3GCGA

Crystal structure of map and cdc42 complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
177
structure length
173
Chain Sequence
QTIKCVVVGDGAVGKTCLLISYTTNEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into host GTPase isoform selection by a family of bacterial GEF mimics
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/transcription
molecule keywords Cell division control protein 42 homolog
total genus 53
structure length 173
sequence length 177
ec nomenclature
pdb deposition date 2009-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3gcgA00
2ZRGA 1DOAA 2NPIA 4GP7A 2ZYUX 4OQMA 3UPUA 3AP2A 4DDTA 4ZKDA 3ZVMA 1G9XA 1VKJA 2GDJA 3QF4A 4FMDB 4KV9A 5DHFA 4AKIA 4KFUA 4LJYA 4FCVA 2FMXA 4LK2A 2YC2C 2WWGA 2DR3A 5FPSA 4B2IA 3U4QA 2IX3A 5HKKA 1RJ9A 2QRZA 3MWJA 1MABB 1ESMA 2PEZA 4PAOA 3TH5A 3BRWD 4NCHA 3PEYA 1CS4C 1R8SA 3VX4A 1PLJA 2D62A 3CWQA 5HR5A 3AKEA 5E7MA 4KLNA 1E6CA 1WB9A 3CZQA 2YWFA 4QKQA 4NYJR 1E32A 1Z0DA 1G18A 2FSGA 2CE2X 2ZS9A 4YC7A 3T1VA 4B48A 4EPXA 4D26A 3P32A 2RGAA 2O8FA 1G21E 4RKEA 1FTNA 4F4CA 1HEIA 3B78A 1G5PA 2YOGA 4LI0A 2ZREA 1PV4A 4HAWA 5C46F 3QVVA 3JZAA 3B1VA 5JHGB 2A9KA 3W5JA 5AUOB 1A7JA 4ESVA 4POAA 3D3QA 3Q5EA 5DE3A 2JA1A 3GLFE 2GKSA 1E9FA 1IN4A 4X8OA 3OEHD 3R9WA 3DL0A 4CEJB 4A92A 3RWMB 3KL4A 1JB1A 1ZU5A 2OLJA 4YMVA 1OB2A 4FCTA 3GLIB 2VP2A 1QBKC 5FUYA 1Z5ZA 4JLAA 2AXNA 4ARZA 2FU5C 3GEHA 4PHGA 2PJRA 3IEVA 4ILEA 1TL7C 4F93B 2O0JA 4HZUB 2CMKA 3I62A 1UKYA 1DE0A 1R8QA 3EZ6A 1RRGA 1XD8A 1DO2A 1E2NA 2C96A 2FSHA 4XWOA 2PZEA 1AKEA 3T1QA 3BAFA 1J8MF 3EA5A 4Z8XA 1CTQA 2HLDA 2IYLD 1R2QA 4EPWA 2X1VA 3K70C 1Q1ZA 1KHTA 1N6LA 5GVRA 1DTSA 1TQDA 2QBYB 2REXB 1AIPA 2ZJ2A 4UJ3A 2F9LA 1QDEA 3PIRA 1ZINA 1E1QA 4QBHA 4CW7A 3BB3A 1UFQA 2EWWA 3CZPA 1SVIA 4A0FA 2O8CB 1TUIA 4HAUA 4LBWA 4IFBA 2GJ9A 1J90A 5C2JB 2ORIA 3BFVA 3QF4B 4NHOA 2J0SA 2OUKA 4PFSA 1M6NA 4DCNA 3U7GA 1DELA 1NBMA 4LGMA 1OE0A 1EFRD 1G8YA 2Z5FA 3RLFA 1II8A 2GETA 4NYMQ 1FUUA 4M1SA 4ZPXA 1UDXA 4M1WA 2JASA 4MYHA 1W7AA 3FMIA 1OFTA 3HU1A 4EPYA 2FA9A 5A5GA 3ZD7A 3CRQA 2GCOB 4HDQB 2ODEA 3RS5A 2HXYA 2QMEA 1TTTA 4KVAA 3C7KA 3ZIAA 1LY1A 3VKHA 1NL3A 1XEWY 2HV8A 3QI2A 4HI0E 3WHLA 8OHMA 3EASA 2GXQA 2HF9A 1P75A 2Q3MA 2RGNC 5P21A 4YMSA 3T06B 3GPLA 3P1JA 3UMSA 1OYWA 1RE0A 3ZS8A 2XNDA 1KMHA 1V43A 1FNNA 1KKMA 2ZJZA 3AKYA 2Q6TA 1TF7A 1YR6A 1NVVQ 2C9YA 5DYIA 5LB2A 1G7SA 3SI7A 2VSOA 4D0GA 5UKDA 1T8TA 1E1RD 1YQTA 4JBXA 1NBMD 3RRNA 4C0HA 3ADBA 2ZXUA 3SC3A 3RS4A 2GCNA 4G01B 1AS2A 3X2SA 3QY0A 3V9PA 1DG3A 2IF2A 4GFDA 4I1VA 4JT4A 3ZZTA 4P4TA 2XXAB 1Y63A 2ZRAA 4Q47A 4KJZA 4U02A 3U3OA 3HU2A 2XGJA 2ATVA 2DYKA 2FGKA 2GK6A 4PANA 4KXFB 1E0JA 3QKRB 1IY1A 4QJ3A 4Q7MB 1UDWA 1MRSA 4G3XA 4WA7A 1JEDA 3CRRA 4H1VA 5JHHB 3SR0A 1NVUQ 2I4IA 3KKMA 2ONJA 3X1YA 1N0WA 1BMFA 3GFTA 3PR1A 4GDFA 1NN3A 2PLFA 2EFCB 2OO7A 4LY6A 3WYFA 4HB3A 1E1RA 5JEDA 1KKLA 3QBTA 5DHAA 5L8VA 5F3WB 1GKIA 4LDJA 5IF9A 2L0XA 3REGA 2ZUDA 4L15A 3TUJC 4G0NA 4YQFA 1BIFA 1YKSA 1SXJE 4ASUD 3EXAA 4DLZA 4U5XA 3WNCA 4Q4HA 1NN5A 1G3QA 4I1SA 3WBKA 2WJGA 1M2OB 5G3YA 3W6NA 1FNMA 4MGYR 4RJLA 3KKNA 1W36D 1TQ6A 3U3JA 4ZIRA 3CH4B 5J4LA 4NYIQ 1L2TA 4TL7A 1II8B 2WHXA 3OEHA 3QKUA 1NKSA 1XCPA 2PX0A 4F4JA 1Z0IA 1Q3HA 4DCTA 3K0EA 3QBVA 3V4RA 3AH8A 4EFNA 2OFWA 2VEDA 1GZSA 1E2FA 2W2VA 3A1TA 4K81B 4D0LB 5JWHA 3EPHA 1Q21A 1Z0KA 3CPJB 5KNCA 1XNJA 1QHHB 3SBDA 3NEYA 4OK5A 2FPMA 1M7HA 1ZUNB 4CT5A 1CJMA 2IS1A 2ZI7A 3FYHA 3K1JA 1KJWA 4CZ2A 1AJEA 4URYR 5FTKA 4Q9KA 1R6BX 5KDOA 2C78A 2BMDA 3CPEA 4LJ4A 4D80A 2JJ8A 4HSEA 3CIOA 3LBIA 2IK8A 4Q9JA 3CF6R 1KGDA 1P6XA 5HKKD 2J87A 3UXMA 3LQRA 2R6AA 2VHUA 2XZOA 2J7PA 4NCKA 2WIBA 2ZE8A 2QT1A 2CEAA 2GVDC 4FW9A 1E2IA 3EG5A 1T0HB 5HPYB 3KB2A 2D3WA 4JLNA 5BN3A 4QBGB 3VR5A 1SXJA 3HWSA 3ZYCA 4TT3A 5CB8A 3F3YA 3OIYA 2ZRCA 2FGJA 3C4JA 3QIAA 4LX0A 1A82A 4HB2A 3T5GA 4RFSB 5DIFA 3SE0A 4JJKA 3RS2A 3SFVA 5BN4A 1LF0A 1KY3A 2UKDA 3AM1A 4DVGA 5L3RA 2VPPA 3PV0A 4ZIRB 4M53A 5SZIA 1IHUA 2R6FA 1JAHA 2GNOA 1OIWA 1OSNA 1XTRA 2BBSA 1G3UA 3OHMA 3Q3JB 4XD7A 2GEVA 1E2PA 3TIFA 3GLGA 3ICQB 2XNDD 5HZKA 2J1LA 4Q4HB 3R8FA 5IK2A 5EP1A 1XCMA 1F2TB 1IAQA 1SULA 3RC3A 2J59A 1X3SA 3VTKA 4W5JA 2HT6A 1Q12A 3WRYC 2DFKB 4IFEA 4CEHA 4EPVA 2HDNB 5DN6A 4BUJA 4RVCA 1S9HA 4QC2A 5DGXA 4KYIB 3W9YA 1XPRA 4LC0A 2IUSA 3T1OA 1I4LD 4C0QC 3CX7A 1T8UA 5GVSA 2G9NA 3EA0A 1W5SA 4OJKA 1XB2A 1NNEA 1XXHB 2WJJA 3CR8A 2ZETA 3TVTA 4Z1MA 5KSPA 5FR2A 4BRUA 1EX6A 4B35A 2BVNA 1S1MA 1VYUA 4LSGA 4DCUA 2OM2A 1FL9A 2F1HA 3ZIAD 4ITRC 3T5DA 3R8CA 1W4RA 1SVWA 1YR7A 1YU9A 3TQFA 4LUCA 4DLSA 1BYUA 1U0LA 3W90A 4UNRA 1GP2A 3GMTA 5KPJA 1TQ2A 1D5CA 1KOFA 1Z83A 1GNQA 1IN6A 4BFUA 4M22A 2QGNA 3K53A 5JFGA 4EDHA 4RKFA 4F7WA 3IQXA 4XSHA 1MRNA 5KYKA 2BBWA 2ZRFA 2WICA 2KJQA 4AI6A 2EU8A 1FUKA 2JLVA 4P32A 2WWWA 3SZRA 3DZ8A 5BYKA 5LBIA 1WRBA 3WP1B 1XP8A 3SBEA 4TTPA 2ZJAA 4KO8A 2N1BA 5FBRB 1R5BA 4XWAA 2IF0A 1G64A 4PPQA 4DLXA 3REFA 3BK7A 2VTKA 2H7VA 2OBNA 1IM2A 2ZI6A 2FSFA 4Q4JA 4TL6A 5F9FA 4KBFA 4OQNA 3A1UA 1II9A 3CRVA 1A2BA 1VG0B 3WY9A 4A2QA 2QM8A 3OEEA 1D6JA 5CJPA 1XEXA 3I72A 2O8EB 2RKOA 1ELOA 3NC1C 2PX3A 1KI4A 2ZI5A 2DWOA 