3NR2A 2I67A 3CX8A 4WEOA 2G88A 4YXWD 3PUXA 3EPKA 3THYB 3CZ9A 3W8RA 4NK4A 3GG2A 4QYSA 2NSHA 3DR3A 2XOEA 3COJA 4ZO4A 2OGZA 2H9AA 2Q5EA 3C6XA 3IALA 3O83A 3EXHC 1XMVA 2QU7A 1VMAA 3DNPA 3HYRA 5JI3E 2AQHA 2E49A 3CHYA 2J3MA 5FORA 4S1WA 1BH2A 2RK4A 1VP3A 3R3XA 4FWIB 5ICFA 1Y7IA 1KI2A 3LT1A 5G0VA 5J2UB 2EF0A 1Q50A 2Q8QA 5K6AA 1MPXA 2GHQA 4U6SA 2HRRA 4UCQA 1KO8A 3ETNA 4OH7A 4B3GA 5P8WA 3DZ8A 3NYIA 1SXGA 5JT1A 1FX0A 1KBOA 1GKLA 1N6RA 3ZGVA 3BL6A 4BGVA 4RVNA 4B33A 4NV0A 2GSWA 4NJEB 3PD7A 1ZM4A 4RLHA 3F98A 5HE9A 2R6GA 3WA7A 2FEPA 1FFXA 2HBRA 4N9WA 2LR0A 3OQ6A 1V16B 5FUVA 3KUCA 2BFNA 4BB6A 3R8XA 1R0RE 5MGBA 4PPNA 2WKPA 3LU1A 4ND8A 3ZE2B 2ZDQA 4YQEA 5JAOA 3E0XA 1FTYA 2BM1A 4CU5A 3ZUGA 2I78A 3LTEA 5JAUA 3F8WA 1TD9A 1XA0A 3NATA 4QPPA 4EX6A 3F5QA 5CDYA 3P2OA 5GJVC 5KNBA 4EFNA 2O3UA 1Z6ZA 2BKAA 3EISA 3ZZ1A 1JP7A 2D59A 5AESA 2HUNA 1XQ9A 3DAYA 4J7XA 4M0KA 4QRIA 5DM1A 1JHZA 1QB8A 4JI1B 3T7EA 4E4RA 3GROA 2RGAA 1P39A 2W71A 1FRQA 2WT9A 1M0WA 3AM4A 1QKJA 4PBRA 4KZKA 3K3PA 1CZHA 5FBVB 4CL2A 5FX2A 3CX4A 4MWSA 3DV0A 5JNUA 1UBNA 1Q83A 1R0BA 4OREX 5H4GA 5HPYB 1N0VC 2X1MA 1U0LA 1WNFA 2HZ7A 4O4JF 2REXB 4LFCB 3PKJA 4QU9A 1OREA 3PC7A 2FF7A 3UOAB 3C24A 3FPJA 3HFRA 1ISJA 1ESCA 2J59A 1Z7YA 4DA0A 1DQYA 3HU2A 3W9YA 5HQ3B 2HK8A 3H3FA 3ZW9A 2J4FA 2P68A 1TIKA 1GSAA 2R68A 3WGMA 5BSMA 3ENKA 3JQ6A 3ZDAA 1QQ6A 2VQSA 2Q6TA 5JTUA 3WICA 2PUJA 1U3WA 2OM6A 4OB8A 3UN1A 3E7PA 4IEFB 5J2TA 2FQYA 3WB1A 1YZHA 2Z5GA 3BZUA 4DQ0A 3NBAA 4ZT6A 3T6KA 1Q3KA 1E99A 1WMEA 4PNHA 4PWYA 3KL4A 1OU4A 4TN1A 5FDFA 5M2QA 1ZMRA 2OCKA 5KYYB 2NU7A 3NIFB 2P7IA 1XGKA 2Z57A 4WW0A 1O9HA 1C3OA 3BX1A 4FOSA 3UB3A 2I4NA 1VJ5A 3N0WA 4BASA 1C30A 2C94A 1JR4A 4ZARA 3HEBA 1MIOA 2OKGA 1UPUA 1YA6A 4FLFA 4PRYA 1THGA 2DF8A 1XV5A 3MILA 2YYSA 1HK7A 1BMTA 3D3KA 4QXQA 3DZJA 2ZR7A 2GPWA 5KWSA 2C4TA 1GCOA 3KO8A 5TMDA 2J7PD 3E2PA 4CEHA 2XZLA 1SEPA 4JT9A 1BE1A 1IPEA 4IDGA 4ZVOA 3TSZA 3I61A 1S2DA 1DUSA 1KFBB 2SHKA 4ZYVA 1CJKC 3PS9A 3P52A 4JJ6A 3X44A 4DAEA 5LC1A 2HLNA 4YT8A 1YASA 1UOOA 4Q37A 1XVLA 4YV7A 3PT5A 1CDZA 3CNQS 2HQBA 2LKCA 3CNLA 4AVYA 3WBKA 4DWVA 1DTEA 5A0VA 3L7DA 3DLAA 4UE3S 4V0ME 1FYFA 4UPEA 1NXQA 4JUAA 4PQGA 1BIFA 4RCVA 1Y1RA 2VCHA 2JLWA 2CXTA 2ODWA 4PTLA 2Y0CA 1K5GA 3CF0A 4EI9A 1NC3A 3TUJC 3DOJA 4O2AA 1MJNA 3R5XA 3ZDFA 2AOUB 2GTPA 2HQRA 3E8MA 2D4AA 2FXIA 4ZAGA 2OORA 2D1FA 2WTBA 3K8YA 1K7EB 2J7KA 5H16A 4YR7A 3HM9A 3P45A 4YT2A 5FR1A 2O8EB 1RDFA 2FX5A 2ZRFA 4AYXA 3PXXA 4KNVA 3ANLA 4GSLA 4BTLA 1Q84A 3AMVA 1QM5A 3ICPA 4UW9A 3MWJA 4X3PA 1D1SA 5EKSA 4CQNA 4BNTA 3AFGA 2J5RA 4OJMX 1D4ZA 4Z8XA 2N9UA 3OTHA 4J76A 1DDIA 4D2IA 4MQBA 4BQOA 4HF7A 3R20A 1FJ2A 4NNPA 4U6QA 3WI7A 4XLZA 5F9HA 1HE1C 2SNIE 1V7CA 4F3NA 4JOCA 3RFUA 2VPQA 4I7EA 1AKYA 4PLZA 3WA6A 4MW7A 1WE2A 3QEKA 3UH0A 13PKA 3HADA 1DEAA 1N0WA 5IVPA 4OJTA 2R751 4K3VA 1OYWA 1V1MA 4PZYA 4U0JA 2IYSA 1ZCAA 1I6MA 2CKDA 2HAEA 2PA0A 4KFTA 3NTOA 5T5QA 3DOEA 3T06B 2R6FA 2ZTSA 4QUBA 3IKMB 4U2KA 