3GCGA

Crystal structure of map and cdc42 complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
177
structure length
173
Chain Sequence
QTIKCVVVGDGAVGKTCLLISYTTNEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into host GTPase isoform selection by a family of bacterial GEF mimics
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/transcription
molecule keywords Cell division control protein 42 homolog
total genus 53
structure length 173
sequence length 177
ec nomenclature
pdb deposition date 2009-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3gcgA00
2QU8A 2CNWD 4M1YA 1N0UA 2WVJA 1PJRA 2CJWB 4QBGB 5SZKB 2ZRAA 2C03A 3LQRA 4L4UA 4L9WA 3ECCA 1XD8A 2DHRA 4C0BA 2PL3A 3AF0A 3K9HA 2YOHA 3QG1A 4BFSA 4R7ZA 1NMZA 1MT0A 3R8FA 1WF3A 4M1TA 1RE0A 3FFBA 1NF3A 1U8YA 4HB4A 3B85A 4CYMA 2BEJA 4NYIR 1XMJA 1Z6YA 1W0KD 2B8TA 3RABA 2VBCA 1W0KA 1NKSA 1WDTA 4MKHA 4B6FA 2B7BA 3I92A 4JLDA 5B58C 2AXNA 2AN9A 2IYYA 3QF4B 1XU4A 4K8OA 4C2UA 4LDJA 3P32A 5FOTA 1Z0IA 4DIEA 2VF7A 1JECA 4JVLA 2G1KA 3QKSA 1UKYA 3AGQA 1ELOA 3ADBA 1YE8A 4Q4JA 4EFLA 3B7GA 1BKDR 5KUTA 2ODWA 3GJ7A 4XTRA 1XPUA 2ORIA 1Z07A 4F91B 1RRGA 2MSDB 2R6GA 4MYUA 2X1VA 2AFHE 1WMSA 1IN7A 1R0YA 2P65A 1VIYA 2XNDD 1XFAA 5JHHB 4NZYA 2G9NA 3W6OA 5H68A 4X8HA 2QPOA 4LUCA 2F1JA 1OW3B 1TEVA 2FPLA 2XGJA 1E2PA 1XD2A 3IHWA 1OXXK 2QBYB 3BIFA 3R20A 3ZZTA 1PZNA 1S3GA 2F9LA 2NPIA 1R10A 3EZ7A 3MFYA 1NJGA 2BIFA 3HYRA 1SHKA 3O8BA 2ZJ8A 4EPRA 2BM1A 1YZLA 4AK9A 5G40A 5SZHB 2F6RA 4E5UA 1UEIA 4UKDA 1S1CA 4A6PA 4G5QA 2I4IA 2PMDA 4NU0A 2BM0A 2ZQ5A 4GRAA 2GXSA 4TLEA 2WJJA 3SR0A 4ZIRB 1S9DA 1S1MA 4C0SA 4H1UA 3EARA 2ZRPA 3FDIA 4YXWD 1LTQA 4B3BA 2BMDA 1QG2A 5AJVB 3WMFA 4JBYA 1TNDA 3SI7A 1ZM2A 2W2VA 4ACAA 2F7SA 2QQEA 3QXSA 3P4YA 1KI6A 3QKSB 4QJ5A 4MYTA 2ZSEA 2IXEA 3B2EA 1F2TB 1IJFA 3VTKA 3CZQA 3TVTA 5JRZA 4RD2A 1CU1A 1II9A 2IK8A 1FX0B 2JJ1A 3N70A 2N42A 4A6XA 3WNDA 2XSZD 4OYHA 1M2OB 1ZUHA 2JIZD 2AXPA 2R9VA 1X8JA 4LJAA 1YR6A 4DLZA 2AL7A 121PA 2Z83A 3IQXA 3LAWA 3CO5A 1XZPA 1OHHA 3LW7A 3B1XA 3EWAA 4DDVA 3KQNA 5DYGA 3VHLB 2Z6VA 5FTNA 1E9RA 3BH7A 1F60A 1MRSA 2C95A 1OH7A 4OHWA 4RFSA 4YMSA 3RC8A 3MWLA 4BLSA 3TH5A 2QSYA 4PXAA 1RRPA 2MSCB 1VG1A 4W5HA 3KQUA 1ZRHA 1FPMA 2J0UA 2XOKD 5DHAA 3LQQA 3DPUA 4URZR 4PC3A 4URXR 2XSZA 4HYYA 2J46A 1TTTA 3UANA 2OFWA 4XVQA 1P60A 4LHZA 4QHSA 4Q1AA 1JJ7A 2BJVA 1JQJC 1MV5A 2CJWA 2XZOA 1RJ9B 4B3CA 3TBKA 1ONBA 3FB4A 3Q7QA 3V9PA 4JVSB 2QAGC 4UNNA 4Y0AA 4AYTA 1FUKA 1N6OA 2PLFA 2GA8A 4MYCA 1T4GA 5KO2A 4QJ3A 1KYIA 4MRSA 1U81A 2ECKA 3SBEA 3U3JA 4A1FA 1PLLA 4LGMA 1Z2CA 3KJGA 3WYAA 4H1VA 2GF0A 3Q9LA 5E4FA 1HE1C 4BGDA 2ZRGA 2CHGA 2ZVPX 2NTYC 3RVBA 2HT6A 4QRHA 2FNAA 2DYKA 2QROA 3PEVA 1E9AA 4RKEA 1Z0DA 1KSGA 1Z08A 3ZDQA 3RYTC 2ZR7A 3K09A 3I3SR 5FPHA 3ICEA 3AVQA 2BMFA 1KAGA 2YOFA 1TPZA 2QGZA 4JVNA 3A4MA 1IN5A 1MABB 3FYHA 5DE3A 3H1TA 2J1LA 4CT5A 3GJ6A 2O5VA 721PA 3E2IA 1Q3TA 4UNPA 3CWZA 4JYBA 4EFMA 1G7CA 3PJRA 3ASZA 2ZJ2A 3SBDA 4US2R 4Q9HA 4N0DA 1NJFA 1JB1A 1WQ1R 4K46A 4D4JA 1FFHA 2A9KA 2R2AA 4CF7A 3AF4A 5HKKA 1TX4B 3UG7A 4HUTA 4GMDA 2D06A 1GSIA 3LO5A 4NTZA 1OKKD 5KU1A 4L8GA 1XWIA 5AJXA 2OBMA 4RCZA 1LB1B 2GTPA 5FPYA 2HJGA 4A8JB 2XXAB 1ESMA 3NDBB 2C9OA 4WA7A 4CEJA 1WP9A 5CITA 4PHHA 1IJEA 1Q20A 2HV8A 5CIWA 4F38A 3TAHA 1FZQA 4IOMA 3DEFA 4KFTA 4PSKA 1XDBA 3K9NA 4Z1MD 4KODA 5FR1A 2NO7A 5J47A 2HDNB 5EP1A 2V6IA 2ZRLA 2EQBA 3K9LA 3GLIA 1AN0A 5AWFC 1SHZA 4DLUA 3D6TB 2WJHA 4YDHB 2JLWA 1AS0A 3PG5A 1E9FA 3L0SA 4Q4LA 1AIPA 1D9ZA 4P4SA 4FMBB 4MKIA 3K0CC 3OEHA 1TMKA 3QUSA 2FN4A 3P20A 2QP4A 2FPKA 4TQ9A 1OIWA 4BZQA 4CDGA 3SQWA 1OYWA 2ZE7A 1IXSB 3K0EA 4LBZA 3W6NA 1Z6XA 3LH5A 2EFCB 2AHOA 1GOTA 1QHIA 2WZQA 4M21A 4JSYA 5KTYA 1VPLA 4QHTA 1F2UB 1Z28A 1ZUIA 2VP5A 3GEIA 2ZU6A 3SJCA 3EASA 1OXSC 5L3RA 2JLUA 2VP2A 5KHOC 3K70B 2WJVA 1MABA 4RCYA 4BRWA 3TGPA 2X8AA 3RS2A 2G1JA 2IW3A 1KOFA 5BWMA 1M74A 1YZQA 4R9UC 5JJLA 2JEOA 3QOFA 1AGRA 3U3OA 1RZ3A 1ZC4A 2WJGA 4IVRA 5J4VA 1N6NA 5JZVA 4RFSB 1E1RA 1C1YA 1SXJE 3LV8A 1GKYA 1TADA 2IHYA 3ONWA 4PAMA 1NBME 4DEXA 2A78A 5AJZA 3QBVA 1G16A 2J7PA 2N46A 4PC6A 5LB4A 2DBYA 2IYWA 4ZI3A 2OCBA 4DBLC 2FV8A 3HP1A 2OHFA 3EZ9A 3DDCA 4D25A 1XEWX 4B33A 3RS5A 4QGHA 4MDEA 3WMEA 1NG1A 4A9AA 4IDNA 4LSGA 2GVZC 5E7JA 4M1WA 3REFA 1E79A 2JJ8A 5TY0A 4BLPA 3CNNA 1DE0A 3IQWA 4PPQA 4FCVA 3WRXC 4DLXA 3NHAA 4RD4A 3WHLA 1CJKC 4HLCA 1R6BX 1KI6B 3NBXX 4GMXA 3G82C 1G4AE 4CZ2A 1NN5A 3ND9A 1OYYA 4AY2A 3GP8A 4TTPA 3BH0A 1WA5A 3MUFA 4B2LA 1KDOA 3U7GA 2OM2A 2EFHB 2QTHA 2DCUA 4O3MA 3A37A 3QE0A 1Z6GA 4AKEA 4W5JA 2PJRA 1CTQA 1XNJA 1E2NA 1CP2A 2IWHA 1D2MA 4Q4HB 4YLGA 1SVSA 1U99A 3AF2A 4J0QA 1E9BA 2FG5A 3C5CA 4KI0A 3TR0A 4DT1B 3B1VA 4Q03A 1QVRA 5CDFA 4BLRA 4OHVA 3L2OB 4DWJA 2GF9A 4G5SA 5CB6A 1E2DA 4DT1A 4QGGA 4ZCLA 1HYQA 3OEEA 4LJ5A 5D3MB 3VX4A 2PEZA 3HPRA 1DELA 3VAAA 1U8AA 2FU5C 3LX8A 4R98A 2IS1A 3WXMA 5FBVB 2QI9C 1LW7A 2X77A 4TLCA 2ANCA 5CJPA 2Q9CA 1KKLA 1RRCA 2JLYA 3OIYA 2D7DA 4G01B 4PPFA 3CPJB 1P7CA 1KO4A 2CCJA 2ASEA 2QEQA 