3GCGA

Crystal structure of map and cdc42 complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
177
structure length
173
Chain Sequence
QTIKCVVVGDGAVGKTCLLISYTTNEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into host GTPase isoform selection by a family of bacterial GEF mimics
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/transcription
molecule keywords Cell division control protein 42 homolog
total genus 53
structure length 173
sequence length 177
ec nomenclature
pdb deposition date 2009-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3gcgA00
421PA 4L16A 4TLAA 2EVWX 2P65A 4B44A 1XEWX 1II9A 4W5WA 1RZ3A 3WYAA 1RYFA 4DLVA 1CU1A 1KI8A 2OCBA 4FI3C 1TUEA 4FWTA 1KMHA 1SXJA 3C15C 3OHMA 5D3QA 4IDOA 1W36C 4UKDA 2HXSA 1DOAA 1FTSA 5JI2E 3CNNA 4KODA 3CO5A 4Q5IA 4OI0A 1RE0A 3LX8A 4BFUA 1ZNZA 2AN9A 3FHCB 2V55B 3TE6A 4K46A 2IX3A 4E07A 4Q9IA 1AS2A 4D2IA 1LF0A 1XCGB 3AP3A 2O8EA 4WAUA 3BGWA 4LYJA 3W8NA 2VSFA 4GRAA 3X1ZA 1HQYE 4PPQA 4OL0A 1W0KD 4FMBB 4LOAA 4QHSA 2ZRGA 3R20A 1F2TA 4LCBA 1CXZA 4PHFA 5JHHB 4CGZA 3IPYA 2ZR0A 3VNUA 2IL1A 1E2FA 3V9PA 2O8BA 2IEZA 2ZR7A 4M22A 1JQJC 1QHGA 1VIAA 2QPOA 2V6IA 4KHZA 5TMPA 1E3MA 3B1ZA 2R44A 3VHLB 2RAPA 3FGNA 3GLIA 3PEYA 2OEPA 1N5JA 3L2OB 2FH5B 3RC3A 1S1CA 2AKAB 3A4LA 1GAJA 3AV0B 4YLGA 1P4SA 4II7A 2CL0X 1J90A 3NC1C 3I72A 4UJ5A 2IYTA 4RZUA 5AR1A 2IS2A 2C77A 2DFKB 1JPJA 2QENA 1GL6A 1C4OA 3MWYW 1WF3A 4HDOB 3A1SA 5EE5B 1KI6B 4NPHA 4B47A 5JRJA 1N5KA 4UXHA 3F0TA 3MLEA 3UMRA 1OH7A 4EPYA 3E70C 2D7DA 3PUXA 4GI7A 2P6NA 4F4CA 3IQXA 1Z0KA 1W4AA 4F91B 4K8OA 4ZIRB 2JLQA 2OCPA 3AGPA 2ZJYA 4PQFA 2OAP1 3SJCA 3EPLA 2O8CA 4AC9A 3ZIAD 4JS0A 1J8YF 1DEKA 5FPSA 4BEJA 1Q57A 3QXSA 3I5XA 1G19A 2ZI9A 3IUYA 4C7OB 3OFND 3D8BA 3NXSA 1QHIA 4R2HA 5CM9C 1DVRA 2XEXA 1I2MA 2F55A 2I1QA 4HLCA 1GOTA 3SYKA 3EZ9A 4EUNA 1NG9A 1OXXK 1IJEA 1Q1BA 2CVFA 2VP6A 4X8HA 1JEDA 3GJ7A 3I92A 1US8A 2YHSA 2G1KA 3AVYA 5JWRA 1I2DA 3OIUA 2V7QA 5TARA 1UDXA 4PXAA 2J59A 3UG6A 2G83A 1IN6A 4DSTA 3HR8A 4LSGA 1HE8B 1AQYA 3BH6A 2ZI3A 4PAQA 1P5ZB 1ZJ6A 1OB2A 3KX2A 5HE8A 3T1QA 3K0AB 1P9NA 1WMSA 3KZ1E 3KQKA 3Q5DA 5C18A 2WJIA 1KJWA 4O2LA 1H8ED 1E98A 3DEFA 2BBWA 3BH7A 3GEHA 3P20A 1YKSA 2IK8A 4GZLA 3QF4B 2ZRHA 4UNSA 1EFTA 5AJWA 4B6EA 2HV8A 4PHHA 3QBVA 4BLTA 4D25A 221PA 1U2RA 2CBZA 5LB4A 3U7HB 1VYTA 4HLUA 621PA 2LWIA 4C7OA 4AD8A 3ZVRA 2PZFA 4TN1A 4RCYA 3HDTA 1QVRA 3Q7QA 4I1SA 4JZKA 2GJAA 5BN5A 4V0LA 3LW8A 1QF9A 3GEEA 4I4LA 5EP4A 4CVNA 2CNWA 5FH9A 2WOOA 3ND9A 2CJWB 3I8SA 4TQ9A 4W5JA 2GTPA 2Q9CA 2C2HA 4ZV4A 1OYYA 3H4MA 1PLKA 1E1QA 1X8KA 2CLCX 3I3SR 3GQBA 1MR3F 2OBMA 4KV9A 1NP6A 2QN6A 4HI0E 2JLXA 1DO2A 4A4DA 2HYIC 3WMGA 5B57C 1M1YE 1Z07A 4E5UA 3IIJA 2X77A 4LHYA 1OFIA 2J0QA 4RFSA 3LH5A 1E9EA 1T0JB 4Q47A 1Y3AA 2J0UB 4NCKA 3ZS8A 3VX3A 821PA 3OE7A 3UWKA 3M0EA 5DSZA 1U0LA 4FWIB 3X2SA 4JIMA 1CR4A 2EFCB 4Q7KA 1SVLA 1ZNXA 4I99A 4QL3A 3EA0A 4RZ3A 1OIWA 4QNRA 1W47A 1N0VC 4RFVA 2ZVPX 2D2FA 1TF7A 3VR5A 1E2JA 1WDTA 2HYDA 4JYBA 1XZQA 2GJ8A 3G5UA 4Q7LA 2QMUA 2P2LA 5DN6D 4Q21A 5J4YA 1F5NA 2ZAOA 3EIEA 4EFNA 1YRAA 2CHQA 3AEZA 4B3GA 4URZR 1HT2E 1P2SA 3AVQA 1RJ9A 2VSXA 3BOSA 1E0SA 4KAXA 2BBSA 1NBMD 1P60A 1AZTA 1VCOA 1M7HA 4PANA 2IUUA 1KO4A 2JATA 1E94E 3CX6A 4RD0A 3TAHA 2PMDA 3CH5A 4EKDA 1EWRA 3PEVA 1T3LA 1HUQA 2BBTA 1TEVA 2GXAA 4Z1MA 1V5WA 2GAAA 2PCLA 3MWLA 1N25A 4LY6A 1SHZA 4NBSA 4PC3A 4WVFA 1EFRD 4QHYA 2ZE8A 3GJ8A 4Q4HA 4UNNA 3WYFA 3IHLA 4FXPA 2Z6VA 1AS0A 1U98A 4NYJQ 2ODEA 4RKEA 3P26A 1OV4A 1MRSA 3IBYA 2PBRA 3EZ2A 4MYHA 3EPKA 1OFHA 3B5JA 4RZXA 3CIOA 4J0QA 2EYQA 1GITA 4WZBE 4CDGA 1W1WA 3KKPA 5P21A 4PZZA 3GLFA 2A5JA 4DZZA 1BOFA 3ZGXA 3ZVMA 5A0FA 4MRPA 1N2CE 1WE2A 1KY3A 1ZD1A 1E4YA 2QTFA 4RY2A 4Q7MB 1W4BA 1MKYA 4A0HA 1OIVA 2J0VA 2A5GA 2V4ZA 3KFVA 4NONA 1QBKC 1TQDA 1OKKA 2Z83A 2ZS9A 2C8VA 1G64A 4URYR 3L8ZA 5G53C 4AKEA 5EJEA 4M1KA 1X6VA 4TLCA 4B35A 2ZRJA 5G40A 3T12A 4C0BA 3O8RA 2QQEA 4QFMA 2OE2A 3FKSA 3SN6A 3WYGA 1NL3A 3PR1A 1NJGA 4ON9A 1Z6AA 1Q44A 1K8RA 3WHLA 3C5CA 3K70C 3NC0C 3SHFA 5FOSA 3RSOA 2HEIA 5F98A 3ASYA 521PA 2BHRA 2GHIA 2QG6A 3FPAA 3U7GA 1KK2A 4X8LA 1AKEA 5FOUA 1KGDA 2XGJA 1XD9A 2BC9A 3BFXA 3NDPA 3QXJA 1Z6XA 2XNDD 2D4HA 2GKSA 1E9BA 1T0HB 5JI3E 3ZDQA 2GZAA 4C2TA 2NO0A 3TK1A 3FOZA 3AF2A 2SHKA 2Z4RA 1E99A 2AXNA 2ANCA 3EW9A 3KXKA 3VX4A 2Q9AA 3A58B 2GILA 4TL6A 1T5IA 1GFIA 3VR1A 2XITA 2BV3A 2FX3A 1CR2A 2IYRA 3LLMA 3MWKA 4W5HA 4A92A 4YXWD 5BYKA 4Q1FA 2JGNA 3VAAA 2G6BA 1F2UB 3LXXA 1AS3A 1R10A 1SVSA 3KKQA 4A0RA 4PX9A 2ZJ5A 5EP2A 1D5CA 2FEOA 2JJ8A 1U9IC 2WSSA 2ZR9A 3B1XA 3KTAB 3R9IA 3TQFA 3THXA 1TL7C 4ZDIA 2WKRA 2DWPA 3MFYA 3Q9LA 1G20E 3LBHA 1I4DD 2F1JA 2REXB 4TT3A 2VP4A 4IOMA 4V0OA 2Q9BA 1E69A 4KBFA 5CJPA 4BZQA 1IN8A 4KLNA 4XVUA 4HZIA 4BFSA 1XPOA 4B6FA 4LHWA 4TTPA 5JEDA 4JLKA 3P32A 3FMPB 4U7DA 1KKLA 5LD2B 1TX4B 4Z54A 4UNQA 3RANA 1BYIA 5FL7D 2WV9A 3U5ZB 4IOKA 3THYB 1T3SA 1E2PA 1WXQA 4BEBA 4EQ6A 5CK4A 4P3YA 1E9CA 1NLYA 4DCSA 3E1SA 2A5YB 3IHWA 5C46F 5D3MB 2L0XA 4TLEA 4IVRA 1IOZA 2IYVA 2IWHA 4IDPA 3RRYA 4B43A 1GNPA 2YYZA 5DGXA 3GMTA 4NHOA 4BQSA 3KQNA 4XSGA 4PR0A 1VKJA 3CPEA 4Q7JB 1UKEA 2HF9A 