1QTQA 1J0CA 1E4YA 1L5SA 1MFPA 1O77A 3KJZA 4OK5A 3RUDA 3HCCA 4C20A 1I4WA 2W70A 1MENA 3RS3A 3TN7A 3HSSA 3V46A 3CCCA 4G2TA 1KWKA 2DSNA 3MBKA 4MHTA 3R7NA 1Y6ZA 2ORIA 3INNA 3BD6A 3K8QA 4FSDA 3BFXA 4QX6A 4RD3A 4GX5A 2WJVA 2ANBA 3OU7A 4UXJA 3O8NA 3WGUA 3WL5A 3HM2A 4JKIA 2B25A 5DE3A 1Y6JA 1P2DA 2Z9DA 1KJYA 3B78A 4ETWA 1UKCA 2IKQA 2X0NA 3W9BA 2ZXFA 1L5ZA 3I2IA 5CB8A 1GZ3A 2HI0A 2G77B 2XKBA 5AW1A 5MN4A 1L4EA 2JBHA 3UWOA 2R79A 3HPQA 4M22A 4BZQA 3W2IA 2IYVA 3TSCA 3O9ZA 2RGWA 4WZBE 4XD2A 4A8HA 4C4YA 4F3CA 3AERB 3T95A 1Z33A 2ZTUA 4MQFB 3L8HA 4DLYA 3RF6A 4X7MA 3W8FA 2O0HA 1DMSA 2ZIZA 4MWEA 4JQSA 4CIWA 1D2AA 4NL4H 1XYVA 3OZSA 4O4JB 2VAXA 4YECA 1UDCA 3KTOA 1H0SA 4LVNA 1UKEA 1N5DA 3K09C 4MVJF 2VWQA 3T7JA 2AG6A 2XQKA 4ENSA 4L9SA 4L07A 1J8FA 2G0AA 3ES9A 3KSDO 3SE7A 1SUFA 3EPPA 2G76A 2QENA 3BL5A 2O06A 2VPZA 4RSHA 2OV1A 2JAUA 3FCEA 3K0HA 2CMHA 4X9XA 2N1BA 1P0IA 3ASZA 3R9WA 2OCAA 4TT8A 2IK8A 3UWPA 3QUTA 3H5WA 4B6OA 5ADVA 2O20A 2Q4OA 2VC2B 3KC2A 2FSUA 1GQFA 1J2JA 2EKBA 5G0TA 4BFSA 4I5GA 3GYGA 2E4VA 1OC4A 1P0QA 4LE1A 4Q93A 3TNJA 4D1YA 1QGYA 2H9YA 5IYZF 4WZ6A 5DNDA 5BSHA 6REQA 2GSDA 3DQPA 4TVOA 1UDRA 2SCUB 2GN9A 4ZZ2A 5CNMA 4BIIA 5IBRA 2W2TA 3HR7A 4FNOA 4JI5B 3P2KA 3Q11A 3PI7A 1YR3A 2X6RA 1NT2A 4KIUA 4OY3A 4R9SA 3WWOA 3TEMA 2J4DA 3ZHSA 4WKBA 2OB1A 5J47A 3LMKA 1V6CA 4NRDA 3SXJA 3MRXA 2ZKLA 3RTAA 4LDPA 3U4GA 3BEDA 2IHNA 1BHJA 1T5IA 1UC9A 1A9SA 4I6JA 1UP6A 4GOLD 4GEGA 5CDTA 1Z6PA 3H0EA 5D87A 4RUKA 4M21A 1T1EA 4KK4A 1K86A 4GZMA 4DV7B 3AGQA 2R7NA 3KNZA 3H75A 4H6XA 4HJXA 5G0UA 3WRXA 1E3LA 4CT5A 1LDMA 2B8JA 2KLHA 2ZYTX 1EFKA 3LX8A 2C98A 3ENQA 4UUPA 4JP5A 3ET5A 5EQTA 1SUSA 3OT1B 4MLCA 4XPIB 3EDMA 1KYIA 1PKEA 4HEQA 4DLBA 4BAZA 4QHYA 1HTBA 2I4OA 2OC4A 3A6KA 5TEWA 1R15A 1X1DA 2QHXA 2YDYA 1PGNA 1U3FA 1G5QA 4IH9A 4X6LA 2ONZA 3CJTA 2QN3A 4NWIA 2WM9B 2I3BA 3LQRA 2VT6A 1IOWA 3CH5A 4FYIA 5SY4A 1QO9A 5TVGA 4LFBB 1EVEA 3HVKA 1L7BA 4YAGA 1H9AA 3IQZA 2R8YA 3K1TA 4U3JB 4FYYA 3WLOA 3K35A 2GYYA 4G63A 4IJ5A 5B3JA 4GWLA 1Z26A 3RCBA 2HHJA 4YRJA 1CR4A 3O91A 2AG1A 1S8AA 1WV1A 3GFQA 1IZ7A 1QDLB 1K9VF 1F6DA 4MP3A 3KL2A 5FQNA 4EITA 3V1YA 3U5ZB 1Y8ZA 1JPVA 4FFSA 4EGSA 1P72A 1G38A 2PQ0A 4JA0A 3L7OA 2B94A 3GZ4A 4O3MA 2XZTA 3R7FA 1RI1A 2YZGA 1Y4SA 2J6HA 4PO9A 3TW6A 2BLNA 1E3WB 3NHSA 2FRXA 2HN9A 4GX1A 4ID3A 3GGSA 3LOPA 3UK1A 3NGMA 4PC7A 4C0QC 4H1UA 4MUKA 4I4TB 4Q7LA 2CE7A 3NBYC 4R3WA 3UYLA 5F7XA 3THWB 4JQCA 2ODAA 2P69A 4BMDA 1RMTA 1S7CA 2GPBA 3DH0A 1U0EA 3A11A 4FGWA 4HWTA 3BOSA 3QHPA 1JBKA 3CX7A 4EA9A 3RKSA 3SZLA 1CUWA 2M6LA 1RBMA 2Q1UA 1AB6A 5EPOA 3UUGA 3W2FA 2OESA 2D62A 3F8TA 4EB0A 4DR3B 4DMFA 4TM8A 2AF3C 2IP4A 3BGOS 3O74A 4PLCA 4WZAB 3U7JA 4EO4A 4L28A 3WL8A 4BLPA 4XVCA 3MN1A 3DOHA 1M2EA 4WBXC 5DNYB 4ECEA 4AJKA 2GK3A 2WM8A 1IULA 1N2ZA 3G89A 1K92A 4JU8A 1XRJA 1X3SA 3EOBI 4GUDA 1WB9A 1E2NA 3B89A 3NDRA 2AEMA 2I87A 4MOWA 3UW3A 4X1IB 4DFDA 4NTZA 5IJXA 3QF7A 4ZIRA 3I5XA 5CM9C 1YR8A 2WPNA 3GLVA 