2ZUBA 3FPAA 3NBYC 2ZJYA 4NCJA 4PR0A 4LV6A 1G4UR 1ESNA 3HDTA 1G3RA 2JIZA 3C16C 2AFIE 1A5TA 1ZAKA 2BCJQ 2IS6A 4U7DA 4TTQA 5HCNA 1AA9A 3VNVA 3T5DA 1EK0A 5AUPB 2AK2A 1FTNA 2DFNA 5C46F 2LKCA 4ERNA 4JL5A 5KSOA 4QXAA 4DSNA 1Z83A 2DWQA 1ZNXA 2K5UA 2QORA 1T0HB 1HT2E 2IUUA 2O8FA 3W3AA 4JIMA 1UDWA 3BFVA 5JEEA 3KQLA 2ZJ5A 2QSZA 5B30A 1OPXA 4Z51A 4WW0A 4MQBA 3EIHA 2J59A 4JLPA 1E6CA 2EW1A 4QM6A 4LYFA 1G3IA 1BS1A 4PHFA 2OV2A 4DUGD 1YRAA 3UKDA 3ZD6A 4ZDJA 621PA 4RD6A 5FUYA 4M9ZA 3SJBA 4ARZA 5DN6D 4KLNA 4YC7A 3RWMB 3L43A 4UNRA 3RSOA 2OG2A 4U5XA 3EIQA 2O8DB 4JLJA 2CHQA 5HE8A 2WHXA 1CULC 3SYNA 1XJCA 4TL7A 4YMUA 4LHVA 4BEBA 1CRQA 1DAMA 3I4LA 3TLXA 2ODBA 3AV0B 3GEHA 5CYPA 4M2LA 2GZAA 3F8TA 2FDCA 3EZFA 1R5OA 1KSJA 3O8RA 3MMPA 4LPSA 3MJHA 4C0AC 2XB2A 1ZIPA 5BN4A 1E32A 4K81B 2IBMA 1CR4A 1E9SA 4DZZA 5FL3A 2I3BA 1XCPA 1KO1A 3IDQA 1GUAA 1XD2B 1ZU4A 2XTNA 4JLAA 1ZC3A 4LY6A 3W5JA 4MRRA 1P6XA 4JL6A 1YZTA 4EPYA 2GEVA 1WRBA 1G5RA 1EFTA 3OF5A 1R2QA 3K1JA 3LNCA 1CR0A 3D8BA 5JCPA 3SZRA 1Z63A 4QM7A 4GP6A 4Q9IA 3CW2A 1FL9A 2RB4A 2Z5FA 3C7KA 3ZGXA 1P2TA 4JLBA 1ZYUA 2JAQA 3KXKA 3K0AB 2YVUA 3NBFA 4KXFB 1ZIOA 1XMSA 3X2SA 3QXXA 2HYIC 3IEVA 1XPRA 3NIBA 1TU3A 3BERA 4I1UA 2OFOA 4JKYA 1EFUA 4MITA 1IONA 3QPWA 1IHUA 4LJ7A 3VR3A 2JCSA 3CB4A 2YV5A 3E1SA 3CNOA 3TE6A 4D26A 2IX3A 4DXAA 3W5IA 3I61A 3UK6A 2J7PD 4PHTA 4ZPXA 4LV5B 4FI3C 4EQ6A 5DHFA 2V54A 4NYJQ 2JLZA 2QTVB 4URVR 3CPEA 1N6PA 2BCGY 521PA 4Q00A 3OIVA 4Q5IA 4PZLA 1M1YE 2JJ2D 3LA6A 1XRJA 1NVVQ 2WSSD 3SEAA 1Z0FA 1Q12A 4I4LA 3UXMA 2P0EA 4FMCB 1NY5A 4UXHA 1SQ5A 3OFND 1P3JA 1B0UA 5F9FA 3UMFA 1X6VA 2JLSA 1ETUA 1YKSA 4IRUB 2N1BA 4WXPA 3KTAB 4WIAA 2R8RA 2GEDA 1JNYA 1H8HA 4Q7JB 1W7AA 2GJ8A 1GRRA 1DS6A 3GLHA 2R6CA 3LFUA 3PR1A 5F3WB 2EFGA 5FOUA 4RZXA 4V02A 2P6RA 4KVGA 5FI0B 1U0HC 3EAQA 3DMDA 1VYUA 4GPTA 5G41A 4C3ZA 2GCPA 3X1DA 5J4LA 4HZIA 4QBHA 2GJKA 4LWZA 1Q1BA 2H16A 4TLBA 3I8XA 2OBLA 2REOA 4EPWA 2I1QA 1R0XA 4Q7LA 5TV2A 1R0WA 3DMNA 2VSOA 2ZXUA 4Q1CA 4L15A 3QF4A 1VHTA 4BFZA 2V1UA 2JDID 2ONKA 4BLOA 4DLVA 2F9MA 2F3TA 2TMKA 2ZANA 3RS3A 3TKLA 3IGFA 2BKEA 4B76A 4KITB 1RYFA 2OESA 2V9PA 2XAUA 3AVYA 5ANRB 1YU9A 2W6JA 3D31A 4LJ9A 3AVUA 3MD0A 1G9XA 5FOWA 2ZI3A 1HH4A 1DBSA 1KNXA 1SULA 3THXA 3FMFA 1EFRA 3KFXA 3AP1A 2IL1A 2QRZA 4BUJA 2PT7A 2BBSA 1YHNA 4ON9A 2I1VB 3WBJA 3RDPA 1TUEA 2XJ9A 5J40A 5CIQA 5AUOB 1N6RA 2IYZA 1PLJA 1E2FA 1GL7A 3REGA 3TUZC 1G1MA 3KUDA 1SVLA 2D62A 1KI3A 2RCNA 1XJ0A 5FPSA 4M1KA 2KB0A 4DCVA 2C2HA 4LPKA 4Z54A 3PV0A 1ZM7A 4LYJA 3LWNA 1DOAA 1T91A 2ZE8A 2GBLC 4YDSA 4ILEA 2V6JA 1XF9A 4GP7A 5D3MA 2BMJA 3S1AB 4FCTA 4M9SA 1SVWA 4KU4A 3RS4A 1SKYB 4ASUA 2ZYTX 3FMIA 3QF7A 4TMXA 2NZ8A 1CJMA 3MG9A 2ZJOA 1KJYA 2CEAA 5GJCA 3KKPA 2R65A 2CL6X 2EYUA 4AYWA 4C0JA 4RD0A 1ZM9A 4JZKA 3U6KA 1J99A 1Q21A 3BS4A 4V0LA 5DYIA 3RS7A 1T9HA 2OAQ1 1G5PA 2MSEB 2G83A 4U02A 5DSZA 1SVIA 3IHLA 2ZI9A 4HEJA 5E7IA 3PEUA 4S2EA 3CR8A 3NH9A 4TMKA 3VU9A 3EPJA 1W47A 1CXZA 1P62B 1G8FA 1XZQA 2FMXA 1JEEA 1TQ6A 3MGCA 1W36B 2VP6A 3BFXA 1IY1A 2WIAA 3WBKA 1QHYA 1UEJA 1IN4A 1NLFA 2ZR9A 4KLZA 1P2VA 2V1XA 1FMJA 3OE7A 2RGCA 4RSGA 1S2MA 1ZM4A 2FFAA 2B8WA 4IOLA 1P75A 1SVOA 2ZI7A 1GZSA 1Q1ZA 3FHOA 3L8ZA 2NPFA 3W8RA 2ZRHA 4JLNA 3ZZ0A 3DHWC 2ATVA 4MGYR 1D2NA 4A2PA 2ZRCA 1GKIA 1E4VA 1GNQA 2VHQA 1HE8B 2J5XA 3GJ5A 3SDZA 3M0EA 2A5FA 4UXJA 1FNMA 1NBMD 2B21A 4IKEA 1JAIA 3S1AA 1E1RD 2WMOB 2HXSA 4MGIR 1RYHA 1UKVY 2V7QD 5JRJA 2ZROA 1W0JD 1UKZA 2QT0A 2JJ1D 4V0NA 1GFIA 4IEIA 3QENA 5FR2A 4D6PA 1XTRA 4TZ0A 1K5DA 1K5GA 2OXCA 2BDTA 2UVQA 4OJKA 4XTCS 2NO1A 1ZCAA 3TJZA 3ZVNA 4C7OA 5DI9A 1JR6A 4D4KA 4KV9A 1KSHA 5CLQA 2WM9B 1RRFA 5JJIA 2YKGA 3SJAA 4PO9A 3VKWA 1X86B 3U44B 1COWA 1IXZA 2HCJB 3MJRA 3EW9A 1BMFA 4F4IA 4GBMA 1BIFA 1NN3A 3FKQA 3ZVLA 4EPTA 3UMSA 4URUR 1X8KA 5KNCA 2DB3A 5J4HA 1G8PA 2GNOA 3AKDA 5FOSA 2E87A 1NN0A 1I4LD 2V55B 1L2TA 2O8EB 3NXSA 1W4AA 1E2IA 5L3QA 4DCUA 3IPYA 5EZ5A 4IW3B 1DG3A 1YR7A 2C5LA 3OEHD 4HAVA 5HE9A 4TMZA 4DC9A 2EFDB 3LBNA 3KFVA 2PCLA 3CZPA 3J81k 4CEIB 2IXGA 4HUQA 1Z22A 2WSMA 1OE0A 2GZDA 2VSXA 2O8CB 1EGAA 2DFKB 3QXCA 1Z6TA 4B3XA 4TL9A 2WAXA 4S35A 4GL2A 1H8ED 2CMKA 2W00A 1NVVR 4UQOA 4CEIA 2G6BA 1JALA 1DG1G 3B60A 4W9MC 1NBMA 3EPKA 3CUEF 2FOLA 2ZI4A 1E0KA 3N2EA 1BYUA 3L0OA 3TW8B 3B6EA 3ZIAD 4PFSA 2QG6A 4B2PA 2GJ9A 5AUQA 1AS2A 4E22A 4PX9A 3U2QA 2WPDD 1M6NA 1X8LA 4B43A 2KJQA 4BLQA 3PUWA 4O0MA 2IYXA 3GJXC 4YMTA 1VCMA 2Q9AA 3A6PC 5H70A 3PFIA 1NRJB 1L4UA 3NG1A 1S8FA 1EXMA 3KDSE 3VR5A 2FEOA 3R7WB 4CEHA 2H92A 3DL0A 4LK2A 1U98A 3HYTA 4Q02A 4NYMQ 1DO0A 3LW8A 4TL6A 2J45A 3GLFE 5EUQB 2ANBA 4PSAA 2JLVA 3W90A 1Q44A 2VQSA 3OAAA 3CH4B 2PEYA 1NL3A 4PAQA 3EPLA 4IDQA 3AUXA 5DI3B 4KYIB 2Z43A 4OKSA 1Y3AA 3BJIC 4B47A 3K09C 4OI0A 2OILA 2QENA 2IUSA 3GLIB 4KSBA 3P27A 4MUBA 1MO6A 4C4PA 3NC0C 1GG2A 3M1IA 3SE0A 2ORWA 2ZI6A 4A0HA 1EFHA 2D3WA 3RLFA 3UG6A 2QZ4A 1KKMA 221PA 3GFTA 5JECA 5GJBA 3IIKA 3K0FA 1II8B 2W6IA 1KJWA 3KB2A 3QPUA 2H8KA 4OQLA 3ZQJA 3X1YA 1G6HA 1QVAA 4EJSB 2WBLC 1F3OA 2WMNB 1US8B 