3GBVA

Crystal structure of a putative laci transcriptional regulator from bacteroides fragilis
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
289
structure length
289
Chain Sequence
KKYTFACLLPKHLEGEYWTDVQKGIREAVTTYSDFNISANITHYDPYDYNSFVATSQAVIEEQPDGVMFAPTVPQYTKGFTDALNELGIPYIYIDSQIKDAPPLAFFGQNSHQSGYFAARMLMLLAVNDREIVIFRKIHEGVIGSNQQESREIGFRQYMQEHHPACNILELNLHADLNIEDSRMLDDFFREHPDVKHGITFNSKVYIIGEYLQQRRKSDFSLIGYDLLERNVTCLKEGTVSFLIAQQPELQGFNSIKTLCDHLIFRKEVACTNYMPIDLLTKENIDYYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative LacI transcriptional regulator from Bacteroides fragilis
rcsb
source organism Bacteroides fragilis
molecule tags Transcription regulator
molecule keywords Putative LacI-family transcriptional regulator
total genus 93
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3gbvA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3gbvA01
2E4ZA 1P2FA 3LUHA 1TJYA 5FWXA 2LP4Y 3Q15C 4YP9A 3OM1A 2XDYA 5IBQA 2RJNA 4ZJPA 3H1GA 3N75A 2OQRA 2PKXA 3L6UA 3HDGA 4MS1B 1JH9A 1JFVA 4RXMA 1ZVVA 7ABPA 3O2SB 1DZ3A 4RKQA 4MQFB 4PICA 5TE9A 1JLKA 1P6UA 2KYRA 1FFSA 3EULA 2PL9A 2B4AA 1J56A 1DRJA 2IOYA 4MR8A 2FMHA 2ZWMA 3IP6A 1Z12A 3EDCA 4O1HA 1ZDMA 3I09A 3SQNA 3QLVA 1ZAYA 3O21A 4GNRA 4OLBA 2FEKA 1QP7A 4NCAA 3VNBA 4MAAA 4FE4A 4W5OA 3Q41A 1LBIA 3KHTA 4E7PA 1YK0A 5JNSA 1QPZA 4G0PA 2F8TA 3N0XA 5DKFA 3RVOA 4ZYLA 2WJWA 3EGCA 5JS2A 3EAFA 3OLZA 4RSMA 3DBIA 4MQEA 2LIVA 1DG9A 1GUBA 9ABPA 3T8YA 5IUKC 2FN8A 3CG4A 3N0RA 3LUFA 3C6QA 1MB0A 1ZITA 2CWDA 2MSWA 1YVUA 1USIA 2L2QA 3ILHA 5IULC 1E2BA 2QV0A 4ZPJA 1NXXA 1PHRA 1VRVA 3Q7RA 3H75A 4Z9BA 3CG0A 3KYIB 4MS1A 4S04A 5EWJA 1SRRA 5IEBA 4D74A 3CTPA 2JVIA 3NNSA 3B2NA 3CKMA 3BRQA 4IGAA 2FMIA 1MAVA 1QMPA 4NICA 4D6YA 3MF4A 2GI4A 3S99A 1D4ZA 2L17A 3KJXA 3LUJA 1PUXA 5E3JA 2PE5A 2IPNA 4KNYA 1CHNA 4F3TA 1YMUA 4EYQA 2FMKA 5B3JA 1JFTA 3OQNA 5JNVA 1BA2A 4LRQA 1FFWA 2ID9A 4OLAA 3Q7TA 2OENG 1FQWA 2JBAB 4YGXB 2FXIA 4Z4IA 3OMWA 1KRXA 2MYUA 3I42A 4KREA 2RDMA 1ISSA 2R47A 4G0MA 3SNKA 2FN9A 4ETIA 3QK7A 4WXMA 2WJAA 2AYXA 2AYZA 2H3HA 1EWVA 2QSJA 2VK2A 3I45A 2WRZA 3BRSA 3QELA 4KPYA 3JVDA 4RXTA 4XLTA 3IPAA 2GBPA 1JDPA 4YS6A 4FB4A 5CHYA 4Z0NA 1SXGA 1D2AA 4WT7A 3DGEC 3LKBA 1FFGA 5EWMA 3F7NA 3RH0A 1NXPA 2JBAA 3DLBA 2NUBA 2P9HA 4EVRA 3HZHA 4JB2A 1SD5A 4F8JA 2WMYA 3KCNA 3HV2A 5DLEA 4JB0A 1OXKB 3MIZA 1LK0A 2E4XA 2JB9A 1ZGGA 4RK5A 2IPMA 1QP0A 4MR9B 2GWRA 2DRIA 4Q7EA 1U8TA 2L19A 2RJOA 2PL1A 4MYRA 2HQOA 2JVKA 4IF4A 5CNKA 1Z18A 4ZMSA 3T6KA 2JCGA 3MA0A 5C5CA 2N9UA 3R0JA 1U04A 4OTZA 1KMIY 3SY8A 1NXTA 5DTEA 1NXOA 4RK6A 3DGFC 4MR7B 1RNLA 5TPZD 4O1IA 5D2CA 3LUDA 1ZN2A 1A0OA 4JASB 4RY0A 1F51E 4WUTA 5FBHA 4LZLA 3RVPA 1M5TA 1TMYA 4IILA 1I3CA 1P8AA 4LDAA 1APBA 5IC5A 3LMKA 2LBPA 1H9CA 1USGA 3E3MA 1FSPA 3TO5A 3UUGA 1M5UA 3GL9A 1DP4A 1OXBB 2MSKA 5CNJA 5F64A 4DADA 3GA5A 1XWWA 5BQ3A 3H5TA 3LKVA 1DJMA 1U0SY 5ED4A 1C4WA 1NXWA 1P6QA 3TMYA 4XXHA 1GCGA 3RVQA 3QLUC 4H3KB 1JFSA 4KRFA 4L85A 3D8UA 4G0QA 3OQOA 4F06A 4G97A 1Z16A 3DZDA 3FGZA 3GBPA 1M2EA 3A0RB 3GV0A 3JPYA 4MR8B 3KTOA 4PYRA 1QO0A 3W9SA 3F6CA 1L5ZA 3JS5A 3O1HB 3OMXA 1Z26A 2FQWA 4OBBA 8ABPA 3CFYA 4L4UA 4G0XA 2PAFA 4Y9TA 3NHZA 1D5WA 1EWTA 2FTKE 2MYTA 3F6PA 5IX8A 4PZ0A 4RK7A 2Q5CA 4Z99A 2HQRA 3NHMA 4MLCA 4RK4A 4MR9A 1RPJA 4EVSA 4P1ZA 5GOTA 5KQLA 4KFCA 2FLWA 3GBVA 5JS1A 3H1EA 1EAYA 5KC9A 2JVJA 3H5OA 1SXIA 3HEBA 4W5TA 4EGSA 3IPCA 3SG0A 3CU5A 1DCFA 4QPJC 3C3MA 5KC8A 1A04A 1RXIA 2LPMA 4OG2A 5JNTA 2FEPA 3QEMB 1MIHA 1JL3A 2PLNA 4RWEA 2PUBA 2NT3A 2IPLA 2P4UA 3QEKA 1QQAA 5HKOA 4HNRA 3H6HA 3C3WA 1GCAA 2IPAB 3OM0A 2IYNA 2A9OA 3CRNA 4N76A 3NBMA 3SAJA 3BILA 1QQBA 4Z4EA 1JHZA 4RZSA 1JBEA 4RU1A 4HYEA 1KGSA 1MB3A 3KLNA 1WETA 1E6KA 5IEJA 5ABPA 1JYFA 5HSGA 3O1IC 4EYGA 3JPWA 3MM4A 2QR3A 4JOQA 2PUDA 1PEYA 3IP7A 4DQDA 3OO1A 1NXSA 3RVMA 2MYNA 3KG2A 4WXEA 2PUEA 3TD9A 3HUTA 1ZY2A 2F8SA 2FEWB 2E4UA 4RY8A 3H5WA 1D1PA 3QLUA 4TLMB 4UHJA 4UHKA 4TLLB 3TB6A 4W5RA 5T7BA 2R25B 2O20A 4F11A 1BDJA 2H0AA 3MMNA 4MS4B 1M2FA 3BREA 4O5AA 4N47A 2E4WA 2FQYA 3K4HA 4TN5A 4Z9AA 4ZMRA 2M1ZA 1LJUA 3LTEA 3KLOA 3CHYA 2HSGA 3HS3A 4YRZA 1GLGA 1DRKA 3HXMA 4E7OA 1D1QA 1C0EA 1ZH4A 2HJ9A 4RY9A 5BR1A 2WWVD 3HUUA 3URMA 3JVIA 5EWMB 1NXVA 3ILYA 4RDCA 4IMIB 4Z4CA 3RVKA 4N41A 3H5IA 2I6FA 1JYEA 4MS4A 1DC7A 3FFXA 3CZCA 2MYPA 2A9RA 1NATA 2LUOA 2A9PA 4KVFA 4PE5B 4ETNA 1UDRA 4MPTA 3H5LA 4N03A 1QP4A 3LOPA 3H1FA 1JWLA 2CD7A 3G85A 1DBQA 4QICA 1RXEA 4NQRA 4EYOA 2X7XA 1ZHHA 1DBWA 3LUCA 2IDMA 5TPWB 6CHYA 1PNRA 3CZ5A 1RZRA 1VPWA 1F4VA 4YWHA 2QVGA 4Z4GA 2V0NA 3H6GA 3CS3A 3O74A 4W5QA 1LJLA 1YTUA 1VKRA 1NTRA 3C97A 3MYYA 4MR7A 5FWYB 4JA2A 4RK1A 4MRMA 5IUJC 2VYCA 3JTEA 3OLYA 2B1JA 4HNSA 5I4CA 3BBLA 1DBPA 2ID7A 3KYJB 3LUKA 3HDVA 5TQJA 2FKAA 3LUGA 3RQIA 3RVNA 3OLXA 1VLZA 3K9CA 3OLWA 3QX8A 1YS7A 3RVRA 1R8JA 3GYBA 3HK2A 3CNBA 1U2QA 4G86A 4Z4HA 1ZESA 4MLDA 4XARA 5FWYA 2J48A 4W5NA 4XASA 4F12A 4MRMB 3UKJA 3SM9A 4RK0A 2FLKA 3LUAA 4MQFA 5TQ0A 4Q6WA 5DCLA 3C3KA 2TMYA 2JK1A 2NT4A 4KV7A 3FFTA 1LBHA 2FW0A 4OATA 5BRJA 1Z2DA 5JNWA 2QVCA 1PEAA 1USKA 2HQBA 4IMJB 1YMVA 4TMYA 4YR7A 2ZAYA 1B00A 2RGYA 3N0WA 2QU7A 2CHEA 1ABEA 5EWLA 