1NN3A 4PC2A 1P6XA 4DVGA 3RVBA 1JBKA 2A5DA 3O8BA 3GD7A 4GL2A 1XBTA 2XJ4A 4DEXA 2FEMA 4KFTA 1XJ0A 4E22A 2GRJA 1SVIA 2IXFA 3BIFA 3F3YA 5DH9A 3X1WA 3GLGA 1XRJA 3EXAA 2RGEA 3JZAA 3OAAA 1M8PA 4TZ6A 4ESVA 3Q72A 3REGA 1U99A 2CVHA 4WZ6A 2HCBA 5FPKA 1US8B 2UKDA 2R6DA 4EQ6B 4PC6A 4TYWA 2QEQA 2E1RA 1KI3A 1DTSA 1N6NA 1FQKA 1XTKA 2XSZA 5CLQA 2IUTA 4ACBA 3B85A 3QUSA 3AUYA 3K0CC 2GCPA 3L0IB 3TH5A 2WKQA 2ZEJA 1E4VA 4BFWA 4Q9JA 2ZRMA 4RZ2A 2ZRKA 2C03A 3K0SA 3LD9A 1ZUIA 4OI1A 2PL3A 4BWYA 1EXMA 1FNNA 4US2R 3LQQA 4ZIRA 2KBEA 3MUFA 3C7KA 1TEXA 1RRPA 721PA 2CCGA 1G21E 4L9WA 4BGDA 3DZDA 1L7VC 3AKDA 2RHDA 3QBTA 4C0SA 3GJ6A 1KDTA 5DIFA 5EP3A 3WXMA 4TSFA 2D62A 3IKJA 5FL7A 4S35A 2NMVA 5JWOA 1F2UA 1Q3HA 2QM8A 2ZJ2A 1ZD9A 3H1TA 2JLRA 3OIWA 1W7AA 4RD2A 2GCNA 1J99A 2ZSDA 2IA5A 1SKQA 3D6TB 4OQFA 5K8TA 4Q4JA 1Y63A 1VDZA 3FVQA 1W44A 4CRWB 4A36A 2YZ2A 3U44A 2WHXA 1E2KA 1RW4A 2YOGA 4LV5B 2ZUDA 4P4SB 2GEVA 3VKHA 1NLZA 4TLBA 5BN4A 4DLWA 3M1IA 1ZNWA 4B73A 1FTNA 4GOXA 5CK5A 1DAGA 3RS7A 3CH4B 2FZLA 2O8EB 3DMNA 5JJIA 2ZJZA 3CRQA 1TNDA 3TRFA 1QRAA 2AXPA 3W3AA 3ZD6A 2EFEB 2OHFA 4MKIA 1PUJA 2H7VA 2ZUCA 4YMUA 2IHBA 5L8VA 4K81B 2JLWA 1YR6A 3C16C 3CZQA 1P61B 5BYJA 2EWWA 2CCKA 1W0KA 2V7QD 1Z6GA 3TUJC 1P2UA 3N5CA 4FMCB 5J4HA 6Q21A 1DBSA 1TQ6A 1JJ7A 2H92A 2I4IA 1TMKA 2KE5A 4O0MA 4DLRA 3W6NA 2GJ9A 1LTQA 3L8YA 4YMWA 4BZPA 4KVAA 4EJSC 1Q12A 1VYUA 2ZAMA 1M6NA 4N1AA 3W34A 5HZKA 3U3JA 2PT5A 1CR0A 2J0UA 2FNAA 2IS4A 1K6MA 1VCNA 2IYZA 4LPKA 2REOA 3LXRA 4GPTA 2O8FA 1PV4A 2QBYA 2ZRLA 4B3BA 4UQOA 1JNYA 4HUQA 1NN5A 3K9NA 2ZU6A 1WQ1R 1XEXA 5CLLA 1N6RA 1N3BA 2QSYA 3DVLA 4JL5A 2W00A 5HR5A 2UZ3A 1QZXA 2I3BA 5HZHA 5L3QB 3ADBA 2CNWD 3L82B 3K0EA 1KHTA 2F3TA 1VTKA 4CEJB 1F2TB 3HR7A 1FQJA 1MO4A 5K8UA 1OKKD 3NBYC 1CJKC 1R8QA 2N46A 1XPUA 1KJYA 2OSBA 3OESA 3H0KA 5KHOC 1XD8A 4Q00A 2ZSFA 1L8QA 3VR3A 1GRRA 4WXRA 2A9KA 3B82A 4OKSA 3B1WA 1GRNA 2V9PA 2RGNA 1ETUA 1G16A 1OHHD 1NVXQ 2X1VA 4ZI2A 2J5XA 1E9AA 5FI1B 1E0KA 3IBGA 4A1FA 3IEVA 4HDQB 4ERNA 1QHSA 1F48A 2KB0A 4YC7A 1SXJB 4LZZA 4DLUA 3DMDA 2PX0A 1SQ5A 4DDTA 1A2KC 1UDWA 2IYYA 3KJGA 2IYQA 5FUWA 1WB9A 1TTTA 2VEDA 1DADA 2A2ZA 3ZVNA 4WW0A 2X2EA 4G5OA 1VCIA 3TR5A 3ZVLA 5KU1A 2ZXUA 2NO1A 3GCGA 5FPHA 1XEFA 3U7FB 1E6CA 3AKEA 4Q9HA 4EJSB 3FHOA 2C95A 2IS1A 1DAEA 3LWNA 4G5RA 3TSZA 4US0R 5LDDC 3PUVA 3KQHA 3U61B 1WBBA 1NVWQ 2NQ2C 3SS8A 2R6FA 3O47A 1NBME 4V0MA 3VR4A 4A6PA 1XU4A 2JLZA 4UJ3A 2IEYA 3DM9B 3SQWA 4MGKR 1DAFA 3GFOA 3W8RA 2TMKA 2F9MA 3K0FA 3SQXA 2DB3A 2C96A 1KAGA 1XD2A 3NKVA 4TLDA 2NPIA 3AP2A 2O8CB 1GKIA 3VMFA 4C3ZA 2Q0HA 1NY6A 2QGNA 4XSHA 4OHYA 3HYTA 2PH1A 1KSGA 4JLOA 4HAUA 2ZREA 4TZ0A 2GA8A 3AUXA 3L0SA 3TMKA 2F9LA 2NO6A 2P5TB 4R7ZA 4B2IA 1OE0A 2C5LA 5JHGB 1LVGA 4YMSA 4V02A 4LYAA 1GNRA 1GG2A 3IGFA 3V4RA 1FX0B 1XTIA 3P4XA 2VPPA 1IXSB 2PMKA 2RGAA 1EFCA 3FMIA 4A8JA 4F4IA 1SHKA 1G18A 1HT1E 2WWHA 5FOTA 1GILA 4Q1DA 2QGZA 3KFXA 3OEEA 4M1MA 5BN3A 3W6OA 3QSYA 1TAGA 3U3RA 1L2TA 1Z0JA 4DDUA 1FW6A 3RWMB 3ZYCA 5J5CA 4LJ7A 3K09A 5B30A 3V4FA 1OHHA 1E2NA 4NP6A 5HKKA 2VP0A 5HPYB 4NYJR 1SULA 4BASA 5ANRB 1E79D 1UKZA 2WPDD 2WWWA 5GJCA 3WP0A 1E2LA 2J7KA 2OBLA 3IDQA 1VMAA 4Q48A 3B13B 4TMTA 5C4GB 1CF4A 2BCGY 1E2GA 4LYHA 3LVQE 3P1JA 2H8KA 1XCPA 2GCOA 2DBYA 3SNHA 2OXRA 1OXSC 3RABA 1SVMA 2BIFA 4UXJA 5L3SA 4HLQB 2VP9A 4NL4H 2Z4SA 1IBRA 4D0NA 4NYIQ 5HCNA 2FGKA 1E9RA 4DSNA 3SBEA 1XWIA 3VKWA 1W2HA 1ODFA 5JS7A 4IW3B 3A6PC 1YE8A 3A8TA 1CTQA 4IXNA 1W46A 3DKPA 3A1UA 2QM7A 4OBEA 4P32A 4GOKA 2WJJA 3UXMA 3WNCA 3KUCA 2E87A 2YWFA 3PG5A 1S3GA 3B2EA 4AKHA 4D82A 1A2BA 5FI0B 1Q1EA 4EPVA 4M9ZA 1KI4A 3VFDA 4DT1A 3B60A 3GFPA 5CM8B 4GP6A 3QKRB 1G3UA 3VQTA 1OYWA 4EPWA 1FUKA 2FN4A 3BFVA 1JPNA 2D74A 2WSSD 1HE1C 5LD2C 3EX7C 3CNOA 3QI2A 2VHUA 3TUZC 2XXAB 1KK3A 3GLIB 2QMEA 4JVLA 4DLZA 2VTKA 3HP1A 1QHHB 4R2IA 4XTCS 3H86A 1U94A 5SZHB 4CT4B 3AF0A 3TKLA 1XMSA 1EWQA 1OFUX 3UK6A 2FU5C 5E7JA 1BIFA 4B76A 5JLJA 2PZEA 2WVJA 2ZVQX 3TW8B 1TU3A 1KO1A 4Q19A 1R5BA 5GVSA 5HE9A 3I62A 1ESMA 3JZMA 2ZTSA 1JECA 4QKQA 2GF9A 2OM2A 3KKNA 1UKVY 1E2MA 2UZIR 3PQCA 1E79A 2WPDA 1W49A 3SOPA 3VU9A 2EYUA 4FMCF 2G1JA 2MSDB 3CX8A 2XTNA 3B1YA 3J81k 5JJKA 1G4AE 3LVRE 3K9GA 1LFDB 2H17A 4P4SA 4KU4A 2QL6A 1XMVA 2JAQA 4BLPA 3AH8A 3EWSA 2AL7A 3CF6R 3LO5A 1N6KA 4PO1A 4EFLA 1U8AA 2F3RA 4HUQB 3E5HA 2PLFA 1FMJA 3RSLA 2V1UA 4EPXA 4KYUA 3UPUA 3R8FA 2P6UA 4LV6A 1JXMA 1NMYA 3TBKA 3W9YA 2EU8A 1YZGA 2LKDA 1E96A 4NMMA 4A6XA 3M6AA 2ZM5A 2GWHA 5C1BA 3L0PA 4A2WA 4OK6A 2QZ4A 1EG7A 4DLXA 4NCIA 1W4RA 1NMXA 3CF2A 1KTVA 2WAXA 3SHWA 4LRWA 1NF3A 3F8TA 2IYUA 2YWEA 4OYHA 1P62B 3B7GA 3WRYC 3A4NA 3K0CA 4GMDA 1TF2A 4CEHB 2G0TA 4UXIA 1EFUA 1GWNA 2CJWA 4YMVA 2ZRPA 2ZI6A 2FJUA 2ONKA 3FMOB 1MO5A 2XNSA 2N42A 1ZU4A 4GP7A 2JLVA 4TYPA 5AJXA 3Q7PA 1ZD8A 1W0JD 1YZUA 3WP1B 4HAWA 2ONJA 1Z0IA 2AK2A 4TWZA 5JCPA 1IJFA 4LWZA 5E95A 2EW1A 1CLUA 3BORA 3MCAA 3TJZA 2N1BA 2HT6A 4PPGA 5FUVA 2QI9C 2LCFA 3TAUA 3FMFA 1HV8A 4MGZR 1P9RA 4QBGB 5KYKA 1OSNA 3Q5EA 2Q3FA 4TL8A 1YZLA 1R4AA 4Q03A 5CDFA 3RRZA 2MSCB 2BEKA 3PUWA 2FZ4A 4HB2A 2ZRFA 1T8TA 3KDSE 2XZPA 4JKYA 2R65A 4V0NA 3OEHA 1N5LA 4B33A 4DXAA 4N0EA 4KJZA 4JLBA 