1G20E 4PAOA 1JBKA 5FBRB 1M7BA 2QUZA 3SS8A 3U4QA 4C0HA 4XD7A 3GPLA 5F9HA 1NN1A 5JI3E 1TF2A 2WICA 5SZJA 4GOXA 4A82A 1SXJA 3B1YA 3PVSA 2HUPA 2EU8A 3BGWA 4JS0A 2GCOA 1R0ZA 4PANA 2WKRA 4PQFA 4ZO4A 5FTMA 2NOAA 1HTWA 4D2IA 4LV8B 5CLLA 3VHXA 2REXB 2A5YB 3MCAA 2VO1A 1XXHE 3WNCA 2MMCA 3ZS9A 5EE9A 1YVDA 1G41A 4RZ2A 1VCIA 1E2KA 2PZFA 4OQMA 4P4TA 1ZU5A 1JPNA 3IO3A 1W44A 3NH6A 5HKKD 2OE2A 4MRNA 1KZ7B 4BQSA 2DWOA 1Z5ZA 1XP8A 5KOYA 2Q0HA 1F2TA 3PXGA 2JDIA 2O0HA 1CR1A 1F2UA 4XWAA 4A0FA 1BOFA 4RJLA 4Q7MB 2ZYUX 2C96A 2IUTA 2VHTA 4JLVA 4Q1DA 5EE5B 3VNUA 1FTSA 3K0CA 5DIFA 3K70D 1DADA 3FTQA 5AR1A 4MKFA 3RWOA 2Q6TA 2REBA 4B73A 4GOKA 4GZMA 4BFUA 5EXXA 2CVHA 3CM0A 1VIAA 3EG5A 3H86A 3QBTA 5C4GB 3H0KA 2F43A 1NIJA 4OL0A 1L4YA 2QP9X 2NZJA 1DTSA 5HZHA 2P5SA 2VIIA 1NY6A 3CKLA 5DLQC 1AZSC 3GJ3A 1I2MA 3TIFA 2F3RA 2YWEA 2QBYA 4E07A 3R8CA 5H8WA 2LKDA 2RHDA 2OXRA 1U94A 4JJZA 4EJSA 4TT3D 1J2JA 2ZREA 4GZLA 1E1QA 1X3SA 1QDEA 4WXRA 1M7GA 1TAGA 5IK2A 3ZVMA 1WBDA 1TQDA 3EA0A 5E7MA 3I5XA 3KKNA 4DEYA 2W2XA 3NVAA 1Q3HA 2IYLD 3BH6A 3QVVA 4KJZA 2O8BB 1W5TA 3FFAA 1KI9A 1FQKA 2F1RA 2SHKA 3BD9A 3ZLJA 1E2GA 1LVGA 1KTVA 4FD2A 2FSHA 1TF5A 4M9XA 1M7HA 2J7KA 2ZJAA 2RGBA 4G5GA 4D0GA 1XEXB 2C77A 4NYIQ 1OHHD 4B48A 5BYKA 5KDOA 3ZD7A 3A4NA 5FTKA 4QG7A 2VTKA 2RH5A 1FX0A 3RAPR 4F7WA 5EUMA 2CLSA 3KXLA 5AJWA 2IA5A 4TT3A 3NEJA 3AH8A 5IHPA 1T6NA 2KI5A 1E2MA 1XEXA 1GIAA 4JT4A 3V00A 1RPZA 1XMVA 2YJTD 1E9DA 2D2EA 2PLRA 4JBWA 1DO2A 1SXJD 4Q01A 1NLYA 2OO7A 2WWXA 3QY0A 2HJVA 2YWGA 4A0RA 5EE0A 3X1ZA 4EQ6B 4HDQB 2L0XA 4D80A 3I62A 2XZLA 2DY1A 4RFVA 1X1SA 4TLDA 5JWRA 4AKIA 4M1SA 1G7SA 1JPJA 2ZM5A 4X8OA 1N6HA 2GK6A 3R9WA 1ZUNB 4IOKA 5EXTA 3FHTA 2FFBA 1IQPA 1JXMA 2Q21A 1KI7A 3BBPA 5HPYB 2HF9A 1R8SA 2Q3MA 4HI0E 2QMHA 4HAXA 2BJWA 1RIFA 3SHFA 4OK6A 2WV9A 4DSOA 3NEYA 4B32A 2MMGA 4MDFA 1GILA 2XZPA 3EZ2A 4PQRA 2QRNA 4A4DA 1LV7A 2Z4SA 4FN5A 4C0LA 4MRVA 3I8SA 3GFPA 5A0FA 2KBEA 2BV3A 1XCGB 5L3SB 2YOGA 3LDAA 4JL8A 3W34A 2QA5A 1GL9B 4TMWA 5K8UA 1E2QA 1DEKA 4M53A 2VEDA 2DFLA 1VTKA 3RRYA 4OQFA 3C5HA 1V43A 4OK5A 1JI0A 3ZZUA 1CJUC 3THWA 1X1RA 3DZDA 1UF9A 4BRUA 3H84A 2J41A 1CJTC 3ZIAA 1ZD9A 2XB4A 2CHVA 3FMPB 4JVMA 2ODEA 3ZYCA 1G5TA 1P72A 4L5BA 3QSYA 4Q4HA 2G0TA 1EX7A 1EWQA 2CNWA 1HURA 2QL6A 1JR3D 3T1QA 4ARZB 3EZ6A 2V8OA 3BWDD 1H8EA 3SNHA 2A5DA 1YJ5A 1TEXA 5L8VA 1Q1QA 5TARA 2KE5A 3M6AA 1N2CE 2WWYA 3A58B 2R44A 2ZS9A 4Q66C 1VDZA 3GLGA 5FFMA 2GZHA 1E69A 3VR4A 4P33A 3BB3A 3TW4A 1G7TA 3A1WA 4QOSA 2GVDC 4HAWA 1GWNA 4DVGA 1K6MA 3CX8A 4ZKEA 3AQ4A 1AKEA 2FE4A 1OH6A 5CK4A 5FUVA 2FFHA 3WP1B 1QHHB 4PZZA 3I32A 4HDOB 1Z0JA 2RGNC 5BXQC 5HZKA 4OHZA 1EG7A 3GLFB 4ZDKA 4HLQB 3CRRA 1LF5A 4UJ5A 5F2EA 4Z1MA 2RGNA 4CEHB 4V03A 5G3YA 3QKTA 3R9IA 4EPVA 4ZCIA 1G17A 1R7RA 2CLCX 2W0SA 4HAUA 5FOVA 3THYA 4BFTA 4XSGA 2A5GA 1E96A 3ND8A 3T12A 2ZTSA 4BFWA 2VP9A 5L3VA 4Z8YA 3OAAD 1ZP6A 1ZJ6A 1NVXQ 1KK0A 2E9SA 3PUVA 1SGWA 3B1WA 4KYUA 5JLJA 3MWJA 3ZVRA 3BAFA 5FPKA 4M8NE 4Z8XA 4MGZR 2QN6A 5CB8A 2CLDX 1G21E 4Q7KA 4A0GA 3K53A 3T1OA 1EX6A 1ZINA 4MH0R 2QY9A 2LCFA 4KBFA 4LBVA 1KMHA 4HB0A 2CL0X 1W4CA 4Q4JB 5AK0A 1Z47A 1OFIA 3JVVA 1EFRD 2ZR0A 3QKUA 4RVCA 3LVQE 2ZRMA 5KSPA 2FSGA 2VHJA 2ZRBA 3DO6A 4NE2A 2W6ID 2X2EA 3FMOB 1IN8A 2ZS7A 1LS1A 5J4YA 1KI4A 3FKSD 3GLHB 1GNRA 2EYQA 4BE7B 1ZMXA 2QPTA 1QRAA 5CM8B 5FBLB 2FSFA 2ZYWX 4C30A 2JATA 2GXUA 3WP0A 3KQHA 1MH1A 3L82B 3EX7C 2IF0A 3T15A 1CIPA 2WAYA 2ZSDA 1A2BA 3JVUA 3QNUA 4IEEA 3X1XA 1E2HA 1EFCA 1PUIA 3D7MA 3CBQA 4XD7D 5C18A 4LX0A 4PO8A 5K8LA 4EIWA 4IDHA 3GLGB 5CM9C 4Q47A 3VKGA 3AVWA 4F4JA 2WKPA 1DAGA 5CDFE 1R5NA 1T5LA 5KSZA 3H2YA 3TSWA 1MKYA 4KFRA 3L0PA 2HCBA 4TN1A 3KKQA 1MOZA 1XD9A 4QNRA 3TSOA 1OB2A 3AKCA 4A92A 3HJNA 4QL3A 3TUIC 4XOIA 2ZJZA 3GJ8A 3THOA 2EWVA 3U3RA 2O8FB 5SZIA 1I4DD 2J0VA 3UMRA 1N25A 2FGJA 2PCJA 2XNDA 1CRPA 5BN5A 5FBWB 5DNYB 4GFDA 1C9KA 4I1SA 5J5CA 3GMTA 3CX7A 4UXIA 1E2LA 4AYXA 1KK3A 4PZYA 3MWKA 1KI8A 1Q22A 1NLZA 4NP6A 3SJZA 1N6KA 4X8MA 3B9PA 4MKGA 4DLWA 5C2JB 2R6FA 4HUQB 3F3YA 2NG1A 2JLQA 3JZMA 4LJ8A 1KY2A 3LD9A 1TF7A 1OT3A 3U7FB 1OF1A 3A1TA 3T34A 1HY3A 4EFNA 3NHBA 3THXB 3BB4A 1A1VA 4QJ4A 5E3HA 3LY5A 2ZI5A 1AS3A 2Z0MA 3NDPA 4B3GA 1P9RA 2OAP1 2WWHA 3RRMA 1CS4C 1OXUA 3HR8A 4E09A 1JXOA 4GDFA 2B92A 1QHNA 4DRZA 4ZKDA 5BN3A 2X2FA 1OXVA 2AWOA 2B6HA 2B7CA 4LZZA 1E99A 4OQNA 4B44A 1B23P 3TNFA 5EJEA 4US1R 5FL7A 1S4QA 2IYQA 4YQFA 1IOZA 1KK2A 2CBZA 3TUJC 1KZGB 1AK2A 4D81A 2BBOA 2CVFA 1Y63A 1JQLB 4GNKA 1N5KA 1A2KC 2H1LA 2HT1A 2O8BA 2FPMA 4LYHA 2FFQA 2RGXA 3GJ4A 2EFEB 2IS2A 2CCGA 3HWSA 3PUZA 1VG8A 5CYOA 1T8TA 2KWIA 3A4LA 1RKBA 1KI1A 3EWSA 1DAFA 1OLOA 4HZUB 5K8TA 3B5JA 1QHSA 3KJEA 4NHOA 2BHRA 4Q21A 1A7JA 3BK7A 3QEJA 1CR2A 4WVFA 3TVDA 1CJVC 1ZNWA 1ZD1A 3EXAA 3P4XA 1W2GA 4QGFA 3U60B 4LC1A 3EC1A 2LWIA 4P4UA 4TL8A 4LJ4A 5EXPA 3TSZA 3X1WA 4XIGS 3IILA 4EUNA 3MLEA 1ZD8A 2ATXA 4G1UC 4OJQA 4Y0VA 3IIMA 3Q72A 1OIXA 4FMCF 5DN6A 421PA 4ABYA 3U3MA 1EWRA 2VSFA 3EA5A 4W5WA 3ZS8A 1U90A 1OFTA 4EAQA 1JR3A 3VR6A 4BLTA 2C99A 1COWD 