3K09C 2CLDX 1IBRA 1QHHA 4B76A 2KBFA 1ZYUA 2CCKA 5DN6D 2OT3B 1XZQA 2ZUBA 1MOZA 1RIFA 4I81A 4IOKA 3DMDA 3TUZC 4PC7A 5JI2E 3QUSA 4Q66C 3A37A 2BJWA 4P4SA 2QAJA 1L4YA 2FEOA 2VP9A 3MG9A 5G3ZA 1KO4A 2KE5A 1N6PA 1QG2A 1G4UR 4OQFA 4DDWA 2NOAA 5KUTA 4PZZA 5KPDA 1N5KA 5AJZA 1BH2A 2BCGY 3KJGA 5DYGA 4QHSA 3FMPB 2VA8A 2V8OA 1I4DD 4F92B 1D2MA 2ZRKA 2RH5A 1Z6XA 1KY2A 1DADA 3FDIA 3B82A 2CL7X 4NCIA 4I1OA 5JEEA 4JZKA 2VP4A 3K0AB 4B43A 2A7QA 2R6GA 4HB0A 4Q48A 4EKDA 5BW8A 1CRQA 1KK0A 4IKEA 3GLFA 2RGDA 3KDSE 1PUIA 1QRAA 2ODWA 1Q0UA 3JZMA 4O2LA 4Q4JB 2P6NA 2R6CA 3H84A 4Q4AA 1W0KD 5DNYB 1OH8A 3AVTA 1OYYA 3ICEA 4P31A 4FD2A 4B74A 2PMDA 4KFRA 5HCNA 5AR1A 1ZNZA 3MJHA 2OZEA 2YV5A 4O0MA 2ZSFA 3BXZA 1N6IA 2WAYA 1GL9B 3B9QA 2R65A 3KZ1E 1KJYA 1G41A 2B7CA 3H86A 2ZU6A 4PHTA 4TL9A 3GLIA 2QP3A 2QM7A 2FX3A 5FBLB 1OHHA 4PAMA 4PO1A 4CF7A 2PBRA 4B2PA 4MKFA 1E9CA 3VU9B 1ZVQA 2A5FA 5FUWA 2R8RA 1ONBA 1E2QA 1AM4D 1JAIA 1F3OA 1T5LA 2QT0A 3TW4A 5FL7A 5BXQC 3PEWA 2OAP1 3NXSA 4UQOA 1NLFA 2C2HA 5TDHA 2Q3HA 1H8EA 1S8FA 4R2HA 1VG1A 2W6JD 4QNRA 1COWA 2O8FB 5H70A 2Z0MA 1HE1C 4DT1B 3QJYA 1NJFA 1RRFA 1XMIA 1G4AE 1BYIA 4TN1A 2GXAA 2EVWX 2H92A 2VSFA 4Q7JB 1P2TA 2CXXA 3U6BA 2ZRMA 5CLLA 2WWFA 3NBZC 4OK3A 5EP2A 5K8IA 2FNAA 5KNDA 4QXAA 2W2XA 4PZYA 1JECA 4JVLA 4L5BA 4DIEA 1UBCA 2OXCA 4G1UC 1OKKA 5JS7A 4XOIA 3K0AA 1IOZA 3OFND 4NPHA 2YOFA 3H4MA 4AKHA 2AKAB 5EJEA 2V4ZA 1NMXA 3OE7A 3W3ZB 1UBEA 4LV8B 4GL2A 3GCGA 4TQAA 3FTQA 4C0SA 1F2UA 4KI0A 4LCBA 2GJSA 4MGIR 4EQ6B 1X8KA 1NRJB 1ZIOA 1WDTA 2R6DA 5EP4A 5IK2D 4URVR 4EJSA 2KWIA 4PC6A 1G3IA 2XJ9A 2NPFA 2O8DA 3MWLA 4Q1AA 2ZJOA 1P2SA 1LVGA 2G1JA 3W5IA 4AY2A 2FPKA 3E1SA 3K8YA 3AF2A 4JLJA 4L4UA 1HQCA 2GZAA 1CR0A 2PMKA 4WW0A 3QKSA 4G5GA 2BM1A 3SQWA 3VHXA 5L3QA 4BPBA 2ZRBA 3WHKA 3PUWA 3BC1A 3VR1A 1WA5A 3NHBA 2VHQA 4L8GA 4MQBA 2KSQA 1Q1BA 5L3SA 2QBYA 4DIDA 4U00A 2AK2A 2JATA 2B8WA 3MSXA 2DHRA 3C5CA 4QGHA 4TLAA 4TSFD 3WP0A 4ZI2A 1JR6A 2QAGA 2WJYA 4MYTA 2ZM5A 4BEBA 1P72A 3WRXC 2W0SA 5C1BA 3CH5A 1XMSA 2QEQA 3DZDA 3GP8A 2I3BA 3BORA 3U3MA 1EFCA 1M7BA 5DH9A 2CK3D 3B1ZA 4Q9HA 4HZUA 3A58B 5K8UA 3AF3A 5JRZA 5FI0B 3Q8XB 3M4YA 1KIMA 4IVRA 1N0UA 5FTLA 5CK5A 3HDTA 2A2ZA 3WNDA 5L3QB 1NJGA 1Q3TA 2TMKA 3AVOA 2D2EA 3N2EA 2OCYC 5TB5A 3M6AA 2VP5A 2VIIA 5TXGA 1CJVC 2XSZD 4C2TA 4LWZA 1MKYA 1E4VA 1CP2A 2J46A 2LWIA 2UVQA 3SHFA 4GP6A 1AN0A 1UKEA 2AKYA 2IYQA 4US2R 2IS4A 1QHSA 3FFBA 4GMDA 4CGZA 3U7HB 1FP7A 2DBYA 2OCBA 2W58A 2QSZA 1XTKA 2F43B 1NP6A 4LV6A 4MUBA 1GITA 2RCNA 2PZGA 3FHTA 4BFSA 4HLUC 2VLIA 5IT5A 3MLEA 2R2AA 4A15A 4JT2A 3B1YA 4LHXA 4KCGA 4WBSA 2GXUA 4Q1CA 4FWIB 1GUAA 3KFXA 5FPKA 4N3NA 4C0KA 3UIEA 2QN6A 2GJKA 2OV2A 1UKZA 1HTWA 3IHLA 4TYQA 3IBGA 5CDFA 2AD5A 5EE1A 3KUCA 1G17A 3Q85A 4IDOA 3HPRA 3L0OA 2H17A 4QOSA 2J0UB 3ZQ6A 5LPNA 1W1WA 4NZYA 2E87A 3I73A 3K09A 3GJ5A 3NDPA 3NHAA 4EJSB 5CK4A 1XPOA 2PJZA 4A82A 1N6HA 1ESNA 3SEAA 3PCRB 4TLEA 1ZCBA 3K70B 2QENA 4PC3A 1ZUHA 3FKSD 3QVUA 4XSGA 2PL3A 5JMTA 1BMFD 3HP1A 3N2IA 1Y3AA 2WJIA 2JLSA 4BZPA 2C04A 2QE7A 3BWDD 1CIPA 4V0NA 1RKBA 1KO7A 1LFDB 4IVPA 3QF7A 2CNWD 2AWNA 3ZVRA 4A8JB 2Q3FA 4QHYA 4UNSA 4M21A 2ORWA 2VBCA 1ZM4A 1GL7A 2JJ2D 2P0EA 2Z4SA 4PZLA 1VIAA 3THWA 2MSEB 3ZJYA 3C16C 1KI3A 4IJMA 3TW8B 3NG1A 4DBLC 4B3BA 2BC9A 3ZVLA 4DSTA 3NWJA 3JVUA 2VQSA 1NN0A 1NSFA 3FE2A 5FOWA 4S35A 4GSYA 2ZAOA 1UBGA 5JECA 3KXIA 3A8TA 5HCIA 1ZM2A 3CRW1 4URWR 5C4MA 3B2EA 1E94E 3ASZA 4Q5IA 5A4JA 3KKPA 3J81k 1KMQA 4Q1BA 4TMZA 1MO6A 3QKSB 1E2LA 4XVUA 4TYPA 4TQUS 4IRUB 4B34A 2NO1A 3M1IA 1F6BA 2IYRA 1E98A 5DI9A 3U3KA 3UMFA 1U9IC 3VX3A 4Q01A 1W49A 2O8DB 3DM9B 4FINA 2IYTA 2ZU0C 1W2HA 4KLZA 3FB4A 5CM9C 3KX2A 4OHVA 2WKRA 3LQQA 1QZXA 2JLQA 3KUDA 1EX7A 3TRFA 2QTVB 2C98A 3CF0A 3IO5A 1DG1G 1W4BA 4BQSA 1EESA 4FIDA 4Q00A 4RD6A 2VSXA 1S3SA 4M1MA 3A1WA 4QGFA 2C9OA 1MO5A 1E79A 1K5DA 1KI2A 2B6HA 1U9IA 5EUMA 4EFMA 2CVFA 2X77A 4M9SA 1CR4A 1NVWQ 1R5NA 3PJRA 4OHYA 1ZIPA 3V4FA 521PA 2GAOA 4K8OA 3OIWA 3LXXA 2ZAMA 4JMPA 4QRHA 5FOSA 4M1KA 1R4AA 4LJ8A 1YRAA 4ARZB 2HCBA 2ZR0A 3LVQE 1ZNYA 4Q21A 2W2TA 4BFWA 1Q1EA 3TJZA 4BEJA 3DKPA 4KITB 2HT1A 2QI9C 2XXAA 1EFTA 2AR7A 1SHZA 1ETUA 4TL8A 4D0NA 4M9ZA 4PR0A 1QF9A 3G0HA 1ZAKA 3LX5A 3R20A 2ZE5A 1JXOA 4LYFA 4DCSA 5HZHA 1KSGA 2HYIC 2WPDD 3KFVA 1NMYA 1XX6A 2EYQA 2XTZA 4ZDIA 1W48A 4ZI3A 3RANA 1VCIA 3A1SA 5J5CA 4J0QA 1IXSB 1XTJA 2IHBA 3GJ3A 3GLHA 2UZ3A 4MITA 2ANBA 1JPJA 4S2EA 2J0UA 2F1RA 3R9XA 4OQXA 4OI1A 2JCSA 2QU8A 4N0DA 2QP9X 2ZEJA 1R0ZA 5KOYA 2B21A 4IHQA 1NLYA 1E2EA 1UKVY 3EPJA 5B64A 1T4GA 3CPHA 2ZI3A 2JDID 4QM6A 1MABA 5SZHB 4DC9A 4DRZA 2W00A 3GFPA 2FJUA 2SHKA 1VHTA 2HYDA 3B1WA 3WNBA 1U8AA 1XU4A 3MWYW 1N0VC 1RVDA 1KNQA 1XDBA 3U2QA 2RGNA 1E2KA 4C9BA 3P26A 4EUNA 3SYNA 3IPYA 1DARA 2YJTD 3TK1A 1L4UA 1U99A 4AURA 2VO1A 3SU8A 3ZLJA 1RYFA 1F2UB 5GADl 4HZIA 4I99A 4TMTA 3P27A 4HLCA 4P4SB 2ZVQX 4MGZR 1JPNA 2F7SA 1XXHA 2BDTA 1HYQA 4G5QA 4LYAA 3TLXA 2OE2A 5DO9A 2ZYVX 3I1FA 5JZVA 5LD2B 5EXTA 2IXGA 2VYFA 3PITA 4NCJA 3ZZUA 3O8BA 1S1CA 2FFQA 2H18A 2DWPA 4MUAA 1WP9A 1L8QA 1CU1A 1NLZA 3HJNA 3SJAA 3SYLA 1TQ4A 5BYJA 4BLQA 4M9QA 1U90A 3QEJA 2IWHA 3HPQA 1ZM9A 1GILA 1IY2A 2AFIE 