3QLVC 4RXUA 1DCKA 3EODA 2VUHB 1ZGZA 1Y1LA 3KKEA 3RVSA 1CYEA 4LE2A 3F73A 1QO0D 1QNLA 4MS3B 1Z25A 4MGEA 1TLFA 1PNTA 4YV7A 3IP5A 1BAPA 4G0OA 3HM9A 4LDZA 1K66A 2YHBA 3OO0A 3TX6A 5FWXB 2R48A 1EWKA 4FE7A 4KK3A 3GWGA 4NCBA 4YCSA 1AB5A 1URPA 3FFWA 4EVQA 3A10A 4MQEB 4KQ9A 4GPAA 1ZH2A 4EYKA 1Z13A 2QZJA 1E6MA 4HNQA 4G0ZA 2L18A 1JDNA 3QEMA 2JRLA 1ISRA 3JY6A 4IRXA 4N0PA 2PUFA 5TQ2B 3QLTA 4EUKA 2FMFA 5IUNC 3CLKA 2GX6A 1XHEA 5BRAA 5KQGA 1BDHA 1YIOA 3IDOA 4WZZA 3D02A 1JX6A 5JNRA 2NZUG 2QW1A 3L49A 3N53A 1GUDA 2GKGA 3DLHA 2CHFA 1S8NA 3O75A 1Z17A 4M88A 4Z4FA 3M9XA 5JNUA 3Q7SA 4H60A 4Q6BA 3HJFA 3MQ4A 1DC8A 2YHAA 2MSLA 2R4QA 3KSMA 5TQ0B 1A2OA 1HEYA 5C5EA 3HO1A 2VUIB 3A0UA 3FDFA 1W9HA 2W42A 4S05A 4P98A 3QX9A 2WY2D 3N6VA 3HCWA 3O2QB 4KZKA 3EQ2A 1BDIA 3HVRA 4B09A 4JP1A 5B3JC 5HM6A 3A3KA 4XAQA 1TM2A 2M98A 2PJUA 3GT7A 3I5AA 4NV3A 1XHFA 1EHCA 4G0YA 3ROFA 4RKRA 1EFAA 4PEVA 3RVJA 2WB4A 5FBKA 5KI6A 4QYMA 1T34A 3UK0A 5GQSA 3M6MD 4ML3A 1K68A 2PUGA 4KMRA 1DCMA 1W25A 4H3HB 2PUAA 4EY3A 5CNIA 4DN6A 4N0QA 3VNAA 1Z2EA 4CBVA 4XFKA 1CEYA 3FMVA 3G1WA 1QKKA 4KQCA 4YLEA 6ABPA 3GRCA 2FVYA 3IP9A 3LFTA 3ROTA 3RVLA 1E6LA 3T38A 3N8IA 1Z15A 2QXYA 4RV5A 5EWJB 4D6XA 1KRWA 1SXHA 2HPHA 1L5YA 4JAVC 4YO7A 1MVOA 1NY5A 1ABFA 2E4YA 1JF8A 5TQ2A 3E61A 3M9WA 5CNMA 1TVMA 4QYWA 5DGCA 5T3YA 2FSPA 5KQPA 5TPZA 4KK4A 5TPWA 5HQJA 3OLVA 1U2PA 3H5VA 2NZVG 3NNDA 4LE0A 4LX8A 1BVHA 1IIBA 5KWSA 2A9QA 3OQMA 4RS3A 3T95A 3O2JA 3P9YA 3NNNA 5EWLB 5KQMA 2PUCA 3O1JC 4LE1A 2IKSA 4WWHA 2E4VA 1AB6A 1YS6A 4ETMA 2PMCA 3HSYA 2FQXA 4MS3A 3EJWA 5PNTA 2BGGA 3KS9A 3Q9SA 1YK1A 1RZRD 3EQZA 3QELB
chains in the Genus database with same CATH superfamily
1Z63A 1Z2OX 2ZAMA 3TH5A 5FWXA 3U1BA 3KQKA 3OM1A 2PGIA 4M0KA 1Q0HA 2RJNA 1LS6A 3LBHA 2Y67A 3P0EA 5A0FA 3HDGA 2C42A 4JC0A 1UWVA 1FP4A 3QX7A 5CDYA 1XC7A 1BOFA 1Q17A 7ABPA 4J0QA 1AE1A 2R96A 3E9EA 2RG7A 3UXMA 4FD3A 2I6TA 1UMCB 5BSHA 1FJGB 2BMFA 1Y5IA 1PZEA 1JJFA 2F90A 3BTVA 3DLTA 1U8FO 2AD1A 3BD8A 2QUAA 1GPAA 5C1OA 3PXGA 1XNJA 2FPLA 2ZWMA 3NYRA 3EFBA 4D7AA 1J23A 1O57A 3QTLA 4TOIA 2QBYA 3EY9A 4D9KA 4ALKA 2E7ZA 5AVRA 5KREA 3CT4A 2E3JA 1U8EA 1W85B 2ZE5A 3BB1A 3GFTA 3GA0A 4FC7A 1G21E 5JJLA 1FP7A 3CCFA 3HU2A 4GPTA 3L6EA 1HXHA 3HWSA 1CJTC 4N5IX 4S0ZA 3M4NA 5CR9A 2YIDA 9GPBA 4J29A 1U0LA 1N6HA 2IP1A 3C6ZA 2QE6A 2QT1A 3PC8A 1EUYA 3VAYA 2OZKA 5EOVA 4WNYA 3DAOA 4MQEA 1XFDA 4HY3A 3TEFA 5LDDC 4OAPA 5LB4A 3FUTA 3RLIA 4X20A 2EZ9A 4JD5A 3E5HA 1E4VA 3EOBI 1DG3A 4KC0A 2WILA 4UPDA 2JFUA 4IRUB 5D87A 4DLAA 2J9XB 3IJRA 3BK2A 3NHPA 4EUFA 5E9QA 1DKOA 2NUPA 2D5CA 1TX4B 2VYVD 2FETA 3E7FA 1JKMA 2V0GA 3V4ZA 5REQB 4AURA 1BNCA 1ZU4A 5JBNA 3GDOA 3KB8A 1XL1A 2WOOA 4K9SA 2YUIA 1DV1A 3QNUA 2GQ0A 3L7LA 1GN8A 1V8BA 2H1LA 5F7OA 3CPSA 3GZNB 3Q6NA 1EK2A 3PD1A 3DZKA 3WK7A 1ISMA 3SR0A 3ANNA 4QVKA 2BW0A 4Y2VA 4L9AA 5DX1A 2L17A 3C8MA 3JZAA 3AUFA 2HJHA 1T6NA 1EBFA 1Z62A 2WSIA 2GYUA 1CHNA 3OIGA 2GF0A 5REQA 3Q8LA 4UASA 4C88A 2ZCJA 5I01A 1YR2A 3H4IA 1Q7TA 3DFMA 4NG4A 5EVJA 1A9QA 4US1R 1KNQA 4B0OA 2WE8A 2P2ZA 4OIFA 5F9HA 1L5RA 1PL7A 1UKAA 1WMSA 2WJ6A 2JGAA 2YBDA 3E2MA 4TMXA 2ZI7A 4CEHA 2AYZA 1PE0A 2HA0A 1WO8A 3N86A 3U4IA 4TRJA 3HJAA 5ALJA 2HX1A 2O8NA 2VK2A 3KUKA 4ID3A 2WIDA 2EL9A 1LNZA 4WZAB 1B8UA 4P35A 5JEDA 2G76A 3FAKA 4FMDB 3RK4A 5SICE 3N6RA 3K6SB 2Z2XA 4ZI2A 2WIJA 1CUZA 1H3EA 1OUMA 1IONA 1YDHA 4CKWB 4COKA 5LZ5A 3MLAA 1IEWA 2BHSA 1LW7A 1TD9A 1VL1A 3HU1A 4HAYA 4IDBA 3UAOA 3V48A 1XCGB 3K8OE 4U63A 5FADA 4CTKA 1B0PA 3SMQA 1DVRA 3NTOA 5BN5B 1E20A 5BR4A 3DP9A 4UZFA 4RK5A 1PWZA 4R51A 2JGKA 4L74A 3MRXA 3MXTA 3OFVA 1N4AA 1AN0A 2HEGA 4MYRA 1J1UA 5IJ9A 5JYBA 1VXOA 1Z7GA 3L8CA 1ZM2A 4RZXA 5FI1B 4KCGA 3ZDBA 3FHTA 2X5JO 2ZK7A 5BV8A 2H7XA 3NIWA 2JGDA 3A06A 2R2GA 4B3IA 4CDMA 2QRGA 2N9UA 1QTNA 1VBNA 2JFNA 2XRYA 1PFQA 2JBHA 2GDJA 2EG5A 4FYIA 2IXGA 3DE7X 3UJAA 3EMBA 1MJFA 3FXAA 2NTVA 1Q0LA 4HEA1 1VIMA 3ZIAD 5JPIA 4ISBA 1UWCA 3CBQA 3G9QA 4JLPA 4M6WA 5CG1A 3I0NA 4C6TA 2O50A 4MHOA 5I7VA 3I23A 3IXMA 1QIJA 4AVYA 2WWWA 4PONA 4F8YA 2W6PA 4U9HS 3RKRA 3MTQA 1A98A 4NI5A 4UCQA 5C53B 4Z3OA 4JC8A 4RTRA 2W2VA 1QHYA 1II0A 5J1SB 1AGNA 5F64A 1GYRA 1VJ5A 1Y8RA 3LKVA 4CMJA 1PV4A 1MQSA 4QX6A 1P6QA 5AHXA 3PUJA 2AHRA 3G9TA 2R7AA 2REBA 3NBFA 5I7SA 3O7MA 3NH9A 1TM7E 1CNFA 4OI1A 4G0QA 1OHHA 2CVQA 1Y5LA 4WKBA 3WYGA 4BVFA 4J0DA 2HU7A 2P65A 5HTOA 1JVNA 2QAGC 2VDMB 3FDIA 3JS5A 1G7TA 5JVDA 1EP2B 1MAUA 2BEVB 3OMXA 4UCFA 4DF3A 2BM1A 3OIUA 5K5EA 2I03A 4DV6B 3WRYC 3D7NA 2CLFB 1UKEA 1NMSA 1MZVA 3AGPA 4JI0B 1CS4C 3DW3X 3OT1A 3KKZA 3IAAA 3WMFA 1SG9A 3X2SA 3T06B 1Q74A 1QYWA 2FOIA 3IV6A 1MTOA 2Q5CA 3L0PA 1U11A 3LM8A 4WKOA 4EO4A 3FH0A 2DT5A 3CEPB 1YJCA 5KINB 3EF3A 3ZHYA 1BSVA 3GCWA 1C29B 2FLWA 3F6BX 3DVLA 1YOVB 2GK6A 3NHBA 3P9RA 4MV0A 5LDGA 4II7A 1XYVA 2X41A 3Q8MA 5JMOA 5BSGA 1R6VA 1AKRA 2ZI3A 5E3HA 7REQB 4J7UA 3KLBA 4IFEA 4JLNA 2RHRA 3ZWBA 2CBGA 5KC8A 3GNTA 3PGXA 4BWGA 4YRCA 3DQZA 4LV8B 2H54A 3MMSA 5JE8A 2I1VB 3DYIA 2VP4A 4GPD1 4XR4A 1F6BA 2KBEA 3QF4A 4YP1A 3KVYA 3PJFA 4I50A 3IDQA 1W93A 3UMRA 4PZUA 4YCLA 1OZ0A 2C58A 2IPAB 2XMPA 1W30A 4PGAA 3MW8A 5AW0A 2GILA 3FROA 5D5QA 3W3ZB 3D7RA 4ENPA 4R2HA 2JLWA 4OYLA 4ISCA 1CS0A 3LDFA 