1P7CA 5HCIA 3LQRA 2ATVA 2NGRA 4LHVA 3QXHA 2VYFA 4D4KA 3OZXA 3EC1A 3SU8A 2OV2A 3CRVA 3GJXC 3UKDA 2QA5A 4R98A 4CW7A 4IVPA 2RHMA 2W6JD 2QORA 3PITA 4KCGA 2XZLA 1F6BA 1ZP6A 5BW8A 1GDDA 1FP7A 1ZC3A 2XJ9A 3SJZA 3QXXA 5E7MA 1CJTC 4OQLA 5FTLA 2CXXA 3MG9A 1G8YA 4F93B 4F4JA 1JR3A 2FFBA 3GLHA 3B8HA 2PEZA 4XWKA 1Z0DA 3QPUA 4NYMQ 1HTWA 5AUPB 2CEAA 1FNMA 2CL6X 3EZ6A 3LNCA 3ZIAA 1TU4A 2BMEA 5JEEA 1Z08A 1XPRA 4OI4A 1G3QA 2NTYC 1P2TA 1Q21A 4BLOA 3QPVA 4BFZA 1OH5A 1LNZA 3LLUA 1QG4A 1KDRA 4M9XA 5G3ZA 1G7RA 2WJHA 2ASEA 2GXSA 1SVKA 3D31A 4PTLA 1HH4A 4AKGA 1GTVA 2VH5R 3RRMA 2YJTD 3K70B 2RGBA 2AX4A 4GMXA 4NCNA 1BMFA 3HJNA 3LAWA 4ITRC 1MRNA 1U9IA 3DL0A 4HB4A 2O5VA 2WWFA 2NZJA 4WIAA 1ZCAA 2CMKA 4O3MA 1IONA 3QNUA 4C2UA 5AJZA 1D2MA 3OEED 3SR0A 2AHOA 5FPTA 1XXHE 2PLRA 2W2XA 1N0UA 3SE0A 4XWOA 4ACAA 4DJTA 1N6IA 1Z28A 3RLFA 3VR2A 3WBKA 2H1LA 1OFTA 5DNYB 1RYHA 4GSYA 3ZZ0A 2RGNC 3L43A 5E4FA 4D80A 1FUUA 3PV0A 4H1VA 4HATA 1LB1B 1UM8A 2G77B 3GJ3A 4WOPA 4NH0A 4R71A 3T5GA 2GXQA 2NPFA 1RFLA 4PC1A 3AVWA 3UATA 1XTJA 2CK3A 4B75A 1YU9A 2QPAA 2VF7A 3PENA 5L3QA 4XOIA 1RPZA 3KJIA 3AM1A 3CWQA 1NY5A 2RGDA 2ZI5A 1CJMA 4C0QC 2YINC 2GXUA 3LY5A 4DLYA 4QBIA 1OPXA 1ZBDA 1Z22A 2A5FA 2P67A 3FB4A 4JLNA 4Q4JB 4B32A 1QG2A 1PZNA 3OE7D 3UMSA 1R5NA 1FPMA 1KO7A 4L8GA 4MA4A 4ASUA 1SKYE 1NI3A 2FMXA 3V00A 2ZU0C 1Z29A 2CE2X 5TY0A 2QTHA 1YVDA 2GJSA 2W58A 3A1VA 4JSYA 3WNBA 3CPJB 4NYMR 5EUQB 1Z0AA 2KJQA 3D3QA 4QGGA 2OESA 2DYKA 2VBCA 3T35A 1NNEA 2BKUA 2QUZA 4HZUA 4TT3D 5E7IA 3A1TA 1NJFA 4KO8A 3KJEA 3GJ0A 3FFBA 2EFHB 2C9OA 4NU0A 1JI0A 1KMQA 1ZINA 3QVVA 2BOVA 4PAMA 3RS5A 2VRWA 2QQ0A 1ZM7A 2DFLA 2NO9A 1R0WA 3ADCA 1NVVR 1UEIA 1ZUHA 2GETA 3AP1A 2XOKA 3ZQ6A 3F5FA 2VHQA 1Z6YA 2CLSA 1IM2A 2QAGA 1B0UA 2YWHA 4BE7B 3A37A 2QRZA 1UFQA 2AK3A 1KKMA 2IWRA 1OT3A 4BLRA 2B8WA 4BRUA 4YONB 3WHKA 4QGAA 4BFTA 2BMJA 2ZRNA 1JQLB 1C1YA 5K8IA 5KSZA 1XDBA 2ZS7A 4JSTA 2DWQA 3FWYA 1IN7A 3LBNA 3P27A 3SBDA 1JEEA 1ZAKA 1RC8A 1G5RA 4Y0AA 2O52A 5FFMA 2CE7A 5SZKB 2W6ID 2WIBA 4B3XA 1T91A 1JJVA 1Z83A 4IRUB 1DAIA 4C0LA 4Y0VA 5JECA 4WA7A 2C9CA 2IW3A 4NCJA 4C4PA 5B58C 2E9SA 3LA6A 2DY1A 1G17A 3C5HA 1VYVA 2CK3D 4V03A 2WWYA 3PVSA 4HSEA 3PJRA 1UBGA 1VHLA 1A5TA 3KB1A 4B3DA 4C0JA 1CP2A 1Z2AA 4PO8A 1M74A 1RIFA 1SXJC 3IPXA 1PLJA 1JXOA 3RS4A 3CNLA 3EIQA 3BD9A 3EWAA 2GEDA 3K9HA 3QKRA 1RKBA 1P3JA 2AKYA 2QNRA 3QKSB 3JVUA 4LI0A 4RFSB 2FE4A 4TTQA 4UNPA 5FOWA 1Z5ZA 4DT1B 1XZPA 3FTQA 1G7CA 3GJ4A 4OK5A 3HYRA 2GK6A 4MYUA 4HB3A 4C30A 4AG6A 3SEAA 4EIWA 4JJKA 1DAKA 2O8DA 2B21A 3TW4A 1DPFA 2EFDB 2YC4C 5G41A 4M1YA 4UNRA 4RD6A 5A4JA 5JZVA 2W2VA 2HDNB 5LB2A 1GZSA 1KYIA 3TNFA 4OQMA 5CYPA 5KPDA 2WKPA 4EFMA 3X1XA 2ZIAA 3MAAC 1ZM3A 1EFRA 1W4CA 4BECA 4QBHA 2JJ1A 2ZYTX 5IDVA 2W0SA 4A9AA 5JBQA 1R0ZA 1ZRHA 3QKTA 3QXCA 4JBXA 1S8FA 2GZDA 2DFNA 3CF0A 2HT1A 1J70A 5GJVC 1YR7A 2XZOA 2B6HA 1QHXA 1SGWA 1W48A 4JLJA 5FBQB 1FL9A 4MRSA 1PJRA 2BKEA 4LGMA 2DWOA 3GLIE 3T61A 2QT1A 2QY9A 3EZFA 5D3MA 1KK1A 2RCNA 4LDJA 3NIBA 1TQ2A 1ANKA 3EZ7A 4HAZA 4KI0A 1GNQA 1TPZA 1X1RA 4DCTA 3ICEA 1XX6A 3DO6A 1T8UA 2IXEA 2OG2A 1NN1A 1R2QA 1P75A 1W2GA 2IXGA 2PX3A 1MOZA 3WY9A 1C9KA 2AFHE 2XXAA 4PAOA 1KIMA 4P4TA 4TMKA 1DG1G 4OHXA 1SXJD 5TVKA 2OZEA 4M9SA 3DOFA 3PFIA 4RCZA 1CIPA 4EDHA 2IC5A 4PC7A 4JBWA 1E0AA 3I5YA 3UG7A 5HTKA 3CPHA 5AJYA 4GDFA 1PVOA 3ZZTA 4DCNA 5FOVA 2FSHA 1G6HA 3RAPR 2ZYVX 1NMZA 2C99A 2ORIA 4B71A 3RC8A 5EXTA 1N5IA 3GJ5A 2PJRA 1GL9B 3AF3A 3EIHA 5JJLA 4DDWA 3SC3A 1XXHB 4AURA 1IQPA 1T9HA 1ELOA 1FX0A 2OUKA 3MJRA 1SXJE 5EE3A 1Z0FA 4HZUB 3W3ZB 4IEEA 1KI6A 3VR6A 4BPBA 3KTAA 5FR2A 1H8HA 4KVGA 4YQFA 2FSFA 1AKYA 3FHTA 5EE1A 2QMOA 4KFSA 1OXVA 4NCHA 3T1OA 2C9YA 2VO1A 4BLQA 3QF4A 1WCV1 4EAQA 1X1SA 1H8EA 1II8A 2BDTA 3P4YA 4OQNA 3T34A 1WA5A 1M7BA 3OFNA 2ZROA 1ONBA 3GP8A 3QE0A 1CBUA 4YXWA 3NH6A 4JKIA 2J7PD 2FGJA 2XTZA 4C0HA 3KKOA 2QP9X 1AQUA 1O87A 4P0TA 4G5GA 4H1UA 4WBSA 4QM6A 2R2AA 1GUAA 5F9HA 4G5QA 3U2QA 4JLPA 2GESA 2ZSAA 4TYYA 4NZYA 1W0JA 4H9GA 1EX7A 2WJVA 3LW7A 4ARZB 1VG8A 4PSAA 2ORWA 1YJ5A 2G88A 3NTUA 2W83A 3VNVA 4OQXA 4A0GA 3I1FA 4A15A 5EZ6B 4O2RA 3NEJA 3EARA 2VP2A 4RD1A 4XWAA 3JVVA 3NG1A 3SFVA 1U0HC 1XMJA 4ZDJA 2KI5A 5EXPA 2OCYC 5KO2A 1Z06A 4YMTA 5H68A 1G5TA 2AFIE 4HLUC 3X1DA 3AKYA 4OHZA 1CRQA 1NVUQ 1VG0B 2D7CA 2IBMA 2ZQ5A 1R6BX 3ASZA 3FKSD 4KBGA 1ZNYA 4LJ6A 1JR3D 3G0HA 1X3SA 3NEYA 5M04A 2RKOA 5DI3B 2JJ1D 1G8HA 3TVDA 5IHPA 5IK2A 1I4LD 3B9PA 4JL8A 1TUIA 4Q1CA 5TV2A 4AK9A 4OHWA 4DSUA 4TMZA 1PUIA 4EPRA 3EPJA 4MKHA 1E2EA 4LJ4A 2Q3MA 4Q4HB 2Z43A 2QP4A 2QBYB 2XSZD 1CR1A 1IN5A 3LRPA 3T5DA 3WBJA 4DLTA 2JEOA 3RHFA 4HEJA 1XTSA 4CEIA 1VIYA 1WRBA 1E9FA 3BH0A 4NYIR 2O8DB 1LF5A 2DCUA 3K70D 3R8CA 3HU1A 3QKSA 1X8JA 1BMFD 4FCTA 1N6LA 1G3IA 2Y8EA 2QRNA 1KNXA 4ABYA 1LY1A 2J3EA 2ZI7A 3PIRA 4HB0A 1V43A 4PSKA 4EJSA 1W36D 1GKUB 2YC2C 1O3YA 4HYYA 1GP2A 4FCWA 3GLGB 5FTKA 1ZC4A 3QEJA 4NTZA 4B34A 2ODBA 1KK0A 2ZJBA 4HAYA 2A7QA 3MSXA 3SZRA 4M9QA 2OO7A 3GLFE 4FD2A 1N6HA 4M1SA 3MGCA 3R9XA 3ZZUA 3C41J 4KFRA 3NBZC 4LPSA 4URVR 1GL7A 1X8LA 4US1R 1OXUA 1OH8A 4PQYA 4YDHB 4B2LA 1ESNA 3REFA 2BWJA 2A30A 2NG1A 5J4LA 1D9ZA 1EX6A 1NN0A 3CUEF 1CEEA 