2CDRA 3RIHA 3VDXA 1ZH2A 1SHUX 1GLVA 5L3ZA 4N4AA 5TQ2A 3OZXA 4GSKA 2FN9A 4BZXA 5FI1B 3H1BA 2ZQZA 3LA6A 1TIBA 4KVFA 2GBCA 2G0TA 2OYCA 4DDTA 1JHDA 4F4HA 3JTMA 4CYMA 5J4KA 4L0QA 1NATA 2F3UA 4NFLA 5LDGA 4Y0VA 3HVRA 4EG4A 2CSXA 4HH0A 2CD9A 5AM0A 3NT4A 5KEIA 2IEZA 3PGA1 3W3AD 1Z8NA 4UHKA 4HAZA 2FB9A 5AUNB 2GMWA 2QTVB 2QLMA 3P9XA 3DTTA 2CFIA 1F0KA 1X1BA 2YXLA 1MB0A 2FNAA 1JT9A 3BWXA 3QPWA 4UJ5A 1GCAA 1OX4A 4MHSA 3R0IA 4JDUA 4FWTA 4AT1A 2FFJA 5K0FA 4X6UA 2EIHA 3KOZA 2PUBA 3H42B 4AP9A 1PFKA 4L76A 2ORED 3AESA 1USIA 1SIUA 1JF8A 3KQQA 1E7MA 4LZPA 4IIEA 1U1DA 2A0KA 3RYCA 3ZVNA 2PHZA 2Y1XA 4G4SO 4WECA 4AZWA 3TX6A 1U0JA 5JVDB 3L02A 4CM9A 5HQ3A 2I91A 3A4VA 2CFCA 2NWQA 4DCNA 1SCDA 1JSXA 3F49S 4G6ZA 3FYHA 1T5LA 1QYXA 1E1CA 2W6QA 4MVXA 3WZ2A 3KJIA 4LSGA 3WGYA 1I1NA 4Y67A 5C1PA 1NW7A 2JGEA 1YFKA 3FPHA 3CTPA 8ADHA 2BDTA 1J2TA 1Y3BE 5FBLB 5ADHA 1JEQA 4LF6B 5KAMA 1I30A 4OHXA 3FNIA 1EUYA 3HJHA 1AF4A 4J3FA 1Y5NA 1PBNA 1MFZA 3ZGNA 4B4WA 2QG4A 4QZVA 2GDZA 4EUEA 1W0CA 4S3MA 2QPOA 1BQEA 3LP6A 1XTJA 4Z4CA 4B45A 1IDOA 4FKBA 4NVRA 3IYLW 1VMDA 2C4MA 2PD3A 1U2GA 4OHFA 4JJ8A 3DYVA 1WDKA 2QDXA 4LBWA 4UM9D 1SK8A 2I2DA 4CFYA 4W9MC 3D7MA 1CUDA 5FYDA 3EQ6A 2I2CA 4TTSA 5AKZA 2XCRB 1Z0UA 3NPMA 2EHDA 3FCYA 1YBVA 3MJSA 2ENUA 2JRLA 1G6KA 4KXVA 4HPWA 1BEEA 1RHJA 4YS6A 3DKPA 2O23A 4MWZA 3ZU2A 1D2RA 4F4CA 5LN1A 4FFMA 4I3GA 1HNNA 4OQNA 2ERXA 3ERCA 1Z0ZA 3KFLA 4RVGA 5M5BA 1YAJA 2NYUA 5AJZA 5I5EA 2H52A 10MHA 5JSZB 4AYWA 5DGHA 1GUYA 1LQTA 5DKFA 1DMRA 1IHOA 1MHPA 1ZKMA 2WBLC 3AERA 4LGVA 3A4NA 4P6VF 1U9IA 1VPTA 4H77A 1P33A 1KAGA 3LKZA 3RYFA 1FNNA 1KBQA 3MELA 4N0EA 1YDMA 4BKPA 5AW2A 3ZQKA 5LP6F 2B98A 5F4BA 2OV2A 1VJDA 3L3BA 4JYMA 1PJQA 2VRWA 1JTFA 3N2YA 3B8HA 1LBIA 4KG7A 1E96A 1Z83A 4QJ4A 4ZQGA 4QIHA 1MV8A 4TQAA 3MRSA 5I3CA 5AJWA 4FYPA 1QCZA 2FWAA 5NULA 3HDQA 5AWFC 5TLSA 5FLKA 3D6NB 5PNTA 1VG9B 2AT1A 1D6JA 4A1FA 3QMWA 2A67A 3QXCA 1CY0A 3BWMA 5DHFA 2VWHA 3LBIA 4IJVA 3UK6A 1WXXA 3WK4A 3N39C 1ZJYA 1VIYA 3WNZA 3LHKA 2OMKA 2ZRKA 5ERYA 5A9TA 3IODA 4KPGA 4U7WA 4IJWA 1Z7WA 2GFHA 4ZVVA 4K81B 5BMVB 1MLDA 5KVQA 3G2PA 2XF8A 4ZALA 4YAOA 3W6UA 4FUQA 1JPJA 3P97A 1TAUA 1JQDA 1CUVA 1BD4A 2FSHA 2JFUA 1DAMA 1X92A 1CVLA 2PGNA 4XVRA 1SUEA 4RIHA 1AUPA 4XRRA 2IGBA 1C81A 1D5WA 2CCGA 2DWQA 3ANSA 4G1CA 5DK6A 3SPXA 4BE4A 1UF9A 2KI5A 3OPVA 3I2GA 2H2FA 3PIRA 4OL0A 1TVCA 2ZS9A 2JH9A 4C6TA 3U3KA 1RYNA 2XUZA 4LI0A 2AWNA 4IZIA 3H5TA 3DVQX 2VA8A 1JHUA 3RS7A 1NNLA 1WS6A 4QL3A 4OHZA 4RSRA 1MC4A 2DWOA 4L1KA 4Q4HB 4AMVA 2I3GA 1Q0TA 4OHYA 4NV3A 5KSYA 3RAPR 3U09A 1RQXA 2RAPA 1OAAA 2VYCA 1RLIA 4V2UA 5EA2A 1JHOA 3I2KA 4DYHA 4JB8A 1BSVA 2OORC 4CLHA 4EMSA 3HV2A 3HDGA 1U31A 1Z3IX 3CVYA 1R6XA 4MKZA 1TC1A 1XZMA 4LQ4A 1F9EA 4Q9HA 2FMHA 2PZMA 1W48A 3SR0A 4DNFA 1EB8A 4X44A 5HOEA 2YICA 2PBLA 3SZMA 2C29D 4GLFA 1FY2A 2OECA 3IUNA 5CFZA 1NW4A 4L5BA 4IDDA 2NSDA 2AGVA 3C3DA 2XMPA 3FMIA 2PGIA 4I1VA 2PNFA 1EVQA 1A69A 3HI4A 5LMCA 3H1PA 5BSRA 2UYYA 