3LLMA 3RRYA 5KDDA 2CE7A 4B3FX 4GOJA 5JWRA 1QG4A 5F9HA 4ZKEA 1E2DA 721PA 2XTNA 4RCZA 3RWOA 3AP3A 2IW3A 5CB6A 2F43A 1JALA 1NBME 2KB0A 2ZRLA 1NKTA 3W3AA 4RFSA 4RZUA 2C5LA 1LS6A 2A5JA 5LD2C 3QQ5A 3EWAA 1CLUA 1X8JA 1FPMA 4DEYA 3LBHA 3UWOA 1IN8A 2ANCA 5GJBA 4X8LA 4KVGA 3CRMA 5C4GB 3FOZA 3LVRE 4D25A 5GJCA 4E07A 4CYMA 3B5JA 1DAFA 1S0UA 1XTQA 5FOTA 5KSYA 2ZJBA 4D4MA 1SVOA 1R7RA 4UNNA 4RD2A 1D2EA 2ODBA 1Z06A 1KZ7B 4A0RA 2GVZC 5CJ2A 5J4HA 4CIDA 1E9EA 1K5GA 4JS0A 4LYHA 4XTCS 2NO0A 3VAAA 1E3MA 1UEIA 4GI7A 1EFRA 3SQXA 4A0GA 4JL6A 3OF5A 1GL6A 3BH6A 2PLRA 3FPAA 3CNNA 3SOPA 1FMLA 3ADCA 3ADDA 4NBSA 3IEUA 4EJSC 3GFOA 1SQ5A 3LWNA 2J45A 3QSYA 1P62B 2AK3A 4DLWA 3LD9A 1Q57A 2IYZA 1KDPA 3RS0A 1E1QD 3FHCB 1N5IA 2J5XA 1R10A 3LRPA 1H8HA 3QXHA 3T61A 1S96A 4G5OA 3C8UA 4D4LA 4FMCF 1FQJA 4GT1A 2D7DA 2O8BB 3GLHE 2YKGA 1CEEA 1YR8A 2FFAA 1W44A 4JYCA 3SJBA 1VDZA 2OLKA 3VNUA 4GOXA 3W6OA 4WXRA 3AVQA 1QHGA 4OI2A 4TWZA 4LBVA 1OXUA 4JYBA 1AGRA 3CX8A 2AD1A 5CYOA 5FI1B 2HF8A 5JBQA 3I5XA 2QP4A 2QA5A 3QOFA 3KQUA 4YMTA 3W34A 1OJLA 1IQPA 1ZC4A 2CJWA 3MFYA 1XEXB 1SKQA 1KK1A 1KI1A 2QG6A 2YVUA 4IDQA 2P5SA 4UXIA 2LCFA 2LKDA 3RABA 4DLRA 4Q9IA 5JRJA 3KQKA 1I4TD 2RHDA 1B0UA 5GJVC 4PX9A 2IS2A 1JBKA 2UZIR 5TY0A 2QRNA 2K5UA 3ZD6A 2WJVA 1YHNA 3QXSA 5AK0A 1F5NA 5EE5B 1EK0A 5AJXA 3C14C 2B92A 2Z4RA 4BFXA 2XB2A 2GEUA 3AF0A 3THWB 4HATA 4IXNA 4KODA 2LKCA 4B2LA 3SS8A 1P3JA 1S9DA 1KO1A 1KSJA 2PEYA 3AUXA 2IWRA 1W46A 2V7QD 1KYIA 1FW6A 5LB4A 1VMAA 1ZRHA 2GCOA 4F91B 5HE8A 3VU9A 2VL7A 4Y0VA 3L0PA 4JBYA 3AVXA 2J41A 2RGXA 3PENA 4NP6A 1XZPA 1KDRA 2ONKA 2DB3A 1GSIA 3LY5A 3ONWA 4MGKR 1I2MA 3U3RA 1WBBA 2WVJA 4NU0A 3ZVNA 2ZS7A 4GZMA 4KSCA 2OSBA 4B6EA 2H57A 3BBPA 4PXAA 4XH9B 1XEFA 2WWXA 2FFBA 3C41J 1M8PA 1G3MA 4Q1EA 2ZSDA 3BH7A 4PPGA 1T6NA 2V9PA 3K9LA 5B2ZA 1RRPA 1G8PA 2JIZA 1E69A 4BRWA 3UANA 1T5IA 1KNXA 1XD9A 2A5YB 4C0AC 2GA8A 4MKGA 5JS8A 1LF5A 1VTKA 4HLDA 4PSVA 1D9ZA 3K0SA 2FH5B 1KDOA 1ZNWA 2O52A 1DAGA 1KAGA 5EZ6B 4HAZA 3EC2A 3IO3A 1P60A 1YJ5A 2BCJQ 5IDVA 4OBEA 2XAUA 3KTAA 2Y8EA 1W0JD 2A3RA 3EPLA 5JJLA 1OT3A 4OKSA 1SXJC 3K9GA 1KI9A 2BEJA 2WKQA 3VKWA 4ACAA 2Q21A 1JXMA 2GZDA 4WOPA 4NL4H 4GNKA 3UATA 4XJXA 2CHGA 3OAAD 4MDFA 1TU4A 2FWRA 4MDEA 1Z3IX 2QTFA 5EXXA 1W4CA 3DM5A 3I61A 2P6UA 2BEKA 1FX0A 3TSOA 4QG7A 2XNSA 2YINC 3KKQA 2RHMA 5DISB 1W5TA 5GJWC 1WBDA 2IEZA 2MMGA 1AQYA 1H65A 1Z6YA 2WSSD 1ZM7A 2O0KA 1TMKA 5H68A 3X1XA 5DSZA 3QXCA 4UNPA 4TLBA 3WYGA 4BLPA 4ZO4A 5EUQB 2JJ1A 4IOMA 3H1TA 1OB5A 1UM8A 1A2KC 4DUGA 5AJYA 1SKYB 2MSCB 2CNWA 2I1VB 1X86B 4D2IA 1CKEA 3NIBA 3PEVA 4HLUA 2WTUA 4QNMA 2QE7D 2OHFA 2G88A 5D3MA 2G6BA 2GJAA 2EYUA 2YOHA 3EZ7A 3QEOA 4TMXA 3LW8A 2BBTA 5E7JA 3FKSA 3G5UA 1U0HC 2VHCA 5L3SB 1XPUA 4Y0AA 2ZSBA 2JIZD 2NZ8A 1F48A 1TPZA 4ZDJA 3B9PA 1F2TA 4P0TA 5ANRB 1S2MA 4FMBB 3RNLA 4DDVA 5LDDC 1N5JA 1U98A 3VMFA 3N70A 3UMRA 2QPTA 4YXWA 4JVSB 4D82A 1G5TA 2RMKA 3B85A 2AXPA 1OFIA 1GNRA 2G77B 1VCNA 2QPOA 3E5HA 4IDHA 5EP3A 5J4YA 4KFTA 3GLGE 3WMEA 1I2DA 3MAAC 1VPLA 2GESA 1GKUB 1CJKC 1JJ7A 2J0VA 4OYHA 1LNZA 1W0KA 1ANKA 1PLKA 4L9WA 4WZ6A 3CLVA 4EQ6A 5FFMA 4ZDWA 5B58C 2JDIA 1E79D 2H1LA 2F3RA 1Q1QA 2O0HA 4A1FA 1EXMA 3GQBA 2G0NA 5FUXA 3LO5A 4ZCMA 4HLQB 2NMVA 2O8CA 5FTJA 3TE6A 3DPUA 2OCAA 4UXJA 1GWNA 3ADKA 4LJ5A 3ZS9A 2ZE6A 4U7DA 3ZQJA 3I8XA 3JVVA 3BD9A 1P4SA 1P9WA 2H5EA 3C15C 3OIVA 1UEJA 4JKYA 1ZD8A 4TMVA 1FMJA 4V0OA 5D3MB 1RJ9B 4KHZA 2FG5A 5TMPA 3GLGB 1DVRA 3ZH9B 1Q20A 1GAJA 4HB4A 5J47A 3BIFA 3EC1A 3TNFA 4ZCIA 3CKLA 3PEUA 1D2NA 1JR3A 4IEIA 4IVQA 3R7WB 4HDCA 1NY6A 4NCNA 4E03A 1G7TA 3ND8A 2HUPA 1Z29A 4K46A 4DSOA 2V1XA 1UF9A 2Q9AA 4A4DA 2FZ4A 2WV9A 4HUTA 3OEED 2BHRA 4JLKA 3TSZA 1QVAA 5TVKA 1J7KA 2QQEA 3ND9A 2F1IA 4MKHA 2REOA 2WMNB 4XTRA 4ABYA 4URXR 4GOKA 4R9UC 1P2UA 2H8KA 4IDPA 3GD7A 4TLCA 1YVDA 4OHZA 2ZJ8A 3BGWA 2V3CC 1U0JA 4QJ5A 4M1TA 3EAQA 3AEZA 3BJIC 1X1SA 3GJXC 2WIAA 4MKIA 3MCAA 4TQ9A 1XCGB 2VHTA 1AZSC 4Z54A 1ZD9A 5H8WA 1W36C 5EE9A 1FP6A 2IYWA 4PPFA 2OBLA 1HY3A 1P2VA 3I32A 2GF9A 2QSYA 3GJ7A 1KTVA 4HAYA 4Q4LA 2BWJA 1NVVR 1OF1A 4DHEA 4X8HA 2QAGB 2ECKA 5E4FA 3K0CC 3A1VA 1E2MA 5J4VA 1KI8A 3KXLA 3RAPR 3LBNA 4RD3A 2PCLA 4Q02A 4PQFA 2ATXA 2QMUA 1VYVA 1G8HA 4WZBE 2FOLA 1UJ2A 1WF3A 3CM0A 3RDPA 3B1XA 3BE4A 2GXSA 5FOXA 4BZQA 1Z22A 4NYJQ 3AQ4A 1HQYE 3VFDA 3NKVA 3EZ9A 5BWMA 1IY0A 1ZMXA 3DOEA 2J0QA 2ORVA 2G0TA 4A2PA 2OFOA 3THXA 2JJ1D 4W5HA 1HT2E 4RFVA 4AYWA 2GK7A 1NSTA 2QAGC 3RVBA 3BB1A 2WZQA 3W6PA 5CYPA 2CLCX 2BKUA 1BKDR 1Z0FA 1LS1A 3AF1A 3QENA 5E7IA 5KNBA 4QBFA 1AQUA 5FPHA 2C8VA 2C95A 3D31A 2QZ4A 3D7MA 2BIFA 2VF7A 4KSBA 1E2HA 4P3YA 4URUR 2X2FA 2ZUCA 4B6FA 4QJ4A 3O8CA 2GF0A 2FE4A 3PFIA 3AV0B 3CF2A 3EWSA 3EARA 4DLTA 1L7VC 4LJAA 3F8TA 3CX6A 3TUIC 2MSDB 3SNHA 3U7EB 4AG5A 5FPTA 2O8EA 2VP0A 4M4SA 4CVNA 1CF4A 1QVRA 3MUFA 5FH9A 4NMMA 1FZQA 3TMKA 1JR3D 4LZZA 4EPRA 1KSFX 2ZVPX 4JLBA 2ZRNA 1NY5A 4M9XA 1OLOA 3MGCA 3T12A 4EPTA 2P2LA 1JNYA 1GVNB 3U5ZB 1R0WA 1P7CA 4LBZA 4TLDA 2FFHA 4NDZA 3ZGXA 4H9GA 2NG1A 2NTYC 3TVDA 1RPZA 3L0IB 1XWIA 2I1QA 1SGWA 3EX7C 2CHQA 1K8RA 1VG8A 3X1WA 2V6IA 2W6IA 2VP6A 4JVMA 4Q1FA 3ECCA 5CIWA 2QPAA 2QTHA 3AP1A 2JLXA 1G16A 