2FWRA 3BB3A 3T1VA 5JFGA 5BXQC 4KITB 4RD4A 3TQCA 4X8OA 3I61A 4KFUA 4QGFA 3EG5A 4AY2A 5DYIA 2JDIA 4OI2A 1U8ZA 4LJAA 4M8NE 2Q21A 1E0JA 3QF7A 4URUR 5EQTA 3CM0A 4Q4AA 4A8JC 1N6OA 1E1RD 1FP6A 3LX5A 4DDVA 1G6OA 3O8DA 4LK2A 4MGIR 5EUMA 3SJAA 4CEJA 4OK3A 2WIAA 1D6JA 4ZCLA 1ZUNB 3A36A 3BB1A 4QM7A 3ECCA 2AD1A 3NDBB 1XEXB 1ZIPA 2J46A 1S9DA 1GM5A 4I81A 5AUQA 3DHWC 2PZGA 2WAYA 3MMPA 2OT3B 4DUGD 2WJYA 2G0NA 4ZKDA 3U3KA 3TGPA 2WMNB 3ETLA 5FL3A 4RKFA 2BJWA 5FBVB 1D8TA 2A78A 3CRMA 2ZRCA 3IQWA 4HLDA 1G41A 1ZM4A 3EA5A 2ZRBA 4F7WA 3ADDA 5JMTA 1HY3A 1NVVQ 4XVRA 2A3RA 4N0DA 1SZPA 2RGXA 5F3WB 4IDQA 2WICA 3AB3A 2FFHA 1YZQA 4RSGA 2ZE7A 1S3SA 1CULC 5LPNA 1U0JA 1KSFX 4FN5A 4B48A 3NBFA 4MH0R 1NKSA 2P0EA 2YKGA 5TB5A 4LJ8A 4KXFB 5DO9A 5KSYA 1NSTA 3GLGE 3PUYA 4V0KA 2CLDX 4XIGS 2OLJA 3K0AA 2GEUA 1G8GA 1I4TD 4IFBA 3WMFA 4JT4A 1Q20A 2BMDA 2XTMA 3MJHA 3QEOA 1RVDA 5DHAA 4TMXA 4ESHA 2F1HA 3RYTC 4CF7A 2FV8A 4M1WA 4OHVA 5FOXA 4L5BA 3IILA 2D06A 4TQAA 4U5XA 4CIDA 1W36B 1II0A 1QHNA 3K53A 4DEYA 4AIIA 4TMWA 5JWHA 1T5LA 1Q1QA 2HJGA 4OJQA 3QENA 3W5JA 4HAXA 4KYIB 3THWB 1R7RA 1AM4D 2CL7X 2OILA 1TF5A 4MKGA 4RJLA 2F6RA 5F2EA 5B64A 2ERYA 2I1VB 4I1UA 3T1TA 2IYLD 2R6CA 2HCJB 3ND8A 1N0WA 2ZJ8A 3RS0A 5E3HA 3QG5A 1FFHA 1Z63A 1B23P 4QJ5A 1XMIA 2IS6A 3AVVA 3GFTA 4LBYA 3ZLJA 4DSOA 1COWA 4IXMA 4LHXA 3FFAA 3OEHD 5KNCA 4GT1A 3THWA 3CLVA 2J45A 2Q6TA 4A0FA 4TMVA 1J7KA 1UADA 3I32A 3SJBA 4MGYR 2W6IA 2H5EA 4D0LB 2B92A 4C0AC 2MMGA 1K5GA 1SKYB 4AYWA 3OIVA 2QROA 1OF1A 3S1AB 2HF8A 4TL9A 3H84A 3U60B 2QMHA 4P4UA 4DLSA 5TDHA 1AK2A 4G3XA 1KJZA 1JAHA 2F1RA 5KDLA 3RDPA 4Z51A 4G0NA 5UKDA 2JDID 1KSJA 3RWOA 4DC9A 1DELA 2HUPA 1NG1A 3CZPA 2ZE5A 2AD5A 2IF0A 2IYSA 2Z0MA 2MSEB 2QAJA 1XP8A 4JLMA 2CHGA 3KKMA 5FTJA 1ZMXA 1NIPA 1R8SA 2R9VA 2RMKA 3BERA 1E9DA 3I4LA 4FCVA 1H8HD 2O8FB 2KSQA 5AJVB 5LBIA 3THXB 2YNMA 1MO6A 1QDEA 2XAUA 3O8CA 1WBDA 5TXGA 4JL6A 2YOFA 3Q8XB 2J0SA 4BFXA 2H16A 5AUOB 2OXCA 4DB2A 1S1MA 1VPLA 4DRZA 4CZ2A 1G4UR 3DDCA 4KSBA 3VHXA 1E32A 1M7GA 3ICQB 5J40A 1KNQA 4KSCA 2C04A 3DZ8A 1MO3A 3DM5A 3QY0A 4FINA 1UBEA 4DHEA 1T4GA 5GJBA 1L4YA 2J87A 2X8AA 3GEIA 2ZYUX 3NVAA 1NKTA 1GSIA 2ZRAA 2WZQA 2REBA 3BAFA 2VA8A 5SZIA 4L4UA 2ZYWX 4BZXA 3BE4A 4LBZA 1J2JA 3NHBA 1ZVQA 3U7EB 3W6PA 2OFXA 2G3YA 3ZD7A 5K8LA 4MUBA 2BCJQ 4Q4LA 1G8PA 1P2VA 1F60A 1R0XA 4GBMA 1XF9A 4WXPA 2DFTA 2O0JA 1UKYA 1BH2A 4JVNA 5SZJA 4CYMA 3IIKA 2W0MA 3K09C 5DI9A 3U44B 1OH6A 2OFWA 2ZETA 4PHGA 3DKVA 1CS4C 4XTRA 3KQUA 1OW3B 3BS4A 4MKFA 3R7WA 2G9NA 2ZRDA 5KDDA 2WSMA 3MWJA 4DB4A 4W9MC 2VF8A 4JVMA 3TIFA 2VHTA 2RGGA 4L9SA 4MITA 3TR0A 1UF9A 4D81A 1KI7A 4EPTA 1U81A 4FW9A 4IKEA 4O25A 1OB5A 2W6JA 1JB1A 1P9WA 4LV8B 3AF1A 5J47A 5GADl 4XVQA 5BWMA 1KDOA 3AKCA 4IFEA 2DR3A 1YQTA 3BC1A 2VIIA 3BJIC 3G82C 4MRRA 1E2QA 1N6PA 1YZKA 3BWDD 2NIPA 5B2ZA 1S0UA 3LBIA 1UAAA 1RRFA 4QG7A 4CEHA 1AA9A 1XFAA 2KBFA 5CB6A 3BFKA 1KI1A 2GBLC 4IOLA 4JMPA 4OJKA 4PHTA 5C4MA 1HYQA 4XD7A 2O0KA 5EZ5A 3OAAD 2QT0A 4M1TA 5BQ5A 2XB2A 5AWFC 2GNOA 1T3HA 3Q3JB 1KO8A 4JVSB 2Z5FA 4Q02A 2K5UA 4Z1MD 5KNBA 1EK0A 1JALA 4I1OA 2BJVA 4URWR 3AGQA 1KZ7B 3N2IA 2OFOA 1G3MA 4G5SA 4PSVA 5EE9A 4MUAA 5EP1A 3E2IA 1JAIA 2EQBA 3X1YA 3U4QA 3NBXX 3IEUA 1UEJA 1DAHA 1IXZA 3S1AA 4Q4AB 4DBLC 1Z2CA 1ZIOA 3AVUA 1YRBA 2R8RA 2OBNA 4NE2A 5JSZB 3HWSA 4M53A 4BFYA 5IRCD 3EC2A 1Z6TA 2VL7A 3K1JA 1KSHA 4D6PA 1D2NA 2OAQ1 5H1YA 3RNLA 4ZCIA 2OLKA 3CKLA 5ELXA 3ZH9B 1G291 2J41A 2AWOA 3SYNA 1DS6A 5JS8A 2GVZC 5EXSA 1E9SA 1QVAA 1S9HA 1G1MA 2PJZA 4BRWA 2R6AA 4DCUA 4U02A 1E2DA 2C98A 2IHYA 2ZS8A 2IYWA 1D9XA 1XTRA 1XJCA 1QHYA 2P6RA 2CDNA 5IK2D 1SVOA 2V8OA 1D2EA 1Q3TA 3MD0A 3QPWA 4JLAA 2GZHA 2X19A 2AWNA 4AYTA 2V1XA 1AIPA 2FPKA 2ODWA 1KI2A 5J4VA 1MT0A 4M2LA 3TLXA 3QG1A 5DISB 3QOFA 4DWJA 4QJ3A 5H70A 2HXYA 4TL7A 2WJGA 4P33A 2F7SA 3IO3A 2JLUA 2ATXA 4HAVA 1Q22A 1G3RA 4ILEA 1VG1A 3D7MA 3DPUA 3PUZA 1OLOA 3H2YA 2DHRA 3FKQA 2B7CA 4QGHA 2YV5A 1TADA 4ZCMA 3KQLA 3ZJYA 3CW2A 4DCVA 1LV7A 2GJKA 2J1LA 4QJ4A 4A2QA 3THYA 2ZUBA 3BBPA 3LFUA 4DIEA 2BBOA 1KOFA 1ZCBA 1UPTA 4Z8YA 1DO0A 3LDAA 2QAGB 1AN0A 2LKCA 1UJ2A 5JCZA 1XB2A 1R5OA 2O0HA 3L0OA 3U6BA 5DHFA 3TSOA 2JIZD 2JJ2A 4RVCA 1AGRA 1CKEA 3KXIA 3I73A 4JJZA 1E2IA 4MDEA 5L3VA 4TYNA 2QE7A 1KZGB 4AWXA 1GVNB 1HQCA 5CJ2A 2FFAA 1HURA 1UBFA 1ZW6A 1KO5A 3HPQA 3TVTA 2JASA 4FIDA 4LX0A 4RD3A 4URXR 2P3SA 4QRHA 5DI3A 4XH9B 4D4MA 5H8WA 5CYOA 4Q1BA 2ECKA 1LS6A 1ZYUA 2EWVA 2XNDA 3SFZA 4DUGA 2XX3A 4R9UC 3CB4A 3I8XA 1NRJB 3NWJA 4LBVA 2BMFA 2BVNA 1XJQA 3EAQA 3FDIA 2VHCA 3KUDA 1NIJA 5G3YA 3VTKA 1GRQA 4MYTA 4B3CA 4QBFA 3GLHE 1YHNA 2BM1A 3BK7A 5CITA 5L3SB 4GNKA 1S4QA 4QNMA 5FBWB 2JLYA 3B1VA 2WWGA 4JYCA 3ADKA 2MMCA 1E1RA 4LC0A 4XD7D 4YDSA 2F43A 1A82A 3UANA 3HU2A 1KI9A 1RRGA 1MABB 1YZTA 4IJMA 3KB2A 121PA 1ZM2A 3CRW1 4MYCA 1MH1A 4LYFA 3QVUA 3CBQA 3RS3A 3UMFA 1GIAA 2IYXA 1ZM9A 1L4UA 5KOYA 1DE0A 3SDZA 1XCMA 3SI7A 3FYHA 2FA9A 3CX7A 3QKUA 5KSOA 3WRXC 4PQRA 4MRNA 2XOKD 2ODNA 3T06B 3EASA 1KDPA 4A8JB 1G7TA 3W90A 3TSWA 2R6GA 3VU9B 1TQ4A 2FPLA 1DARA 3LV8A 1XEWY 3WNDA 3QJYA 1Z3IX 2ORVA 4JT2A 3PXGA 2ZSEA 5EXXA 4B74A 3CRRA 3U6KA 4BUJA 2FOLA 1Q1ZA 4PFSA 3NH9A 2ZITA 