4TWJA 3DNMA 3ZHYA 5JSZA 4YFYA 4YJHB 2DFKB 4J29A 2O2ZA 3R6TA 3NS7A 2Q5FA 5JEEA 1ODSA 3H1EA 2BFPA 2VQ3A 3RH0A 4MS4B 3OLXA 1PGOA 1ULSA 4KU4A 4YEDA 4DSZA 2JEZA 3NXKA 4EJFA 2QLFA 3PR1A 3PFNA 4V38A 4E5UA 1DO2A 2LV8A 3K0CC 1OJLA 1W73A 3GMSA 3LQ2A 5IVDA 1ZS9A 5BNFA 4LJ6A 3LUAA 2I4RA 4KWIA 4QBHA 1FFSA 3LUFA 3CKYA 1MKYA 4UEQA 2EFJA 3T9DA 3I39X 2B5WA 1TM2A 3G9ZA 1TEHA 2JLUA 2XVYA 3OCVA 3JARB 4J75A 3DF7A 3ESBA 3LXRA 2Q46A 4R0NA 1PV1A 1R8JA 4UFOA 2UXDB 5L8VA 1C4KA 2FPUA 3M2PA 3PJDA 3F9IA 2ZTLA 3D0KA 1O5OA 2FPGB 4KX3A 3COVA 3TIXB 3VR3D 4AJEA 2B0CA 2IJGX 3K2QA 4Y2JA 1JSRA 1G1MA 4KLNA 3NB0A 3A04A 2O2XA 2PQMA 1KXZA 1LFDB 3SR4A 4C2AA 3SIXA 2H0RA 1K1EA 1KQOA 3HXQA 4Q12A 1PWZA 1KU6A 1R00A 1SCNE 2HIAA 1I7NA 2QGZA 3AOGA 1VPVA 1YDHA 5B1YA 2DKNA 2XT6A 1TTHA 3V80A 2CB0A 4X66B 1LTHR 1NI4B 2DJ5A 2E5WA 3ND8A 4LCBA 4RBNA 5IYZA 4NCBA 3STWA 2ACEA 3EEIA 3WYGA 1G8SA 1KIAA 3AESB 5THQA 1ST3A 5HCIA 4QLBA 2FPIB 1NKVA 3SLKA 1BFKA 5JO9A 1AHHA 5JR3A 2VSYA 3C74A 1XNQB 3D8UA 2FPWA 4M9QA 1MO4A 2C4KA 1ZIPA 3ISVA 5F35A 4UEOA 4FZ5A 3SC2B 3X2EA 3VJLA 3NDPA 5BURA 2P9JA 4UHJA 2ZCUA 1JR3D 4WLFA 5I7RA 2P40A 3L5KA 5KOIA 4CMCA 1C1XB 1CS0A 2FF5A 2P9HA 3RK0A 2FN7A 3B6ZA 3BE8A 3PXUA 4NAUA 1SIOA 4NATA 5MN6A 2PYIA 4S0ZA 2ZCVA 4V2IA 4D6XA 1CUCA 1GKIA 1R8QA 3K9QO 4QREA 1UMBA 3WQBA 3ZJVA 4HC4A 1Y82A 1RXIA 1CQJA 1MJHA 4RHTA 4O02B 4CM4B 1E32A 1BQ4A 2DQSA 4E5MA 4JITA 1AKUA 3IQHX 2ZUUA 3KEGA 4YMUA 4BQSA 1E2UA 2LCIA 4KB5A 4KIFA 4DG9A 4CQLB 4YHHB 2OZKA 1NQTA 1ID1A 4X3CA 3TIFA 5MHTA 3K0CA 2FRDA 3BQ9A 5LA6A 4OSPA 3ZLTA 3L77A 1P1RA 4QATA 2JZCA 2AJCA 4TV8B 5CJ2A 1QP0A 4P33A 4ZGWA 3LCMA 3IO5A 3HJRA 1FQKA 3HCRA 1WETA 1CEYA 5U4QA 5EHNA 3EXHA 4KFUA 2V7BA 5CURA 3I6MA 3TDKA 5LQRA 2Q50A 1V25A 2O0KA 3LFHA 1COZA 3BIWA 1I01A 2BN4A 3TIVA 1NJFA 3SP1A 1AXEA 1VA5A 2D06A 1J6UA 3E4CA 3KQUA 1QIEA 1EA5A 2EX1A 2QA5A 4PYOA 5D85A 3KZXA 2J0EA 4L9RA 2VTVA 1N36B 4FEGA 4ROTA 3GB9A 4LRUA 4C6RA 2X7XA 1N2BA 1GEGA 4YAKA 3GUUA 4KGDA 4FIDA 4OHBA 4MUBA 5ALDA 3WGGA 5CVVA 3T5GA 2ZIXA 2WNSA 2ZAGA 3BXEA 1PL7A 1YB5A 3WWZA 2ZB8A 3JQPA 1KPHA 2EKQA 3GLHE 4CF6A 3W06A 1BMDA 5FI3A 4GXTA 2YXEA 2XOKA 1EJBA 2ZBRA 5LVAA 2MHCA 3GLRA 4BNWA 1EX1A 3Q6NA 3PC6A 2OCBA 4JR1A 3H9EO 3CVJA 2O1WA 2I9PA 3P19A 2Z4SA 1DVRA 4G5FA 3QLVC 2Q8NA 1YU6A 4Y2GA 4CMKA 2H54A 4URVR 2PANA 3N53A 5AQ1A 1C7ZA 2X5OA 4KO3S 4O4HA 4PN7A 4F8EA 2EHJA 2LDBA 2Q3LA 5LJIA 1E0DA 3R7LA 4RDIA 1OZGA 4HDSB 3MCUA 5FIUA 3T9CA 2CLIB 2ZB3A 1XP8A 1ZD4A 4DNOA 2NX2A 4ESEA 3COYA 3IDQA 4YPOA 3FHTA 4II2A 1FXUA 2E3JA 4ENVA 2AFVA 1QV6A 3VHRA 3IRVA 3JQ9C 1NQUA 3MGGA 1FU4A 1DO0A 2D4HA 2HFKA 5LIRA 4HAOA 4AC9A 1MXHA 3LPCA 3GLIB 1YS1X 3AKDA 4QEDA 3NRJA 4A6XA 4E03A 1V3UA 4CLEA 1ML4A 1EZ1A 4EPWA 3UK0A 4HDRB 2IBMA 2AD5A 3B1WA 3RVJA 4TUYB 1RBYA 3FKSA 3OCCA 4C29A 2BL4A 2VYND 3VAZA 1Q11A 4ZAWA 4P93A 1QBKC 2DPLA 2ZIUB 2PKEA 5K0BA 2ZRDA 3MMPA 2VJPA 2RH9B 1MEOA 2H1LA 2GHRA 4K9LA 4MR8B 4DIDA 1GADO 3TZ6A 4CFZA 5J4VA 3KQHA 