1RM4A 3H84A 3ZVRA 2GAIA 3GLFE 3NH6A 1KI2A 4CMIB 5KTRA 3NM4A 3ANXA 3UVEA 3VNSA 3FSEA 1ABBA 1T8RA 1ZL2A 3BH6A 4W6QA 4YMLA 2BHRA 3EXHC 2W22A 2R85A 2HMTA 4QFBA 4HB3A 3AKEA 4F0JA 2BSAA 5FHRA 4JOQA 1N7HA 1Z7BA 1BVYF 1K6XA 1B74A 3EUEA 1KI7A 4I50B 1NXSA 4TXLA 3MTBA 4XCXA 1U2GC 4C4YA 1AGYA 5B7QA 3SIXA 1T4MA 2OHGA 2PX8A 1ENYA 3H5NA 2DH5A 3SZGA 2NZXA 2QSZA 5C1PA 5LJLA 3SXUA 3VZDA 1F8YA 3PR1A 5H5JA 1T3SA 5IBRA 1AS0A 4IG4A 2R8RA 4X6YA 3ADKA 1U80A 2O20A 2AL7A 3HXTA 3I6MA 1NJ8A 5DOZA 3TQSA 1VYUA 1NNLA 2EFJA 1QK3A 1R0BA 1BGWA 1X8XA 1LJUA 3AEUA 1Z2AA 1GTVA 3F5FA 1E8MA 2PLAA 3M1YA 1ELOA 1B0ZA 1SKYB 3F3YA 1GZ3A 1FDTA 2B6NA 2K87A 5FPYA 1C1YA 4ID9A 4BB6A 5B12A 1ZLXA 1ZIOA 3A27A 4C4RA 4UVHA 3W78A 1QDEA 2I2DA 5FUQA 4FNGA 3VAAA 5KOHA 1KTVA 3WGOA 2QX8A 3ZTTA 1MEEA 2H52A 5IDWA 3LJKA 4N5NA 1L5KA 2Z4RA 5IYZB 4D3DA 2UYQA 3DPIA 4HT3B 3W5JA 3T41A 4LRUA 4Y0VA 5E7JA 2A9RA 4UPVA 3NIDB 3IEVA 4G01B 4KLCA 5LQKA 1TAUA 1PSZA 4NTZA 4OXQA 1GPLA 5CB0A 1E3DA 2XUGA 3BJMA 2PDAA 3TLCA 4C0WA 4CU2A 3KQSA 1IOWA 2XKAA 4Y6SA 1ETHA 1YI1A 3RTBA 4Y2GA 2RSLA 1R9NA 5GONA 4ZYXA 1RKUA 1NNUA 1RRGA 1PR6A 1V3TA 1RZRA 4X95A 4OLJA 1DXQA 1VLMA 3RJ5A 4QODA 3OZFA 1PT7A 1DKPA 3KXKA 4E03A 2Q41A 5B3KA 1VKJA 2XUAA 3AEXA 2ZOSA 3MK31 4LXUA 5EIXA 4D4HA 1EJ2A 4L5CA 1OTHA 2B1JA 3P8ZA 5CVJA 4ZYUA 1FYWA 5C4IA 4BY9E 3HRIA 3O31A 4KAXA 4O4IF 2QTRA 4REMA 3IVXA 4QSHA 5F1OA 5BUSA 4TQAA 2J41A 2BKEA 2IYZA 2JFHA 3ZS8A 1AHNA 4EIWA 2H5IA 4ZVQA 4CIYA 2ZRAA 5EMMA 3U48A 3MWJA 3ZU2A 4WZBA 1R00A 1ZAKA 5KMGB 1HFWA 4FTWA 3TFWA 1QHHB 2FFJA 4K6GA 1WL8A 4KWTA 4WK0B 4OB6A 1YC2A 1LX7A 2GR9A 3E82A 4B43A 2NAPA 3JQ9A 2OBLA 1CZNA 1L7OA 1NT2A 3A3YA 4I1SA 3Q10A 3HUDA 2X6TA 4TVSA 2AG8A 4XASA 5KKCA 2H2AA 3PEUA 3G0DA 4QE3A 3U3ZA 4Q5IA 5DM70 1BWPA 2VA8A 5BRNA 1DBIA 3P9IA 2WTMA 3WYEA 3HYTA 4WRRA 1U1DA 4UTPA 3KKKA 4LGVA 4G0WA 2R4TA 4IH9A 1DSSG 3GG9A 1EP9A 1USKA 4NFYA 4P34A 2GNOA 4RL4A 4X1YA 3OY7A 5KNCD 1T8SA 3LX6A 4JJIA 3VVBA 3WSWA 2H2HA 1G0NA 4FDAA 3U56A 3MJSA 4UBJA 4ZYVA 1E69A 2ECKA 1CUHA 3RVSA 3GVIA 3VMMA 2Q1XA 5I51A 1R88A 4PBTA 3WWYA 1IM2A 3B48A 4AX8A 1CX9B 2QT9A 2JI4A 4LJKA 4PC3A 3HEMA 3KJGA 4AJKA 4CU5A 1V39A 3KAQA 4WASA 3C3PA 4YMVA 4LEIA 1K66A 4TKZA 5AM0A 3HA5A 2GN1A 4ZXPA 1EIZA 1O08A 4PLTA 1WHTB 1QE0A 2HCBA 4EVQA 4YCSA 5EUBA 3JALB 4XX1A 1QHEA 2WJIA 1L8LA 5K4AA 1ZH2A 2RB5A 4HAUA 1NX6A 1OKKA 2Q3HA 3TKYA 1T4CB 2B4QA 1HK7A 4G1FA 1PQWA 3IFSA 2QRMA 4HC4A 1NN5A 3LK6A 4N8SA 4IVPA 4O0LA 4BQEA 4IRXA 3FSRA 4HJRA 3HKDB 4J91A 3IELA 4G9GA 1EFRD 1O6CA 2ATEA 5K51A 2I3ZA 4FLFA 4B47A 1N3LA 2X15A 3KDSE 5IUNC 2GX6A 1NVVQ 2GBLA 4TMVA 5JATA 1EG2A 5K3EA 3QPCA 3L84A 4J49A 4OYHA 3RFTA 1FYVA 1WMBA 3PPYA 1NHGA 2FPGB 4ZVSA 3UK6A 4DJEC 4P3OA 3AHEA 1L5HA 2BJVA 2GBFA 1BN6A 5ECGC 1DBSA 3GLFB 3NR2A 2IYEA 3OU7A 3KQPA 3RU7A 4HLUA 4ZZ1A 3E9NA 2VT2A 5TQ0B 1NVDA 2R4QA 3KTAA 4EUHA 1NBME 2JZOA 2GF2A 4P98A 1B1AA 1BN7A 4K1LA 4KXFB 5JW6A 1B8VA 1Z5PA 4J2HA 1CC1S 5E4TA 2ZUCA 3MS7A 5EP1A 5FBVB 1I4LD 4JP1A 1TUGA 3L8EA 4DLLA 1XRSB 1F2DA 3QEOA 2CCGA 1N34B 5A05A 4DV5B 3JD4A 2D3TA 1J33A 1GU7A 3K9LA 1TQ2A 2O1WA 3JD2A 4AKEA 3U4QB 1KF0A 2XVMA 5KO2A 2HR1A 5P21A 1QU2A 3PQ6A 1IVNA 4P32A 4BFWA 2JLRA 3G13A 3RC1A 3L5OA 2OD9A 3BTOA 3HKEB 3IESA 4ZQFA 1V5EA 3EBOA 2ZSHA 3FMVA 2JEYA 2KLBA 3GLSA 3ONNA 3PGMA 4BWFB 2W2QA 4L73A 2AQ8A 5LP6C 3CX3A 2C9BA 1EZ1A 2XE8A 3S55A 1FX1A 1U1IA 1JKXA 2JZNA 1YA4A 2EAUA 2GK7A 4U0JA 1G6KA 2ZW9A 1XP5A 3A4NA 4FUQA 4XIFA 1QBGA 2WFZA 1SXHA 3JRWA 5KHAA 3PTLA 4TTSA 4GBGA 4A8JB 1A7AA 1GRQA 3E03A 1PJ3A 2PRYA 1EA7A 4YO7A 4C4PA 3CQ9A 1L7BA 5JYEA 1NSFA 1IVSA 3ZGXA 2J9FA 3IHLA 2X9GA 4C14A 4OX9B 3KYCA 3FPBA 5A5GA 1NUPA 3EF1A 1XZLA 5KVQA 4J7XA 5LYJA 2I7DA 3P5SA 4PZCA 4XVRA 3WAGA 4XDGA 3OPVA 4IZ6A 1AQ6A 2X14A 2I1LA 1F8FA 2YFHA 3T7KA 2P69A 3WL3A 5KYUB 2Z2IA 1EX1A 3EMVA 3EVEA 4XKJA 4YONB 1WUIS 2ZJZA 1OI7A 2ZWIA 3TS1A 2WTUA 4AZSA 3P9YA 3DTVA 5EQTA 1W6UA 1NRWA 5A4KA 2D2EA 4WLOA 3GELA 3OZXA 4DSNA 1I7SB 5B64A 1A9XA 1KQOA 2NU8A 3G0OA 1SC1A 4RGQA 5JDIA 1M6WA 3N0TA 3UYKA 3CE6A 2V6JA 1XNQB 4C3UA 4QUHA 2IH5A 1KVRA 2K2WA 1XI2A 4KP7A 4HZGA 1DAOA 4EO9A 1U3GA 4CPDA 1A9YA 1EM8B 2AVNA 4YP9A 2CZQA 4ZT7A 3EF0A 1E9SA 1NQAO 2QYTA 5K0LA 2C4MA 2G5GX 3I6IA 3WGQA 3L6UA 3OJLA 1S2DA 1TKAA 1AKUA 1XMIA 1RCTE 4XWKA 4FE3A 2OD2A 3HBFA 3VDMA 3DOEA 4ENUA 1Z2PX 5ALXA 2G83A 2Q3CA 3PQ4A 1BEEA 4MQFB 2FZGA 1QQ6A 2DF8A 1P6UA 1OA0A 3C6BA 4PGMA 1G4AE 5JNLA 1GLVA 3NHJA 4FIDA 1FVXA 3UK7A 4RDHA 2FG7C 1J8VA 1N0VC 1UJNA 1JXMA 5FB3A 5HF8A 5E0OA 4DEXA 3EYAA 3OJ0A 3RTEA 1P2DA 3CSUA 2PANA 2C5HA 3B6EA 1AHIA 4X1IB 1JFFB 3IV7A 3A2NA 3QLVA 5K3DA 1FNDA 4UE3S 3SICE 2EIHA 3RRBA 4FLMA 4EZBA 1QORA 5KQRA 3EFEA 5FJIA 2IP2A 2PRSA 1MRZA 3WP1B 3CVXA 4LS3A 2TRSB 2IEBA 4UAJA 5AJZA 1I6MA 3ZV6A 4DBZA 1HDZA 4U9UA 1W88A 1BCRA 1FU4A 4BE9A 3SPXA 3A4MA 5FNVB 1HE1C 2F8TA 1Z4JA 5DHRA 2D7JA 4X61A 1MG0A 3A4YA 3W2GA 1SUPA 1VMKA 3ZCQA 3EAFA 4L8FA 4LF7B 4PYJA 1EUCA 2VWGA 2YYYA 5M3BA 2C07A 1VE5A 2DTXA 2JD2A 5IDXA 2X3YA 1KL7A 3KHUA 4EH1A 4I1PA 3GXOA 2VPYA 4ZJYA 4KAFA 4GEKA 1ZSVA 1V4NA 4FNMA 4P80A 3EXAA 4CM3A 4JJFA 1D8AA 4BX0A 1SUIA 1WCIA 4ASUD 4P22A 2FPUA 4XR9A 1MB0A 3AKCA 3EX7C 1U5BA 2CLDX 3HBJA 