4M21A 4L15A 5FUXA 5FBRB 5KPJA 1XXHA 2J9RA 1BO6A 3ZS9A 2WWIA 2CCJA 2JIZA 3IO5A 1YR8A 1A4RA 4KLZA 2YWGA 3R9WA 4F92B 3K9LA 1OXTA 1YR9A 5FTMA 2VQSA 1DAMA 2FPMA 4B2PA 4GFDA 4F38A 3AVTA 2WM9B 4PPFA 1IY1A 3K0FB 1X86B 3QQ5A 4NDZA 3R7WB 3GPLA 4ZDWA 1IY2A 2GVDC 2YVUA 5DYGA 1HEIA 2ZJOA 1KY2A 4IVQA 4N3NA 1E1QD 1G8FA 3PEUA 4M1OA 3N70A 3UIEA 5KDOA 3CR7A 4NKRA 4ZPXA 2FFQA 3BRWD 1UBCA 2YOHA 2RGCA 3B9QA 3QIAA 4PO9A 4X8MA 5DN6A 1MABA 2JLSA 1Z47A 2QU8A 5FR1A 5L3RA 4C0KA 5GVRA 4ZO4A 2HJVA 2ERXA 4D26A 1Q0UA 2ZRIA 4BFVA 2ZSBA 1S2MA 2IF2A 1P72A 2NZ8A 4Q1AA 5FBLB 1WP9A 2BM0A 4Q1EA 3NHAA 2F43B 2GF0A 1LS1A 4D4LA 2QAGC 2IT1A 3Q85A 1W5TA 4CT5A 2NOAA 2X2FA 3DOEA 3HU3A 5JRZA 4PPNA 1COWD 3AVXA 4JLVA 2C78A 1HA3A 2ZJAA 2GCOB 2QPTA 1EESA 3ONWA 1NLFA 5DE3A 1M2OB 1G9XA 2CHVA 3AQ4A 4MRVA 1PLLA 3PEWA 4ARZA 2ZI4A 3U3MA 1VECA 4ZI3A 1EGAA 1QHHA 4D0GA 3C4JA 4P31A 3VKGA 1AZSC 4G1UC 4ZDKA 4BLSA 2Q3HA 1IN4A 1NBMA 4Q18A 4E03A 4E09A 5C2JB 5F9FA 3B6EA 2VHJA 2JJ2D 3U3OA 3T15A 2KWIA 3U4QB 4PZLA 4DKXA 4TQUS 3C8UA 2V54A 1FZQA 3OIYA 4Q9KA 3BXZA 4QXAA 2GDJA 5GJWC 1VHTA 1J8MF 2QE7D 1AJEA 2PT7A 4Q66C 4W7SA 2RH5A 3SYLA 5CDFE 4IDHA 3MRSA 4TSFD 4JLDA 3THOA 5A5GA 2RB4A 1U8YA 4LHZA 1VG9B 3CONA 4CEIB 4Q01A 4LJ9A 4S2EA 2P5SA 2OCAA 2QTVB 3GLHB 4TTRA 5KNDA 2V6JA 1OIXA 3BB4A 5CB8A 2O8BB 4JBYA 1II8B 4XJXA 3TUIC 1KAOA 4HDCA 2QSZA 1ZU5A 4M4SA 1JR6A 2GBLA 1BYUA 1RRCA 4IEIA 2AR7A 2FSIA 1AGPA 5HKKD 1LW7A 2W2TA 2FG5A 2QP3A 1U90A 2GK7A 1RJ9B 3AVOA 2IUSA 1E2HA 4HUTA 3KXLA 4LUCA 2JCSA 3A1WA 1CJVC 3HPRA 2D3WA 3IIMA 2B7BA 1CRPA 2DPXA 4Q9LA 3CWZA 1S96A 4WZAE 4GZMA 3A4MA 1H65A 2WWXA 2BEJA 1DG3A 5KSPA 1A1VA 4POAA 1M34E 1JR3E 1BS1A 4ASUD 1IY0A 1G5PA 1XTQA 2WBLC 5AUNB 2V3CC 3KJHA 2FSGA 2F1IA 1IAQA 1XNJA 5JSZA 2HLDD 3FE2A 1KMHB 4M0LA 3AVPA 3C14C 2GAOA 1MV5A 1YZNA 4FMDF 3AF4A 2FF7A 1VCMA 2D2EA 4MDFA 4D4JA 2VSOA 2JA1A 1NSFA 4AI6A 1Z8FA 4A82A 1FMLA 4V0ME 3W5IA 5CIQA 4IDNA 2ZPTX 4LJYA 3RRNA 2HLDA 5FPYA 4AG5A 1IHUA 4IHQA 4B3FX 3B78A 1W5SA 2NO7A 1BKDR 1A7JA 1IXRC 2R62A 3OF5A 5KTYA 3UWOA 1P73A 1SVWA 5EE0A 3ZQJA 4LJ5A 2B8TA 1K5DA 2J7PA 2ZE6A 2ANBA 4DIDA 3M4YA 3RS2A 1GKYA 1OJLA 3KL4A 3CR8A 3K8YA 4FMDB 1T6NA 3EPHA 4A2PA 2H57A 2PEYA 5J4KA 4U00A 4QC2A 1G7SA 3GLFB 4Z8XA 2FDCA 4AKIA 2VLIA 1CJUC 5IT5A 2VP5A 4LBWA 4PZYA 5IF9A 5DLQC 4TYQA 1XD2B 4QOSA 4LC1A 4MQBA 1FOEB 2H18A 4IOJA 2UVQA 4QHTA 4C9BA 5KUTA 3N2EA 5FUYA 2WOJA 1R0YA 2ZANA 3WMEA 4ZKEA 4G01B 4GOJA 5AK0A 5CIWA 1F3OA 2EFGA 5FTNA 4AYXA 2WMOB 1EFHA 3PCRB 8OHMA 2XB4A 4I1VA 2PCJA 2WTUA
chains in the Genus database with same CATH superfamily
5DULA 4AX4A 2EVWX 1H1LA 4BLUA 1XEWX 5FB3A 3ROGA 4F72A 1PQUA 1ESCA 2C7QA 1IY9A 5K2MA 3M3DA 4W5WA 4WLNA 2AN3A 4BZZA 1UBJS 1FUEA 1RLIA 3FR8A 3HVUA 3K94A 2JVKA 1K7FB 5B3KA 1Y5LA 1KQPA 1B6RA 3VH2A 5D3QA 3TDNA 4MKRA 4UUNA 3TBFA 3IV6A 2FUCA 4UKDA 5FNVB 2JH9A 3RBZA 3D2BA 2IPOA 3E5MA 4HQLA 3CNNA 5JI2E 4NE9A 2D6FA 1ZO8A 4OI0A 4EA8A 2E6UX 4BFUA 4PZCA 3HCPA 5BMVF 1LPBB 3TE6A 2DUWA 2QQ5A 3VNAA 2IX3A 1SC9A 3IAXA 1AS2A 2CXPA 2A86A 4NENA 3AG5A 3PB3A 1XCGB 2C0PA 2JFQA 3AP3A 4RTKA 2D2VA 4WAUA 3MIIA 2HJRA 4FYHA 5K7SA 2FUNB 2IH2A 4GF5A 4A2CA 4GOLD 3EISA 4PLHA 2GPJA 3WGIA 1KP9A 4MW6A 4QHSA 4WDRA 2PWYA 1D6NA 1F2TA 2C4TA 3EQ9A 4PCVA 4PHFA 5D7BA 3UJPA 3ZCSA 1NGSA 5U9CA 2WI8A 2ZR0A 2FRDC 4H59A 1M72A 5FI5A 4Y9SA 1Q84A 1VMEA 4G36A 5EL0A 3V9PA 4C22A 4CKBB 2IEZA 5KQMA 2O8BA 5IJ9B 5JDIC 4GOMD 3T7TA 3BZBA 4IFTA 1PG5A 3LYUA 3MJVA 3H2BA 2V6IA 1NZDA 1R66A 1QH1A 2QRVB 3PQDA 1E3MA 3PEYA 3GLIA 1OUMA 3E3AA 1QF6A 2W7TA 1R4MA 2BFEB 1S1CA 3CG0A 3FCSB 3A4LA 4Z3OA 1UJCA 4FFMA 1P4SA 1EQAA 3JWIA 4EMBA 4AKSA 5JJCA 3ZWDA 1U6IA 1IZYA 1J90A 4OM8A 1TZJA 1KYWA 2I3ZA 1DZIA 1O96A 4RZUA 4CF5A 2ZR8A 1TYAE 1Y6QA 4N40A 1FU4A 1NVFA 2VPXA 2FW9A 1C4OA 2COEA 4J16C 4HDOB 4I6EA 4NOKA 4KO1S 1KI6B 2GYVA 2J0EA 5EE5B 4UC0A 4B47A 4WOJA 3N2ZB 3RHZA 3TD2A 3MINA 3QX9A 4GI7A 1DBQA 1RBYA 2FPUA 1UP4A 1OI2A 2P6NA 3IUMA 4MUXA 4R1OA 2I1WA 2GK3A 3UK2A 1IVSA 4YRQA 1X1BA 4PQFA 2WSYB 3MXTA 4I6GA 4BAZA 2A0YA 1ZKDA 3R5KA 3W79A 2EZ8A 3N8IA 4AC9A 3ZIAD 2G72A 3IDSA 3QXSA 4KXWA 4YCSA 5CLIA 2ZI9A 3IUYA 3STUA 4EABA 3OFND 4OHCA 4LK3A 3ZHUA 4GKJB 3NXSA 1QHIA 4R2HA 5IASA 1JQEA 1CY2A 4M0FA 4MUEA 5MFPA 2F55A 1SXHA 3UPTA 2XMZA 3VO1A 2AUTA 1HLDA 1L7BA 3KEMA 1RQ7A 2IEDA 5HJ5A 1JAYA 1DKQA 1JE1A 3CXRA 4HMPA 4TRNA 4UEOA 2R6R1 3QMPA 4AJ4A 4NV3A 1GXSB 1NAHA 4L2IA 3S68A 2IDKA 4Z5XA 3HVIA 1US8A 3MTGA 4U2BA 3T38A 4CM8A 3D4IA 5F7ZA 2LV8A 2E82A 2H2FA 3UG6A 1MX5A 2G83A 3EUEA 1YQUA 2C84A 1OA1A 2WFAA 2VBIA 4V2IA 3WYNA 1HE8B 1AQYA 2JANA 2RHGB 3BH6A 4M38A 5A2GA 4EATA 5IXYA 1AKWA 1ZJ6A 1YBVA 1C2TA 3E18A 2BUAA 5ADUS 4RNDB 4I4IA 2DUJA 2DMRA 3H9BA 1ZMBA 1LKZA 3Q3GE 1I6MA 4HDKB 2WJIA 1KJWA 1RAAA 3GRCA 3DEFA 1WVGA 2PQMA 3D8RA 3LPDA 2BBWA 3DE1X 2QTAA 1UMCB 1YKSA 3RHTA 5AJWA 3V4LA 4ECEA 3PHBE 1ZZEA 4B6EA 3GEBA 3DLCA 3S2IA 1LK0A 1EHCA 2HOQA 4R51A 4KUEA 1UXGA 1X7ZB 1CUWA 2IV7A 2FPSA 1R4ZA 2X4IA 4K3UA 3JZDA 2G9ZA 4OAQA 4OXRA 5LB4A 4D8VA 1S7GA 3IVCA 3ZVRA 4AD8A 1QIKA 2PZFA 2QVYX 4TN1A 3TCXB 4RCYA 3T7DA 2H1HA 2PD4A 3G0BA 5C5DA 3Q7QA 4F6RB 4WH0A 1V0JA 3Q5GA 4LVNA 3VPFA 