3NYRA 3UCFA 1MZPA 1GCUA 4BVHA 1I2AA 2BEVA 2GXQA 2ZFUA 2QAJA 2HWKA 2M1ZA 4JVLA 4M1SA 4UARA 5DPMA 4IAOA 3RWMB 4TXHA 3UAZA 1GPWB 2ATCA 2QXTA 3FNBA 1W29A 1XDUA 2BJWA 1XJ5A 1GEEA 4IZ6A 4JXJA 3LM8A 4Y6LA 3H65A 5JD5A 5DBGA 3TLAA 1BXGA 2ZE8A 3BICA 3E3NA 3S28A 1AGNA 3WC4A 3IV6A 1L7OA 2AG5A 4M1EA 2ZJ7A 3KB8A 2AFHA 5F5LA 1TYDE 4H16A 4K40A 1HL7A 4C87A 3D1JA 1NBIA 3ITDA 3GT3A 2GF2A 5ALMA 4HUJA 1CY7A 1GDDA 1PFYA 2QWXA 3R0XA 4FD2A 4MWCA 1KPIA 2IT1A 3RABA 1SUBA 1A8HA 1LU9A 3RQSA 2IEDA 1EPUA 2R6CA 3H11A 3QKRB 1Y5IA 5HZGA 3HP7A 4TTVA 3SK0A 2PT5A 3SKYA 5B30A 2HC9A 3MCWA 3S5UA 3B5EA 4DILA 5IK2D 4XIFA 4Y8VA 2J3EA 5C3MA 5B6IA 3S27A 3ROPA 1HDXA 1WSBA 1GQYA 2LBPA 4UEKA 2XHEA 2QX9A 1SR8A 4NV1A 4XVQA 1UMBB 5K0TA 2O2EA 3EARA 1UAYA 2AOVA 4D8TA 1ILWA 1J24A 2GZHA 2A1UA 3R7DA 2ZIGA 4J16A 3U1VA 1H42A 1N33B 1DZ3A 1O6BA 1YVEI 3MCAA 1TUBB 4AQ7A 3AVUA 1T2CA 3FWKA 1XDGA 2IPOA 4MI9A 5DGTA 2C3MA 4B34A 4B3SB 1Z56C 2JD2A 5GADl 1KARA 3Q3EA 4C7MA 4EFDA 4KE9A 4KSCA 3AUFA 3NVAA 5MGNA 2OBYA 1Q1ZA 3K71B 4H0CA 1V45E 1IN6A 4EG1A 5K0CA 3FTDA 5K2MA 4C0KA 1US8B 3TLGA 3JQEA 4R7GA 3NTLA 4GKAA 5F4ZA 3SHQA 3VO1A 4RTRA 2X0RA 2IHUA 4FGJA 4KGXA 4DVJA 3RSCA 3VPSA 2H5LA 4NE9A 1C4WA 1ZGGA 2B8WA 2H4YA 1T9DA 2WIDA 5AOCA 1XD8A 4R2KA 2JBWA 5IF9A 3T5TA 3WK7A 2PWYA 4C5CA 4GMDA 1CY2A 3OEED 3ZHVA 3GLGA 2JJYA 2B20A 4B8YA 4HL6A 3SBOA 4HQ6A 1KKUA 5IDYA 1EX9A 1J5PA 3QJ5A 4WIAA 3UV7A 3Q10A 5DBEX 3WHIA 4E30A 5IU6A 1LI4A 2ANCA 4LXIA 4Y9TA 5DTMA 1KJJA 4F92B 3EUWA 4F3RA 1LDBA 3ODPA 3TE7A 4NYIR 5JNWA 4IMJB 3OX1A 4ZO7A 1J8VA 5DNUA 2P65A 2ODNA 4Q01A 4JY7A 3RK1A 3KKEA 2A1IA 2FR8A 1M8KA 1NUUA 1WMSA 3LUBA 2GPJA 1I1QB 3GJ5A 1RTTA 3Q88A 2OYRA 4BVBA 3NT2A 3JZMA 1HQKA 1U4NA 1XCOA 4YRPA 3CG0A 5DN6A 4IIJF 3P9PA 3BC1A 2ZRQA 1QGUA 5ADUS 2IIBA 3A3OA 3IA2A 3DBRB 3JRXA 4MV5A 3W6ZA 2CYAA 3VJMA 3TQOA 4ZMRA 3OIWA 5THXA 3BRQA 4LYJA 3H7IA 4YA6A 1WU8A 4LY3A 4HQ0A 4WA8A 3RHTA 2HR1A 2ZT7A 4FQ7A 3LFTA 4MXDA 1PZGA 3F5FA 1FX0B 1ADBA 1QHYA 3W8NA 1EFHA 3LQ1A 5ICMA 2J0QA 4XQGA 4IVPA 4RKQA 4H7HA 2PMDA 1V7ZA 2P90A 5CLGA 4QOJA 2OZLA 5F3DA 5JAMA 1G5HA 1M8FA 1NUPA 1SWWA 3PJRA 1NVAA 2E48A 3K30A 4LGYA 2XYRA 1NR7A 4XDYA 1W8DA 5TXGA 1PUJA 2H06A 3ZS9A 2XZOA 2UUAB 1IXKA 1OB2A 4UZSA 5HRAA 4HI0E 4D26A 1VDMA 1NN1A 1KOJA 1ZJ4A 2YWBA 4P4GA 3PA6A 1GNTA 3LZDA 2MT9A 2W4IA 3EF3A 3O90A 4QGAA 2PGDA 1OWPA 1TO6A 2ZDGA 3A4MA 5HIAA 5LBUA 1XQYA 3AX6A 2OV6A 4UBMA 4BQFA 1E5LA 4Q05A 3H9BA 3RWBA 5GAJA 3FMFA 4YACA 1Y8QB 4G36A 4NFHA 1R6VA 4NBTA 5JCJA 3RO7A 1WZ2A 2A35A 3QWIA 5KYWA 2YX1A 3IDSA 4S1VA 2C4NA 3NTVA 3STUA 4PONA 1V35A 4Z3KA 1Q6ZA 3OX4A 1OBVA 5KTRA 2GDJA 1JR2A 2GERA 3GEEA 3MMXA 4Y2SA 1RKQA 2IP1A 4L27A 3NBKA 1TFRA 3U61B 4FKZA 2DBQA 1E98A 1N5KA 1UKVY 2Y8EA 1PSWA 3EJWA 4M0DA 3S1LA 1CZLA 1P0CA 4JJZA 1INLA 3AB8A 4X6XA 1H2AS 1RCTE 1RZVA 4J2TA 4PLFA 3AHGA 3N0RA 2QNIA 3VDRA 1JBEA 3AQIA 2JBAB 1W94A 3NGXA 3OHPA 2E1RA 4R1SA 1DHRA 4BLRA 3EGIA 4P9NA 3LJKA 3EGWA 4K86A 4NU0A 5TMBA 