1NVMB 3N7TA 4KGDA 2WHPA 1U0NA 3AONB 3VX3A 1S9DA 3K0KA 1NW3A 2OK8A 3IRVA 2FR8C 2LXNA 3BMNB 4Q3CA 4O3MA 1YSCA 4WKPA 1N25A 1QC5A 1II8B 1Q3KA 4XM0A 5T4BA 1CF9A 4E0BA 1O0BA 3NYQA 2JVIA 1X77A 3KSDO 4PHHA 5K45A 4RH1A 4U00A 3QKWA 4WBNF 5DISB 1CIJA 3I4FA 3S99A 4F85A 2AFIB 1SBQA 2GXUA 4KIGA 4N49A 2YN2A 3ROEA 4I2VA 4KNYA 3CEAA 4JCCA 4I3HA 4AS2A 5COAA 4EYQA 2DHQA 4IMRA 2OR3A 3DOOA 3H1TA 4BX3A 3U44A 3I01M 3KYBA 4L9SA 1X14A 5B1IA 1HT1E 5IMSA 3W2FA 4CF5A 3HADA 1M72A 2BSQA 3UZUA 4K03A 1GEEA 2FZKA 3PSAA 4FKBA 3H9EO 5BQ5A 4Z2YA 4C3VA 4KPYA 3E9CA 3GROA 3SIRA 4FFLA 1CV2A 1LI4A 1KS9A 1MIOB 3CR8A 5JXIA 3EWNA 1HT0A 3IC5A 3EEIA 4MGHA 1Y8CA 4NEQA 4WT7A 3QFSA 4AWAA 2UV8A 2HPZA 4TWZA 1JYSA 1TYBE 4Y1FA 3DSRA 1AKNA 4PAMA 5AVJA 1W36C 1NXPA 2WTAA 1DIHA 5CLQA 3TN7A 5M34A 1P0QA 4PLCA 1ODKA 4TWJA 2CLHB 2A88A 1IB0A 1COWA 2QGNA 3L77A 4LHYA 1D04A 1LWOA 1DOZA 1W0CA 4RIHA 5CAEB 2YHIB 3VPBA 2BTEA 3MT0A 3HDTA 2VF2A 4AP6A 5F3WB 4AK9A 4DYVA 4Q7EA 2KE5A 3O38A 4DCOA 1WZCA 1U7PA 1JG6A 2HQOA 1E32A 2JVKA 3FX2A 3P4UA 1W47A 4DY6A 1I1QB 3G2QA 3DAPA 3HPQA 4JB8A 4DNPA 1QU3A 1LA2A 1RPNA 2CVPA 2GS9A 2QU8A 2YVAA 1WXGA 3HVUA 4GX2A 3HSSA 4NMXB 4Y1RB 2QTVB 3W8NA 4D0LB 2C2HA 2X76A 2DTEA 4KE9A 3H11B 1GV0A 2PEYA 2NPIA 3AF2A 4B48A 1RNLA 4TLBA 1EK5A 1Y6ZA 4XCVA 5JAMA 3VNUA 1ADJA 1JT9A 3LUDA 3R5JA 5E6SA 1GARA 1NX9A 3RVPA 1MENA 2VRBA 5L9AA 2XCLA 1SC6A 1N6IA 2Y93A 2JATA 1GYQA 4RD1A 1B3RA 3UUWA 2RGUA 5ETJA 1QRAA 2K4MA 3QZUA 3UCEA 3KVRA 1VYHA 3LQKA 1OI2A 1T5DX 5KKNB 1X7XB 3WDSA 3A14A 3CUYA 1R6AA 5CNJA 1EFUA 5IHPA 1JE1A 1G7RA 1J70A 3V8EA 4W4TA 4EY7A 1YULA 5BQ3A 3ERCA 1C8VB 1U0SY 2P62A 2NGRA 5EC8A 1JV2B 1DIGA 2Z2YA 3QLUC 4AMGA 1AVTA 1ZO8A 4DABA 1QFYA 3RBZA 4G65A 3WK8A 1L6IA 2NUPB 1P39A 3DDCA 3B85A 2VZ9A 4CYMA 1KSGA 4RD0A 3TGWA 4BX2A 1PIWA 2C31A 3DZDA 3FY4A 1H2ZA 2W6JD 2JAHA 2PV0A 1T9ZA 5I7EA 5ERXA 3F6CA 4A7PA 1U8UA 1X2EA 3LNTA 4M22A 4P9NA 3EC7A 3H83A 1PJ2A 2O5EA 1M83A 3ENWA 1E6UA 1T26A 4NJMA 4HDKA 1XL0A 1JJ7A 2BY4A 4J2OA 4J0CA 5BNTA 3W5DA 1QR6A 1WXXA 1WP4A 4GOLD 1YQUA 3IT0A 3P9CA 4LNUB 1Z0FA 4P7GA 5CW1A 4P5DA 3U9SA 1MC5A 1U98A 3IURA 1IPHA 4G4JA 1OYWA 2EBWA 5EXPA 5I7AA 1QFMA 4MI6A 1K88A 1F0KA 4EMBA 3I2HA 3GBVA 1AA6A 1LDBA 3RREA 4F5YA 1Y1TA 1M5RA 3R6GA 2JVJA 3H5OA 4H6PA 4E6PA 4MIYA 5HMMA 2IVFA 2GVDC 3Q5GA 4FW8A 2XAAA 4PG6A 5FL3A 3UMBA 4KUGA 2ZU6A 3PF8A 4RZUA 5KSWB 2ZRMA 4P0PB 1JBQA 4EKNB 3VPHA 1X9HA 3LIPA 3UGJA 1QQ7A 2W2XA 3IUQA 1YMQA 3KPJA 4M9RA 1DJOA 1B43A 1JIUA 1ZVQA 5EXXA 3W6PA 1SA0A 2VDVE 4ZQIA 5B2FA 1XN1A 4YJ3F 2R7KA 3AILA 5C34B 3BILA 1N9ZA 1M33A 3NETA 1IN8A 4KBFA 3GLUA 1GUAA 2FN3A 3IALA 1XVAA 1G98A 4RU1A 3T5MA 2HBRA 3JQAD 4LECA 3AI3A 1ZINA 4NBWA 2PK3A 3ZNQA 1UC9A 4CMGA 1YRWA 4WCFA 3AKDA 1ZJJA 1CQJA 5JSHA 2GYYA 5DBHX 3U4HA 4U0KA 2X4IA 2UZAA 3E5RA 3MJDA 4R2MA 5E6RB 2M9MA 2DHCA 5AK3A 1D6MA 3OO1A 3JQPA 1T9DA 1NIJA 5CCBA 5I4BA 3TD9A 1UPBA 3VZRA 1T1EA 4BZWA 1BG6A 4E51A 2E4UA 4HAWA 5CDTA 5T7BA 2IVZA 1W96A 5AVXA 1EVZA 1PVOA 3K6KA 3OZGA 1UBRS 4B7CA 3VR5H 4CUKA 4MVJM 3VX4A 1FDUA 1UMKA 4KVAA 2NYAA 1L4BA 3R8FA 1F1JA 3G7SA 2CUNA 5TGDA 4L0DA 2DG2A 1KY2A 1GLGA 3AV0B 4OX9Y 1SB9A 3IP1A 1ZH4A 2XZLA 2O7QA 4J94A 4QO7A 3O4VA 4MRPA 4RMNA 3B20A 4HGOA 2XTAA 2YY5A 5AM1A 3BTUA 2SKDA 1L5GB 4MO9A 5EWMB 2D74A 4B85A 2O5CA 4ER0A 1H69A 3GH1A 4YCMA 3D4OA 2Z3WA 3ZIUA 3O8QA 2IDJA 2QPLA 4FN4A 1OR8A 4K9OA 4RKFA 4TV9A 1TCBA 3LD9A 1YQEA 2A9PA 3NBAA 5FUYA 1QONA 4X63A 4HXGA 1IU9A 1VCHA 3I5MA 1N57A 4Y2UA 4J1TA 1GT6A 3IBSA 4FFBB 2V6GA 4FUTA 3W8RA 2DWCA 2Q1SA 3G6KA 1SUFA 3IOEA 1QVVA 1L5WA 1KYVA 3CYFA 4N5MA 1AQUA 3KL2A 3KAKA 4CT0A 1C2TA 1IXSB 1AJEA 3EIHA 5TPWB 1MFPA 3M6UA 4B3SB 3GJYA 1JIJA 2G88A 1VHTA 3HYSA 4D9GA 1XTRA 1BO6A 4QTUB 2JIZD 4W5QA 2C59A 4WLFA 3SX2A 1UM8A 1JAZA 1JIXA 1JDBC 3MAAC 4RZ3A 4UDXX 3VISA 4JLSA 2AEMA 2PTHA 2Q5OA 3OLYA 4NSNA 3K70B 5JDIC 1YAJA 3IB6A 4M49A 4YJ2A 2GXAA 3BE8A 3KPWA 2AHOA 1RS0A 1PTJC 4NCNA 4KR9A 3ADPA 3HNRA 1EIWA 4NQZA 3QX8A 2ZJ5A 5DBIA 5H4HA 4ZYYA 2C7BA 1IFXA 1Y8RB 2DH6A 3I58A 4KO4S 4NRDA 1PFGA 1XZIA 3DFFA 3LCMA 2IXBA 2QV7A 4WDRA 4ZV9A 1U3FA 3A6LA 2C99A 1V5FA 2LCFA 3OC6A 1NI4B 4ZT3A 4CXMA 3DE0X 4HJXA 2YXEA 3PHBE 4MVWA 5I3CA 4JH0A 1UZAA 1O87A 3ZV3A 3R9KA 2D5IA 2RJ3A 3OF2A 3AFNA 4DIFA 3H2KA 3G8YA 1JKJA 1Z9BA 3ZDFA 1TYAE 3M2PA 3V8NA 5JSKA 3FJYA 2NTJA 1N9GB 3PX3A 1LBHA 5BRJA 1K6JA 4PYOA 4MVJD 1WB9A 4ENWA 2HQBA 3EASA 4ETIA 5KTSA 2ZAYA 3AHGA 2VWHA 4BB0A 5A06A 2QU7A 2QUIA 2R1VB 3MGKA 3C41J 1TZMA 2YIVX 3RJ9A 1DCKA 1G18A 3NHLA 4QVIA 2J1LA 5FV4A 1B42A 3CRW1 4UHBA 3M83A 1I5RA 3HJHA 4MS3B 4Q24A 4EA6A 3KO8A 1HUQA 2CMHA 1B8NA 2N0SA 2AXQA 3MINB 4KQMA 1GFWA 4P4SB 4E09A 4ERXA 2X3UA 3QYPA 3JQRA 1SCUB 1LK7A 3F0TA 4NLLA 4RBNA 4BVJA 4RTKA 4LW8A 5IM4F 1H1LB 4W6ZA 3JR7A 4PLGA 3DZIA 3S40A 1ACMA 3PGLA 1L3IA 4TWBA 3R41A 4M76B 2I4MA 1JQLB 3I2GA 1LBSA 1R4ZA 4OBXA 2NSJA 3DO6A 1WMFA 1QIEA 2RH9B 3QEMA 5IN4A 2JRLA 2LVBA 3CMMA 2QMUA 3PRHA 3LX8A 4FDLA 1PNVA 4PG5A 1Z6PA 1EVEA 4KQHA 2VN8A 3IVAA 4G09A 1N7GA 2XLCA 1H85A 4G4SO 3F5DA 1YIOA 1M75A 2NVWA 2Q6VA 2FG6C 3QE3A 4GOXA 1VE6A 3SMVA 4IQ8A 4YCJA 5LP6F 5C37A 3I73A 4JR2A 3DLHA 2CHFA 5AVUA 1VPEA 2FV8A 3TPFA 3WRXC 2RHWA 3CB2A 4BVAA 4JA0A 