3Q9LA 2D4HA 3FMFA 3OESA 3DMNA 2ZSEA 4BLOA 2FEMA 4EAQA 1DAIA 3EIHA 3HYTA 1G6OA 1XD2B 3IBYA 4OHXA 2NQ2C 4YXWD 3VNVA 2GRJA 4DXAA 1JEEA 4LJ7A 4NTZA 4V0MA 2HXSA 3M0EA 3BERA 1TEXA 3U7FB 4C7OA 1SKYE 2CLSA 4PPNA 1TUEA 4RD0A 1A5TA 1P9RA 5HE9A 1R0XA 2IXEA 1A4RA 2OAQ1 2ZJ5A 3RHFA 3X1DA 4ACBA 3F5FA 4ZV4A 2J7KA 4TZ6A 2Z83A 2ERYA 2REBA 1G20E 2KBEA 2W6ID 1AS0A 5D3QA 1EFHA 1G7CA 1Z6GA 2ZQ5A 3GLFB 3E70C 3SN6A 4DB2A 4DJTA 5SZKB 2CJWB 2PT7A 2R62A 3A4MA 3IIKA 2WPDA 1OXTA 2WOJA 1GOTA 1CXZA 2GEDA 3K0FA 1E4YA 1AS3A 221PA 3GEEA 4BFTA 3U44A 1XJ0A 4JSTA 4A8JC 2IYYA 4OL0A 3KQNA 5H1YA 1RC8A 4BFYA 4B3GA 2DWQA 4DLVA 4JSYA 4IOLA 4DCVA 5AJWA 2WWHA 5J4KA 1XF9A 4RZXA 4B3XA 2AHOA 3HR8A 3Q5DA 4M2LA 2OILA 4JLOA 2IUTA 2DFLA 2GJ8A 3QXJA 4MRPA 3BOSA 3P4XA 4LJ9A 5E95A 3TAUA 3THXB 1DBSA 3LAWA 421PA 2IT1A 2ZYWX 1OFUX 4B73A 3VR3A 4DDUA 2Q0HA 2BMFA 1GRQA 3CBQA 5DLQC 1Z0JA 3A36A 3I4LA 4FMDF 3K70D 4LPSA 1T3HA 1IXRC 5KO2A 4GMXA 4P4UA 2CCJA 4QHTA 4LC1A 5F2EA 2NO6A 2F3TA 3RS7A 1J8YF 3NBFA 4QFMA 4RD4A 3NDBB 3HR7A 3ZZ0A 2V6JA 3IGFA 1KK2A 3IQWA 1YZNA 4PC1A 1N6NA 4D81A 4C2UA 3NTUA 2QUZA 2ASEA 4DSNA 3AF4A 2WWYA 4YDSA 2C99A 2WSMA 1YZQA 3BS4A 3GJ6A 4W9MC 4A8JA 3B6EA 3PUZA 5JSZA 3FHOA 1NI3A 2A78A 3T15A 1KZGB 4NH0A 3UG6A 1Z47A 3U4QB 3QPVA 5JCZA 2AL7A 2GZHA 3NBYC 4Z1MD 4AD8A 3I92A 5FOVA 1OH6A 1BS1A 3ETLA 4GPTA 4TMWA 2F6RA 1M74A 2WSSA 3CNOA 4AKEA 121PA 5C18A 1NN1A 2YC4C 1HT1E 2D2FA 4HEJA 2IYSA 3UWKA 5JCPA 1RYHA 2V7QA 3PXGA 5L3VA 1GM5A 2GBLC 3B8HA 1Z2CA 2IYXA 1CRPA 4W5WA 1AKYA 5KU1A 2A5GA 5FR1A 1E96A 3LV8A 4A2WA 2B7BA 3B60A 2A30A 2AWOA 3NBXX 3TBKA 4B33A 4B71A 1M1YE 3ASYA 2BMEA 1FTSA 1E9DA 1Z6TA 4A6XA 4LYJA 4LV5B 3E2IA 3D6TB 3DKVA 4L16A 1JJVA 3QPUA 1XBTA 3Q72A 1IJFA 2VF8A 4PQYA 4UKDA 4IEEA 4MYCA 4TMKA 4XVRA 4O2RA 4BASA 1G1MA 3FMOB 3CWZA 3NC0C 4QL3A 4WXPA 4OJQA 1WMSA 4CEIA 4GZLA 4N0EA 4TT3D 5G41A 1G3RA 4YMUA 3AVYA 1NMZA 2XSZA 3GLHB 3MJRA 5FTNA 1G5RA 2XOKA 3CW2A 4CT4B 1J2JA 4Q19A 4IW3B 1J70A 3QPWA 1OH5A 2BMJA 3QKRA 1IXZA 2JGNA 4MA4A 1CR1A 4JLMA 5KSOA 2ZRPA 1PUJA 3FKQA 2O5VA 4HUQB 3QG5A 1YZTA 5EXPA 1AGPA 4E22A 1V5WA 2WBLC 2J7PD 4BZXA 1PZNA 1T3LA 4EFLA 3TKLA 4TTRA 2RGBA 4P33A 4MRSA 1OIXA 4C30A 2FDCA 2N46A 1G7RA 4HYYA 2F1JA 3QNUA 4R2IA 2BKEA 3VR4A 1DO0A 1W47A 1XTIA 1LV7A 2VRWA 2YWGA 4L9SA 1VIYA 3DOFA 4YDHB 3I5YA 1T9HA 4I1UA 4E5UA 1YE8A 2IUUA 2ZJYA 2W0MA 1GTVA 4V0LA 1KI7A 4NE2A 4QBIA 4O25A 1H8HD 5AJVB 5EE0A 4B3DA 1O3YA 2ZR7A 2XITA 5FBVB 5FUVA 2X19A 4NYIR 821PA 1RFLA 3PUXA 1UPTA 4Q4AB 4DEXA 4XIGS 1TF5A 2JLZA 2P67A 3LH5A 2DFTA 2DFNA 3MD0A 2XOKD 3QG1A 4JLVA 1E0KA 1ZW6A 3WMFA 1GKYA 4M1YA 1ODFA 3MWKA 4BGDA 3WMGA 3PQCA 3RYTC 1FX0B 2H16A 3CR7A 3B7GA 3NEJA 1VECA 4RD1A 1PJRA 2E9SA 1OH7A 2V1UA 3EZFA 2XX3A 1N6RA 1WE2A 1DPFA 3TAHA 1U2RA 2NGRA 1P9NA 3O47A 2BJVA 3OFNA 2FPLA 3TQCA 4WIAA 1ZP6A 1M7GA 4D4JA 1D8TA 3BH0A 1SZPA 2NIPA 5M04A 1W36B 1VCOA 4IXMA 621PA 1LB1B 3KB1A 3U44B 4OI0A 4KU4A 3CO5A 4TZ0A 2CHVA 1MO4A 1KO8A 2YYZA 4JIMA 4BFVA 4BWYA 1G6HA 1P61B 1X6VA 5A0FA 1MR3F 1NF3A 1VG9B 2GCPA 4H1UA 1E9SA 5BN5A 1WQ1R 2P65A 3L43A 2ZRHA 2CCGA 5ELXA 1DAHA 4JL8A 1KAOA 4US0R 2BV3A 1TX4B 5DI3A 1T0JB 2GHIA 3CB4A 2X8AA 1U94A 4AG6A 1TADA 1NG9A 1XXHE 1TEVA 2RB4A 3U61B 2B8TA 4MRNA 2ZS8A 4DT1A 2ZR9A 1YRBA 4M1OA 3A4LA 2PT5A 1A1VA 1SXJD 1ZD1A 3N5CA 2YNMA 3TR5A 5JLJA 4KAXA 4QGAA 4TYYA 2F55A 4Q03A 2XEXA 4B3CA 4QM7A 2D06A 3LW7A 5CM8B 4E09A 2D7CA 3AVUA 1N6KA 3DDCA 1TU3A 2CVHA 1IN5A 2G3YA 2YWEA 4KFSA 1Q44A 4D4KA 3DO6A 1MV5A 2RGGA 1YZKA 2A5DA 3IKJA 4PO9A 3LXRA 1GRRA 2IXFA 2JLWA 4BE7B 1UADA 3I8SA 2P5TB 4FCWA 1RW4A 1EGAA 1N6OA 1G8GA 4A6PA 2WWIA 2WM9B 2HEIA 3RRMA 3K9HA 5B30A 2IYVA 3GJ8A 3WBJA 4Z51A 1D9XA 5CIQA 3W8RA 3L8YA 4V0ME 4WVFA 3ZDQA 3U60B 4US1R 2GAAA 2E1RA 3SFZA 2HJGA 3HU3A 2YWHA 2IBMA 4CEHB 1H8ED 3O8DA 1RRCA 4OK6A 4IDNA 3SJZA 1E2JA 2N42A 4HDOB 1WCV1 4LHWA 5J40A 2R44A 5FL7D 3GLIE 1CR2A 3RS3A 3PUVA 2W83A 2FZLA 1LW7A 4ON9A 4HAXA 1DAKA 5G40A 4DB4A 4AYTA 1IN7A 2DCUA 5CITA 3RSOA 2ZYTX 2WOOA 4UNQA 1W4AA 3OZXA 1FQKA 1RZ3A 3IHWA 2O8BA 1Z08A 4LPKA 4DLYA 6Q21A 4Q7LA 4KBGA 1SVSA 1U8ZA 2RGEA 4YMWA 2PH1A 4CEIB 1N2CE 4B75A 1MT0A 2XTMA 3MMPA 4W7SA 4RZ3A 1KI6A 1ZU4A 1XJQA 1YZUA 1ZCAA 3IILA 4M8NE 2OBMA 5JWOA 4RCYA 4V03A 4F38A 4URZR 1U8YA 2XJ4A 1N5LA 3HYRA 1IJEA 3TGPA 1VHLA 1S4QA 1VCMA 1OPXA 3R9IA 4II7A 1XFAA 3UKDA 2XZPA 1PVOA 1QHNA 3IIJA 4PO8A 1E99A 1Q22A 3CNLA 3LA6A 4DSUA 4V02A 1O87A 4F4IA 2J3EA 2Z6VA 1KJZA 2V55B 3T35A 3THYB 2ERXA 3K0CA 2VHJA 2G1KA 5EQTA 5IRCD 5KDLA 2IC5A 4NYMR 4ERNA 1KDTA 1JQLB 2V54A 2ODNA 5JJIA 4CEJA 1C4OA 2BBOA 4A9AA 2JLYA 1II0A 3F0TA 1HH4A 2RAPA 2XZLA 4XWKA 4C0JA 5JSZB 4PC2A 4AWXA 5JJKA 4FN5A 3THYA 3H0KA 4WZAE 3H2YA 1KSHA 1N3BA 1OKKD 1N25A 4YLGA 1AZTA 3EW9A 1XMJA 2CL0X 5G53C 4C3ZA 5K8LA 2WAXA 3AVPA 3UG7A 2QGZA 3UK6A 2C77A 3C5HA 3CONA 1EG7A 2PCJA 2KI5A 4B44A 3NVAA 2ZRJA 3OAAA 3LDAA 4RY2A 2GWHA 2J9RA 1P73A 3L82B 4GBMA 4XD7D 1PLLA 1AK2A 5AUQA 4YONB 5DI3B 1COWD 1Z8FA 5TARA 4B32A 3RRZA 1MO3A 2JJ2A 5AWFC 4TYWA 4C0BA 3AUYA 2AX4A 3FGNA 4RZ2A 1HV8A 5FTMA 3SYKA 2ZITA 1KI6B 1XEWX 3AKDA 4D6PA 4JL5A 4JJZA 4MRVA 4DLUA 4X8MA 1HURA 3KKOA 3LNCA 4UJ5A 