3ER8A 3IV9A 2FPGA 4JZKA 4V0LA 2ZBDA 3BHIA 5EWMA 3H9CA 1IBCA 1SQSA 5ALQA 1WR8A 3U4HA 4ZHQA 2WEKA 1OROA 5FH9A 4HH4A 4BXOB 2WOOA 2CJWB 2NYUA 3K30A 1V5GA 4AIRA 2Q9CA 4JP1A 4L5JA 5MHTA 3GGPA 4MYRA 2C2HA 3AU9A 2ZQZA 4TTAA 5JQWA 1MAVA 4FT4A 3E53A 4JUFA 4RLFA 3U40A 3SEFA 4NBLA 4IMIB 4RIEA 2XNCA 3R0JA 5DCYA 1PLKA 1SJ9A 1V5FA 2BTQA 2EHJA 2JLXA 1DO2A 2PRSA 3HY6A 2ZJ3A 5B57C 1M1YE 1Z07A 4L4ZA 3VA7A 3S70A 4M0EA 1P0CA 4R9RA 2FG7C 1QJ4A 4RFSA 2HXGA 2XYHA 2J0UB 5J5VA 3PGXA 4NCKA 3VMMA 4XCXA 3VX3A 4B2YA 821PA 1CQIB 3JQAD 4XGRA 3DWGA 5DSZA 1CDZA 2BFDA 4ZI7B 5CT6A 2YYAA 5CDUA 1LGYA 1FVOA 1PK7A 4M98A 4CV1A 1E4EA 2WDPA 2HO4A 1RZUA 5HDBB 4NG5A 1TJPB 1L5SA 1RQNA 4YQZA 4F3NA 2H7CA 1ZSVA 2IZ7A 3KV1A 2HYDA 3VR5A 4JYBA 5CH5A 1XZQA 4EP1A 1PZEA 2I3AA 3MC1A 4RK4A 1DC5A 1UAGA 1ZH4A 3ETCA 3GCDA 4R2JA 2QMUA 1GR1A 5DXJA 4CE6A 4EG8A 2X0JA 3DEHA 1T9BA 2P2LA 3KC2A 3RB8A 4DVJA 3OZFA 4Q21A 1Q7RA 2IIQA 1WDKA 1ZGJA 2VHZA 5HQTA 1E6WA 2QLTA 1P2SA 4URZR 1K08A 4HQ0A 1GUYA 1GSHA 1P4JA 2WW8A 4TKLA 3UQZA 2VSXA 2B9VA 3BOSA 5EGNA 4E15A 3KTDA 4TN5A 2LR0A 1P60A 4K88A 3H16A 1VCOA 3FETA 3CZAA 2IUUA 2JA2A 1UDRA 2VPZA 1TKBA 4P81A 5FWXB 3VYWA 5AM4A 4W5OA 3QM1A 3NBKA 2G82A 4PX5A 4QOEA 4EKDA 1T3LA 2YRWA 5AK5A 5MGNA 1WU8A 2BBTA 3KOYA 4DLBA 3GCXA 4TS3A 5EJGA 1MVOA 4Z1MA 2GAAA 4CMCA 2PCLA 1NYTA 1RHKA 3JWJA 1CQXA 2B2XA 2YX1A 1Y7IA 2FEXA 3MWLA 4UM7A 4ZQFA 5HOEA 4IEFB 2XCOA 2GAJA 3I9V1 4WVFA 2F1KA 1EFRD 1JHRA 4REMA 1XVIA 5AKHA 5I6DA 3QOXA 1V4BA 4JNCA 1EGHA 1EPUA 3D3WA 3R44A 1ODKA 1R00A 4FXPA 3OZAA 4GBED 1PNRA 2FP4A 3KPVA 1RNLA 1MRSA 1JLMA 5D2CA 5HDQA 3CNEA 1OFHA 1ILEA 1NMSA 1OI4A 1GITA 3KYDB 3QVTA 2H1VA 4PZZA 3LUJA 1DRJA 4MUIA 4X54A 3GLFA 2GZ2A 2CBGA 4Q82A 1E8DA 1BOFA 4HXYA 5AW0A 1QQTA 3BXGA 1J9EA 3EGXA 4LTDA 4RVFA 4HNUA 5JSUA 2OFPA 4KV7A 2NU6A 1WE2A 3DEJA 1QTNA 3I01A 2GN2A 1M2VA 4KE9A 1XCOA 2O1EA 1PQYA 1DO8A 1PT6A 1XRQA 2GTIA 3I28A 3IC5A 1W4BA 3BD6A 1MFZA 3DVAB 4RY2A 3RU2A 2A5GA 4KIGA 1LDMA 3HM2A 1M2NA 1FFXB 1QBKC 3RU7A 1TQDA 2ZS9A 5CT5A 2ECPA 2RARA 4EKNB 5KYWB 5DTMA 5EJEA 4M1KA 3OLWA 1FYXA 3JQAA 3KQOA 3IALA 1QE0A 4UE3S 3I9OA 4NRDA 3G13A 3PR1A 3FNRA 3FFWA 1Z6AA 1Q0ZA 1Z5UA 5K0SA 4Y98A 3WQQA 1X1AA 1KL7A 1QZ3A 3NWPA 3EAFA 2DPLA 4IZHA 2NVUB 4D8TA 2B6NA 3WVNA 2YXDA 4HGQA 4WKCA 1GLNA 5K51A 3IMFA 1PJ2A 3F96A 5F98A 2VWPA 3U7GA 1RI2A 4X8LA 1NPYA 1T4CA 2V9CA 3NLLA 3SG0A 1KGDA 3IT1A 1XD9A 2BC9A 3BFXA 1NT4A 2JFNA 5AICA 2Q29A 3LCRA 1IPEA 1Z6XA 4IICA 3TZLA 4M54A 3Q2IA 3JRWA 4PXSA 1X2EA 2GZAA 4N01A 5KYYB 1HR0B 4WBNF 4C2TA 2ONZA 1M1YB 3BMNA 3AF2A 1TCCA 1PJAA 3MJ4A 2V7VA 4M8IA 4MJXA 4RANA 2WHEA 1I6KA 3BHMA 4N54A 3M83A 4L74A 3S8MA 3VX4A 5I45A 3FDXA 3RVPA 1Y9EA 3U5TA 1E3JA 4HPXB 3A32A 2JFBA 2W5UA 3LFTA 2KMLA 5IUJC 1TJ5A 4BQRA 4YXWD 1YE3A 3QMMA 4GX2A 1VI6A 3IXMA 3V1YA 5BYKA 1WO8A 3GL9A 3K7EA 4H0NA 1D3AA 3FUUA 5EJIA 1R10A 1F20A 1HDCA 3KEQA 1R18A 3KKQA 3OM0A 1KDVA 5CCXA 5C8ZA 2WAOA 2ABWA 2FZCA 2OFFA 2LIPA 3RG2A 5JATA 4JI6B 1BW9B 5CDTA 3M4ZA 1POXA 1U9IC 1PK9A 3THXA 1BXKA 4CM5A 4POOA 5JDIA 2R4TA 2PWZA 1G9SA 2CSUA 2DFDA 4ALIA 5A9TA 2GHRA 2WKRA 4J1NA 4YXFA 1ZXLA 1ZVVA 3NJRA 4BO7A 1G20E 3LBHA 2F1JA 2CFIA 2VDWA 3TLJA 3ZNPA 4IOMA 1A97A 3O3CA 4KBFA 3JW8A 4E7OA 4IX9A 2AXEA 5A05A 3AJDA 3SZMA 1NW7A 5IKEA 4EJ0A 1PT7A 4PM4A 5EZSA 3WIDA 1H2ZA 4JLKA 2WF7A 3BGVA 3FMPB 2PV7A 4HMOA 1ZS9A 4ARSA 2H65A 3VYVA 1QIGA 4UNQA 2A0FA 4J16A 4YUXA 2QMQA 4ZI5A 5KYUB 3KK0A 5IFLA 5FL7D 2QX7A 3TWOA 2GHQA 4A0QA 5CK4A 1E7RA 4KG7A 3LCJA 1P81A 4PGGA 4MXDA 3V4OA 5I9NA 4ZHQF 3PP8A 5BQPA 1CERA 5IBQA 3ND7A 3T5PA 3LYHA 4RGYA 3GEGA 5BUZA 4TLEA 1B2LA 5CH3A 3MOSA 4PLZA 1TTHA 1TA4A 4C3VA 1JA0A 3I23A 2WUEA 1Y3IA 1SD5A 3L6EA 2TSYB 2YS7A 2R8BA 2BGMA 2YYZA 3GMTA 2ODPA 4BQSA 2PZ8A 1VKJA 3CPEA 4Q7JB 5AI6A 4WZAA 1MHTA 3VC3A 1P6XA 4F4UA 3EXHC 1JBKA 2GUGA 3RU9A 4HKTA 5IVIA 3BD7A 2DF8A 2H6EA 4DEXA 3IAHA 3FYUB 1PNQA 3MF4A 3AL0C 4BO5A 1EDBA 1JHOA 2HA0A 1ES9A 1WKVA 4FFLA 2NVBA 1XJ0A 2GRJA 4FYKA 1HZJA 3HMQA 4FT2A 5DH9A 3SSOA 4DQ0A 1XRJA 2I8CA 3OAAA 4TZ6A 2FSPA 4UM9B 4CKCA 2V0GA 3BK2A 4ZOLA 2HCBA 4WQMA 2LW7A 5FPKA 4EHJA 3D9QX 1ORWA 4JB0A 5B2FA 3W9BA 3DG9A 1S3FA 2ZP1A 3OE4A 3FX2A 5DB4A 2BR4A 4GNRA 1E1NA 2P6PA 3LKDA 4X84A 1Y42X 5CLQA 1PEAA 4JOSA 4X9XA 4FZ3A 3VBEA 2B5VA 2J09A 3QUSA 5BNTA 2RD2A 2ZATA 3K0CC 1ZGAA 1IXYA 2Y1CA 2ZEJA 3N2YA 2NTVA 1VGQA 2PO7A 2ZRMA 4RZ2A 1JLKA 5FWDA 4JI0B 4RPKA 2C03A 4UULA 3C4VA 4NXNB 3CW9A 2AF4C 2Q3LA 4B0OA 2R4QA 4DRXB 3EXFA 2IGBA 4US2R 2KBEA 1NULA 1V3QE 3I2FA 4MVJF 4N49A 3UJHA 2ZT8A 3QX7A 721PA 2XVYA 2P9GA 1FBTA 1ORIA 2I9PA 4Y2UA 1E2UA 1T9AA 2R6JA 2VDRB 1RRKA 3GFGA 3IEIA 2XHZA 4TMYA 3U39A 3WGHA 3DZDA 2Q5LA 4G67A 5JXHA 3HWWA 2X2PA 3HN6A 1E2BA 3OCXA 2WTNA 3DDSA 3GJ6A 4C0SA 1UOQA 3ADPA 3FZEA 2JGIA 3GNTA 2NMVA 1XZIA 4D9MA 1MAHA 1ZFNA 2QM8A 5IPFA 1ZD9A 5I7UA 4YRSA 4QQFA 3OIWA 1BH6A 4QPDA 2GCNA 2L69A 3VGPA 1MXHA 4B46A 1PR4A 1WPRA 5J23A 4XUDA 4C08A 2DQZA 1H94A 3D7NA 1ULUA 4HWRA 3BILA 4QPNA 5REQA 3I9JA 1SELA 3FSRA 3L8GA 5JTTA 4Q9DA 2A4MA 1WEKA 3TXYA 5I7WA 2YJ6A 3RH0A 1WCIB 2OG1A 4YR9A 3V3TA 1TLFA 5T8KC 5KJ1A 2OAGA 1CEQA 2XOEA 3GOHA 4PPYA 4X7PA 3C3YA 5B36A 3VJRA 