3W9UA 2A0KA 2V7TA 5AQEA 2EV9A 2CXPA 1LQ2A 3PRJA 1Q3TA 1ZUHA 2ACWA 2NU6A 4H60A 1ZWLA 3F67A 3QA9A 1BXGA 1NYLA 1Z7YA 4MQBA 3SEQA 2A5DA 3A0UA 2VFAA 2QL9A 1FYEA 4X1OA 2FRDC 3WK4A 4CE6A 4Q9KA 1FZTA 4FLEA 1L4MA 3DE2X 3VTKA 1KI9A 3Q2OA 3ZH2A 1XMXA 1P0FA 4X54A 1YL7A 4CM4B 4NL4H 5ALGA 5CBKA 3WLSA 3IKTA 3ZDDA 5IXYA 2QP9X 1P7YA 2CLSA 4MP8A 2A3RA 4X0EA 5EKTA 2AN3A 3RC3A 3SKYA 1FTYA 4MNTA 4I4LA 1P1JA 1FFAA 4RPHA 3U3MA 4ESOA 5LQRA 2XCIA 5DK6A 5FA5A 3WZ2A 4S1WA 1MJNA 2XIQA 2O9JA 4Q1DA 1H2WA 1N2SA 2DLDA 4JOSA 4NJEA 5FUVA 4EJFA 5AKXA 2Y66A 4ZWNA 3QP9A 3L6BA 2FJ0A 2MJLA 3DLPX 1EP1B 3MOGA 1XTPA 5FORA 4FC6A 2AJCA 1KJJA 1UC8A 2AC2A 2D13A 4B84A 2PKWA 4BVEA 3AVPA 3GGOA 3VHXA 1V7ZA 2F3UA 4TS1A 4EFLA 4YVFA 4MGKR 2RHTA 1P1BA 1PR3A 1U2SA 2ZUSA 5DTJA 1EDDA 4CTOA 3CX7A 5AESA 4G41A 3RYFA 1SZJG 1GRNA 3EDRA 1J7JA 2IQIA 4BVGA 5AKZA 5LFAA 2Z6QA 3RADC 3I9MA 1NY5A 1JECA 1YQDA 2P2YA 3K2BA 2XNKA 2I9PA 4RTLA 3V2HA 3QNMA 1J06A 5AW9A 2VL7A 4DR7B 1VQ1A 4IBOA 2VEDA 3TI9A 4LCJA 1C9JA 2P2NA 2R8PA 2GJSA 3ISVA 2IUUA 3DV9A 4AY3A 4DG5A 3FPAA 4J0KA 1U0JA 1Y4ZA 3F78A 2DQKA 1YDFA 5F1KA 1X1SA 4K9KA 1O0SA 1RRVA 1H6AA 3A4VA 3DTYA 4H7KA 3DP7A 4M54A 3BSWA 2JRCA 2OV3A 2JK0A 4GSKA 1MLDA 3DBOB 1G3UA 4NAHA 2AOXA 1JI0A 5CXQA 1S4MA 3CLUC 4QEZA 4DIKA 1Y8ZA 2ZVJA 4KDFA 1M66A 2RBKA 2GN6A 4GZ3A 4KX5A 4B6GA 1ZHOA 1MV8A 2EW1A 4D4JA 1SCJA 1SD1A 4GI7A 4KO3S 1L4UA 1JH9A 1OXMA 3TF5A 5D3KA 1FVFA 1YCHA 4NJOA 2P7HA 5J2TF 5BSFA 5L3QB 5LKAA 3OQHA 3TJRA 2O14A 3F97A 3TNLA 1FFSA 3IR5A 4HK4A 1ZD3A 3G2JA 2ONJA 4INPA 4CM5A 1YRHA 4RACA 1AK2A 3C1TA 3WNDA 4PTYA 3C16C 3ESBA 3LCJA 2VZ0A 2WUFA 1HG0A 3MIIA 1DC6A 3MWKA 5CA1F 3W6UA 2Y27A 1GNQA 1O3YA 3DA8A 3THXA 1BHSA 1CNMA 1P4RA 1GU0A 2EZ8A 3BWBA 3IEXA 3OWHA 1IN7A 5F9MA 3DMGA 4PYNA 1NP6A 1L8XA 1U7TA 1UK8A 3AIMA 4ZCMA 4Y6GB 4ER5A 2IUYA 1WZ2A 4MCHA 1JTVA 1C9YA 1XMPA 2DBVO 4U5XA 1MP0A 1ISGA 1ZONA 3KJZA 2IOFA 2ST1A 2QHXA 5DKFA 3RVOA 1FJXA 4M38A 1UWLA 4HAIA 2WM3A 3C39A 3A9WA 3WL7A 1JS1X 4Q02A 1UPXA 4Z6KA 4IOJA 1GV1A 1P6XA 2XMZA 2XYVA 4JI1B 3GP3A 2WOJA 2A9FA 9ABPA 5GZ1A 1A4IA 3HCCA 1HNNA 5FYQA 1X8LA 4J0GA 4FYWA 3PVSA 3ZGOA 2AUMA 1C7EA 3O4IA 1XV5A 5ESRA 3GDGA 5LZ8A 3L1KA 4DSTA 3ZJTA 2FSSA 2PR2A 3EXEB 5FFNA 5FX2A 4BLOA 3M5CA 1DEKA 3AIKA 2H1CA 3HFJA 4FJ2A 4JP2A 4W1PA 5IULC 1E2BA 2HTEA 4ZU6X 3RRXA 5CU7A 1J2JA 4U7FA 3CLVA 3DV2A 4DQUA 5EJIA 1PF7E 3F98A 3PHGA 4NNJA 5CCEA 3WLHA 2UYCA 2YVUA 4Z3KA 3C8HA 4OQQA 3X1KA 1U2DC 2IGBA 4KTTE 5CFNA 1YCDA 3OAAA 4OI4A 3TTTA 3KT6A 4D9MA 3OKFA 4CRWB 1XLWA 3OFJA 3OZRA 1CULC 2ZXEA 5EKSA 4ABYA 1QCDA 4M6WB 1YL6A 3LUJA 3RYHB 4DYHA 1T43A 3E4CA 4HNAB 1IZ9A 1KO5A 4RD6A 4RJLA 4FZ3A 1B2LA 3OQNA 1L5QA 4CKZA 4EHLA 1TEVA 4EZEA 3GGPA 3NOOA 1FQWA 3BEDA 1HQCA 1KRXA 4KREA 4O2BA 1ISSA 1W2WB 4L5AA 1F6WA 3R7WB 2XB2A 3OIDA 1KOLA 1YRLA 2K5UA 1SVKA 2PH5A 5H7XA 2VG8A 1CUWA 2EEPA 2EWWA 1SAYA 1TW3A 4Q4JB 4RXTA 4XIYA 2JFXA 4XLTA 2IYVA 5MGNA 1IVYA 3WZMA 1E61A 2CJFA 3A3OA 3HB9A 4M8NE 3BMOA 5KYYA 3THWA 1KIMA 2OP0A 1QRUA 3UMCA 2VCYA 5C32A 1RW4A 2XNCA 3TUJC 1OPRA 4NYJQ 1W48A 3TD6A 2KJQA 3QWHA 2V6FA 3PFNA 4NCKA 1I5EA 3NHKA 3NTQA 3DOFA 1VSUA 3MIZA 1U6JA 2XE6A 4B46A 2E4XA 3MCWA 5ER9A 4DWVA 3D6MA 2AW3A 3E9ZA 3JQ8A 1J2UA 3JWEA 2RI6A 3W5CA 3D7LA 3WGLA 2PKQO 3UT0A 5J47A 2ZAOA 4WESB 2CFRA 2P2GA 2ZQYA 4KTVE 4YIHA 2WLTA 1NFRA 3EYWA 5AYVA 3AF4A 4I7EA 2D6FA 3U4MA 1JWAB 3R0JA 1TQ4A 4OP1A 4BGVA 3I5XA 4ES6A 1WZNA 3UENA 4MVJP 1A8PA 1VRCA 2BUBA 4Q1EA 4K9DA 2EKLA 3GOQA 5ITZB 1ZN2A 5I7HA 1EXMA 2ZRHA 1F51E 4WUTA 3SHFA 2QPOA 2GCPA 4O4JF 4DLXA 1B2RA 3VKWA 4TGLA 5M5BA 4IIJF 3FHLA 5H9WA 1I3CA 4P0TA 4LDAA 4O2BF 4M1ZA 1ML4A 2Q5LA 3T7CA 4AIRA 3I4LA 4GZ6A 1VL8A 3G5MA 1RI2A 3G5TA 2H4JA 1T1SA 2ZCVA 1KY4A 2VJQA 3IKVA 1XRRA 2C20A 2AX3A 4U9IS 4BMXA 3BPSA 4BKPA 3F2VA 1K86A 3LI2A 2QLTA 1CE8B 1W8DA 1KDRA 2FK7A 3OQOA 4IIEA 3UOGA 3RLFA 3FGZA 3A0RB 4OQMA 3IAEA 4IM7A 5DNCA 2QY9A 3BCHA 3CH7A 5E1DA 4HVCA 3B1WA 4X1IA 2HLNA 1E5XA 1TTPB 1XR3A 1D4OA 2FQWA 3NUZA 2ORYA 2W6IA 2XEXA 4ZQBA 3ZS9A 5IBPA 5JMTA 3GRFA 4MB6A 2PAFA 4Y9TA 2GYWA 2GA9A 3NHZA 4NESA 1D5WA 1RRPA 5DE3A 3UXYA 4CTJA 4QZVA 1EESA 1S3IA 3LLMA 1K4MA 5CDFA 1VIVA 2HA6A 4IHJF 4TQUS 2IYYA 1EXWA 1MX9A 1CEXA 3GLHB 4AWBA 4AZ0B 2BCGY 4XYBA 4KG7A 1JR4A 2ZCUA 1N2JA 3W5IA 1HDCA 1WXHA 3WNBA 4GC5A 2WZQA 1WEHA 1OVGA 2IQ5A 5KYXB 1XPRA 2GJ4A 3EGDA 4Q15A 4XVQA 2R62A 4H18A 4JLDA 1HV8A 1Z0IA 5CLJA 2FPMA 2ZYAA 1QM5A 3U5TA 1AIPA 1B7GO 2OWDA 2MCFA 4WZBB 1B6SA 1MQAA 3M6LA 5I7RA 2VQ6A 2DCMA 3QUQA 1RYYA 5B1SA 1KVTA 2P4EA 2UZ0A 2XV1A 4EGCB 3CMCO 1RHJA 3ECCA 4IVNA 5LA6B 5DNWA 4UNRA 4W1QA 3S1SA 2X3FA 3QOWA 4GR5A 4HNRA 4D57A 2PT9A 4P81A 1SJ9A 2Q6KA 4AXXA 1Z29A 2IIVA 3BMNA 4K2HA 3L79A 2WG2A 1KI1A 2E21A 5HKKD 1LRJA 2WAAA 1U3WA 3QF7A 4PY2A 3AQ4A 3HACA 3DDHA 3I9V6 4J4HA 1JXAA 1CZKA 3D1VA 1NBMA 1RZUA 2P1DA 5DYTA 3SAJA 1QQBA 5BOVA 1N6KA 4X1YB 3UG7A 2HOQA 5HF6A 5IWCA 2I4RA 3D5TA 1SIBE 3F4KA 4UM9B 1YR8A 1QRSA 1GPDG 4UJ5A 3RYCB 1VCMA 5EFOA 3G2MA 1UC4B 2FN4A 3GARA 4C4AA 1DTSA 1Q0QA 1K6EA 3BSFA 4FJ0A 2TECE 5AXDA 4F7DA 2GOYA 4CIVA 2ACKA 5J2TA 2GDZA 3K0HA 3TB6A 4DQVA 3OKPA 3F9IA 2LNDA 1OROA 5HW0A 4U6NA 1P1CA 2H0AA 5JS7A 4QARA 3K1YA 3LCRA 2YMMA 3TCKA 