1Q57A 3TAUA 1U9IC 3HPQA 3KZ1E 2JLRA 3ADDA 2OCPA 1AZTA 4R2IA 4RY2A 2FWRA 1KHTA 1N5IA 2VRWA 3IPXA 4XWKA 3RRZA 2ZE5A 4Q1BA 4DCSA 2G0NA 3BOSA 1F5NA 1MR3F 2CE2X 1FNNA 1P5ZB 3OIWA 3Q5EA 3I1FA 3IBGA 3L8YA 4W7SA 3SC3A 2XXAA 2YHSA 4KFSA 3RNLA 1GRQA 1IXRC 4OI1A 1VMAA 4Q18A 5EP3A 1QHHA 3KJIA 1C4OA 1SXJB 4AURA 1I4TD 3FHCB 4G5OA 4BZXA 4QFMA 5HR5A 1XTIA 2BBWA 1RC8A 3OHMA 4KO8A 3K0AA 4NBSA 5JHGB 2J0UB 1MO5A 2IYVA 5G3ZA 5JWOA 1TU4A 2DWPA 1YZGA 6Q21A 2C04A 3SHWA 4B74A 2FZLA 1QHXA 2ZYVX 3AGPA 5GJWC 3T61A 3UATA 4BASA 5BQ5A 4AKHA 2G88A 4PTLA 1SXJC 5JS8A 2VH5R 5TDHA 1D9XA 1O3YA 3PUYA 4TYWA 2OT3B 3VKHA 2IT1A 4DDUA 4TQUS 2HYDA 1A4RA 1KO7A 3PENA 1HV8A 3BC1A 2O8EA 4A2QA 2GK7A 3MAAC 1L7VC 2PX0A 1OFHA 1PLKA 2QAGB 3WRYC 4KCGA 4FIDA 4OI4A 2QQ0A 1WCV1 1NI3A 4B3DA 2BBTA 3UPUA 2VL7A 2YYZA 4LJ6A 2ZRIA 5TVKA 2CK3A 1BMFD 2VLIA 4TMVA 3EC2A 4TSFA 3SYLA 4TSFD 2IEYA 3RRNA 3QJYA 3W8NA 2BVNA 4M9QA 5EP4A 3GLGE 4HLUA 3W9YA 3F0TA 1W46A 1G6OA 2XNSA 3QPVA 5B2ZA 5JWHA 4B35A 4C0QC 3OFNA 2CL7X 1VCNA 3FGNA 4CEJB 1Z0AA 3A1VA 2ZRKA 5FUXA 1W36D 3T1VA 1CF4A 1YZNA 2H57A 3QEOA 5DISB 2CXXA 1HQCA 2P2LA 4NONA 3T35A 1WXQA 4PSVA 4NCNA 1J8YF 2RGEA 3B1ZA 1DAIA 1NVWQ 2BMEA 2C8VA 1GVNB 1II0A 1NG9A 1YRBA 4NYJR 1KMQA 4C0KA 3CF0A 2AX4A 5EZ6B 5KPDA 3P26A 1UADA 1F6BA 1GAJA 4QGAA 4IHQA 1D5CA 4ESHA 4RZUA 3FKSA 5A4JA 5F98A 2QPAA 1XXHA 3AB3A 3PUXA 2JGNA 1T3LA 1QZXA 2XEXA 3ZQ6A 4NDZA 2GRJA 2NMVA 3WMGA 3PCRB 2WOJA 2ZU0C 4I1VA 2AKYA 4Q48A 3VR2A 4BECA 3CWQA 1G18A 2UKDA 5JCZA 3AUYA 1E0AA 3H4MA 2J3EA 4KAXA 1ANKA 4AG5A 1HT1E 3FOZA 3Q7PA 2KBFA 4AIIA 4IDOA 1P9WA 2IYRA 3PIRA 3QXJA 5H1YA 4BZPA 4CRWB 1S9HA 1T3SA 1GDDA 2XTMA 3KKOA 2UZIR 2IYTA 2NIPA 3B78A 4NL4H 1OIVA 4HLDA 1W49A 3VU9B 4TYPA 1G8YA 4ASUD 4QHYA 4DJTA 1EESA 4R2HA 1FQJA 1T8UA 1ZBDA 4M1MA 5C4MA 1Z29A 1E94E 1KMHB 4RD3A 4WBSA 4OK3A 4A8JA 3E5HA 4G5RA 2Q3FA 1W5SA 5GJVC 2RHMA 4RKFA 3UWOA 2GCOB 3VQTA 2VHUA 1E2JA 3C8UA 4AG6A 2ZS8A 2GAAA 4POAA 3TK1A 5JFGA 1XTKA 2QE7D 4HB2A 1W48A 1S0UA 3OESA 2JASA 3D3QA 1G7RA 2CCKA 3U61B 1NSTA 3FVQA 2AKAB 1RVDA 2R6DA 2ZUCA 2IWRA 5A5GA 4Q9JA 3HR7A 3RS0A 3A1SA 3BXZA 4QNMA 5FL7D 5JJKA 1R4AA 3LBIA 1FOEB 2UZ3A 3RHFA 5IF9A 2OUKA 2WOOA 2Q3HA 3I73A 2ZRFA 3CRQA 3LLMA 5KYKA 5AUNB 2ZJBA 4FINA 4HLUC 2YINC 3KUCA 4ZI2A 1W36C 4G3XA 4ACBA 4MUAA 2YC4C 4Q4AA 4B71A 1DAKA 4NCHA 1L8QA 1HEIA 1U0JA 2D4HA 5JEDA 4L16A 2PMKA 1OV4A 1JR3E 2WJIA 1NNEA 2RGGA 2FJUA 1P2SA 2C78A 4URWR 1QF9A 1NP6A 1YZKA 1XBTA 4M4SA 4AKGA 1E1QD 3IBYA 3QKRA 3C15C 2A3RA 4XSHA 2JA1A 4FCWA 1E2EA 1CLUA 3U7HB 1KGDA 3FE2A 5EE1A 2C98A 1AM4D 1VKJA 2FX3A 4IFBA 4PC1A 3AVVA 3DOEA 5TB5A 3AVOA 1IY2A 4LBYA 1PUJA 1VHLA 3C14C 3T5GA 4XWOA 2G77B 1AKYA 4H9GA 4RD1A 3M4YA 1P73A 2WTUA 4XVRA 4LHXA 4LCBA 3U5ZB 2QMOA 4UNQA 4IVQA 1MRNA 3DVLA 3AVPA 2O0KA 2BEKA 2DR3A 4HAYA 2GHIA 3KL4A 4MA4A 3LXRA 3KTAA 3B9QA 2X19A 3E70C 3GCGA 2AWNA 3QXHA 5C1BA 4B75A 4X8LA 2F1HA 1MO3A 1RFLA 2YWFA 4JSTA 1BH2A 4NPHA 5GADl 5KNBA 1VYTA 4XJXA 4YMWA 2QMUA 1WE2A 1KIMA 2ORVA 3ETLA 5LPNA 1KDTA 2QMEA 4FW9A 4JLOA 4AC9A 4NYMR 4HDCA 3EIEA 2Z4RA 5FOXA 2D74A 2QT1A 1XX6A 4II7A 1E0JA 2P5TB 1GP2A 4JLMA 1UDXA 5EXSA 3HU3A 1AQUA 1U9IA 1FW6A 3VFDA 1UBFA 2OSBA 4DDWA 4C9BA 4R71A 4KBGA 2AD1A 4Q1EA 3I72A 1SVMA 4PPGA 3F5FA 1M8PA 1Z0KA 3C4JA 4PHGA 4DIDA 4LI0A 5TMPA 5E95A 5IT5A 2AD5A 2QTFA 2WPDA 1N6IA 2XTZA 3QG5A 2GILA 2ZPTX 3ZH9B 2ZAOA 3DM5A 2P6UA 5EP2A 2C9CA 3CH5A 2RGDA 1OSNA 4XH9B 3DOFA 3FWYA 1UAAA 3MSXA 2O52A 1W4RA 3Q5DA 2BWJA 5JMTA 1S3SA 2G3YA 4L9SA 3Q85A 4LRWA 5JS7A 1TQ4A 3T06B 4PPNA 2BOVA 2VP0A 3CRW1 3NTUA 1N5JA 4ZDWA 4LJYA 4IJMA 1XJQA 2ZE6A 4LHWA 2BKUA 5UKDA 1R8QA 3W3ZB 1W1WA 1ZCBA 4NKRA 3GQBA 1HQYE 4CGZA 1W4BA 5IK2D 4PO1A 4UNSA 3KX2A 4ITRC 1E98A 2ZRDA 4P31A 3R7WA 5B64A 5LDDC 3DM9B 2YWHA 3O47A 2A5JA 2ZSBA 4LC0A 1KJZA 2HLDA 3IO5A 4NCIA 4QBFA 4JJKA 4QBIA 5FTJA 4BEJA 1G8GA 3U6BA 2ZVQX 4JT2A 2H18A 3EPHA 2YZ2A 3PEWA 1KDRA 1TQ2A 3PEYA 3CF2A 4FMDF 2OLJA 4B34A 4Q19A 4YXWA 1P4SA 3GFOA 4N0EA 2WSSA 3L0IB 4TTRA 1P61B 5GVSA 1UPTA 4JBXA 5DI3A 4YMVA 1AQYA 1CBUA 1XB2A 4CIDA 4TZ6A 4A36A 4HAZA 2ZAMA 2V3CC 1GNPA 2WWGA 1SKYE 2OCYC 5HCIA 1DAEA 1W0JA 4BFXA 2VA8A 2O8CA 2XITA 3SQXA 4AI6A 3V4RA 1IM2A 2FZ4A 4WZ6A 1JEDA 2R6AA 4F92B 5FUWA 2OEPA 1XXHB 2XX3A 4HATA 2WWIA 4PQYA 3SOPA 5EE3A 2FH5B 4FWTA 4EJSC 3K9GA 4Q1FA 1UBGA 3TR5A 3K0SA 4US0R 1N6LA 3BE4A 5BYJA 2QAGA 1ZNZA 1IAQA 2IC5A 3CLVA 3WYGA 4LOAA 5IDVA 2FSIA 4WZAE 2O8DA 3NKVA 3CPHA 1JAHA 3KKMA 4HB3A 1DARA 4DLTA 3ICQB 4Q9KA 5IRCD 3CNLA 2DFTA 1G291 4EPXA 1E3MA 4MRPA 2H5EA 4DCNA 3W6PA 2ONJA 1U0LA 5DH9A 2QAJA 1FP6A 1G8HA 5FH9A 3K0FB 4JMPA 2WIBA 2YC2C 1T5IA 1YR9A 1K8RA 1LS6A 1XEFA 3GD7A 2IEZA 2EWWA 5P21A 4TQAA 3KB1A 4NH0A 4V0MA 4EKDA 5L3SA 3NWJA 2PZEA 3CONA 2O0JA 2HXYA 2D7CA 3TQFA 1XTQA 4IFEA 3WYFA 2WWWA 3DKVA 4I1OA 2J87A 5KNDA 1D2EA 4PC2A 3GLIE 1ZVQA 4P4SB 4TLAA 4I81A 4A8JC 3IKJA 4MGKR 4HZUA 4O2LA 5K8IA 3AVTA 1DVRA 1V5WA 2GXAA 3OEED 4Q9LA 4TMTA 2FA9A 3QKRB 4GI7A 4JYCA 4D4LA 4OHXA 1H8HD 3A8TA 1G64A 1Z2AA 5JI2E 