3MWGA 2PKQO 4K87A 1CRWG 2PWPA 3PXDA 2JFHA 3ITNA 4ID9A 1C8KA 2JBAA 5CDGA 3M1IA 2NVWA 2H2IA 2FWNA 3R3YA 4DREA 2PUEA 4GOXA 4QT0A 4WBXC 1OWLA 1SBYA 4AF7A 3RS7A 4N82A 1PFGA 1T29A 2O8EB 2VJOA 2TS1A 1QRAA 3CBGA 2GEBA 2YV4A 3W3AA 2Z1DA 4UMDA 4ZZ2A 3REQA 2DPMA 4B6OA 2WQ6A 2H7VA 2ZUCA 3ROKA 5EA2A 1B2RA 4AMGA 4HQRA 3VGJA 2CCKA 1W0KA 4ZZ3A 1D8AA 1Z35A 1T5OA 1Z6GA 2OECA 3N8KA 4PY2A 1P2UA 5L7YA 2FCRA 4UBNA 4YALA 3N5CA 1KRWA 2B4YA 5J4HA 3FOFC 2YYSA 5I7RA 1YKGA 2YMMA 1JJ7A 3LOUA 4I36A 2H92A 3MERA 4MS1B 2BLNA 5DX1A 3RF7A 2EAUA 1Y6FA 3U3KA 4YMWA 4BZPA 4LF5B 5BYAA 3KSMA 3QU4A 4N1AA 3W34A 5HZKA 1ISGA 3ZE6A 2IYZA 4WV3A 5E2IA 2IU3A 3I1JA 1L7DA 2XYVA 4LPKA 4JODA 4CKWB 1EB8A 1P4GA 2QYHA 3PI7A 4HXFB 4JUCA 4GPTA 2FZGA 5FBHA 4OHBA 1BGVA 1L5HB 1I0ZA 2VHWA 4P84A 3SX4A 3VR4H 4E2YA 1JNYA 3D6MA 1JBEA 1JZTA 2X7HA 1JP7A 4HWGA 3LECA 1VPWA 3DVLA 2P4UA 5HR5A 3LM8A 5HZHA 2PH3A 5A5FA 1RWKA 2ZIGA 3EDRA 3K0EA 1O9HA 1F2TB 1FQJA 1MO4A 3FPGA 4JASB 4FW8A 3WGMA 1RBZA 4HNQA 2J48A 1KH1A 2EERA 1YOVB 1JQKA 1KJYA 3OHSX 3A1NA 3OESA 2FN3A 3RRFA 3DZFA 1XN4A 2N47A 5D00A 2RSLA 4Q00A 5GM2A 1GRRA 1YFJA 4HNAA 3L4EA 4UQLA 1HDRA 2A9KA 4ZVPA 2VQDA 3SICE 5A4IS 4NG4A 2KX7A 4ZI2A 2BI8A 3UMYA 2X1VA 3UMGA 2J5XA 3L5OA 4BMXA 4ENPA 4DARA 3CN7A 2BEUA 3D0RA 3JQ8A 4DM4A 1GYRA 3IEVA 2QXYA 2HTFA 3N58A 1ZEMA 5JRDS 4K7JA 1GV0A 5L45A 3H6HA 1Q3KA 3U81A 3QVMA 3UQYS 1ZLXA 4FJ0A 1TTTA 1LI5A 2IYQA 1OI3A 1DADA 2WYHA 3WA6A 4F1KA 3ZVNA 4Y8VA 4U0JA 5EKXA 5C8YB 5LQKA 1DP4A 3FPFA 1VCIA 3TR5A 3ZVLA 2AQKA 1TEZA 1G2OA 2GSDA 3GCGA 1XEFA 4YCDA 3BDAA 4DA8A 4ER3A 2R3SA 2R66A 3HWX1 4HGRA 2IS1A 5LDDC 5I7VA 3U61B 1WBBA 4J29A 3LBYA 4C5AA 1XL0A 1FLVA 4RVUA 2WNHA 5CPFA 1TRKA 2FETA 4H6XA 1XU4A 2AOUB 1SEVA 3C6QA 3FHLA 3O93A 4UJ3A 3DM9B 5HX7A 4MGKR 1YS9A 1DAFA 5JH7F 2F9MA 2ZUFA 1D4FA 1N5OX 2DB3A 5AKYA 4RIIA 4TLDA 3AP2A 1LLFA 4C3ZA 3C3WA 4CKWA 5ITWA 2P4QA 3K4HA 6REQA 2YUIA 3P0FA 4RWZA 4M0CA 3PF9A 2R0QC 2IDJA 4Q9AA 3PZBA 1KSGA 4F1JA 4TZ0A 1W8IA 2ZREA 2UXDB 3AUXA 2YWCA 4FBGA 3TMKA 1A8IA 3HVRA 4FNGA 3FNFA 4B2IA 5JO0A 2B98A 3P9PA 2PE5A 1DIAA 4WCVA 3VR2D 1NJ1A 3T4UA 4FS3A 3LI2A 3E9EA 1FX0B 1TXGA 1XTIA 2R1VA 2VPPA 2YJ3A 2KW5A 3N28A 3DEAA 1YASA 3T3OA 1U4OA 2WYVA 4JYPA 1KEEA 3BFJA 3WYEA 4BNVA 4F4IA 1NNI1 2WWHA 1HT1E 5DHUA 1UZUA 3WAKA 5D7NA 1GILA 2BL4A 2DSTA 1RYZA 3NHUA 3OEEA 5LFAA 1L0BA 2XBLA 3KOUA 5ES3A 3GP5A 3PPXA 1VPTA 5H9WA 1WD5A 1ISHA 2NZYA 4PG8A 3V8EA 3VU8A 3G2OA 1CK4A 1E1KA 5ECDA 2VPYA 3FSGA 4AUKA 1FW6A 5LIRA 4INZA 3DYVA 5B30A 2HH9A 3LO8A 2EJUA 3OMXA 4KXQA 3U17A 2LTAA 3ZQKA 3HBJA 5GV7A 1FS5A 4EECA 5CA0F 1E79D 1ODTC 2JPDA 1XZMA 2R5WA 1VMAA 5C4GB 1CF4A 4NBTA 2C4NA 1ISFA 2H8GA 4LYHA 3ZE2B 4D56A 1N92A 4WZAB 2MDTA 1AHIA 3P1JA 2H8KA 4AMVA 1XCPA 5FO0A 1OX5A 1TT7A 3BIXA 3I58A 3RHSA 3QVLA 2P3QA 3P9XA 1GZ5A 4OFBA 3RABA 1AMNA 4LNAA 1CZHA 1ULZA 5FUMA 2H1CA 2XVXA 1YSCA 4WFIA 5DM60 4O4JA 4D0NA 2CZCA 3VOTA 3BHNA 1EU1A 3H1PA 1E9RA 5HCNA 1O0CA 1T10A 1WB4A 4IG4A 3VKWA 3ULKA 5IZCC 3FAZA 1IMOA 3FAKA 2X41A 4OSEA 1EZ4A 2Y1GA 1B8PA 3TTYA 1YE8A 1RYMA 2NAFA 3A8TA 4MW5A 4IXNA 2YCBA 3AWDA 4CTNA 2GBCA 1LVHA 1USKA 4KGVA 2V8BA 4ALJA 4ER6A 3BMXA 3GBSA 1KWKA 4OBEA 4ZN6A 3KT0A 4GOKA 3I37X 1M6YA 1PCXA 1Y4ZA 3NV9A 2FSUA 1RWMA 1UKAA 2UVPA 2E87A 1UBNA 2BI7A 3PG5A 3TFQA 2DX7A 3B2EA 4I1IA 2PUVA 5DHSA 4ENQA 3PDWA 4F9EA 3TQTA 5JPCA 4ESEA 3DAHA 5C32A 3H9JA 3TL2A 4LMBA 4DT1A 1XMOB 2AMJA 4CLEA 4Y6PA 1V7ZA 4GP6A 2W2KB 1G3UA 2GF2A 2V7BA 3O1LA 4B3IA 2FLWA 3PFGA 4Q39A 1FUKA 3AUUA 1FRVA 2Z9CA 3AY0A 3BFVA 5TE9A 4V0RA 4Z3DA 3PDJA 5ALVA 5JV5A 3DSRA 4HBZA 2I6TA 4PONA 3NANA 4GU5A 2LIVA 4X97A 4ZYLA 1DKRA 3V1TC 4CT4B 3E9YA 4CDNA 3NRBA 1PWZA 4J2HA 1AO3A 3AF0A 3RCBA 2FWAA 1I33A 2G67A 5FHQA 3PC7A 2Q45A 2FU5C 3RGWS 1AT1A 4NCBA 4B76A 4BNGA 1ORHA 2SCUB 2ZVQX 3AEKB 3MTDA 1TU3A 3PT5A 4S1WA 1FFGA 4TV8F 2Q7DA 1Z13A 1FUIA 1UBTS 3U4IA 3B3GA 2W22A 1F5SA 2I6XA 3OZWA 5BQXA 3KZMA 2VAXA 3ICCA 2OMEA 3QFSA 3OT1A 3P9CA 4JAVC 5AHWA 1RQRA 3PQCA 3VDRA 4KTTE 4U1RA 5JO9A 3SOPA 2IOHA 1TKAA 1EA7A 1JG7A 1EWTA 3MTIA 4FMCF 1AY0A 2UYCA 3S2GA 2R1TB 1T36B 1ZMOA 2LUOA 1U2ZA 4HD8A 4B6JA 2G8NA 4HNTA 3F6YA 4KJXA 4KU4A 3H8WA 3RQIA 1Q1NA 4NZMA 3AJRA 2A6PA 4MAAA 3K9CA 4BLPA 1YB7A 3FPCA 2D1FA 1EVLA 1LRJA 1C0PA 3JCZA 3GLKA 2Z3WA 4JLWA 5K0JA 3PLRA 5TS2A 2O59A 1PF7E 3F4KA 2G6TA 3NP9A 1N33B 1FMJA 3AZQA 2ARKA 3RSLA 2P7IA 2YNMC 3MS7A 4EPXA 4MEAA 4YWHA 2BAGA 1M83A 3O1HB 4LV6A 1UKCA 2FPXA 1T2FA 3LVFO 4FZJA 1JQAA 4HDRB 3W9YA 4WADA 3O1IC 1L5FA 4LVOA 4NMMA 3IOMA 3KR1A 3MCUA 3HVHA 3VYUB 2QSJA 3IODA 3JX9A 4Y1GA 4A2WA 5L6LB 1U7OA 4EZIA 3GN1A 3C0KA 1EG7A 1W4RA 1NMXA 1D1SA 5K8CA 3NHSA 4BYMA 2JFWA 2O8NA 4WCDA 4LRWA 5LU9A 1PK8A 3F8TA 4FEEA 2YWEA 3HEMA 1UJMA 3SX0A 3IAS6 1Z68A 4PWYA 2X6QA 2M6RA 4QE3A 6YASA 4QDUA 1Z8HA 3INTA 4G0YA 1HMYA 4KMSA 4OBXA 3WRYC 4C14A 5MFZA 1GEGA 3TKAA 3I2KA 2Z57A 3AFGA 1GV1A 3B6ZA 4HR7A 1EFUA 1GWNA 3IRUA 5ALGA 2ZRPA 2ZI6A 4F2GA 4TWJA 1ZNQO 3ZWYA 4CN8A 4YMVA 2N42A 2IDZA 4GG1A 1W2WB 1VJCA 5AJXA 3Q7PA 3QVOA 4B83A 3WP1B 3DBOB 3U9SA 2CWWA 1L6IA 2V3VA 4L7VA 4E1VA 1IJFA 4P3PA 1TM3E 2IQ5A 1CLUA 2INGX 3CUWA 3MCAA 5DLYA 3TJZA 2CL5A 1EM6A 