3A9RA 3DFUA 1CCWA 1XMSA 2F64A 2ZJ7A 3DBHB 1OFIA 3QOXA 3LTEA 1E2NA 4MWOA 3U40A 2P67A 5JU6A 3PNBA 3G5AA 5A4DA 1EE2A 2C4VA 4R81A 4FI3F 1D1QA 3ELYA 3H6KA 1GSHA 1G2OA 1QIMA 5AI6A 1LCIA 1N9KA 1XRNA 2Q0XA 2Y1DA 5U4QA 4DAEA 3IQFA 4E6EA 3J7AC 2QN3A 5BV7A 2H0QA 3HBLA 3IL2A 3LU1A 4EUNA 4RM2A 2MSDB 2DPGA 1C2YA 4AAYA 1I5OA 3TYXA 1L5HB 1C9MA 4YFVA 1FSFA 3PNYA 1M74A 4EUEA 3HZOA 1C7ZA 2WDZA 3WK9A 1VKHA 4EGQA 5BWNA 4IUCS 1YZ3A 1QGUB 1MA3A 2HK8A 2X5OA 4FPXA 1YB6A 2HJSA 1EQAA 5K03A 1ZD2P 3NBUA 2SNIE 4JQZA 2HWYA 1T2CA 2FX5A 2JGJA 2YWDA 2YUTA 4YYEA 3FGNA 1YF3A 3RYIA 3FLBA 1FLNA 1DBRA 1JRLA 1KBOA 4XJXA 1NC3A 5F76A 1D0IA 1MNAA 2QGZA 4YHHB 1UMDA 3CPJB 2QTVA 4H7EA 4HB2A 3JALA 4KQGA 2JHPA 1DWUA 1VKRA 1SC3A 2HMVA 2DFTA 2Q50A 2VDOB 3COZA 4IP0A 4NH0A 5CDUA 3L7CA 4JA2A 1XYGA 2P2SA 1XXHA 1IBSA 3PNPA 4LOHA 2FKAA 4P7JA 1JLRA 3T7AA 1GWNA 4IDCA 4CLHA 2AOUB 3C87A 4KBYA 3NGXA 1VLZA 3EZYA 3UWOA 1NUQA 3BHJA 3FBWA 3IDSA 3DO8A 2KB0A 1U4OA 3E7XA 1H23A 3HYRA 2DQYA 3K16A 4OQNA 2EWVA 3VZPA 3IH5A 2QX6A 4HDNA 4MW5A 4MEBA 1IEXA 3H99A 4HX2A 1FXWF 1XKLA 1YE3A 4XARA 4E21A 2OFPA 5AW4A 1GNRA 2X1VA 3CC8A 5FO0A 5TMPA 4MP6A 3AZPA 2QX7A 4MWSA 1ODFA 4NS4A 2VF7A 4WLEA 2A6PA 4BNJA 4U2DA 2BFPA 3K09C 1DWPA 3G0GA 3GJ7A 4QLBA 3HWWA 4BFTA 4U7TB 1XQVA 2H9AA 3GJXC 1FQKA 2JK1A 3M4XA 2NT4A 2XOEA 1P7ZA 4FWIB 1OWOA 3LYUA 1NOIA 1RLJA 2C4KA 2XNSA 5JI3E 1A97A 3PRYA 3KJQA 1XQXA 3D6UA 1RLIA 1MGPA 2BI7A 4X93A 2REQB 3B6ZA 2AS0A 3GXBA 1C0PA 1ZM4A 1STOA 2F8MA 2HLDA 2VPQA 3DTVB 3DOCA 2KM1A 2OKGA 1PJAA 3DL2A 2VUHB 1IOZA 4QJBA 3LXXA 4G5OA 2JJ1D 4MKIA 3SBDA 4W63A 3TFOA 4YJ3A 1H6BA 2O7SA 1QH8A 1SQ6A 1U7HA 4ZI7B 3LHSA 1CY6A 2NPOA 3LDUA 3HKEA 3IP5A 3T5PA 3TZBA 4CCYB 4DARA 2V54A 3QU5A 4LOIA 1BHO1 4K6KA 2YRXA 3K31A 3OO0A 1GPH1 4BV2A 3OPYI 1JHPA 2PPLA 4M1SA 4RGYA 3KR1A 1II9A 3FFWA 4F1JA 2VHQA 2XRZA 3L7OA 2YXBA 4DWJA 2V1UA 3EGXA 4G0ZA 2OC9A 2AG5A 5A71A 1EP3B 2ZRIA 3AB3A 3HXKA 1E0DA 3JY6A 4KQEA 4LQCA 4QGFA 2JHAA 3K8ZA 2Q2WA 2VRCA 4GSLA 1ORDA 4UCWA 4X00A 4B3GA 3VRHA 5FP0A 3U3RA 5D6NA 2C03A 3C14C 4FYKA 4EFMA 1F06A 2BZ0A 2O6HA 4N0MA 3QW2A 3IPYA 1W0KD 1ZJZA 3H65A 5ESXA 1AUPA 2YWXA 4LXYA 1L7XA 3HP7A 3BH7A 4PYIA 2P9FA 2QW8A 5B58T 2M6LA 5ADUS 3FTCA 3ICVA 4XVUA 1KHHA 3A6PC 3EG5A 3RCBA 2GLTA 1E2DA 3FFAA 3LP6A 4RW0A 5C4GB 1KH3A 3FYTA 4IF6A 5DI9A 3U3JA 4EI9A 1BX3A 4PRZA 3V00A 5CBPB 3U6KA 1ULUA 2GETA 3O0DA 3OT5A 2QBYB 3CUWA 2ZSDA 3E9MA 4URWR 4X1KB 3HO1A 3CSDA 4OXNA 3QTTA 1XTVA 1DTWB 3ES9A 2FW7A 1FP6A 1K9VF 1UEIA 1OYVA 2UUPA 1KK2A 3N6VA 4OAOA 1ZN7A 1H4SA 4G8CA 1AKTA 1FEZA 4FKZA 1DKRA 4RHCA 1NONA 3B9PA 3O8OA 2GPWA 4LJLA 4YV1A 4EHFA 3NRBA 4BV3A 1QB7A 3VO1A 1FNSA 2CLEB 3WQHA 1ZJ4A 1BROA 1QZ3A 1W94A 4WSOA 2JAPA 4WH0A 1M8GA 4QBKA 1JLLB 4RKRA 4DC9A 4EI8A 2ZRNA 2WZDA 4J75A 3P9PA 2GAAA 4L8GA 4V0NA 4DRXA 1T34A 1LVUA 1XZ8A 5CBPA 1XCLA 2OYRA 2IXAA 2I55A 3ZY4A 4GMFA 4OK5A 3JQCA 4L6AA 1NR7A 4WFJA 1A7KA 2MDTA 1IEQA 2Q5EA 4KX3A 4OEHA 1WDWB 1ECGA 3DMRA 1QVRA 5LXTB 5CIQA 4PW0A 2BGKA 4RO0A 1WTCA 3NUGA 3GAMA 2B8JA 2EDCA 3PFHA 4HWKA 5CB4F 5HQ3B 1LF5A 3DR3A 1AQIA 2OXEA 5P8WA 2IXFA 1TF5A 1FQOA 2QXYA 1MEOA 1AXGA 2UVQA 2YS6A 2FMXA 2H8GA 3DC7A 1CY0A 3I8OA 4IJ6A 5KQSA 2GTHA 3EFOB 3SR4A 3CN9A 4BLRA 1UBNA 3C0KA 3EBPA 1Q77A 3ICPA 4DBLE 4LXHA 3NC1C 1W49A 5CFOA 4A6XA 5JMPA 3FOEC 2JH3A 3ZI7A 2PS9A 3ZUPA 3AF6A 2H65A 4Z86A 1NBWB 2QJFA 2TMDA 5F2KA 1DQNA 5TPWA 2IZOA 5THQA 1WNFA 2HRBA 5J4VA 5JAPA 1ITZA 4GYYA 4FS8A 4ZTUB 1IIBA 4AQ7A 2Q9BA 5JD5A 4P82A 1NRIA 221PA 3HKCA 4S1OA 4CL2A 3FETA 3B1FA 3SHTA 4EB6B 1OH6A 3DBRB 1PWHA 3PXUA 4LA4A 1R5BA 1L4HA 1US8A 3Q3IA 1XPUA 3U7RA 4PVDA 2BBOA 2G1AA 2PMCA 3KEOA 2JD1A 3ZY5A 5I45A 2ZSKA 1UK6A 3T61A 3O4FA 2QMYA 1N2IA 1FNNA 2CDRA 2Z57A 3SSNA 4B4DA 5A3JA 2BGJA 3DUFB 3QVGA 3F9CA 4A0RA 1SCUA 1E2EA 1P2FA 4XGKA 1UOOA 2O0KA 5HF9A 4B4VA 4NXMB 1M0TA 1QZUA 1A8SA 5ECDA 3K6RA 4Z49A 4B2LA 4DRYA 2K6GA 3HCFA 2OQRA 3FWHA 4RKEA 1JIIA 2G72A 4J3FA 1ECPA 4LZWA 3HRHA 5TT1A 3ACBA 1PBNA 1WD7A 2OD7A 1WB5A 3UATA 3L18A 4PICA 1LPNA 1VIAA 2YN0A 2X40A 3A04A 4PX9A 4UU8A 3V7YA 1FMFA 2C7PA 4H7PA 4F4CA 4I4IA 1WWKA 5K0CA 1CP3A 2CFOA 3G88A 2OSVA 5K6RA 4X3CA 2BFBA 3OQ1A 5K99A 1AV7A 3MTAA 1Z4KA 2ADFA 3SQNA 3LC0A 2ODPA 1BKDR 1XLTA 2J31A 3M1IA 3PNLA 3IAXA 4P4NA 1T5LA 1XD8A 3ONVA 3R5TA 2NV6A 4H7IA 4PSUA 1QP7A 5K8TA 2GD2A 2Q62A 2GTPA 4H7DA 3F2IA 2Q07A 1Y5RA 2QG6A 5DTMA 5EIBD 4V0KA 3UK1A 4B8YA 4FWBA 4YRMA 3FZNA 1YONA 2OB2A 1SKMA 2NYVA 3P26A 2FF5A 5TNXA 3NM6B 4ATNA 3H18A 3A05A 5FF9A 2QD3A 3NONA 4IDFA 1U0RA 4HN2A 4NP6A 3UAWA 4AJ4A 5K6AA 4QASA 1RADA 2XHZA 1GQRA 2UXCB 1ZUIA 5C8VA 2XKBA 4RSMA 2W8BA 4PPQA 1RYZA 2C3PA 1UZUA 3P2MA 2IX3A 2ZT6A 5GM2A 1WD5A 2GVZC 3N2KA 4FMCF 1HLFA 3D9QX 2ZBPA 3O03A 3FAZA 5B58C 1RZ3A 2RHJA 2WMDA 1A50B 3E27A 1CR0A 1TQDA 2H29A 4E5MA 5IKEA 4CR8A 5FR2A 2A0FA 5DSTA 4V24A 4MHTA 2V4MA 4B80A 2BM8A 3PUWA 4OFBA 2CWDA 2IEIA 4JQSA 1DO8A 1PT9A 3E0QA 1M1NB 1IWOA 2FPWA 2R1TB 3SHQA 4AZWA 2DR2A 1NXXA 2V9CA 1O6BA 4UBMA 4KQFA 2VCHA 3KYIB 4ND6A 5DCUA 3FYSA 1E4OA 1YS9A 4WERA 3ZJ5A 3JTMA 4D74A 1DQYA 3CTPA 3K9QO 1X1CA 3B2NA 3TW8B 2RGNA 5L3RA 2JCXA 5JAQA 4EL0A 3NHUA 2FUNB 1U3UA 2HSZA 1E1KA 4GOMD 4D0RA 3QUAA 2A1UB 