2IXFA 4B6EA 1UBCA 2VPPA 5ELXA 2F43B 3SN6A 2HEIA 2PX3A 2VHCA 1KK1A 2ZRNA 3IEUA 1II8A 3LX5A 4BFYA 4PC7A 4ZDIA 2IYUA 1A82A 1PVOA 3NC1C 3GLHE 3G0HA 2A30A 2YNMA 1NVUQ 1ZW6A 2GAOA 2Q9BA 4OBEA 2R62A 4CW7A 1LF0A 4V0ME 1OFUX 4RZ3A 2PH1A 1NMXA 4FMDB 4G0NA 5TXGA 1UFQA 1E79D 3WHKA 4NMMA 3AVXA 2P67A 1BO6A 4CT4B 2A2ZA 5J4KA 2QM7A 1OXTA 1Z8FA 3B13B 2CDNA 2ZEJA 4YONB 2BC9A 4ZCMA 1DPFA 3TMKA 2VYFA 3AF3A 3N2IA 4B3FX 3KJHA 4UJ3A 3K70C 2VP4A 2RGAA 3MWYW 3LRPA 3NBZC 3WNBA 3U4QB 4NCKA 1RW4A 4Q4AB 3TRFA 3OE7D 3O8CA 5HTKA 1N3BA 4DB4A 4MYHA 1J90A 4BWYA 1VECA 2OZEA 4M0LA 2HF8A 3GJ0A 4IDPA 4KHZA 1NIPA 1OJLA 3CX6A 5CJ2A 1J7KA 1NMYA 2W58A 3N5CA 4LBWA 3KQKA 1VYVA 1Z3IX 3OIUA 4O25A 1VCOA 5AJYA 4IOJA 2J0QA 2GXQA 1GM5A 1NSFA 2OBNA 1SKQA 2PBRA 4WZBE 1G3MA 5LB2A 5GVRA 4DLSA 2D2FA 3VX3A 4WAUA 3VMFA 1GITA 4D4MA 3SYKA 2RKOA 4WOPA 2ZIAA 2XJ4A 2H17A 8OHMA 2CE7A 1E9EA 4OI2A 2F1IA 1MO4A 2KSQA 1N0WA 4FXPA 4BPBA 4DUGA 2VF8A 3CRVA 2PT5A 1Q0UA 3QIAA 4M22A 4AWXA 1OB5A 1VG0B 2V4ZA 1FMLA 2OLKA 1XTSA 1J8MF 2P6NA 3CIOA 3AF1A 1P2UA 1Q1EA 1QG4A 3PITA 2JJ2A 2F55A 1XEWY 2FEMA 4I99A 4DDTA 4TYYA 4N1AA 5FTLA 1F48A 4GT1A 3SFVA 2GESA 4LYAA 2GJSA 1H65A 3RSLA 2ZETA 4IXNA 1WB9A 2GETA 4QC2A 1US8A 4M1OA 3BFKA 2C9YA 3CR7A 3O8DA 2QNRA 2Y8EA 4GOJA 1GL6A 1TUIA 4P32A 2WJYA 3WY9A 1D8TA 4XVUA 3QVUA 1HUQA 1RJ9A 4OQXA 5BW8A 2GCNA 5KSYA 1SZPA 2FGKA 3SFZA 4D82A 3AEZA 2ODNA 1KDPA 4N3NA 1LFDB 1I2DA 3QI2A 2EVWX 3AKEA 4JKIA 4KFUA 5B57C 2E1RA 3PQCA 3RANA 4C7OB 1O87A 1W2HA 2RMKA 4IXMA 5JBQA 2IS4A 1N5LA 2W83A 1N0VC 5LD2C 1AJEA 2NO0A 1XPOA 1ZM3A 2WKQA 2GBLA 3UWKA 3LXXA 3LBHA 4LHYA 3ASYA 2IF2A 4DLRA 4ZV4A 3U44A 1BYIA 1UJ2A 2AK3A 3IUYA 4D0NA 3R9XA 4E03A 1M34E 4KSCA 3SU8A 4F93B 1S96A 4GSYA 1Z06A 1E0SA 3CF6R 2GKSA 1YQTA 4C2TA 2A7QA 4DHEA 5LD2B 4P3YA 5FI1B 2ZUDA 3DZ8A 1U2RA 5KDDA 1OH8A 5FBQB 3BB1A 1OH5A 3I5YA 5CK5A 3K8YA 2NGRA 1E4YA 1PV4A 2RAPA 3HU2A 3U7EB 2CK3D 1KAOA 2J9RA 4DSTA 2QGNA 1IN6A 3U3KA 5JSZB 2J0SA 5M04A 1KO8A 4V0KA 3DKPA 2ZRJA 1YR8A 2NQ2C 2AR7A 2WWFA 3MRSA 4V0OA 3JZAA 4BFVA 1KNQA 1CKEA 1Z6AA 2V7QA 1J70A 3A36A 4O2RA 4JLKA 2XOKA 4A2WA 4ESVA 3AP2A 1YZUA 1D6JA 2HLDD 4KVAA 4FWIB 1ODFA 1CEEA 5KDLA 2GEUA 3C41J 3ZJYA 1U8ZA 2ZSFA 3AKYA 2W6JD 1AGPA 1G19A 1R5BA 1T0JB 1WBBA 1UM8A 4AD8A 4D0LB 5FPTA 2JLXA 2W0MA 5KPJA 1HA3A 2PJZA 5L3QB 2ZITA 4P0TA 3THYB 1XMIA 3Q8XB 3AM1A 3QQ5A 4DSUA 3OZXA 4ZIRA 1IY0A 5DGXA 3LVRE 3AP3A 1E9CA 2ERXA 4DCTA 2GDJA 1G3QA 3B82A 1NKTA 5EQTA 1UBEA 3V4FA 2QM8A 3B8HA 1VG9B 821PA 2H7VA 4DB2A 4QKQA 1DAHA 2QP3A 1KY3A 1KSFX 4TWZA 1OKKA 3ADKA 4A15A 5DO9A 2ZSAA 1LNZA 1FUUA 1KO5A 4IVPA 2GWHA 3IIJA 3THWB 5G53C 3GEEA 3G5UA 4OHYA 3T1TA 5D3QA 3VR1A 2FF7A 2NO9A 1TL7C 1XTJA 2P3SA 2W2TA 4U00A 1GKUB 1JJVA 1P9NA 2NO6A 3HU1A 4HSEA 1QHGA 2ERYA 1GRNA 1FP7A 4DKXA 3KXIA 2IYSA 2PZGA 1ZNYA 3CRMA 4CVNA 4TYNA 2IHBA 3ADCA 4EDHA 5LBIA 3BRWD 3UIEA 4B2IA 4DLYA 5JSZA 4URYR 3RC3A 3TQCA 4TYQA 1KI2A 4F4CA 2DPXA 3GLFA 1SVKA 1G3UA 2QE7A 1IBRA 3Q3JB 3LLUA 2OCAA 2GJAA 1UKEA 3A1UA 1QBKC 1GTVA 2OFXA 1XCMA 3BORA 3P1JA 1LY1A 1T3HA
chains in the Genus database with same CATH superfamily
2QU8A 5CBPB 4EB8A 3HBAA 3AY7A 4AUKA 2CJWB 3NOVA 1C9MA 1JKJB 1UK7A 1WUHS 2SKDA 4CU2A 2RD2A 2ST1A 4HXYA 2DHRA 3K9WA 5KX5B 3AF0A 4QAJA 3WDSA 1I33A 2Q3JA 3FROA 5ECGC 1GAXA 5DBGA 2WG0A 3RBZA 3CUYA 1HTBA 1NMZA 5DMHA 5EKSA 4UTXA 4A8TA 2IY7A 3WLOA 3K5WA 4YUXA 2BGIA 4JBGA 2BZGA 4O4LA 1OCEA 3FG9A 4JITA 2AVDA 1NVKA 3VR2D 2ZK7A 3YASA 3RVMA 5AOVA 4CYMA 2BEJA 1UDCA 3K0HA 4EW2A 5IMSA 1ORWA 1XMJA 1EX1A 7REQB 4F11A 3RABA 2B8TA 1BMQA 1YMQA 2GYUA 1WDTA 3JD3A 3U26A 4B6FA 5I01A 3F1LA 2PQ6A 2Q4RA 4B4UA 1WULS 1U2GC 2AN9A 3AC0A 5EJ9A 2AG8A 3PKZA 2G5TA 4E6EA 2RBGA 1WKBA 4K8OA 4LXQA 3UMMA 3OCJA 5F1YA 1NX6A 4G0MA 4MUJA 1W59A 3L6OO 2RGUA 3AGQA 4LS3A 1ILEA 4PXYA 4Q4JA 4X64B 1BKDR 4YRZA 2ORIA 3KEMA 2I6QA 3HUDA 3V4SA 5B6IA 2RB5A 4F91B 2MSDB 2ZZNA 1YBHA 2R6GA 4MYUA 1WCWA 4QSHA 2XECA 4RELA 5I48A 4MWCA 1P39A 1DDGA 2UU9B 1VIYA 5C8YB 4W4TA 3A1CA 3S2YA 5JHHB 2RHRA 2H7XA 3RAFC 3PJGA 3SMVA 2EJWA 2P68A 2C7QA 2F1JA 2IOHA 1CNEA 1HORA 2FPLA 2CVQA 1Y4UA 3OKPA 5B58T 1XD2A 3FDJA 1NJ1A 2BFOA 3BMOB 3NOQA 1O54A 1QE0A 3BIFA 1MEEA 1EJ6A 4MZXA 1T9AA 1S3GA 2CGEA 4JJ6A 2F9LA 4A6DA 2O54A 4O5OA 4PR3A 3EZ7A 3MLAA 1SHKA 1MX1A 3O8BA 4YASA 5EIBC 2ZJ8A 3UVEA 2O1EA 3I4CA 1CNMA 1YZLA 3PD7A 3Q8WA 5SZHB 3NYIA 1Y89A 4AK9A 3Q3HA 4WERA 4LJSA 1UEIA 4UKDA 4TXHA 4FUQA 4L27A 1KVQA 2I4IA 2PMDA 2WD8A 2WJZB 4NU0A 4CM9D 1Z6PA 4TLEA 3S7TA 2CFIA 2F8LA 3HBNA 1OGYA 3HFGA 1S1MA 5L6MB 1R16A 4YMGA 3O31A 4YV2A 2LV8A 1JKJA 2NYVA 4ZAWA 3ZDCA 3IMFA 1ZM2A 2ZYRA 2X4LA 4YAFA 5BURA 1QRUA 2F7SA 1GY8A 4HRYA 4JC8A 3ZY4A 1QK3A 1TA4A 1H9CA 1KI6A 2XR1A 3BSYA 1QBGA 4KUHA 4QJ5A 1XU7A 5G0TA 5T6MA 3R40A 3UK0A 2C7BA 3WDLA 1F2TB 2R48A 4OGKA 5BV7A 1EM8B 2CVZA 3BRSA 3VTKA 2VOEA 4GXQA 2IK8A 1EKXA 2N42A 3Q3VA 1R4ZA 3C3AA 2WA2A 1GR0A 4U39A 1M2OB 2ZSJA 3IS3A 4I1IA 2P2CA 4L08A 4MV7A 5AVTA 3DZJA 3DDZX 3TZBA 2XWSA 2I71A 4DLZA 5JD6A 1ML4A 4Q15A 2A9PA 4ABTA 