4TTQA 2EFEB 3G82C 3MRSA 5HTKA 4MH0R 1OHHD 3VHLB 2Z43A 1SVKA 1AA9A 2CBZA 2QMHA 3TR0A 3B13B 2EWVA 4G5SA 4PTLA 1XD2A 1HA3A 4BLTA 3IDQA 3K0FB 4C0LA 4JKIA 1ZC3A 4LRWA 2G83A 2HCJB 5FBWB 2DY1A 4IOJA 1ZBDA 2IEYA 1G8FA 2VH5R 3U6KA 1NG1A 1SXJB 4OI4A 5AUNB 4A0HA 2QNRA 2ZI4A 2GBLA 1GIAA 4CDGA 2MMCA 1FFHA 1WXQA 2ZTSA 2ZI9A 4UXHA 5SZJA 2OEPA 2R9VA 1KO5A 2OXRA 4RSGA 1LTQA 2NO9A 1UAAA 4AKGA 1T91A 1P5ZB 1YZLA 5KSZA 4PSAA 1K6MA 2GTPA 4PHHA 1KK3A 4PSKA 2C03A 3P4YA 1KMHB 4AIIA 4V0KA 1OW3B 3L8ZA 4ESHA 2ZSAA 2JLUA 2EFHB 3PUYA 3QE0A 4Q9LA 2QORA 2QQ0A 2YZ2A 1G19A 2EFGA 2ZRDA 2OCPA 3D8BA 4JBWA 3AGQA 1NIJA 5K8TA 3PG5A 3DEFA 5FPYA 3QXXA 4BLSA 2P6RA 2RGCA 3KQLA 2QMOA 3T1TA 5CDFE 1NIPA 3DHWC 3Q7PA 3VR2A 3BFXA 1C1YA 1J99A 1E9BA 5F98A 3K9NA 1EFUA 1OV4A 1DEKA 5FOUA 1UBFA 1B23P 1BOFA 1OXSC 2ZROA 3CUEF 3LFUA 4Z8YA 3AVWA 3IIMA 1Z0AA 1Z6AA 2JEOA 2W6JA 3X1ZA 3S1AA 3A6PC 3AKCA 3SDZA 2BM0A 2IYUA 2QROA 1XJCA 4HUQA 5TV2A 3SJCA 1DS6A 1IONA 4NONA 2EQBA 3V00A 5E3HA 4MYUA 4PQRA 2IL1A 2OG2A 4ZDKA 2FN4A 1E9RA 5IHPA 1YR9A 1C9KA 1HUQA 2FF7A 3PVSA 2FV8A 4PHFA 1JR3E 3EIEA 1DAEA 3I3SR 4BECA 4ASUA 1OXVA 1R0YA 4FXPA 3KTAB 3DVLA 1JQJC 4BFZA 2HLDD 4OQLA 1FOEB 2CK3A 3GEIA 4EIWA 1CJTC 2IS6A 4Q7KA 3THOA 4M0LA 2EFDB 4OHWA 1US8B 4LOAA 2WKPA 3BB4A 2Q9BA 1QHXA 1X1RA 1E9AA 3WYAA 2ZRIA 1GDDA 1E0SA 2XB4A 1VYTA 2D74A 3VR6A 1OIVA 4B47A 3EIQA 5EE3A 4FWTA 4C4PA 4A36A 2HJVA 5AUPB 3EPKA 1US8A 4WAUA 4LBYA 3L0SA 4JLDA 1E2GA 3GJ0A 1SHKA 4ZCLA 1XMVA 3RC8A 2EW1A 5CLQA 4NKRA 4PAQA 1SVMA 5KTYA 1F60A 1Z2AA 2ZPTX 3A4NA 2CDNA 3AGPA 1TF2A 1MH1A 4C7OB 3TSWA 2BOVA 3RSLA 2ZANA 4FMCB 4LJ6A 4XVQA 4JLPA 2OFXA 4HAVA 1YZGA 1SVLA 4BLRA 1ZNXA 4GRAA 5BQ5A 4I4LA 4LHYA 3KJEA 3FFAA 3FVQA 3S1AB 1S3GA 2YHSA 1Z28A 5EXSA 4DUGD 1EWQA 3NH9A 1OXXK 1M34E 1T3SA 2F9MA 3GJ4A 1XRJA 4KYUA 1XTSA 3SHWA 3BFKA 3VQTA 4FI3C 2ZIAA 2QY9A 3LLUA 4LHVA 1OFHA 5KHOC 4MRRA 4DKXA 3VKGA 1TAGA 1CJUC 1GNPA 1GG2A 1ZUIA 3OE7D 1TNDA 2NZJA 3EZ2A 2QL6A 3Q7QA 3R7WA 3W8NA 3T34A 4CRWB 4AK9A 1Z07A 2AFHE 2AN9A 1R5OA 3IPXA 3O8RA 4O3MA 3KJIA 3KQHA 4DWJA 1HE8B 1CULC 1Z63A 4AC9A 1G291 1U81A 4R71A 5B57C 4Q18A 4R7ZA 2DPXA 5JI3E 2WJHA 3P20A 3QKTA 1ZM3A 4Q1DA 2CL6X 1QHYA 1BO6A 4G5RA 4R98A 4JVNA 1ZJ6A 1W0JA 1X8LA 1NVXQ 2C9CA 1QHIA 2X2EA 2NO7A 2JLRA 3FWYA 2JAQA 3NH6A 2Q9CA 3IUYA 1DAMA 3WXMA 1GFIA 2GILA 2FSIA 3KXKA 2P3SA 3LX8A 4TYNA 4DZZA 1GRNA 1EWRA 3L2OB 4TSFA 2OESA 2ZE7A 5EZ5A 4AYXA 5FL3A 2WMOB 4N1AA 1W2GA 1JI0A 4QGGA 5FBQB 2PZFA 3AB3A 1E0AA 3KJHA 2IHYA 3AVVA 4LHZA 2IA5A 3OIUA 1CBUA
chains in the Genus database with same CATH superfamily
3QHAA 2Z8YM 1G21B 1VL0A 4TV9A 2WE8A 3UPUA 4LE0A 4OQMA 1SC9A 3AP2A 4KREA 4JX9A 4DJ5X 3V6LA 1G9XA 1TLTA 4FMDB 3ANNA 2GRUA 3CEPB 3WL4A 1C0KA 3MELA 2VTVA 2WWGA 4C6RA 4ROSA 2G04A 1M2FA 2X8JB 5KHAA 3SF0A 3WNZA 3LBAA 3ZHSA 2IX3A 2NLOA 4KPUA 1FU4A 1DJQA 1MW8X 4RPHA 4IKOA 4O4JF 4HXYA 3TF5A 1MABB 1ESMA 2GPYA 2PEZA 2X0IA 3E18A 3TH5A 3OTHA 3SY8A 3ZBTA 5IAOA 3PEYA 1R8SA 1D4OA 5LJLA 3CWQA 1KJQA 3AKEA 5E7MA 1N2XA 1SOMA 3DB1A 3CZRA 2V9ZA 1LPMA 4ZN6A 2WFLA 4HNAB 4HG2A 3OO0A 3AEQB 2FSGA 2J85A 3T1VA 4D26A 2AZMA 3ZWMA 3P32A 1G21E 3FF4A 5FWXB 1EGQA 1DCKA 4V3CA 1SUAA 2EERA 3B78A 1E6EA 2XYVA 5C46F 4L07A 2FPSA 4P5PA 1WQ4A 4Z3KA 2ATEA 2DLDA 1GG8A 3JZAA 1E4EB 3JSXA 1YAJA 3P2IA 1ISMA 1H6DA 1RXEA 1Y1QA 3GMDA 4BTLA 2EKLA 4TUYB 1SZDA 1MBZA 3T3IA 1DHRA 1RQ7A 1VMIA 1NR7A 2JA1A 3PNPA 1E9FA 3OEHD 1U3GA 3Q9UA 2VH1A 4CEJB 1OTXA 3H1PA 3LUGA 2J9GA 2OLJA 3NJ4A 4YMVA 1RRMA 4ZU1X 2N0SA 1JDTA 1Z5ZA 4ZANA 3E2MA 2AXNA 4HMQA 2C4WA 4IGKA 4MIYA 4RZQA 1OI7A 4ZAYA 4ILEA 4M6WA 4XRRA 2HMVA 1T36A 2CMKA 1U5BB 3JATA 4LIPD 2PUJA 4L72A 4HGRA 3I62A 3I8OA 3PNYA 2Y66A 2Q29A 1E1CA 2LP4Y 4XWOA 1MX1A 3U80A 3WHIA 4QWMA 1AKEA 2B1JA 3BAFA 1J8MF 3PNQA 4MIEA 3B6KA 2HLDA 1R00A 2PLAA 3SZOA 2YZKA 4MV9A 1RIIA 2X1VA 4ZJPA 2A57A 5JZOA 4YRGA 1Y4UA 4NE9A 4ZC8A 3LWDA 3KQMA 2GK4A 4WXYB 1L5HA 4RENA 2FX2A 3AC0A 1A71A 2BEWA 4U3JA 5CH8A 4UJ3A 1L3BA 2EZ4A 1HLDA 3QIVA 1YK0A 1L7PA 2QQGA 1TFRA 1KYVA 3FROA 1PR0A 3L1UA 4P86A 4RVDA 3BB3A 4ZYYA 1ZJWA 1DHTA 5H0IA 2Y9PB 3P0HA 4ZXPA 2FWMX 1J49A 1E7MA 2YYYA 1TUIA 3CKMA 4B45A 3IAXA 4HAUA 3VMMA 4IIDA 4D8VA 4G4SP 4II3A 3EFOB 2FQXA 1J90A 1PEDA 2BFOA 1PZGA 3NP9A 3QF4B 5C2JB 2WB2A 1GFWA 1HSZA 3LPMA 4HMOA 4JBGA 1M6NA 2PUHA 2I2AA 1MG5A 2QL5A 4G37A 4GMHA 1MN6A 2VUSA 4ZK6A 3PHJA 1NATA 1G8YA 3JQFC 2Z5FA 2O57A 2VQDA 1II8A 3RLFA 2X7JA 1VPTA 1EXNA 2BGJA 1WVGA 1GT6A 5ARDA 1W7AA 4E94A 3ENKA 4EPYA 4QO8A 3GRAA 3SIRA 1M2OA 4W8GA 5A5GA 3PFWO 3CRQA 2GCOB 2DUUA 1XAGA 1Z36A 1MXHA 2WWRA 2XKJE 3IQDB 4HDQB 3RS5A 4UPEA 3ZE9A 3C7KA 1DUIA 4MQFA 4NK5A 4S1PA 2VK4A 1Y8AA 5F21A 1EHYA 4FNMA 5FORA 3U09A 1XEWY 3C8ZA 3AIIA 3MD9A 4YUWA 1HNWB 2VKQA 3WHLA 2QW0X 4U6NA 3ZUPA 2Q3MA 1BDIA 4ND2A 1EKXA 2ONYA 3RYHA 3OZIA 4AKEA 3OLQA 3COPA 1UC5B 3P5BA 4D4HA 4GD3Q 3B48A 1QANA 3PYMA 1FNNA 2CFOA 2WRZA 1O03A 2Y3IA 2ZJZA 3STXA 1XT6A 2VH2A 1Z4KA 4C6TB 1YR6A 3TLAA 3I2KA 5BOSB 3OZ7A 5K0BA 4KYVA 3RS9A 5DYIA 3W4JA 1G7SA 2XVXA 1VJTA 3RIXA 1FUEA 1M54A 4POOA 5IZ4A 4EH1A 1A9SA 2HNBA 3V42A 3K32A 3DNMA 3RS4A 5TQ2B 3X2SA 1AS2A 1JA1A 4U7HA 2QM3A 2HMUA 