5E4YA 5EMHA 2EQAA 4HDSA 1XJCA 5K05A 1L8AA 2ZPUA 4GS5A 4REQB 3V7FA 1NG9A 3FKSA 3EVFA 5I8WA 1PR2A 4KXXA 5E2BA 2P1ZA 3BJZA 2HHJA 1K4YA 1JR2A 2JPDA 2PKRA 2I8LA 1OX4A 1RHUA 4LYYA 1ATZA 1ZCFA 1DPGA 3MTEA 3ADOA 4Q05A 2GZ2A 3AJDA 3I42A 3WRVA 4C0XA 4FGUA 2I2WA 2D59A 4G0NA 1UUFA 5FBRB 1P1KA 2ODBA 1A4XA 3ZHBA 2JNWA 2E0IA 5CPFA 1EWVA 1JWBB 2QSJA 2WF9A 3B7PA 3OQIA 4BAGA 4NY1A 1NULA 4DBLC 1K8YB 2QB5A 121PA 3C3BA 3GLHE 3QELA 4OM8A 3G0HA 5HTKA 4XEHA 1QPGA 1SCQA 1N2OA 1XZQA 1R27A 4Q3BA 1BRMA 4B3XA 5JZSA 4Q3AA 2YMLA 4QTTB 2QE7A 3F7NA 3K20A 1RYHA 1BFUA 1QFJA 1UKYA 5IM4A 3B89A 1CG6A 4B5LA 4EVRA 1DJQA 4JB2A 4RS4A 4KSCA 4PFQA 1I7PA 1TIPA 2AMFA 3WFIA 5L3QA 3HV2A 4IQ0A 3JYLA 1OCEA 4JB0A 4BECA 4RZHA 1P62B 4JENA 5G3ZA 5DM0A 4Q1VA 3LT1A 3BUSA 4WKNA 2XTMA 4RVHA 4MKHA 1Y7PA 2R6R1 3TRKA 1HRDA 4R9RA 3WNQA 2AXEA 2AUTA 1KMNA 2AR9A 3OCWA 1MVNA 2CYAA 5BR8B 3FYUA 1CR1A 2XUOA 3L7IA 3FOWA 3K4QA 4ZVUA 3MA0A 4DTCA 5C5CA 4YN3A 5HE9A 1FYDA 4YP5A 4FN5A 4CFYA 7MHTA 3AHFA 1FXUA 3DHEA 1V9LA 4HTAA 1KQGA 4MR7B 2H1VA 4M1OA 3V97A 3DE5X 1NW6A 1VJ1A 1N5RA 5LMNB 1ZR4A 1HDOA 3SIWA 4QBFA 1G6HA 2C5BA 1GKUB 3C3JA 2WUVA 3Q4GA 4JJGA 4NBLA 4WBSA 4B3JA 4V0LA 1F5NA 4DY4A 3TWOA 2JFPA 2P7IA 4OM7A 1XTTA 4DKXA 1JHOA 1Q6ZA 4J1SA 5I9MA 2YJNA 4H1WA 5IJ9B 1GKIA 2O0MA 3KJIA 3N74A 4PR3A 1QOQB 5E1BA 4J3JA 3RF6A 4HYQA 4A2CA 1J97A 1U8CB 2XGJA 4EHBA 3AF5A 3WOVA 1DNPA 2ZJ4A 3A26A 3GRRA 1VHDA 1Z6AA 5JAHA 4PM4A 3RTAA 3B2EA 2OUIA 5DMXA 1X9IA 2DPYA 2IHJA 2JCBA 4G97A 1OPXA 4MA5A 4ECAA 2AN4A 1KYIA 3R6LA 3T3IA 1E3QA 2FR0A 2JIMA 2EKZA 5BSEA 1Z36A 2HHLA 1KU6A 5KSZA 2G82A 2X22A 1D0VA 3IT1A 3CZMA 2NUTB 4GECA 2ZBFA 4JZKA 4LDNA 2AI1A 2C3YA 4GBMA 3WO1A 3AW8A 2V7QA 2GZ3A 8ADHA 2VUSA 5IX8A 4AJOA 1R8QA 3B6IA 5TEVA 2EWMA 4G2TA 2IYAA 3HABA 4JWKA 4NK4A 4X7BA 1BS2A 5EN4A 1ZA1A 1OKKD 5CM2Z 2WA2A 3PC8C 4II3A 1YBMA 1ZN8A 5CX1B 3UMSA 4RJIA 1V11B 1BMTA 2Y99A 3AIOA 1T8UA 1ZK0A 3WIUA 2AQIA 3WY9A 2DYKA 2M6SA 1PR0A 1GLNA 3A6ZA 2HJVA 4NOMA 2PFSA 1TU0A 1O97D 2WYIA 4IIXA 5A7GA 3RIEA 2AWNA 2WJJA 3CU5A 5FDFA 5TSDA 5KUTA 3N1UA 2BCJQ 3E3LA 3MB8A 3OJFA 4X60A 1Z4LA 5BR7A 2B8NA 3KZOA 5IKXA 5F9FA 4DM3A 4AUKA 3HYLA 1ATIA 2HA2A 2X77A 5JSZB 1X7HA 3EXEA 3HWX1 3QEKA 4BHTA 5CCDA 1E94E 5KDLA 1AUQA 4DB4A 1VYVA 1VSVA 4MK4A 3BCSA 1KZYC 1QG6A 4IUDS 5HUQA 5L45A 4MJLA 2WFLB 4KITB 4M36A 3ZXXA 1K8RA 3EJ6A 1GO2A 1IIRA 1VL2A 4PGFA 1AG9A 3B3FA 4RZSA 4P92A 1GTMA 2IFTA 4EEKA 5EUMA 1AGXA 5L4NA 1E6KA 3LRPA 2NXJA 1CW2B 4N5DA 4NH4A 3V5NA 4J90A 3GLFA 2BYTA 2CXRA 1IJFA 2H5LA 5K9ZA 1KO1A 2QMZA 3GD7A 2A7QA 5CX4A 2X2EA 4J6EA 2WT8A 3ZKAA 3T3HA 4LI3X 2R60A 4YWJA 3H86A 5ALYA 1YZVA 5FPPA 2QROA 3B1JA 2I29A 4C5AA 1PV1A 4MWDA 3DHNA 4RY8A 3WGHA 1IRIA 1D1PA 1H1LA 3WB0A 1OBCA 1RP7A 1Y3AA 3O3OB 4O02B 5FTJA 4RZIA 2GT1A 2Z2KA 1CUSA 2R8XA 5D3MB 3BZBA 1Y81A 3BERA 4FDVA 5KIAA 2GCOB 4K5QA 1VL6A 2PBRA 3RVDA 1E1CA 4RESA 2Y1GA 2XYHA 3KLOA 2HSGA 3HS3A 3WKDA 1TD1A 3GMTA 3IUBA 3MWYW 1G2PA 5AKHA 1O95A 2UUCB 3AJ8A 3URMA 3CV3A 3JVIA 1IUOA 1LPMA 3S2FA 4IEIA 4MV8A 2NUAB 4NMWA 3AU8A 4K9PA 1ECCA 1X3LA 4Z1MD 3HCBA 4IWYA 2G06A 2VKQA 1A8UA 1QTRA 4FHZA 3TB4A 4LYGA 4KVFA 3Q85A 4PE5B 5DNYB 4DDKA 1QP4A 1ZI8A 2H7VA 4JT4A 2KMLA 3DE3X 1SVMA 4QICA 3V7NA 4H27A 2O0HA 2QQEA 4IV8A 4ZU3A 2EJUA 1HE4A 4ZV4A 1L7PA 1L3CA 2PWZA 2YZMA 3KUXA 1OGJA 5GJCA 4AMUA 1NURA 2XXBA 2XHEA 2POQX 2ZZKA 3OIWA 4GZMA 3R0XA 4LYFA 1X39A 1AGRA 5CVDA 5LMCA 3FUXA 2HMUA 4EP1A 3U49A 1U7ZA 2E48A 1BKSB 2J3EA 5JRJA 2BGUA 1YBAA 5I9NA 1UBKS 1ADGA 2BM0A 3K30A 3VNRA 3TBFA 1NVUQ 2JFGA 3T94A 4IZHA 4WIAA 3FRIA 3BCUA 4JODA 3LZCA 4BO5A 4RIFA 4WA8A 2OVBA 5IUJC 2XDWA 3GLHA 2WZCA 2D1TA 5DN6A 1E58A 1DBPA 1NLZA 3KYJB 4HMOA 4YI3A 3SM3A 5I4CA 2HXSA 1I2ZA 2QJWA 1LRKA 3DE4X 1KMCA 1JG4A 1SVUA 2Y9MB 3OLXA 4XDHA 3LVBA 6ADHA 4L6IA 4ALLA 5BWMA 4IICA 5NULA 1M0EA 1JA0A 3R0IA 3ACDA 3EQ6A 4Z4HA 1C7RA 1OX6A 1UM9B 1QXSA 5C8YB 5LIPA 1WBDA 1A9RA 4HUTA 1DT3A 1B15A 2WF8A 5IK2D 2VF4X 4PHCA 3KBOA 1MO3A 3HQ4O 5DHUA 5SYAA 1VE7A 2NU6B 1TE2A 4PC6A 5FBQB 3EK2A 4F60A 4C05A 1NBHA 2ZS9A 4KW7A 1LSOA 4N7JA 1L6RA 3RK0A 4FILA 4H2DA 4E5PA 2OWEA 4GP6A 4JEMA 1H2BA 2RMKA 5D1HA 4UOEA 2IYRA 1OGIA 1GPBA 3AG6A 1L3BA 4L02A 1YS4A 4IR7A 4BKRA 5H1YA 1GTRA 4MUHA 4OMUA 1LRLA 2IHNA 1Z08A 4KI0A 3EODA 4B7XA 2WK1A 2IYLD 3KKEA 4LN1A 3GLTA 3DMTA 4AKSA 4AZ0A 1CYEA 3PQFA 4FZ5A 3E53A 1F3OA 2R6DA 3STHA 1HYQA 1O8BA 2N42A 1UDXA 1R64A 1BXZA 1DELA 1U2TA 2YWCA 1W5AA 1DZIA 4YMHA 4GX5A 4MV6A 3BSYA 1XZBA 2V3VA 3ZD7A 3H8SA 3FNBA 4FOSA 1G63A 1E6MA 2COKA 4JK3A 3HWRA 4FHDA 5JRDS 2ZPTX 3S4YA 2RHBA 2XMGA 3M5DA 1KAMA 2JJYA 2ZIXB 1L4GA 4OUDB 5JCOC 3AV3A 2XCQA 1OAAA 1EGQA 1X1DA 4MINA 4EFDA 2DQZA 1Z6XA 3AEZA 3CLKA 4LXGA 1TEZA 2HL6A 2CF6A 3WIVA 3DB1A 1JX6A 1SNYA 1E3SA 3WMRA 3UFXA 2C77A 4CM9D 2GRJA 2VZEA 3D31A 4L72A 2HYIC 4I1RA 1DXOA 3Q12A 3HGTA 3UN1A 7GPBA 3AVXA 5FV7A 2ZIZA 4BVLA 1P19A 2DPXA 3ZWQA 4O2AA 2UVPB 4IOKA 4ZQGA 2C2YA 2PSSA 2Z8XA 1VG0B 3GZNA 5TEWA 2NSLA 1RXVA 3NAQA 1OZAA 1U81A 1WR8A 3PQ3A 3E84A 5AICA 2O05A 1HEYA 3C5WP 3CUVA 3QKUA 2VUIB 3U7QA 3ZG6A 2C9DA 2W42A 2BKAA 3VFDA 3P20A 3H8WA 1I3LA 1KVUA 2I3DA 2QW0X 3T7IA 4EFNA 2VYND 3D64A 2PU5A 3G2IA 1X92A 4DLWA 4F3KA 1G2QA 1PG2A 