4QOGA 4BTEA 4KZKA 4CMJA 2YZMA 3CO5A 2PO5A 1G59A 2SCUB 4WY8A 2G8NA 3EWAA 1OJ7A 1I3OA 5DYGA 4Z5XA 3VHLB 4GPAA 2PSDA 2WZDA 2VWQA 3AERB 3BH7A 3L7AA 3NV9A 4KMMA 4NFLA 4NZMA 2YXNA 3WOHA 4RFSA 3VISA 1IVSA 1HQKA 5EGSA 3D8RA 3UW3A 5C37A 4NXNB 1TJ4A 2J6CA 1T2NA 5EQFA 3Q10A 4F5ZA 2QSYA 5IT4A 1PJBA 2R3SA 3OUZA 4KQWA 3KAPA 5DMXA 4FFWA 4EG3A 3NONA 1TIKA 1ZRHA 2E7ZA 2J0UA 3A4TA 1U6KA 5I8ZA 2WFLB 1EE1A 3KZMA 2C94A 3E3NA 1HDYA 1MO2A 4K6MA 4MVJE 3ZE7A 3ZKWB 4FM9A 4EFDA 1IRXA 3HBMA 2XYVA 3ZBUA 2J46A 4MWDA 3TINA 4PG7A 4X44A 4MAAA 4LHZA 1XSEA 3K2IA 4NOJA 3E22B 4Q1AA 5KJCA 1JQJC 3IOCA 3VSEA 1QF7A 4ZA2A 3OE5A 3PYLA 1BDJA 2I7DA 1G4HA 4UD2A 3NHRA 1RJ9B 3TQRA 3PQEA 3OZWA 4B3CA 3ILVA 3MS4A 4IIVA 1KYZA 1U5AA 4QUBA 1UBTS 4AYTA 5JT1A 2FKAA 1T4GA 2ZXFA 4J94A 3KPJA 4QJ3A 1PFYA 1ZGJA 3LGXA 3W2FA 1ORDA 2Z08A 3IR5A 4KX3A 1P6UA 1QAOA 4FEEA 3U3JA 4A1FA 3KJGA 4D8UA 3Q9LA 4BGDA 2ZRGA 2ZVPX 3RVBA 2NTYC 3ROFA 3KALA 1SC9A 3RSQA 3DCYA 3ML1A 2DYKA 3PEVA 4NBRA 3OO1A 4XFJA 1Z0DA 3STHA 5AVSA 1Z08A 2BUBA 1QKJA 3BCHA 4C0AC 3RYTC 3OM8A 2PA3A 2BHSA 2YOFA 3AVQA 1TPZA 1QIFA 3INNA 3TB6A 4FGUA 2Y9PB 3DVAB 1IN5A 1PUXA 3K9QO 2F3PA 4OFXA 3DR5A 3MSCA 4X3CA 3EQ8A 5DE3A 2B1GA 5F3DA 3T7RA 2J1LA 3STVA 2O5VA 4KQIA 2OHXA 4MS4B 4UNPA 4WINA 721PA 1F2VA 1I1QB 3IBFA 3ASZA 5EPUA 4OB8A 3CGWA 1H6CA 1UINA 2YWBA 3C48A 4EF5A 4CIBA 4CL8A 1R37A 4XWTA 1XRNA 3NWPA 4KGZA 1E3SA 2R2AA 3NP9A 5H16A 3G2IA 4CF7A 1OROA 3D7KA 5HKKA 2QZZA 4RH0A 3WLLA 2A9JA 2B5WA 5FNVA 2C8LA 3OQIB 1T9DA 2C2GA 4ZVTA 3OQNA 3GLTA 1GSIA 3LO5A 3KAKA 1B8PA 3PI6A 5CT4A 1LBIA 4DPMA 3DE2X 3ZXIA 4BQNA 1C3OA 1H2YA 5AJXA 3H6HA 3IUQA 1EUQA 2HJGA 3O3MB 1BGVA 1H2BA 1TJPB 5FYQA 2PE5A 1ESMA 2OQ2A 2C9OA 5KYTA 1WP9A 1T2AA 2V45A 3M4JA 2PYIA 2YFYA 3GBSA 4DV3B 1IB6A 5M3BA 3OPYI 3KZVA 2HRZA 1LH0A 2I91A 1CJSA 3PZRA 3KVRA 3ZY3A 1FZQA 4BKUA 4IOMA 4F96A 4KFTA 5EERA 4PWZA 3K9NA 5B7NA 4DBZA 4RIIA 3LHIA 2WSYB 2Y0EA 2R79A 4WUTA 4ZYLA 1AXGA 3D8HA 1KFEB 4EHAA 2EFYA 1S3FA 3WKDA 1SHZA 2XQFA 4X1IB 4DADA 4YDHB 3CCFA 5ALSA 3NAZA 1AS0A 1E9FA 4J1TC 4UVEA 1AIPA 5EAIA 1TE2A 3LK6A 3G2LA 3Q7EA 5E6SA 1J20A 1P17A 2KQUA 3OBBA 3K4PA 3QUSA 1UFRA 1THTA 2H9IA 5EJIA 3KOMA 3QU5A 3SQWA 2JEYA 4NARA 5SYMA 3W6NA 2DERA 1Z6XA 2AHOA 4LF6B 4AP5A 4Q9DA 3SHTA 1VFPA 2Z9CA 2MYPA 2VXBA 5KTYA 2C5SA 2WU8A 3E9EA 3T5AA 4ZOEA 3GEMA 3EASA 1LI7A 1OXSC 3I6YA 5KHOC 3AY6A 1IY9A 2WJVA 1MABA 4JJGA 4L0QA 1KAQA 3EXG1 1P7VA 2X8AA 3WLTA 1NURA 2QLJA 3K2BA 4MVJP 4L6IA 1PS9A 1MD9A 4RW0A 2UVPB 5JJLA 4QYMA 3IDAA 5I9TA 3QOFA 2CWDA 4IBOA 1PN3A 4KDRA 1RZ3A 1X7YB 5J4VA 1QO7A 3H8JA 4QEZA 1DCKA 1HF3A 1C1YA 3DL4A 1V9CA 5TMBA 4M0FA 2IHYA 3RRBA 3WWPA 4X65B 2VI5A 1UR5A 1NBME 1SCDA 1EXDA 1EVYA 3VC7A 3L6DA 3MXTA 1QIMA 4N3CA 3R0IA 5AJZA 2RHBA 1AOXA 1G16A 1XA0A 1L7XA 2PQ0A 3QVGA 5IXYA 4PX2A 1KU6A 2N46A 3DF9A 1BXZA 2DJ5A 4ZC1A 1HDOA 4ZI3A 1HE2A 4DBLC 3HP1A 4JT8A 1KEKA 3WGVA 3BXOA 3C7AA 4DQLA 3C3MA 3FCCA 3UUFA 1ZOPA 1RWBA 4HGRA 2FPGA 5K0BA 4NBTA 5A1TA 3WMEA 3PXAA 4Q34A 3AL2A 2RGRA 3EDQA 3JVDA 4GEGA 4FDUA 1UPAA 5EHXA 2Z6UA 3DH0A 4LSGA 2JJ8A 3FPGA 2NZUG 3HRIA 3FLAA 3IQWA 3V7FA 3LY8A 3PFBA 3BBLA 4DLXA 3NHAA 3WQSB 4RD4A 5AW0A 1CJKC 1ZVKA 4IIXA 7ADHA 2WTXA 3KQTA 1G0NA 1ZCFA 3G82C 1JWBB 3G5TA 1HNXB 1NN5A 4TKVA 4AY2A 4DV2B 3BH0A 2QE6A 3MUFA 1YRLA 2VYQA 3X44A 4B2LA 2VN8A 5EJ7A 1KDOA 4JEHA 5EIEA 4DV1B 3ROQA 5FEMA 1LJLA 2Y68A 3HKCA 4HH0A 4O3MA 3FRIA 2QZ9A 2PJRA 3ETEA 3AESB 2AA3A 3H16A 4H0NA 4I50F 1D2MA 1SKAA 3FFWA 1SVSA 3QZUA 2HCRA 5B2EA 1V37A 3AF2A 2OMKA 4HXGA 2FG5A 4ZO7A 5AXDA 4DA7A 4KI0A 4DT1B 3STTA 3PPYA 1CP3A 4V3CA 1W8IA 4Q03A 4ED9A 2AE2A 3N6RA 4FHCA 4JT9A 3CSSA 5CA0B 5EC8A 3ETGA 4BLRA 1PR3A 1Y4SA 2PKCA 3GXOA 4NCXA 4EYSA 2ZVJA 3GFGA 5FHRA 1H5NA 1QGZA 1GUBA 1GZDA 4DT1A 1WHTB 1GFWA 1RCFA 2P79A 2R6JA 4LJ5A 1JQKA 3OEEA 5CVDA 5D3MB 3ZJTA 3HPRA 1U8AA 1SOWA 3LX8A 4R98A 1VI5A 1EAYA 2H07A 3GRPA 4I9UA 4G97A 3JQAD 4KE9A 4ZZ1A 2FWAA 2FWIA 1X0XA 1LW7A 4MPTA 5IJWA 1KBQA 4AIRA 1Q0HA 1KKLA 3H9GA 1U7HA 3OIYA 1NF2A 2D7DA 1XZMA 2JF0A 4PPFA 2FW9A 1Q1GA 4IPTA 1JYSA 2QEQA 2ZUBA 3NBYC 4PR0A 4Q24A 3W79A 4LV6A 1G4UR 3FUXA 1G3RA 3QNMA 2X3UA 1SZDA 4XZ3A 4RVGA 4KNWA 3RVJA 3JRNA 3MPOA 5KCMA 5TRTA 5HCNA 1DBWA 1VZ3A 3O4HA 4MW7A 3F7TA 1EK0A 3T5DA 4V38A 2AK2A 1M0TA 5EESA 1L7QA 3U37A 4A3SA 4CM3A 1WW3A 2G9VA 3CT6A 3JQAB 5C46F 1QGOA 5KKCA 5DYNA 3OFVA 1IEWA 2DWQA 1L5MA 2H4HA 2C92A 2QRPA 4OXQA 2K5UA 4RPIA 4DSNA 4RTSA 1EUYA 1QCZA 1T0HB 1HT2E 2V9ZA 1M2NA 3AESA 5HQJA 2Q1YA 5EIHA 3U80A 1SIOA 2JBAB 4I9FA 1PGQA 1G2OA 2B0CA 4JIMA 4B6PA 4XB2A 4D3ZA 4UTNA 1NATA 2ZJ5A 1E6UA 1FP2A 1ZOLA 3OJEA 2O2EA 5B30A 4Z51A 3FPFA 2AYXA 3LY9A 4Q12A 5IHXA 3KV1A 1KEPA 2J59A 2XUAA 2BTQB 1A4IA 2YQZA 1OTHA 3L7KA 3ADPA 4FWBA 4TV8B 5KWJA 2YHAA 4JQSA 3UPDA 2OV2A 1QE3A 3TIIA 3H1AA 3ZD6A 3LCJA 4DW8A 3UAVA 4M9ZA 3LT1A 1CDZA 4NU8X 3ASVA 1BXKA 1DKQA 3KR0A 4P5DA 1TZMA 2OG2A 1FU8A 1E77A 1VE6A 1C3VA 2VBGA 1CY1A 1I2ZA 2CHQA 5BN4B 1U0RA 4HEQA 4HKTA 2C00A 4INJA 1W19A 4TL7A 3MQFA 1T3ZA 4BN5A 3GAFA 1HZJA 