3ZGXA 5ELXA 5BN1A 3D4LA 1CERA 3BJIC 4IMPA 1D0SA 3WWYA 1WM1A 1YB6A 1HNXB 1QIDA 3FPFA 3SHWA 3UBMA 4C7VA 3DDUA 3PQ6A 4Y7DA 1BA2A 3C14C 1NX9A 4MW4A 1I7QB 2G09A 3IC5A 3X1WA 2BZ0A 3H9GA 2NUTA 1Z7BA 3SVTA 4IZOA 1TNDA 1KJ9A 4HX2A 1N6LA 3GH1A 4I6GA 1R10A 2HA7A 2NZUG 3M89A 3D2CA 4WADA 1K8ZB 2Y71A 1GTJ1 1D6NA 3VPFA 1N1GA 3RIYA 2HF7A 3IFSA 4HGNA 4ZWNA 3TB4A 3WIOA 4E33A 1VPEA 5FWNA 1VBFA 3IQFA 4QJIA 4RY2A 3GA7A 2NV0A 3NOVA 4V0KA 4HUTA 1FYVA 5TF4A 4QRHA 3VKGA 4QICA 4UQOA 1B7GO 1LK0A 1P91A 3EEFA 2DY1A 1A8QA 2ZK7A 3OPNA 5K3EA 1P73A 1Z06A 3NT5A 2WYVA 3OKCA 4G0NA 3NHAA 4PCVA 2IV2X 1U2SA 2ZTHA 2GHTA 2MU1A 4BAUA 5H7XA 4HWPA 1W1UA 3A7DA 4CF4A 2Z9CA 3RAEC 1EB9A 2I7XA 3PEUA 1AJEA 1E64A 3NEAA 2HLDD 4HFMA 3NBFA 4F91B 1S8OA 5F5XA 3KSZO 4P36A 1YIOA 1I4EB 3ORHA 4JSRA 4NDAA 4FZRA 4OMUA 5ARBA 1ZK1A 4AN1A 4LOHA 1K7SN 1WCWA 3IDOA 3QXXA 5HDBB 4JFAA 4MS3A 3VR0A 1QU2A 4YASA 1YA8A 3KTAB 4FFBA 4QTZA 5JCOA 1ISMA 1MW9X 1TUEA 3CT4A 3IPLA 1MP0A 5HK8A 8OHMA 3PFFA 2H1CA 4CLOA 3K09A 1MABB 2XDAA 2GBIA 3DTVB 3DVAB 5IK2A 4FUTA 4ZRNA 3FFXA 2C9OA 1C3XA 3DV2A 3K8ZA 1QZTA 1E9RA 5B3KA 1NT4A 1CD5A 2X5KO 1JMKC 4RHXA 1YAHA 1XQ1A 4EBFA 4GFDA 5KU7A 3PGXA 2E89A 4F93B 1NPDA 2XZPA 2FDXA 4G9BA 3FYUC 2JHPA 3ABIA 4NENB 3A4IA 3CN9A 3H2KA 5DHTA 4Y9SA 5G41A 5JFTA 2F6RA 1GYPA 5UKDA 1CQJB 1P3DA 1RLJA 1V8ZA 1G7RA 3O4HA 1TM4E 3SZUA 3W3AH 4DMRA 5AW3A 1CV2A 1T0HB 3H2ZA 5EOVA 1FLVA 1PTJC 3FXAA 4GI1A 4E31A 1UZLA 1RPAA 5EY5B 1HG0A 4IRMA 2Z1MA 4LVOA 4DXAA 1QP7A 1VB3A 1E60A 2G28A 4H18A 4Y9UA 2QRLA 1KVRA 4U6NA 2PBZA 3RFFA 2JAOA 3KVOA 1KORA 4ZI7B 4UVDA 2WYUA 2A92A 2VEOA 4H1HA 5AJTA 5DZSA 2Q4BA 2MR5A 1QH1A 5H83A 3S2EA 3OJOA 1P2GA 3B6IA 4JMLA 4L8YA 3C7DB 5EJ2A 2WZCA 3DXZA 3KPYA 1KMCA 2I6QA 4NZYA 3HDHA 2VO1A 2XPCA 1JAHA 4YRLA 1XZNA 1G98A 2B34A 4FLMA 4FVTA 4ICIA 2OA0A 5IHPA 4FT2A 1TAHA 3W79A 2OQ2A 4DGSA 3O2JA 4WNAA 4DDKA 4DG8A 2XYHA 3FSJX 2Y1DA 4P5PA 4CJXA 1KZ6A 4D8YA 5I48A 1TX4B 5AVYA 1H8HA 1PP4A 3WYFA 4QULA 3UAYA 3EF1A 4LZZA 4JFRA 1UJ4A 1ZNYA 2OBXA 1V96A 2VHYA 4R8RA 4MKRA 1NURA 5JMPA 1T5TA 4RTKA 3JWIA 3KZKA 1SRQA 3EXFB 3U2QA 1SXIA 4IL5A 3STTA 2ERCA 1Y37A 5KQSA 4BEVA 2AR9A 3CINA 3OTWA 2VUTA 3IMFA 4MGHA 5TMPA 5I9SA 1N7JA 2V59A 5K3FB 2O0LA 3BJRA 5BQFA 1BDHA 5CPFA 2Y1KA 2NPFA 3WK9A 1YZTA 2ABWA 2EJUA 3FAZA 4PIMA 5H9WA 1Y6FA 5DCUA 4FNAA 3EFEA 1A98A 4BJ5A 4A2QA 4DYVA 2DM6A 3DYIA 1EGMB 2FP3A 2PLWA 4BC1A 1PG0A 2X5NA 2IZ1A 4K9QA 1LV7A 1TVMA 4LMRA 5TT0A 3U39A 4FU0A 5KNCD 3FGPA 1DAGA 3GJ8A 5A4DA 2I4LA 5AVKA 4NE7A 3C3EA 5D3MB 1WA5A 3C1OA 2FI1A 5JMTA 4MJ3A 5FBWB 4NOMA 4BL5A 1CJCA 2BVNA 4FCTA 4HFJA 3C85A 2CLOB 4BV8A 3GVIA 5BQXA 4Q02A 5JJIA 2XGSA 3R7WA 3M9WA 3VTAA 4B4OA 1NC1A 4RLSA 1XRLA 5EVJA 1VB5A 3ZZMA 1YE8A 3L1KA 1WULS 2R2GA 1I3MA 2PVCA 5TJ9A 1E0AA 1BCSA 3KAJA 1VA4A 4EPXA 4MI1A 4HZUA 2W42A 2DFVA 1OXBB 1YR6A 3FFTA 1OIVA 2J33A 2ZRMA 1F17A 3H8WA 2IWHA 2HD4A 4DLKA 2FPSA 2QYOA 4TYYA 2EQAA 3SIPA 3VA7A 5D3KA 4DCCA 1MQ8B 4JGGA 