2ZUFA 5C51B 1QCDA 2JBHA 4GFDA 4I1VA 5FWNA 2XXAB 4KXYA 4YJGA 4Q47A 2ZRAA 1J06A 3EBLA 3HU2A 5JZSA 4WJZA 2DYKA 2FGKA 5H82A 3RO7A 5AK5A 3ERCA 1IY1A 2V74B 3ZXYA 4EI7A 1UDWA 1MRSA 1SBTA 4QE3A 2B3TA 2Z57A 3ETEA 1NVUQ 2ONJA 4R9NA 5C4IA 1KEPA 2HCTA 4LSWA 4BXOA 3B53X 4E5KA 1Y9JA 3M9LA 3PR1A 4HYQA 4X0EA 2H29A 2GBGA 4GDFA 3O4GA 2EFCB 3EVFA 4FGLA 4HNRA 4OQQA 4MB6A 4F11A 5F3WB 1GKIA 3VGPA 2OGTA 3WV4A 5JXHA 1YKSA 3L7LA 1SXJE 2RIPA 4W1SA 4ASUD 1KFBB 3EXAA 3VKUA 1ZHHA 4IGIA 4U5XA 2DQSA 3LDUA 1G3QA 5DP1A 3S70A 1NMSA 3NJ8A 2WJGA 4D43A 3RHSA 5G3YA 3THWA 4ZZ0A 1E1DA 4MGYR 1W36D 3KKNA 4BJ1A 1TQ6A 2DUWA 1RLJA 3GQBB 4ZHQB 3TXXA 3CH4B 5K99A 4MEBA 5J4LA 4NYIQ 3HI6A 1DKQA 1L2TA 1XQWA 2PX5A 2WHXA 4JC0A 4KACA 3NR2A 1NKSA 1SU4A 4R8RA 4ARVA 1Z0IA 2OP1A 4F4JA 4YRMA 4YCAA 1XA3A 3SLGA 3V9AA 4DCTA 4HT3B 3LU1A 4DYVA 3AH8A 1EP1B 3BZUA 2CYCA 3L6DA 3WRWA 2VEDA 4GKKB 4WLVA 5GZ3A 3TDNA 1FFGA 2JBWA 2W2VA 2XRMA 3FDZA 1DIHA 3KHUA 1XDSA 1Z0KA 2HFJA 2RBEA 5LYYA 3UFXA 1XNJA 1XL0A 4C22A 1JE0A 1YHZA 4OMCA 3TOCA 4I50F 1M7HA 4YDQA 1UMBB 2IS1A 3FYHA 5CFOA 3PB3A 3QU2A 4Q9KA 5FTKA 5FA5A 4J7AA 5JCJA 5FADA 5KDOA 3CPEA 2Q5QA 2QOEA 1DBPA 1V5GA 3JQPA 2JJ8A 1KQ3A 2M1XA 2OO5A 2AG6A 3VI4B 3TTTA 3BA1A 3ZCVA 2WY2D 1Z6ZA 1KJ8A 1YOVB 2J87A 1W96A 1EDEA 3UXMA 1EX9A 3OJLA 3RGGA 5T5QA 3U26A 1BCRA 1QJ4A 2P91A 2R6AA 4QUKA 1P44A 3RFVA 5COAA 3EIWA 2FDCA 5CR9A 1ZD5A 2J7PA 1S01A 4NCKA 1OILA 3T5BA 3RVJA 4B40A 2CEAA 5D5PA 1Q95A 2OCDA 4C0WA 2HDWA 3ND6A 5JZ9A 4KIUA 2ORYA 4QBGB 1SUWA 2QYSA 3V8MA 5BV7A 3ETDA 4HH0A 5BW5A 3HWSA 1PWXA 3ZYCA 1YJBA 4PYJA 2LCQA 5JC8A 4Z4GA 4TT3A 1JDJA 1OBOA 1KYXA 1F5SA 5EJ6A 2ZRCA 4KI7A 1WOYA 3C4JA 1JKIA 4L5CA 5LU8A 4LX0A 1KYWA 3WA7A 4W6QA 2XQGA 4MR7A 1OXMA 4HXEB 3CT4A 1KC1A 3RS2A 3SFVA 5ARCA 1KY3A 2H52A 2UKDA 3AM1A 5L3RA 3DT9A 1GUZA 4ZIRB 1PG5A 4TZTA 1IHUA 1QG6A 2M6SA 2TECE 3FSGA 5DMHA 2GNOA 4ZI7B 4TLLB 4IJQA 2GEVA 1E2PA 1PJ8A 3UT5B 3ICQB 1G98A 1DBQA 5FAXA 4COKA 4Y2VA 5ALVA 3RC3A 2FETA 2RG1A 1KH3A 4M7OA 3I76A 3L7KA 2DFKB 4IFEA 4RF5A 5DLEA 4P36A 1DFGA 4OB6A 3R3YA 4QC2A 3C85A 1RXUA 1VKZA 3WMXA 1I4WA 3HDJA 1LWNA 3PXDA 2OZLB 5J2TB 3BIOA 4B5KA 4QTYA 5BPFA 4OJKA 2JH3A 1ABFA 1XB2A 2OPHA 1H93A 1RYZA 2ZBEA 3JASA 5KOIA 1AMNA 5SV2A 3U4IA 4GPBA 4GYWA 3EZNA 3FPFA 3KQYA 3R0QA 5FR2A 4BRUA 5DNUA 1Y89A 3C4VA 1RCFA 2FR8C 2JFFA 4LSGA 2OM2A 2HGZA 1ESDA 2VC2B 3GDHA 2Y2UA 1OX6A 3R8CA 1YR7A 1SVWA 4XUGB 1GTMA 1V6CA 4YPOA 1U0LA 5PGMA 3W90A 1DBRA 5KPJA 2AT1A 1Z83A 1RAHA 2AR9A 4NHEA 3AIMA 4IDAA 4HNSA 1RYDA 1TC1A 5E1DA 3P9QA 4NZMA 4MKXA 1BHJA 1BDJA 3O38A 4D9NA 1MEEA 2W2LD 2W6CX 5KYKA 1E8MA 1GG9A 2B25A 3MB5A 4BRZA 4LFAB 1BDHA 3H3JA 3RJ5A 2HV9A 4R9VA 1UZLA 3TPFA 4H7PA 3BE8A 5IZCA 3CZCA 4R41A 3DW1X 5LBIA 4EG0A 4L6AA 1G0OA 3EH1A 1CZUA 4FYHA 4TTIA 3TIGA 4DSZA 3FPCA 4H7EA 4KO8A 2J09A 2N1BA 4W9NC 2BM9A 2J9FB 3AR8A 3PC4A 1YL6A 1G64A 2IF0A 4XWAA 4A26A 5HG0A 1F7VA 2VTKA 2H7VA 2QHXA 5DTMA 2QUBA 1KFKB 1UBLS 5EJMA 3WDSA 1II9A 3D7SA 4RXTA 1VG0B 4BQNA 4WTOA 5J59A 3D8RA 2WUWE 4Y0NA 2QM8A 2J6HA 5ES3A 1FBTA 1XEXA 3D59A 3EUWA 3KD3A 4TKUA 5I9NA 3PU6A 3ZDBA 2FUNB 5EWLB 2CD9A 3RVRA 1KI4A 1J0XO 2X4LA 4BX8A 2DWOA 3Q40A 4OV6B 1QHHA 5TLSA 2OQ2A 3X2FA 1HRKA 3AHFA 4HNGA 4QELA 1PR9A 4D9JA 4K9MA 1MOZA 1E77A 1RIFA 1DXOA 2DULA 1QOZA 1U28A 2NUAA 2OENG 3DXYA 2RI6A 1BEEA 4Q66C 2ONZA 4MTLA 2JKZA 2QAJA 2AFHB 2VP9A 1L4FA 1X80A 4LXQA 1N6PA 1PNRA 3PTZA 3EXFB 1J07A 3VR4H 1N78A 1C30A 3LPCA 4I19A 5KUTA 2O59A 1XALA 3BMCB 3L77A 5KPDA 4QOEA 1N5KA 1R64A 2I4LA 1BH2A 2BCGY 3N0VA 4RSHA 2QVYX 1QXSA 2RAFA 1L7DA 2V8OA 5IBCA 5WRFA 1I4DD 3ZWCA 4DABA 2ZRKA 2RH5A 1NZDA 1Z6XA 3FDIA 5C34B 2O2HA 5JEEA 4F0JA 5JANA 1GGJA 2VP4A 1OU4A 2A7QA 1ZH0A 4HB0A 4MGHA 1RM0A 3W2EA 1CRQA 1CUYA 1PZHA 4GXRA 4IKEA 5FQOA 1BU8A 4X1OA 1VKHA 2RGDA 4ARUA 1USGA 4E5VA 1GNSA 1RKQA 4RW0A 4XFDA 5HSGA 4JBIA 4O2LA 3P9PA 1WKVA 4JOBA 4Q4JB 3JS5A 1I3KA 2R6CA 3R5KA 4NBKA 4Q4AA 1SQ6A 2IYFA 1JGTA 3SQNA 5DNYB 1N2SA 3CW9A 2WTAA 4OB7A 5KX5F 1X1DA 4H4EA 2D5BA 4WNAA 4KFRA 1BOOA 1L1FA 3I1YA 3MJHA 4DMLA 5TPZA 5GM1A 2ZSFA 2R8EA 3FCYA 3WK4A 4W6ZA 3B9QA 1KYZA 3UK0A 4XOUA 1KJYA 4WH0A 1G41A 2B7CA 3FZYA 3HEMA 1A9ZA 4PHTA 3V3TA 1BE1A 3SZ3A 3GLIA 1NVDA 2QP3A 4DR4B 2VRCA 3PWTA 4JJEA 2HFKA 5ALTA 1U8TA 4UQLA 4XJVA 1E9CA 3UVEA 4YS6A 2ISSD 2RHCA 3B20A 4C7JA 1ONBA 2YRXA 3OZAA 1MVNA 1T5LA 1Q6ZA 2QT0A 3T54A 4BMOB 1EFVB 1KFCB 4LQDA 4PINA 4E88A 2BE7A 5F1OA 3OT5A 4NBUA 4O4IA 1H8EA 1Y9ZA 1S8FA 1N9GB 4INZA 1DKMA 2W2KA 1VG1A 2W6JD 5BOSA 5JXWA 4RK0A 4QIHA 4HGZA 2WSLA 1NOIA 3KZKA 4QWWA 1V6AA 2KLBA 4DT1B 3IAEA 4HRAA 1M2VA 1XMIA 3WB9A 3L7OA 3OF2A 2EVWX 2H92A 3KVVA 4WY8A 4ZQEA 2ZUSA 4Q05A 2UUAB 3MTJA 1ZJ5A 1AQNA 2CXXA 1YQWA 3DBHA 2ZRMA 5KQSA 4PG8A 1YMVA 2OP0A 4N49A 3EHDA 1UP6A 2FSSA 2AG1A 2FNAA 1XLVA 2A9RA 3GWZA 4REQA 3WIEA 3QW2A 2CC2A 4FFNA 1PP4A 1VSVA 4JVLA 2OXCA 1YL5A 4N8SA 1VJRA 4JLSA 4JEHA 1USKA 3UV6A 5J43A 1KQFA 1GTRA 5FD8A 3LDGA 4NPHA 4YPFA 2PGAA 1BXRA 4L8VA 4LECA 4BMVA 3H4MA 4ZARA 3S2SA 4AKHA 5AK6A 3SBXA 2EP8A 1LPBB 2GS9A 2V4ZA 3BVPA 4YROA 3TFQA 2NW6A 3U1TA 3UXEA 3VYUB 3II6X 4LX8A 1JXAA 4ZOAA 4DMKA 1R4MA 1VL6A 3GCGA 2WZDA 4KI0A 4PYIA 