2OO3A 3RS9A 2BH2A 1ZMBA 2V8BA 5K0BA 1PZMA 2W6CX 4CMHA 1IG3A 1U7DA 4RPKA 3VYVA 3GIDA 1GVNB 1Z5VA 3PXAA 4ZT5A 1WJGA 3SE0A 3SQMA 4Q01A 1R4AA 4ML3A 4F4IA 1DCMA 2OCBA 4M0MA 1RAEA 3W2HA 3B70A 4UUOA 3KSAC 2OYCA 1MHPA 1WUYA 2DY1A 1R9MA 2IZ0A 2ZUUA 1RLTA 3IT2A 3TL6A 2A9VA 4UVGA 4AUMA 4D8WA 2I71A 4IIDA 4GPIB 4WMLA 4WZAA 5CK4A 4FB5A 4KQCA 3UCXA 1RU3A 2OO7A 5KNCA 1ESMA 4HSEA 4JYPA 1M1YA 5EHGA 6ABPA 3SLKA 2C57A 5A0VA 1U5CA 4ZOAA 2P90A 7REQA 4JVMA 1B0AA 2ZTMA 1LZKA 1M7BA 3PB3A 1P1IA 3RSSA 3R3XA 5MN5A 3L0ZA 3AL3A 4D56A 3WGJA 3BQNB 4JYBA 5CYPA 4KDCA 4DJ5X 3E61A 1XE3A 1G8SA 3OMLA 4RMJA 5DLYA 4RJTA 4KXQA 2CV0A 1DAPA 5DDIP 2FWBA 1VJDA 3IKMB 1T8TA 4C01A 2JARA 3CLSD 1NZDA 1YRBA 2I22A 2NMVA 3O8NA 3SZRA 3OCVA 4D25A 5EWLB 1ISFA 2YWBA 4P33A 3D1JA 2WAYA 4MYSA 4WWHA 1JR3D 2ARKA 3ZE7A 4XD2A 5CFZA 3D43A 3GLKA 4QOJA 1S96A 1JJIA 4PNZA 3OZDA 1NJ1A 1UEJA 3EQZA 2GCNA 4WOBA 5KOYA 4G1CA 1Z74A 3Q3HA 4OGKA 4IDQA 3TSZA 3TM5A 3LC7O 4LQ4A 5IAEA 5HDQA 5KYYB 3RRJA 4AMZA 3ZD8A 1W581 2IE8A 2X42A 3HDJA 2FSGA 4NR0A 2EBHX 1GD1O 3JD3A 4O4LA 3FLEA 3CUTA 3PFIA 3W2EA 1QIIA 3I92A 2O1EA 4PYQA 2FDRA 3OTHA 5EGNA 1RWXA 2Q2QA 3AEQA 3LF1A 4H1UA 4LHZA 2KYRA 5CTJA 3DCNA 4DREA 2QWXA 4UUMA 1KPIA 2GCEA 4BP3A 1XCBA 2LKDA 2Z98A 2B4AA 4GXQA 1DRJA 1LLQA 1SU6A 1HE5A 4RZQA 1ISIA 1ZNQO 3SS8A 4HNAA 2I34A 1BE1A 4HCJA 3R24A 1Q21A 3F1LA 4L3WA 2BEVA 4O1HA 1UOEA 1Y8QA 3LF2A 4NE2A 5KTTA 4DV0B 5I4IA 1JLSA 2BGNA 3C5VA 2JGIA 3T3DA 3QVVA 1FL9A 3GDFA 3T52A 4EW3A 5FTMA 4NCAA 4MAAA 4Z0PA 4CV3A 3KDAA 3AB7A 4NE7A 1M2VB 3AP3A 2ZJ2A 4YASA 3OPXA 1IJBA 4X24A 4WXPA 1FY2A 1WPGA 2JGNA 3A28A 4FFRA 3S1AA 4G0PA 3KETA 3BWDD 3R4VA 3ANTA 4JXJA 5E2AA 3EZ2A 3ZJ4A 4BAUA 3KR0A 3L06A 4ZYLA 2Q7OE 3DCJA 3BMOB 1X1TA 2HLDD 5J59A 5JJCA 5DW3A 1U31A 1E89A 4LDRA 3M6VA 3R44A 4R54A 3BJIC 1SOWA 3BEOA 4PZPA 3TLBA 3LX5A 2CVZA 2VDPB 4KPUB 4JP5A 2V98A 1K5PA 5C1DA 1CK4A 3LUFA 1JZQA 3D6TB 5CD9A 1G1AA 2ZUBA 4AN1A 1DT5A 5L3VA 1QF9A 3DYBA 2A84A 3AF0A 2ATVA 4AN4A 1R6BX 1Z6ZA 2UZ1B 5FTNA 2Q9UA 1KEZA 1SXJE 5IAJA 3DKKA 4YT2A 4RHFA 1G20B 2QV0A 1DHRA 4TROA 1EUCB 2NYRA 3DTVD 4QNNA 1E5VA 3H75A 2P6OA 4Z9BA 4P3XA 1F2UB 1N5IA 4R8VA 5CHEA 4F9TA 3D4IA 5E4FA 2XMDA 3KSUA 5TX7A 4H0FA 2FZLA 4S1PA 3Q72A 1WQ4A 3OQPA 3EIUA 3O8LA 3HVIA 3RRMA 4XH9B 5GINE 1CRQA 2HT1A 1QMPA 1KO8A 3F74A 1MGOA 1T3LA 3PUZA 4WJZA 5A1JA 1IAVA 1JT2A 1U9JA 2C2OA 1JDBB 3MF4A 3WJ1A 4B76A 5JFTA 2CXQA 1T6XA 1H42A 4UFOA 2IH4A 2H48A 3Q9LA 3ZBTA 2C04A 4NDAA 4WGGA 3ZBUA 2GAOA 2YZKA 3B60A 1OREA 2Y1LA 4LRQA 1FFWA 2OECA 4GL2A 3D4PA 2VNJA 3KCQA 4R0VA 2OENG 3UA4A 1JHAA 3PP8A 2Z8YM 3I8XA 3OMWA 5E1MA 3GQBA 1R9GA 3UKDA 1N2CE 1YB1A 5BW4A 1U0GA 2ISCA 1R0XA 2FN9A 3GJ0A 2A4KA 4HDMB 4JQOA 4RYLA 3ZQKA 4CNBA 4WXMA 1C80A 2D1FA 3ET5A 3GFQA 4UNQA 3EPJA 1VYTA 2Z2ZA 1N6NA 3I45A 3BRSA 1V8OA 1N2BA 3IPAA 1KK3A 3FTQA 4MKXA 4LG1A 1MHTA 4W9NC 4OQZA 4R98A 2RI0A 2E18A 1RAHA 2XMRA 3EVBA 1D2AA 4CDRA 3L4KA 3P2OA 3CVWA 1VLVA 4FBLA 1MJGM 3PLNA 4PAGA 2J3IA 1XQWA 5H3HA 4X64B 4DMGA 1ZNZA 1W36B 1Z47A 2DBZA 3GQBB 1MV5A 2K7ZA 3HBAA 3HKBA 1ILWA 2IW3A 2JIZA 4L4XA 2QP3A 1WCXA 3O5AA 2VPPA 1F1BA 2V6MA 1E5TA 3PE4A 4OQFA 1UR5A 3EY4A 4TM7A 3WGVA 5K3SA 3NTXA 3RYCA 2DRIA 2OV2A 4IKEA 4WTOA 2BMEA 4BNTA 3V46A 1T1JA 3WGGA 3C6XA 4IF4A 1ORTA 4MDEA 2YHUA 3WBJA 1J39A 1XQ1A 2ZRFA 3LP5A 4X8LA 6Q21A 2DULA 2JCGA 3FCEA 3H4TA 1TLLA 2H4HA 2R97A 3WKAA 1IULA 1KMIY 2XSZD 3GCDA 2FW1A 1VPDA 3LUBA 5F1PA 2L0XA 4GX0A 4WZ6A 4ZAGA 3S2SA 3ZHQA 4LYDA 1HEIA 4LY9A 4JJ6A 4PG4A 4DCUA 2ZIGA 5IHXA 5ELXA 3CIFA 3TRIA 1F4LA 4QHYA 1VHLA 1ZRNA 3B52X 5A3VA 1GZSA 4YRGA 3DZJA 1H9CA 2LBPA 3LKZA 2JCSA 4GXTA 2A86A 2CL5A 1YB4A 1K98A 2MSKA 2PSEA 2EATA 1P29A 2IDKA 3AR2A 3GA5A 4GE0A 3NOVA 3GGGA 1KMHB 2G77B 2ISQA 1HLPA 2FF7A 1TOAA 3ANLA 4LJ4A 4AXBA 1SQ0A 3KE8A 1GCGA 1GNSA 3DZ8A 1L4KA 3GT4A 4LF6B 3B12A 2J6HA 5G41A 1X1QA 4D4LA 4F06A 4NZZA 3QOFA 2UXDB 1KKUA 4MGIR 4RMGA 4TTVA 1XZFA 5MN4A 1VGQA 3DOIA 5CYFA 1L5ZA 1XTQA 1UZNA 2NZJA 2IEYA 5BVHA 1XF1A 1LF0A 4KR3A 2ZJBA 4ZREA 4POOA 2H11A 4EG5A 1TRKA 2ZTSA 4FEGA 3THSA 4KLZA 1YDGA 3FHCB 4I66A 3SC6A 3UJ7A 3VPSA 3WKCA 2CLCX 4N4AA 1TW2A 1GAWA 1OI4A 1UPFA 2OK7A 4F5EA 3AY7A 3A6DA 2HRDA 5CT5A 1X86B 4HDSB 2EYQA 1OFHA 2PT7A 3CSSA 4RCVA 1JB1A 3SDZA 1P2SA 4G5SA 2ZZNA 2QMHA 2OG1A 2BDEA 3VPFA 5A62A 4QUDA 1BDMA 1UBFA 2G5TA 3OU6A 1ONSA 1CEQA 4LV6A 4QVGA 4TXNA 1DQPA 3S3TA 2VHUA 1WUKS 3GRYA 2D2VA 4L1KA 1H66A 4F92B 2VQFB 4X85A 4EJSC 3QWIA 2AOWA 4I55A 3KPUA 4CG0A 4CMCA 3U3KA 3C2QA 3QPBA 3C3EA 4RWEA 4K2AA 3INRA 5DF1A 3TLZA 2IEAA 2R6FA 3JZDA 5HCUA 4BQFA 3LT4A 2NVBA 2TYSB 3IA2A 5T6MA 2WAXA 1J0DA 2SICE 2WP8J 3P9SA 3REFA 3WIOA 4QXRA 4C4TA 5CXUA 5HIKA 1LXCA 2IYNA 2L82A 4CQNA 1FFDA 3T7DA 4I36A 5ITVA 2Y6UA 3ZE2B 4WCVA 4L4YA 3WVNA 5H4GA 1V1MA 1ZOPA 3ABOB 2HRQA 3QVKA 4PRKA 3GUHA 4LZOA 1NMXA 4QQKA 5EYPB 3TAUA 3DEAA 3TZHA 3I9LA 3BQMB 2ZTVA 3Q5EA 2V4ZA 3W8DA 5JZMA 4ACBA 4ZHQA 2IP4A 2WINI 1JSLA 4XSVA 4M55A 4MRAA 4ZOEA 4KN6A 3EPPA 2OVFA 5A9TA 2OCXA 3VTZA 1EUQA 3VGPA 5TGZA 2PUEA 3AR7A 1JKFA 4CEJA 1VFPA 1NJ6A 1M7GA 1M2WA 1WX1A 1SA0B 2H2DA 2SBTA 2XYQA 4NNOA 2GZAA 1NUUA 4UHKA 3SC2B 4KO1S 3WK6A 4BKMA 3GT0A 4G4GA 1T6BY 3WQRA 5K8CA 1DAIA 1WKCA