3UHJA 4E5KA 4HMOA 4X8LA 3IAS1 4ZVKA 1Z68A 3DEHA 4TTQA 1N3LA 3HLTA 1L7DA 3BMOA 3QYAA 4OKNA 1U3DA 4Q1CA 2AB0A 3ZV6A 3F1KA 4EMUA 4FC6A 3FTQA 1QG4A 3KFXA 3HUUA 5DP1A 1E0KA 1GU0A 2BBWA 2FGKA 3IXLA 3G8BA 3CF4A 4JJKA 4DSTA 7GPBA 1TCUA 4LHWA 5G40A 3A1VA 2DXIA 3Q3JB 2PFSA 1DELA 3AJDA 4ZICA 3DDOA 1ABFA 1DAFA 2JVIA 1UKYA 1TO1E 4PNPA 1D2CA 1LVHA 1UKBA 4UMVA 4BVLA 5I7VA 3GRAA 4V1CI 3HZHA 2XVXA 3GLSA 4O8CA 4QBTA 3ZV5A 3VR5A 2B7CA 3GOQA 1X1CA 5EXDA 5JY1A 3LT2A 4QG7A 4E6EA 3SGLA 1JEDA 3QQPA 1C7RA 2KBFA 2O7QA 3KOYA 4NDNE 1FP6A 4F97A 1I80A 1FJHA 4AZVA 2W37A 5KQMA 4MV0A 3DB2A 2C83A 4W63A 3U3ZA 3WMWA 4MJLA 2C9BA 4KIGA 4QUIA 2A84A 2XVMA 1CR1A 1O03A 2WHPB 4N0DA 3MTJA 5ALWA 3UJNA 1E2FA 1KI6B 3F74A 1I7LA 3EGDB 3NI2A 2Z5FA 2QUJA 2VJLA 1KNXA 1RRPA 2TRSB 3OEEA 4FI3C 4MUMA 3IQXA 4ND6A 2WHYA 1LX7A 2WR8A 1XHEA 1KTVA 5C4MA 2RHMA 3QSYA 4E3WA 3M2TA 3D59A 3BE5A 1FEZA 1ZXBA 1TJYA 1T24A 4AJIA 2AE1A 1XL1A 1JEQB 1IXYA 2I2XB 3NMUF 4QXMA 2ZBQA 1J0BA 3L79A 5JZBA 3FMGA 4N65A 1ZMBA 3F7TA 5EIEA 2NVOA 2ZSUA 4WK2B 2QD5A 4PZCA 4PV7A 1P4JA 3RM3A 3N8KA 1MV5A 4DA9A 1Q0HA 3MWGA 4A2WA 1IZ0A 3E7FA 3FUCA 1N4DA 4LYYA 1NG1A 2VHJA 3ZXIA 3ZI7A 1IH8A 3PDHA 1SCAA 2PMKA 4RVUA 4A0FA 4CF5A 4M36A 1ISSA 4WBSA 2XXAB 4M2LA 4BX8A 4M9ZA 3LQ4A 2CJFA 1Y34E 1JVBA 2RIPA 5HOQA 4ZV7A 1OV4A 3F47A 1Z4MA 2FH5B 3SIWA 4L3OA 4D44A 4NIMA 3V7WA 3LG2A 5AQEA 3OP1A 2QV7A 4GC5A 5FEUA 4BFVA 2DH5A 4OM8A 1O4WA 4PZDA 3DE7X 3KYBA 3ZD7A 3TSAA 4BB5A 2RGUA 3WGLA 4FZJA 1I3LA 4O4LB 1W85A 4JBYA 3HXMA 2MOKA 1UP4A 1PZMA 3TZEA 2WJHA 4M8LA 4Q7JB 3MA0A 3V1NA 1B14A 3AVQA 1ZIOA 1OT3A 3KEMA 3D6TB 4A0SA 5EHXA 4TS4A 3B5JA 3R2JA 3O4JA 3DT9A 3HY4A 1ZONA 5K7SA 5FWXB 3ABZA 1DLJA 5TT1A 3V3TA 5D86A 1EM8A 4KFCA 2PX8A 3ZWNA 1QDUA 1TA4A 3PUYA 4IUCS 1XEAA 1ODJA 4HMQA 4LEIA 4L78A 3SJ7A 4BMSA 3EZYA 4G26A 1NMZA 1ZC4A 1XZCA 4C4ZA 5ITZB 2R96A 5CEJA 1N75A 2IZZA 1UJ6A 3F6BX 2CLHB 3IS3A 3SAJA 5T3UA 3AQ4A 1PJCA 4GPBA 4BVEA 3INTA 1EJ0A 4JC4A 1N0UA 4GGMX 4N7JA 3BYZA 5DASA 5H59A 3EVGA 3JAMA 2VYNA 3WK5A 5LP1A 1S7GA 1K63A 1ZVMA 1BE0A 5ALYA 1SBCA 3WV5A 1P7YA 3L8ZA 4QT0A 3R5TA 1U7OA 1OWLA 2FPXA 2VDPB 2X5JO 5KDLA 1GTVA 4KH0A 3WV4A 2NO4A 3TQRA 3QW2A 4YRAA 2I66A 4KGVA 2B6HA 3RD5A 4RGVA 3F96A 1IZ9A 4BLOA 3DUFA 4OHKA 4B3JA 4DQKA 1H8HD 1YQUA 2A0FA 2ODEA 2XJ4A 4IXTA 2LIVA 4OG2A 1FLNA 3CNBA 1YRAA 3DMFA 2RSLA 3LI2A 3WNBA 4DV6B 3ZD6A 2CNWD 1QCYA 1J8YF 3VAAA 3D7SA 1Y81A 5JE8A 3RVKA 3X0DA 1EE1A 3KYDB 3EA4A 1AXRA 1HSZA 3AR6A 1XXLA 3P0HA 3D4PA 3HBAA 4X1KA 3LQQA 4RD4A 2P3LA 3PPIA 4I50F 1V2GA 3QVJA 4YUVA 5SYMA 3N2EA 5JNRA 2FPLA 3C3KA 1W2HA 4DLPA 4ID9A 3QXHA 4HLNA 3LUDA 4EGCB 5C8YB 1O96A 3A6LA 3HN6A 4MUAA 2JFGA 3HU3A 4QT4A 2Q1XA 3VR1A 4KBYA 2B1RA 3EGXB 3DJFA 2E5FA 3HKEB 2Q5QA 1XZLA 3MMSA 4INAA 3LX6A 4L85A 4WV3A 5DWVA 2PG3A 3JCZA 1UJ2A 1MUUA 2C00A 4EB6A 1EVJA 3D2LA 2QUBA 4LGMA 4N9QA 4KSBA 2ZCJA 2VOEA 2EYUA 4NZNA 3Q1KA 2JF0A 1BVRA 1ORWA 2PLAA 4PCUA 1Z0DA 3UKJA 2VQFB 2HM7A 5IVIA 1GV0A 