2UZAA 4LCBA 4P3OA 1CRWG 4MGIR 1GUBA 1X8KA 5IK2D 5M34A 4X6UA 2H4HA 1XZFA 3VNBA 2B5VA 3WVNA 1JLHA 2O8DA 3EFBA 5HX7A 2CKMA 2D1QA 2Z2IA 3DVAB 5C1IA 4CMGA 1DKOA 2ES4A 1RTKA 3ILSA 3INTA 4AY2A 3ANLA 4IV5A 4JLJA 4F85A 2VNIA 2H85A 4ML3A 2PH5A 4XIFA 2AA3A 3QKSA 4G5GA 1X39A 3E35A 4D9CA 1DEHA 3KEMA 3ZTYA 1WETA 4XGKA 2CHUA 4LRYA 2FPPB 4DM3A 5HQTA 1EVJA 3KG2A 3OM9A 4MULA 2AK2A 2PWAA 1KEVA 2A4MA 4NJEB 2DHRA 3MVEA 4TLAA 5KYUB 3WP0A 3K31A 5JYCA 4A5OA 2QAGA 3GBSA 2GPAA 2WINI 4EB3A 1P72A 1U9ZA 3EK2A 2W0SA 5F52A 3WRXC 5C1BA 2H1OA 1T13A 4LYGA 3DZDA 4AUMA 3BGOS 2C97A 3C7CB 5DH9A 8ATCA 2CYAA 4HNVA 3GJYA 1B6TA 4Q9HA 5K8UA 3VDMA 3NC4A 2NAPA 2WJPA 3L1KA 5I5EA 3ZWNA 1CZRA 1GQSA 1NUAA 2WFAA 3BMQA 4O63O 5CA0B 2GLXA 4GQAA 3WNDA 4JEMA 1ZUNA 1SBYA 3PXUA 3Q6NA 1UQRA 1IWOA 3AVOA 1JDNA 4G0QA 2XMSA 2EZ8A 3N2EA 4YLEA 3CZ9A 1NTOA 2H1HA 2IPOA 2QSUA 4R3WA 1CJVC 2JI8A 1F2VA 2QLFA 4OUDA 3UBTA 1OZ0A 1U0OC 5DW3A 4Z2AA 4Y2SA 1RWKA 1TCBA 5AKYA 5MGBA 4RK1A 2ZRQA 4M0DA 3ISJA 5IM5A 2AKYA 1UKEA 1NQAO 1UOPA 1T26A 1YIOA 1XP5A 2IYQA 3DZKA 3IRVA 3AETA 4K3UA 4UAJA 4C87A 1FP7A 1DG9A 4M8IA 1PFQA 2JKYA 1B0AA 1XTKA 3ML1A 3QV2A 2R751 2F1OA 4RHXA 2OVBA 2AS0A 4X94A 1NUUA 2F43B 2OBYA 5FYQA 2ZBDA 4TRRA 1GITA 2RCNA 2ZR8A 3MTDA 4BFSA 3R6WA 3ZY3A 3QJGA 4HLUC 3IV7A 3UB3A 4BMCA 5LQDA 2J5RA 1QK4A 2IEDA 3MLEA 1VI2A 4JT2A 3B1YA 4E2WA 3SKYA 4UDNA 4FKBA 5AK4A 1GUAA 1BFKA 2O5RA 1C50A 2C42A 1AN9A 1M8JA 1PK9A 2PQMA 1MVLA 3BWYA 3TOVA 2GJKA 2OV2A 1MT3A 1UJNA 2JVKA 2WHYA 3U1VA 2YXLA 1ESEA 4FHDA 3OQNA 1J1IA 2W6QA 5CDFA 2IOFA 1RC0A 2Y1CA 2FVYA 2AI1A 3L8DA 4XZ3A 3P9SA 1XNRB 4I14A 1RP7A 4ZV9A 4BN4A 4CKCA 3VR6D 1NW4A 3GCZA 1PD1A 3WB0A 4RKYA 1SK9A 2G76A 1PJSA 2R7LA 2QR5A 3K09A 2WK1A 5DHQA 4DV7B 3EEBA 4EJSB 1MOPA 1XPOA 4OREX 1W52X 3SEAA 1HOTA 4C89A 3PCRB 2BGMA 4X71A 4Z0HO 2X15A 1UR5A 3G68A 3T5CA 3DJYA 1ZCBA 3NM5A 3EEQA 1WG8A 1WNTA 1NV9A 2Z09A 4G0OA 3L4BC 4XB2A 4XSGA 4ALLA 5B1YA 5JMTA 3IQHX 3VH3A 1SRQA 3PL5A 1F9EA 1GGKA 2WJIA 3KP1A 2JLSA 4H0FA 3UJBA 4BZPA 4BY9E 5CCBA 1XPJA 2XGSA 3T4PA 4MXDA 1YZFA 3GAAA 3COYA 1RKBA 1VPEA 2I8AA 2CNWD 1RXSA 2FOXA 2Q3FA 1JKFA 1AUVA 3RQSA 1WEHA 5B1SA 1EIZA 1YDHA 2I87A 4XWWA 3EUFA 4UM8B 4LFBB 4YRTA 1PRYA 1RNLA 2Z4SA 2QR3A 1VIAA 3HJBA 2ZPUA 3GR6A 3J7TA 1LPAB 3OURA 3EEYA 3R0JA 3G2MA 3C16C 4MUFA 4ZAFA 3ZJYA 4LQLA 2P40A 5I7FA 2CUZA 2PUGA 2B9VA 1GRVA 4QFBA 4Y3UA 2RSLA 3TW8B 4RLSA 3O3NB 2G8NA 2PXXA 16PKA 4EOGA 4RTSA 1OAOC 2UVPA 3HVKA 1WOMA 1TVEA 3JQBA 2VQSA 3JVUA 5M5BA 4QARA 5LOVF 1VGVA 1UBGA 5AOVA 4C76A 3KXIA 3AY7A 3M6MD 5HCIA 5B12A 2JI7A 1RE1A 3FZQA 1WD5A 5C4MA 4M7RA 4Q4DA 4B17A 1FP1D 3C6KA 5HW0A 1EUYA 3ZHBA 1XVLA 3NTQA 4TMZA 1O8BA 4M7PA 3KBOA 4AZWA 5FJJA 2E4YA 3UTDA 3LYAA 3M1IA 3IHKA 5GOTA 4CKXA 2IYRA 3WIBA 3WL5A 1SUDA 3N07A 5DI9A 3WMRA 4DQXA 1OFVA 4KIWA 4LY3A 2FUKA 1W49A 2WYUA 5LP6F 3ABSB 1HC7A 1SQ0A 3W1EA 1RHMA 4FINA 1JLSA 3T99A 3IYLW 2AFHA 2ZU0C 2FPIA 4G1FA 4KLZA 1XZIA 2KLHA 1VYHA 4OH1A 3KX2A 4OHVA 5CM9C 2WKRA 5L40A 1QZXA 4J0KA 2JLQA 3HA5A 3OZGA 4TMYA 1YS7A 3EF1A 3WG9A 4PBSA 3KUDA 4KC0A 4UEJA 1GPMA 1XSEA 1EX7A 1T5HX 1J8QA 3TRFA 4Y6LA 3ZR4B 2GHTA 3IBTA 1SPBS 4PRLA 3AFHA 4BQSA 2PGJA 3GGOA 2WAOA 4LXHA 2P75A 1NBOA 4YAJA 1AZLA 3AESA 3EJ6A 1GY8A 5KMGA 4AM8A 1PTJA 4RQAA 5LBUA 1WZEA 4ZWNA 2HNKA 1FFBA 2CVFA 3ZQ4A 4ZVKA 3U56A 3U9TA 1R5NA 3FR8A 3G5TA 2GAOA 3OM8A 4K8OA 4O2AF 3O0TA 3TBHA 5AVQA 5FOSA 4JMPA 4QRHA 5LXTA 1JHOA 2HMYB 4FGKA 3DMFA 1R4AA 5DNVA 2Z5VA 3K73O 1YDWA 1GUYA 1GGEA 5FRDA 2HU8A 3H5IA 5A3VA 1U3UA 4CM7A 2ZR0A 3H5LA 2ZWVA 3LVQE 3A27A 2W2TA 4Q21A 4BFWA 4ND6A 5AM5A 4TVSA 4HDMA 4BEJA 1SUBA 4OUDB 1CSEE 3C3DA 4IXTA 2QI9C 2HT1A 1EFTA 1DBVO 2XXAA 1ZIDA 1SHZA 3V8RA 3KOOA 4LXUA 4D0NA 3G0HA 1XKLA 3TLCA 5REQB 1QCCA 1JA0A 3RRFA 3H5VA 2D0OB 3F6EX 3WGLA 2H31A 2Z58A 3H8SA 2FPRA 3JQ7B 3EYWA 4ENRA 3QLEA 5K3OA 5IH3A 4AMGA 5JZBA 1DBWA 3H9QA 3K1AB 2WG0A 2IZ5A 3X0DA 4C88A 1MH9A 2VZ8A 3RANA 2ZSKA 1U11A 2ZT6A 3LCMA 4X60A 3FOFC 2ZVDA 1NYLA 3ZV7A 4OX9B 4MHSA 2YWRA 4MITA 1F8FA 2ANBA 3RLIA 3VV3A 4UPVA 5BV1A 2IP2A 2G6TA 2R47A 4C7MA 3G0CA 3D6NB 3L8GA 2JIRA 3W7AA 4O8ZA 1WPQA 3ROTA 1NJSA 1S3FA 3CX3A 4LYDA 2QP9X 2ZEJA 4LGYA 3ZWOA 1YF3A 3HGTA 4HVTA 1DB3A 5BP7A 1O57A 4EFLA 3LCVB 1EBFA 1JL3A 1UKVY 3PD0A 2Q8QA 1MIOA 1T4GA 1R1DA 1U31A 2CUNA 2O2EA 4HNHA 2JDID 3RK4A 4EZBA 4JI2B 1QWSA 4ZQBA 2W00A 4QOGA 3SS9X 1MC8A 2DETA 1LSOA 2XD9A 1V9SA 2XODA 3F5SA 2HCFA 3DZHA 3S99A 1XMOB 3K6SB 1A72A 2W7TA 1U8AA 1XU4A 2CYBA 2XZTA 3MWYW 4UEQA 3A2MA 2TS1A 2DHEA 2R5NA 5AICA 1XZDA 1YS4A 4S1VA 5LKRA 3UO8B 2OB1A 1F8YA 1HL7A 3IPYA 4S1OA 1L4UA 4M1ZA 4AURA 2XYHA 4J49A 3AETB 3RSHA 2RH8A 3T7SA 3O0DA 4I99A 3P27A 4HLCA 4P4SB 1CVIA 3WTBA 4ENTA 4MAAA 2VDLB 1HYQA 1P29A 1P18A 2G25A 5AIAA 1Z38A 2VDNB 1NX6A 3G79A 3EODA 3TOSA 4BO9A 2IXGA 3GEMA 4OGKA 1L0BA 4NCJA 4OQ4A 4Y6PA 5KC9A 3OPYB 2R5FA 3I9FA 5IX8A 2XUGA 1L8QA 5TGZA 2HR1A 1YTUA 4MJXA 3A9UA 5D86A 1Y1SA 3IULA 4BLQA 2EG5A 3QEJA 2P8JA 4QTZA 3LLMA 1LI5A 4EG3A 1ZOOA 3AHEA 4B3FX 4MEJA 3SLKA 2YY5A 2N9UA 5F9HA 4ZKEA 3ZX4A 4XQEA 1I4OA 1MC1A 1XJ5A 2N47A 2QKYA 1ECPA 1YC5A 4GR9A 4R16A 5CB6A 1NBME 2EP7A 4O4IF 1NKTA 3JRWA 1A95A 