1ESZA 1TO1E 3GRYA 2LCFA 4YRIA 1QS0A 2H1WA 3HMKA 4HQOA 5JH7A 5LU8A 4UM5A 2CDBA 3A1EA 4QBGB 4MGZR 2YCLA 1OSNA 2JW5A 2ACKA 2CZGA 2Q3FA 3Q5EA 3VI3B 4CQMB 4EDFA 1DKMA 4YJ2B 4FFPA 1HETA 2G40A 4H7FA 2BGKA 3TL3A 4QUBA 3BMOA 1H23A 1T8TA 3DGEC 3FUXA 4JKYA 4G5XA 1JIKA 2Y27A 1MQAA 3OEHA 2FPRA 4G1MB 1PP4A 4KJZA 3NWEA 4D9EA 5LMNB 2YV3A 2YZMA 3QFCA 3ZTTA 4YY3B 1ZEJA 1IK6A 1YCFA 3LLSA 3FPJA 2P9EA 4TVKA 5D86A 3OQIA 5AVRA 4Z0TA 2OV2A 4JIGA 3GJXC 4A8PA 4IJ6A 4EJFA 1JAZA 2F90A 1XHEA 2W6JD 4MS4A 5F4ZA 2QORA 1O8CA 5KVSA 3PITA 2XZLA 1ZP6A 2FPIA 3IUQA 3DE3X 1ZC3A 5BW8A 1KERA 3W2IA 4OJMX 4U7PB 5JD6A 3BL6A 1CY4A 1WTAA 1G8YA 3DAFA 1Q50A 3A6HA 4K0RA 2SCUA 3AEKA 1J1IA 1JVBA 2FFBA 3GLHA 5LSAA 1TE2A 1R50A 5EMKA 2NLOA 3RJZA 4KGZA 5E9QA 3ZI4A 1EWKA 2ES4A 3OOYA 4FKZA 3I05A 1VRWA 3BE5A 1MT3A 4AJ2A 3WHIA 1E1MA 4ARVA 3F73A 5EOVA 4MR8B 2OYRA 3RTAA 5C7IO 1A27A 1T9KA 2JB9A 4J0JA 5EINA 2BEVA 1Z08A 4PG4A 1HDEA 4QYWA 3UEOA 2FAXA 1G3QA 3IBSA 1T6XA 1XZBA 2B69A 4ZT7A 3SS9X 2PKEA 1L5YA 1QQ5A 2YFQA 3QRWA 1ODCA 2AG6A 2QVBA 4CODB 2G70A 1OH5A 3BICA 1LNZA 1SUEA 4DNFA 5LJLA 1IM5A 1M2FA 5G3ZA 5ALWA 2WJHA 1AGYA 2EL9A 3ZGVA 1EWYA 2GXSA 2EDCA 4L22A 4PTLA 4EB0A 3EW7A 1TKRA 4PS0A 3N0VA 3HYCA 2Q1TA 5K0BA 2G5TA 4N9WA 5FTWA 5EWMB 3K70B 4NCNA 1BMFA 4C1BA 2AZTA 3DV0A 3LAWA 1F17A 3OMLA 4HB4A 1ZQ9A 2WWFA 2NZJA 2CMKA 3A6FA 3KWLA 1EBBA 1G2QA 3KPUA 5DTRA 1IONA 3SXJA 1ACLA 3NX4A 3JRXA 2WUVA 4NICA 3RNOA 3OEED 4OOEA 3CLHA 2ZBQA 4ZEMA 3SR0A 1J00A 2AHOA 4I1YA 1EKXA 5FX2A 3K35A 4HPJB 2ZYSA 2W2XA 2APJA 3HDYA 1N0UA 1I2AA 3GUYA 4YRTA 3VHRA 3WQHA 1E77A 4MR7A 2AN1A 3INGA 1DWQA 3WMXA 2FJPA 4XWOA 3A2NA 4JI8B 3SC2B 4FUTA 2ZT5A 4DJTA 2RE8A 4KNWA 1DQRA 1GKKA 4WXMA 3RLFA 1U63A 4R6XA 1POWA 3VR2A 4EMUA 3WBKA 1R16A 2FXVA 5JYBA 3EH2A 4HRVA 3GRAA 2WHYA 3EXG1 1A5SB 4RELA 4DQUA 2HEGA 4MV8A 4DGSA 4EMTA 4LF6B 3RRXA 3ZZ0A 5LNK6 5E4FA 1FUUA 1W5AA 3VR3D 2X22A 2V98A 1LB1B 4FGWA 2YMLA 5F5LA 1BDHA 2G77B 4WOPA 3T4XA 4IIVA 2JKYA 1FP4A 3MUEA 4MA5A 3T5GA 3QVGA 1JU3A 4NBRA 1RFLA 5FAKA 2VF5X 4NZZA 7ABPA 3OZEA 3QPDA 2GYWA 3TFOA 4ADSG 3PENA 1RPZA 4XOIA 3E3OA 4AUNA 4B7ZA 1CQIA 4GI3A 2ZI5A 1CJMA 2GCGA 5HFNA 1Y9ZA 2YINC 3BWMA 3FUCA 2HZ7A 1M67A 4I55F 1OPXA 3MT0A 4WVLA 2A5FA 4Q4JB 4B3TB 3FB4A 2W2QA 2XKKA 3AETA 3UMSA 3VPBA 1R5NA 1KO7A 3LL4A 3EHDA 2PGXA 4L8GA 4YDRA 1KS2A 4ASUA 4CEJA 1CUXA 3RYFB 4X3CA 2W93A 2YY6A 1JB9A 2CE2X 2B61A 2WE7A 3BQMB 3BT7A 1RAFA 4N18A 2X3FA 3DCJA 1WB6A 4RKWA 1TOAA 2NTNA 4IRMA 2UYHA 1PL8A 1IBSA 1U0BB 4P4GA 4DC0A 4D0SA 1GQOA 1JDJA 2OESA 1LK5A 2DYKA 4AN4A 2OV1A 2P77A 1T25A 3NHRA 5EERA 2BKUA 4HZUA 2HF7A 1KS9A 5TRTA 1R27A 3A1TA 5CVDA 3ZDEA 2EFHB 3EUFA 3QVVA 2BOVA 3RS5A 3VTFA 5A06A 1AV6A 3D54D 5D6NA 5L95A 2ZIXB 2VJAA 1DINA 3FWNA 3ZQ6A 1LPPA 3CF4G 4OSOA 3DAGA 1WF6A 3KJNA 3EZXA 4EI7A 4BE7B 3NW9A 3A37A 2IY9A 2V7TA 1KKMA 4GH5A 2N1MA 4GOOD 4FZRA 3RC9A 4RXUA 3LA8A 2HU2A 4BFTA 5E3JA 2ZRNA 3CMMA 2H1RA 2JBHA 4WKOA 3L8CA 1NWCA 1Y1RA 2ZB2A 2PK3A 1KR2A 3PU6A 4H1WA 4N47A 3MMNA 5K8IA 2I54A 5GV8A 3O0TA 3PPVA 1X7HA 3FWZA 3BYZA 4EFKA 5B6JA 3KQSA 3DCYA 3VU1A 5K01A 1EDOA 3EVNA 3TZKA 3GRVA 1UWVA 3UNXA 4X44A 3A1CA 4GI1A 4I14A 4KAFA 2X0FA 3U3ZA 3URMA 1G5RA 1JG6A 2V5AA 2XWSA 3HCWA 4WZBA 2IVZA 5TF4A 5HOQA 1CUEA 1MVNA 1WXGA 4WI1A 3SVZA 1VQ1A 2W6ID 4EJ2A 1CY6A 2I66A 3E7WA 2OL4A 3HDHA 4GI2A 4IRUB 2O2EA 2F48A 4ISBA 5MN6A 4WA7A 1BZYA 2C9CA 1KYTA 4UEKA 1PIWA 3UT5B 2ZDQA 4C4PA 3HLYA 2PY6A 2D1RA 2XE4A 3DUFB 3IJ5A 4CMEC 3NUQA 3M4JA 4HSEA 4JI1B 3L4JA 2O1SA 4IGIA 3SHQA 3MB5A 4J0FA 1VHLA 3DOHA 3KB1A 5KWJA 2I0FA 5DYTA 3PYXA 1Z2AA 3IBCA 4PO8A 3IP6A 1CRPA 4MPRA 4NFSA 4XOUA 2NP6A 1SXJC 2UZ1A 3IQDB 1PLJA 4HH3C 3V8MA 5I7FA 1JXOA 2OVBA 4W1RA 4TTTS 3BD9A 4UBMA 4YT4A 2W2KA 3GCZA 1T0IA 2AKYA 5GADl 2IPNA 3LP8A 5FOWA 4DT1B 1GPAA 1RLOA 1XZPA 1MF7A 3SAJA 4I1RA 3UV7A 2FK7A 1E7WA 2WJPA 4CWAA 5C8VA 1NBHA 1OOEA 2QW8A 3HYRA 4OK5A 5IUNC 3LF1A 1DBIA 1NE2A 3FPBA 1RACA 2AYYA 2Q5IA 4C30A 4OHOA 2I22A 4Z7JA 3M6IA 3AI7A 4JJKA 1TVKA 1F6WA 2B21A 2W71A 4YO8A 3TW4A 2H07A 3UK7A 3HTXA 1DPFA 3TTSA 4ZMSA 3BCHA 2BFEA 5G41A 5CCBA 4WECA 4YV0A 2F8TA 4EX6A 5IARA 4UCFA 3ES9A 1QYIA 4UNRA 5A4JA 2D0DA 2HIAA 1H4VB 2D54A 1VZ2A 4XSVA 1L1RA 2PO5A 2HDNB 5LMZA 2PIDA 4QELA 4MDHA 5LZ5A 1U8CB 1KYIA 2Q1YA 4DA0A 1ABFA 3ESBA 3TD6A 2YY5A 3ZDFA 2NO4A 2ZSIA 2D5IA 2PKRA 4PFKA 1S8AA 3HH8A 2G4CA 2XRZA 4OB8A 1ZM3A 1EFRA 4NU5A 5AM1A 4QBHA 5H4HA 3UKOA 3HSYA 1XROA 3PL1A 2W0SA 4A9AA 2J9FB 2NNWB 1G5HA 3TZCA 5LOVA 2Y0PA 3QKTA 2OCXA 1S8FA 2XYRA 5K4GA 2DFNA 4Y6QA 4MQLA 5C80A 4C21A 4LWPA 4S1VA 3OZDA 2AG5A 1YTUA 4Y3UA 2Z30A 3DWFA 1SGWA 4JLJA 1CSEE 4IG9A 4K1LA 4MRSA 1I6LA 1Y33E 2OORC 1VJ1A 2VUTA 4FLMA 1XZ8A 4UQPA 5JSQA 1QQBA 3T61A 2GUWA 2QTBA 1NW3A 2QY9A 4KI7A 1D0VA 2VAWA 1RCFA 4AY5A 3FBWA 2J9GA 4YMLA 4LDJA 3PX2A 1DB3A 1UPFA 3EZ7A 4EJ6A 4IP0A 4G2NA 1TPZA 3ICEA 1ZW1A 3DO6A 3QYPA 3ZXXA 5BSKA 1FJXA 1T8UA 2IXEA 1P75A 4UATA 3RUEA 3IOBA 1UBHS 4QOIA 3FPKA 1XR3A 1KIMA 4JHXA 1CB0A 1DG1G 1PGQA 1QAMA 1SXJD 4JH0A 2OZEA 3D3EA 4QAJA 3RK4A 2GO1A 4LWQA 4RCZA 4ZO6A 1VL1A 2Y1XA 3JATB 2C4VA 1CIPA 3JWEA 4N5HX 3W06A 5IWAB 1LVUA 3EXHA 4TM7A 3I5YA 4DR7B 3UG7A