4B1FA 4ABTA 2C2WA 4B3MB 2O8FA 2VXYA 1AM4D 4XYLA 1FOEB 4TRNA 3U7QB 2GZAA 3FVWA 4JZYA 1F2DA 1Y8CA 5AKXA 4FMPA 3AY0A 3IV9A 5EP2A 1VIDA 1T9GS 2IGTA 4G56A 1U7ZA 1NW9B 3SDBA 5E3HA 4URXR 4M0CA 5FFFA 4D9IA 1XTRA 2A5GA 4P5DA 3RJTA 1Z07A 1BWRA 3LT4A 3Q7PA 5H68A 5COAA 3TW8A 3ZHTA 3NHRA 3Q7TA 2OGTA 4YQFA 2XQJA 2JGDA 2ZU6A 4NENA 1P61B 2YWDA 3KKMA 3DE6X 4W5WA 5A4IS 3UPDA 3BG5A 2Q2OA 3AJ9A 4RYDA 2MYTA 1YIAA 1DHTA 1NVVQ 1XU9A 2F43A 2WMYA 3A9VA 3OPQA 2OD7A 1ZOOA 3H2JA 3DFUA 3QMMA 4FKMA 2V5UA 1EUCA 1EM6A 5CT5A 4A9AA 1RWPA 3GGOA 1XLUA 2IHBA 3HR4A 1TT7A 4A73A 4EVSA 5DX8A 4CG3A 1QIGA 2B5VA 4RC9A 3QG1A 2ARKA 4HDMA 4BFYA 1BO6A 4CIVA 4CIYA 1C9KA 1P77A 3MPOA 3NHKA 4MUYA 2R0QC 4HCJA 4ED9A 3H86A 2HQSA 2AYXA 2O1XA 3PUHA 1SUCA 5DCWA 5B7QA 1NUAA 3A6JA 1WUHS 1AVTA 1GNSA 3HVUA 4FYHA 4C7OB 3UWSA 1UUFA 3B2EA 4BKMA 4UVGA 5K4GA 4CLOB 3MTAA 3DTVD 1AG9A 3HBNA 4WFJA 1I0LA 5H5JA 3Q7EA 3OICA 1X6VA 4GLBA 4XJSA 2X58A 1T2EA 2BHNA 1VJ0A 2YMQA 1IDN1 3OOYA 4XQCA 5EXSA 2G1PA 2Q6IA 2X42A 4TRJA 4XOIA 2WA1A 1P1KA 3AEKB 2MSEB 2WJYA 3ZWYA 3E6AA 3O73A 3CVUA 2OWEA 1FZQA 3DP7A 2IYZA 3FNRA 3RJ9A 3D64A 1HTWA 2ZUVA 3WLSA 1KMNA 1IUNA 4MUFA 4YIKA 3ROTA 4R9VA 1Q0RA 3T4EA 4RYLA 2J0VA 2I71A 3FPCA 4PEVA 5IEJA 2WRZA 3EFBA 3AXTA 4E13A 1CCWA 4ZMSA 4RM3A 2BFFB 2VXOA 3EIHA 3OM8A 4AG6A 3ADKA 2BP7B 4Z5XA 4LRXA 2PYDA 1DAIA 4YH1A 1ECGA 1MQSA 3BILA 4IKOA 5IHXA 3WGIA 4C2TA 1JEAA 1EJ6A 3FROA 4GM0A 2ZAYA 1THTA 1FMLA 5TPWA 4LGCA 1BX0A 4CG2A 2JFPA 5B7PA 3DHNA 4DJTA 1FS5A 1NUQA 1Q17A 2DOKA 1RFLA 2R85A 3QUBA 4U2FA 1AURA 1YC5A 1L1FA 3UK2A 4LZAA 4UNIA 4C4SA 5J2UA 1UINA 1HORA 1X7WB 1JTEA 2JFOA 3MWEB 2XIJA 4KL8S 4YAWA 4GC9A 3UJ3X 4IOLA 1TTQB 3ROGA 3O4VA 1BAPA 1OYOA 3I8XA 4IGEA 4IIDA 3WLHA 1H2BA 2YQZA 1HR0B 4LFAB 4BNVA 2BGNA 2O8BB 5FUBA 2GD1O 1N5MA 1JJ7A 1LA2A 1XMPA 1J1IA 4JK3A 2P2LA 1A7KA 4M9SA 3ZE7A 3C3AA 2WHQA 4KO8A 1S02A 4ISBA 2O8DB 3L8EA 3ONVA 4HAWA 2KW5A 3QVMA 2YJTD 7MHTA 4IGAA 3NNNA 4KRYA 1UBMS 3O8QA 2VDVE 4P7FA 3W1VA 3JWGA 4D3YA 4GVPA 1SHTX 3Q72A 2H5IA 1KH2A 1SZCA 4EO9A 3A9WA 2XUJA 3VKHA 1PV4A 2V9PA 4DC0A 2CDAA 2GUWA 1L5VA 1GL6A 3JQFA 3L82B 4HS9A 2OSBA 4X92A 4O2RA 3W3ZB 4O2LA 4EL0A 5JO0A 1JU4A 3SFTA 1H1LA 1YDGA 3JYOA 3FBGA 4DA4A 1P0MA 5I8PA 1TF7A 4GX2A 3U7IA 3W6NA 4CKCA 4F8JA 4ML3A 3DW1X 1QQBA 3FUUA 5L4SA 1TZCA 2BF7A 3VXKA 2CBZA 2CNNA 1Z8DA 3N7AA 4BO7A 1DJOA 3L0DA 1QHXA 2J3KA 3N1UA 2O05A 4Y6GB 4GGPA 1P0PA 2IYNA 3VSDA 5J4LA 4GRAA 4L7VA 1N5OX 2Q4DA 2ZR0A 5JISA 2WD8A 2OHGA 2I65A 4G0MA 5I9BA 3D8NA 1Z6XA 4RNCA 3M4ZA 2FVXA 3FI9A 3KZOA 3IAM6 3GMIA 2AX4A 3UAWA 2Z2YA 4AF8A 1RRFA 4DADA 1QG2A 3S3TA 1YZUA 3OF3A 2NO9A 2V7PA 3GN1A 4MQEA 4RK1A 2NU6B 5CB0A 5GZ1A 3V2IA 2BTQB 1JLLA 3NALA 4H3HB 1YR2A 4QPJC 3RV4A 1JIVA 2HXGA 5IZCA 3ZWKA 4UHEA 3A1DA 3DMTA 5D3QA 4AKIA 4ARBA 1WOYA 1J06A 2M98A 4EI8A 2G9UA 3Q9SA 5ENVA 4ETIA 1H22A 3VPBA 2FOIA 3BS4A 4I4CA 5FOQA 3CG4A 4B76A 2XCSB 3IDFA 1FPMA 1I9CA 2EKZA 4R1LA 1KZ1A 5TC4A 1E9DA 2HJGA 1IM2A