1DAMA 3I4LA 3TL6A 3TNLA 2C7VA 4M2LA 4Z4FA 5TQJA 1OX4B 1JSZA 1R5OA 2CXSA 5FA8A 1JBQA 4MCAA 4K81B 4RGQA 2OWDA 2PUBA 1XUOA 3LT2A 3G7SA 2I3BA 3K05A 1XCPA 4Y6QA 1BXRA 1J49A 3OCXA 2SKEA 3KRTA 3T3EA 2VTDA 4DGSA 3JARA 3RF7A 4JLAA 1NE2A 3W5JA 1ZC3A 4LY6A 1L9KA 2BUCA 1GEGA 5AVOA 3VVMA 2AGVA 1YZTA 1HFEL 3DA8A 3BWEA 1F6WA 1GQSA 1WBJB 3Q0TA 1EFTA 2RDMA 1DWQA 1R2QA 3OF5A 4JNKA 1MQ9A 4JEUA 3AL0C 1CR0A 3SZRA 3FOEC 5IG2A 4QM7A 4Q9IA 3CW2A 1FL9A 1BMDA 1XQ6A 4IM7A 2FN7A 3C7KA 1JF8A 1P2TA 3CJQA 3LFTA 2OHHA 3R6TA 4JN6B 4JLBA 5AW1A 2VSQA 1IN1A 4K9SA 2X1MA 2YVUA 4FR2A 1SUIA 3DMHA 3NBFA 3X2SA 5BPFA 1HSOA 1LKZA 1XPRA 2HSEA 3NIBA 3BERA 4JKYA 3DL2A 1IONA 1JILA 4TXLA 2AI2A 1OLXA 2ZULA 3FCXA 1CUWA 2Y9MB 3ST7A 1ZRMA 1G6Q1 1L3CA 4REOA 2BKVA 2YV4A 3QLUC 4C78A 3WIOA 4E2XA 1V3UA 2C1XA 4JJEA 4TUYF 2V58A 4XSVA 4HBGA 3ZWMA 2GBCA 1F7VA 4RKYA 5K3BA 1PWHA 3H5NA 1TI7A 5AVUA 5IULC 4ZOLB 4K7JA 1PV1A 2JLZA 1SELA 2XZDA 3CPEA 5TNXA 5JDCC 1KDYA 521PA 5ITVA 4Q5IA 4NABA 5EYPB 3TTUA 2WUWE 1NVVQ 4L50A 4PLFA 4Y2PA 1PFKA 3LLCA 3JWHA 4DV6B 2UDPA 4YJGA 1HO3A 3JQFA 2WIKA 2IVFA 3E9MA 1VLVA 3GHYA 3ADOA 3PX2A 5DF1A 3ITKA 2FCRA 4J6FA 4EB6B 4UXHA 4PIVA 1MC8A 4QDOA 3LC0A 3W5DA 3WXBA 1M1XB 1QS0B 4IJ6A 5D01A 4ENSA 1PYGA 1X6VA 2A1IA 4BEVA 4IKOA 1ESDA 1PJCA 2N1BA 2R8RA 4H59A 4ZP1A 4BYMA 4Q7JB 2G9QA 2X9LA 4DQVA 1GRRA 2VH1A 2X7JA 2YJNA 1XAJA 4DLKA 5FOUA 4V02A 4U2BA 2IZ5A 1WQ4A 2QWXA 3T7TA 1U0HC 5BNIA 4EHKA 1QHEA 1MB9A 1VYUA 4KLRA 2HF7A 3OP1A 4IAOA 5TS3A 4C3ZA 3L7OA 1XZ8A 2GCPA 4P4NA 4KKXB 1G1AA 3GWGA 2Z09A 3O3OB 4HZIA 1ECPA 3HEAA 4OSPA 4QBHA 4X90A 4IO1A 3TJRA 4HEHA 2FRDC 4YIKA 1JPVA 3FI9A 1P4JA 3IUNA 2A59A 2FZ5A 2JRLA 2OBLA 3IJ5A 4TLBA 4X7MA 4KXMA 2P1DA 4G9BA 1CUCA 3MT0A 5TV2A 3L4JA 3BIXA 1J24A 3C1OA 3DMNA 1LWNA 4MJ7A 1MAUA 1L7OA 3PX3A 4L15A 5HF8A 2C29D 2V1UA 4K9OA 2ONKA 2A0WA 4GYKA 6REQB 2ZIVB 4BLOA 1SUSA 2F9MA 1ZN2A 3KZOA 3ROXA 1P0QA 2TMKA 5JRDS 1EHYA 3OOHA 4ZZ3A 3TKLA 3IGFA 2BKEA 3D0RA 4MQLA 4REQB 3WGQA 4ARVA 4B76A 5B1YA 4PZDA 2OO5A 2BGNA 3R7DA 3BIWA 3AVUA 3RYFA 3MMSA 4F4FA 1BMTA 1BWPA 3LHSA 3DAGA 4RIFA 3AP1A 4S05A 2IL1A 1O97D 2P0AA 2QRZA 4N3BA 1JDSA 3PGJA 4P83A 5IKPA 4RKQA 5CT5A 1NRIA 4E1VA 3PDUA 2VH2A 1LW6E 5A4MS 1KFKB 1OBHA 2VYNA 1ZGAA 3JZDA 3JD2A 3O26A 5J40A 4WJKB 3BFPA 1PJSA 4K6FA 5CIQA 2IYZA 2OCXA 1PQUA 3AEXA 1W5BA 4BWVA 1MP0A 4OXKA 3S5UA 4B0OA 1OAOC 2RCNA 4HTFA 1CQIA 5H83A 4RSMA 1MXHA 4LPKA 3WYEA 2Z1NA 5I8PA 3W05A 3RU9A 1UM9A 1ZM7A 2BGUA 1T0IA 2GBGA 3LWNA 6ADHA 4N03A 4QATA 4CN8A 2C3UA 4PWYA 4YDSA 1FY2A 4ILEA 2HM7A 2O3TA 3V2IA 4TROA 3CSUA 5KYUA 5DT9A 1Y42X 2FUNB 3S1AB 3Q9UA 3L8CA 2L82A 2PGIA 3NHLA 2G72A 2KMLA 1Y1TA 1W52X 1Z4MA 2E4WA 4WLVA 2I3GA 3RBXA 3P19A 4BHTA 1CJMA 1Y8ZA 5LLSA 4UFOA 5A03A 5BOSB 5DNEA 3KWMA 3ZI7A 1G8JA 3AU8A 3N7AA 5TGDA 2NXCA 1FFBA 5GJCA 2PZKA 1MGPA 3KKPA 3OJ0A 4TWRA 3C3KA 5TC4A 2UYCA 4RD0A 1ZM9A 3PC4A 4JZKA 3ZCUA 1J99A 1Q21A 4V0LA 1T9HA 2QN8A 1O94C 1UP6A 1G5PA 2OAQ1 2V7PA 4FQ7A 4JUDX 4TM8A 1ORRA 2X8LA 2VTVA 3IP3A 5DSZA 3UFXA 1QR2A 5M29A 2C5AA 2D1RA 3CR8A 3NH9A 1CDEA 1U65A 3BHNA 3B8EA 1TQ8A 1W47A 1CXZA 3HV0A 3PU6A 3Q15C 5CVUA 3MYRA 4ZQHA 4F3CA 5C1DA 2A1UB 3UBMA 4IL5A 1TQ6A 3WQQA 5IH7A 1W36B 2IPMA 3O4VA 1H2XA 1UKAA 2O2GA 2PRIA 1N2CB 2WIAA 2WILA 5FULA 3E7FA 3SQOA 4HNUA 1FFCA 4RSGA 4CF6A 5CB4F 4G6ZA 1HMPA 1FMJA 1PR0A 3DTVD 3JYOA 2HWKA 4EYGA 3K8ZA 1AKVA 3WWOA 4W6QA 3L8ZA 4KQGA 2NPFA 3GA5A 3M2PA 4JLNA 1E5QA 4YALA 3ZZ0A 3IKMB 3LP5A 4NK4A 2CLFB 3H2JA 3OZCA 1D2NA 1V3TA 3OTGA 1GKIA 1RP1A 3P9CA 1E4VA 1KEWA 3E9CA 1GJRA 4LG1A 1GPNA 1IC6A 2J5XA 3GJ5A 3A3NA 4ZQBA 5LA6B 5CYGA 1UBRS 1T2EA 3MF4A 4UXJA 1FNMA 1ORIA 3CUSA 4EF4A 3N2KB 2NU6B 3MRVA 1IOVA 1GPUA 4N7MA 3S1AA 3TVYA 3IV6A 5KYUB 3ZY2A 2P41A 4KH1A 4Y0NA 5DIZA 3UV7A 1CQZA 1FUYB 2QYHA 5CW1A 2AW3A 3O95A 5AM4A 4F56A 1QH9A 1B8UA 1VB3A 1UKVY 5CNIA 5H02A 2IHVA 3PRJA 4JA2A 4E3ZA 3W4KA 3RM3A 2YV2A 4MIOA 1KBOA 4IEIA 1NQTA 1GYRA 1XTRA 3JQ7B 4MQ6A 1XG5A 4TZ0A 2XCTB 1XZAA 1Z16A 3EBLA 3EG9A 1K5GA 2JW5A 2BAGA 2F3QA 4OJKA 4XTCS 2VT3A 3MAJA 2BF7A 4NJEB 3M1LA 1RRFA 5B6PA 5JJ5A 1YBVA 1R4MB 4PO9A 3MGAA 4AKSA 1COWA 3IESA 4U2CA 2HIMA 3HCBA 1W8DA 5AVQA 4F4IA 3SYMA 2JLVA 1BIFA 1OGIA 3FKQA 2GTIA 3ZVLA 3EEQA 4URUR 4EPTA 5KNCA 5IM4A 1V11A 1G8PA 3EVCA 4DA6A 1TM7E 3P7MA 1SBTA 1UBJS 3N3AC 4TKUA 4WTOA 2V55B 1FYFA 5BR1A 2EBFX 2OHJA 1W4AA 2AC7A 2W8BA 2B5OA 3UUWA 4BRSA 3DJYA 4J0GA 3KYDA 3AHGA 3FDZB 2BM9A 1GTG1 5D7NA 3TLGB 4N3AA 3GI1A 1J39A 4HAVA 4DC9A 5JXWA 2DF8A 2EFDB 2VDUE 1PSZA 1QKKA 1QRDA 1L4BA 2Z4TA 4P1ZA 3CZPA 4B3TB 1Z7EA 2O2YA 1OBCA 3WKBA 2NPOA 1N2HA 4MYRA 4JXZA 3CVUA 1LNQA 1Z22A 3FCAA 2BYTA 2OVFA 4EEKA 2GFHA 4DCJA 4D98A 1K97A 2D2XA 3H75A 1HDCA 1HFJA 3N1UA 1EGAA 2DFKB 3QTBA 4MXDA 4PHCA 3P5SA 1THGA 4N76A 2Q49A 2WAXA 4S35A 4CE6A 2CMKA 3F78A 1L1FA 2DLCX 1Z17A 2EJVA 2G6BA 1JALA 1GUZA 2R8EA 4KE8A 2ZYAA 1NBMA 4KSYA 3BG5A 2ZI4A 3DLHA 1BYUA 3WDMA 3L0OA 4OJMX 1UWCA 1EB8A 1ZRSA 1NOKA 2QTTA 3WLJA 3F47A 3ZIAD 4TOIA 3P9RA 5AUQA 3QVSA 3VPHA 4IZ6A 1AS2A 3D9QX 