3AR3A 1U5BA 4O4IB 5E4JA 1FUIA 3C6XA 2AMFA 4WCDA 4KH0A 4UOZA 1DAOA 4FEYA 1IZ0A 1NJ5A 2YIMA 3G2HA 3A9TA 1FU7A 1VDMA 4FOSA 3OI7A 3NOQA 5EJ4A 1FPMA 5D5HA 4EO9A 4BHTA 4DEYA 3EFHA 1UC8A 4DMMA 3U62A 5JYDA 3INGA 3S8YA 3T52A 2VDWA 5F35A 2ANCA 3DCJA 4X8LA 4KPFC 3FOZA 2DU8A 4JXZA 4E07A 5K0FA 3WWYA 5A04A 4PZDA 1DAFA 2J07A 3DH0A 1AKNA 4D4MA 1MVOA 2WSYB 5JSFA 1KC3A 4ND8B 5HM6A 1IOLA 1Y6JA 2FRXA 1UJMA 4P9NA 1UMCB 5M2QA 3WFIA 1JAXA 5J4HA 5KOJA 1M10A 3EXG2 1LRJA 1E9EA 1K5GA 5FWXA 3UGQA 5IASA 5K4HA 3CZ4A 3WLFA 4ME6A 3QZUA 4N8DA 1FXWF 2PU7A 4XCXA 1JQEA 1SVNA 1NQTA 1R27A 4A0GA 4R8LA 4XJSA 4EHJA 3ROGA 2GF2A 1NW8A 3GJSA 5ITSA 2P9ZA 1DDOA 2XGOA 1UP7A 4D57A 2V65A 1C3JA 1GL6A 3BH6A 3NBAA 2DHCA 2PLRA 1FMLA 3IEUA 1NW6A 2P1ZA 1MD9A 3GFOA 4Y6GB 4EJSC 2AQKA 1DWQA 2J45A 1A8SA 5CJJA 4D3SA 1TCUA 3M4XA 4DLWA 3OPYA 5C1OA 3L0ZA 1M8FA 5T8KA 2HRDA 4OA5A 1E1QD 2PS3A 5DCWA 4YP1A 2J4CA 5B1EA 3JAKB 1J1UA 7AT1A 4U2EA 2VHWA 3NYQA 1H8HA 5L7WA 3GG9A 2P78A 1RKUA 3QXHA 3QU9A 4MWCA 3T61A 2JARA 4G5OA 3UY4A 3UWSA 3JQGB 1FB5A 2DHDA 5JDIA 4NS1A 2ECQA 5EWJA 4D4LA 4EY5A 4FFDA 2YKGA 2FFAA 4M83A 4E5SA 3SKVA 2I6FA 3TZ6A 4C06A 1Z7WA 1ZX1A 4GKBA 1W1IA 3HUUA 1QHGA 4TWZA 2M32A 4XXHA 1XZAA 5E6RB 4YYEA 4DF3A 1AGRA 1MP0A 4MV8A 1I4EB 5AM1A 4E5MA 8MHTA 1L7NA 1ZCFA 2AD1A 4GBED 4TTSA 3NV9A 5CYOA 5A1JA 4GP9A 2HF8A 5CX4A 4EUSA 2H2GA 3QOFA 5L6LB 4FOOA 2ZZNA 2LD4A 3KFLA 2CJWA 3LQFA 3EGWA 1KOJA 2XVMA 3MHPA 3E9EA 1Z0ZA 3QX9A 3HFSA 3KTOA 2DFDA 2YVUA 3MWEA 3MN1A 4J43A 1NYRA 2VNAA 4I4TF 4MW1A 1P0FA 2I71A 3ZZNA 3O8OB 2Y1WA 2GA9A 4DLRA 4BYGA 3H4VA 3LUHA 4RPIA 1OWNA 3OPNA 1XRMA 3X43A 2PQ6A 2QLNA 3FTCA 1RWPA 1OQAA 2UZIR 3N0WA 4JCCA 3OZFA 3IE0A 2XOEA 2CMGA 1U0EA 3AK4A 3DE7X 2AXQA 2J9FA 3FFXA 3QXSA 3RKUA 1B00A 1FXSA 1R74A 5KI6A 4D4IA 4I4NA 5DRTA 2Z4RA 3IIIA 2GEUA 2V7TA 2Y05A 4WZAA 4HATA 2OPBA 4KODA 4BVJA 4TKLA 5HRUA 5T41A 1NNSA 3MAJA 4KRXA 5EQDA 2XNCA 4JFAA 4OY3A 1R0SA 3RSFA 1S9DA 1N9ZA 3RU3A 3DZBA 2ZIEA 4KQ9A 4BNJA 3AUXA 2PO7A 4R1OA 4RA9B 1P0IA 1FW6A 1T2EA 2COKA 1WB6A 1KARA 2FP4A 1EG2A 2GCOA 4JR1A 4NZ9A 1KAMA 1PJ2A 3FHLA 3LK7A 4CLRB 4F1KA 5I7OA 3VU9A 4J7XA 4QDTA 3QBJA 3AVXA 2NT3A 1N57A 3I5AA 4UZFA 3WWPA 2GPJA 4XIYA 3PGXA 3MT9A 4PLHA 3LXUX 4I46A 4DLNA 2AOUA 3LX6A 1U3FA 5GV7A 3X44A 3F3KA 1A7KA 4QEZA 1RJWA 2PD6A 5AI8A 1W87A 3HDVA 3W7VA 2WZCA 3A4YA 4KIFA 1Z88A 3KM0A 4B6EA 4BGIA 2JFHA 1XEFA 3GGPA 1U3WA 1M6EX 2XB9A 2XIJA 3C87A 4EZEA 4G26A 3PX7A 1H2HA 1T6NA 3EF0A 4KQIA 4RVGA 2WVGA 4M9RA 2FR1A 3S7TA 3SYMA 3BCRA 2VWHA 1XCLA 3Q1KA 3RIHA 3PRHA 2ZUEA 4KQ1A 4XCQA 4C3VA 2B78A 2JCBA 3UANA 4D45A 4RVNA 4HJXA 1XD9A 4C0AC 1SWWA 3PXEA 2HC9A 3LYUA 4AZ0B 4YCNA 4PSVA 1WHSB 2F3PA 2FH5B 1KDOA 2H4XA 1PV1A 2G70A 4JQCA 1LLUA 1KAGA 1HG0A 4OGLA 1PGQA 1J7JA 3Q12A 2V4MA 5EZ6B 1NVBA 3OF3A 3LHFA 4XEUA 1MORA 3R5TA 3WGKA 9LDTA 1ORRA 5EA2A 4N5HX 4RYDA 3TG8A 4DA8A 1GPJA 2AEJA 2Y8EA 3HJGA 3FVWA 4I5FA 1W76A 3R4CA 1OT3A 3VPFA 2QE6A 4OKSA 3EPLA 4NOLA 1SXJC 3KR9A 3VKWA 4ACAA 4RUKA 2YS7A 1AXGA 4GNKA 1GPNA 2P2ZA 1BFDA 4XJXA 4AFNA 2DOKA 1KMMA 4S12A 5ALFA 5LQCA 4ECAA 1FFEA 1ZGCA 2ETXA 1FRZA 4UBIA 1PJTA 2ZWOA 3N8GA 4E5PA 3KHKA 2TMGA 3G0BA 3DM5A 3WSVA 2H54A 3I61A 1XZCA 4CM1A 5E2BA 4YFYA 2XNSA 5GJWC 3KKQA 2RHMA 5KNBD 1X7ZA 3OZBA 5BNWA 5LIPA 2PK3A 2XT6A 4CLEA 1M1YA 1YR1A 2R8ZA 2YX1A 4LWQA 3BIWA 5JS2A 3GIDA 1C8BA 1VLHA 1KWKA 2J33A 3G9ZA 4S24A 3WSWA 5JYBA 4A3SA 1LRKA 3KLMX 4IOMA 2VOJA 3QA9A 3ZHOA 1Y8QB 2WW8A 4P82A 1FDOA 1RM3A 1RFGE 5I7SA 3E9MA 2FN3A 2MSCB 5H83A 2CNWA 1K7EB 3R40A 1X86B 3SC4A 4D2IA 4CHTA 3NIBA 3QEKA 3CH7A 2WTUA 1TYEB 4BNYA 2QE7D 2OHFA 3C1TA 3OLWA 4CMEC 3EH2A 3WLPA 4Q3LA 3D4PA 2E85A 4CLDA 3PDWA 3FY4A 3ZNNA 1CZNA 2EYUA 4L22A 3QEOA 5LXTF 4G0UA 3EXHA 1XPUA 5E7JA 3FKSA 3G5UA 4PTZA 1V7CA 5JSKA 3S28A 4EHKA 1G8JA 2ZSBA 2XYQA 4ZDJA 4P0TA 3N8DA 3ME5A 3UW1A 4QT4A 2Q5JA 2XA9A 1ADGA 3FAZA 3Q0TA 5E4YA 1U98A 4O3FA 3N70A 2G9RA 1DZ3A 3UMRA 4CM8B 4I55F 3CVXA 1CEXA 4ZP1A 4YXWA 2JVIA 1NFQA 4LVOA 1NXXA 2VYND 2HCRA 4I4IA 3ESCA 5F4BA 1GNRA 2G77B 3CEMA 2NZYA 2QPOA 3E5HA 5IJ9A 5EP3A 4Q93A 1SZJG 1F8UA 1HDGO 4U7FA 3HK2A 1VPLA 4XX0B 4DQVA 1ZGGA 2G17A 2IHJA 1ZGJA 2J0VA 4S2UA 4KUHA 1ANKA 4BLUA 2A0UA 2JZNA 4QECA 4HMPA 4EG7A 3DVRX 2JDIA 4PYQA 3OCZA 5LUBA 2O2GA 3VZCA 1IUNA 3EULA 4XX0A 2O6HA 3GQBA 1YO6A 1OWMA 2G0NA 4Q39A 4HLQB 3VKFA 3TE6A 3EC7A 1X7WB 3MW8A 3V80A 4UXJA 1L4BA 4R69A 4JK3A 3ADKA 1EDBA 3F4KA 3OJWA 4U7DA 7REQB 4D8XA 1VL8A 3I8XA 4PYKA 4GMGA 4EP1A 1V1JA 3IP3A 4RJTA 1P4SA 1P9WA 1AV7A 3C15C 4OXQA 4JKYA 3P9KA 4M3NA 4NENB 5KX5B 1ZD8A 3WBBA 1FMJA 4JOSA 3ADPA 3CLRD 3JARA 4KHZA 4MVJP 1UIMA 5D3MB 2APJA 4YQEA 3L6OO 3WGMA 5TMPA 2MCFA 1DVRA 1BX0A 5DU2A 5CLJA 3VHRA 2WUFA 4BNHA 2YHBA 4E2YA 3BD6A 5I51A 4Z53A 1OZHA 1UZMA 1D2NA 1JR3A 2J3JA 4IEIA 5J2UA 3DDUA 2C5FA 1YB4A 3ROPA 3ND8A 4K46A 1LSUA 1X7GA 2WQZA 2Z1NA 3BQNB 5LP1A 4N76A 1UF9A 3KC2A 1FP2A 1VP9A 4A4DA 2AFIA 3ENZA 4UE6A 2PUFA 4HUTA 3F3MA 3VU0A 2HZBA 1V5FA 1NXSA 3I9V1 4JB0A 3ZV5A 1M5UA 1XZMA 1J7KA 2QQEA 3EMKA 3QVOA 4GXTA 2GARA 1JPVA 4PICA 2F1IA 5KOHA 5EIAA 2C1ZA 2WMNB 4XTRA 5CHEA 1PJQA 4DV3B 4GOKA 3K2IA 3M6IA 4C4TA 1CF9A 1ZI9A 2GYVA 2HRCA