1DQSA 2WPDD 1X8LA 1DUIA 5LDGA 3DMPA 2IYXA 4HMPA 4KYVA 3GJXC 3NM6B 5FPPA 2Q9AA 2XMZA 2PRKA 2YJGA 4AS2A 5MN5A 5H70A 2PXCA 3PFIA 3A6PC 1PJ2A 2W8ZA 4MVJH 1YZVA 1WIWA 2X8WA 4QXMA 1ML3A 3DLTA 1E3WA 2D8AA 4RK1A 4P38A 1LC3A 3AEUA 4LK2A 2YZGA 2H8GA 1U98A 3ELDA 3UT6A 1ZGHA 2H4YA 2VCYA 4QDTA 4BE9A 5CURA 1XQWA 4TVKA 4QTTB 1LPOA 2WUFA 2IU6A 1N2JA 1SBHA 3TEFA 1AGYA 2BH9A 3GQVA 5JXJA 1ENYA 1RI3A 4LZPA 1XNHA 3KHTA 1XCOA 2COKA 1QTIA 4PSAA 3PD1A 5EUQB 1D2RA 3UAYA 1CY2A 4QLBA 4C4YA 2V65A 3OAAA 3EGXB 2QVZX 3WNZA 1AGNA 1JA1A 1PT5A 5B1HA 5I7VA 2FN3A 1KVRA 1NL3A 2PEYA 5ALVA 5DI3B 4G85A 4Z99A 4OKSA 3PA8A 4RA9B 1EJ0A 3K09C 3OU7A 1YAHA 3U09A 1U0GA 4DEVA 4DIMA 5IKMA 3C5WP 1WB6A 2I2AA 2VYCA 3MGGA 4GLFA 4BRZA 2DPYA 4FDLA 3F1KA 4MVCA 3MB5A 3P27A 5TQ2A 1D4AA 4TUYB 1F4LA 2PJDA 3NT5A 2ZI6A 3GRRA 1VDMA 2CXHA 3W8DA 4FPXA 4XYEA 4AJNA 4MR8B 3MWEB 5JVDA 4W63A 3SR4A 3ODPA 4QU0A 4JI3B 5HK9A 4PYKA 5GJBA 3OZBA 3GGPA 1NU8A 2XUFA 2E49A 2W6IA 1KJWA 1KVTA 4MROA 2ZJFA 4OHCA 1C3JA 5JAHA 3L7CA 1ND5A 5JZOA 1G6HA 5ALWA 4EJSB 1QV9A 2WBLC 1BSVA 2FR8C 2OFFA 4F3RA 3FOWA 1O5TA 3WGKA 2HPVA 3T3HA 1M7BA 4ZEVA 2QUZA 1DQNA 2LVBA 3SS8A 1D4ZA 4DV5B 2PPLA 2QPLA 3EXEB 1NN1A 3RUIA 1TF2A 2WICA 4BO9A 3A3KA 1H4SA 2B94A 4E5PA 2J08A 5K0GA 3V8VA 1L5YA 2VJBA 1QLWA 1R0ZA 2GZ1A 3SXUB 1XCLA 4ZO4A 5FTMA 1LPNA 2PMCA 2NOAA 1RHRA 4C5CA 4BL5A 3TQQA 2H2AA 5L6LB 5B3KA 3KNZA 4LV8B 4ZREA 2FLVA 4X66B 5AJHA 2A5YB 1Z5WA 4G81A 2MMCA 2PVSA 3JD4A 4LZOA 4EPWA 4XA8A 1YVDA 2GZSA 5B12A 1GNTA 2PS9A 2AQHA 4XQGA 3IO3A 1JPNA 1RBZA 3DOIA 1UPFA 3NH6A 4J7CA 1YRQA 2OE2A 3E3LA 3ESRA 3CW8X 4EEXA 4WCFB 3I04M 3L05A 1KRHA 3OZUA 4BQSA 1Y7PA 4YTEA 5AVVA 1M2JA 1XP8A 10MHA 3GJYA 1J09A 3PXGA 3E0QA 1WO8A 4QLOA 4OBBA 5A5VA 1LBHA 3OKFA 1K86A 1PD0A 3S2UA 2UUAB 4JLVA 1IVNA 5EE5B 3JY6A 1DAOA 2O7NA 3RWOA 3AT1A 1G8AA 4UFPA 2E55A 5BW4A 1NXXA 2GN4A 3DXFA 3M3HA 4GZMA 4HP8A 4BFUA 2CVHA 5C4GB 5TSDA 1T29A 2QJWA 2I6XA 2IU3A 2FF5A 2NUBA 3JQ8A 3OTHA 2F43A 2JIQA 2OLEA 4L4YA 4W1QA 3PJDA 2ZYSA 3AJEA 1NVAA 4LHSA 2HU2A 1TFUA 2ZRQA 5HZHA 3PWTA 4UHJA 2V4UA 4PW0A 1ZIXA 1WCIA 4K9KA 4L5IA 4H15A 2DCMA 1NY6A 4FU0A 3VU3A 1K1EA 2FN9A 4FE4A 5DLQC 3EFOB 2BF4A 5B2FA 4WBNB 3P2OA 3MT8A 4HL6A 1JDTA 2BONA 2NTJA 3HXQA 2C57A 2P4EA 1UANA 1N3LA 2Q6VA 4AG3A 4EG8A 5H8WA 1FYXA 3LC7O 4K0RA 3ZEIA 4KPYA 3JQ7A 4NU6A 3HXMA 1NV8A 4ESEA 1A9TA 1E1QA 4XX0B 3I5XA 4B3HA 3VJRA 4DEYA 3ZCXA 4JNCA 4P4LA 2IYLD 5ICMA 1GRCA 3E53A 4HDNA 3FLBA 4X97A 5SY6A 1QYDA 1M6VA 3FFAA 5J5VA 1FQKA 1JHZA 3DF7A 3RVKA 1GHTA 3BD9A 1QG6A 3DE4X 1AXEA 4MS1B 2XF2A 1KTVA 3PF8A 2LCQA 4BIMA 1UZLA 3T7AA 4UM7A 1Q0ZA 1JR6A 4G5GA 5KDOA 4FC7A 3WK6A 4QAQA 1UBLS 3A4NA 3ZY6A 3ELBA 2WMDA 3V48A 3U48A 2QVGA 2PNFA 4QVIA 4O4LF 1SWVA 2RC5A 5K8VA 3RAPR 1SOAA 3HXKA 3KXLA 3H1FA 1K7EB 1JHYA 2HA0A 3B9RA 5IHPA 4JT4A 4RDHA 1GIAA 5KC9A 1ZMOA 1HT3A 3MCTA 3BWBA 4C87A 3WO0A 2XOEA 1SA0A 1YOVB 1CZNA 2YZ7A 1UJ5A 4N65A 2H4XA 3C3EA 3QY0A 4LF8B 3LSYA 1PDWA 1IEXA 1XRMA 3EGOA 4A0RA 4BKQA 4EQ6B 2DETA 2GARA 4IJWA 3WFZA 4AB1A 4NXMB 4YRQA 4HDQB 2L0XA 2DECA 2DY1A 4XB6B 3TMYA 3HP7A 3QH4A 5GONA 1GGEA 5JWRA 2Z8XA 5IFKA 5IVHA 1G7SA 2H6EA 2PN1A 1JPJA 4HJXA 4ZMSA 3FDFA 1RM5A 1TAHA 2TMGA 3GQBB 3TSCA 3WLIA 5LYJF 4XARA 3C85A 3LBYA 4ISCA 3WK7A 3PNYA 5KTNA 3IBCA 3TKAA 1IQPA 1VLQA 4LKOA 2Q21A 2HF9A 2XA2A 3EIFA 4HI0E 1XDWA 3QK7A 5AVRA 4JGGA 2ZAGA 2VK1A 3SHFA 3LSTA 1JFTA 4UE6A 4IHKA 1WCIB 4L28A 4MQ5A 4O1MA 2Q1SA 4OK6A 2A35A 4MUGA 3URMA 5C34B 1YQUA 4PQRA 2ZJ0A 3FH0A 5SYNA 4MW6A 1C29B 2ZAIA 3THYA 3TQOA 4LDPA 4R3WA 3OECA 1YI1A 1PJTA 1Z38A 1C3XA 2Q6KA 3W34A 5JW6A 2LBPA 2QA5A 1GKLA 4TRJA 5FFFA 1DKMA 1G21B 2YTZA 3HO8A 4TMWA 2UZ4A 1H2AS 1MOPA 3R2JA 5A7HA 1KXJA 2DFLA 5KNLA 2CV2A 3SKYA 1ABEA 4IIEA 3WLEA 1AKMA 3DHNA 1Y81A 4MCJA 3H6GA 4PZ0A 4OK5A 1JI0A 3ZZUA 2YWJA 3H9BA 1X1RA 2I5PO 1UF9A 3DZDA 1XL0A 3LUPA 4Z49A 3H84A 2EZ4A 2KHZA 1OI7A 3ZN2A 1LNSA 1IY8A 2XB4A 3VR3D 3PTAA 2V98A 5IFLA 1W4ZA 4MKRA 1ZPDA 2FZKA 1Y33E 2WVHA 4UASA 5A6SA 1Y3DE 4HDKA 1G5TA 3TI7A 1ONPA 3AJ8A 1KAHA 4DUYB 5AM2A 2DVMA 4WFIA 3JATB 4MO2A 4UREA 2G0TA 4YUVA 3D0KA 5E2BA 1U7UA 4CM4B 4DDMA 3OZDA 3P0JA 5LP6B 4B17A 1K2WA 4EVIA 1V5EA 3ZBQA 2CNWA 2E4VA 3HBLA 1EWQA 1PS0A 2AOWA 4HDRB 3RYHA 3UA3A 4MRMA 1C7QA 4EO4A 1NMSA 1DXQA 2OPHA 4ARZB 4RDXA 2Z2YA 4ZHQF 2V8OA 4RPKA 5AKZA 5DNCA 5JNSA 2JHCA 2A5DA 2TMYA 3RW9A 4EITA 3AUKA 3TOXA 1NFFA 4B5LA 1Q1QA 5CAEA 2P40A 5L8VA 2KE5A 3M6AA 3ZDBA 1NW7A 5C8YA 2CF5A 4IHAA 3LCMA 3RG2A 1L1QA 1VDZA 2OV8A 4YPOA 3OPMA 3FDXA 3PNPA 3GLGA 2GZHA 4ZGBA 3KPUA 3IQIX 3VR4A 4P33A 3BB3A 3TW4A 4H7PA 4EUFA 2ESRA 3RS8A 4YT2A 4JI8B 4U8GA 1CHNA 3L79A 4CXMA 1LCIA 2BD0A 1QVWA 2GVDC 2ISCA 3H19A 2QD2A 5H81A 1XYGA 1GWNA 5H5JA 4DVGA 2O3UA 5KX5F 5AESA 1AKEA 5ER6A 1MV8A 1U5CA 3WP1B 1PJZA 2XADA 1GPLA 5ETJA 3R8FA 3T5CA 2CXPA 3BL5A 4J0IA 4OHZA 1ABBA 3ZXUB 3P52A 4QTUB 2H3HA 2N1MA 3NKLA 2AFIA 2VCHA 3HVIA 1VP9A 3CKKA 1MXFA 3LDFA 3R9IA 3R3WA 1G17A 2W0SA 4HAUA 4E5MA 4GSLA 1Y5RA 1P8JA 4PZ9A 1DDOA 3JSXA 5IVDA 2XVZA 1EI9A 3OZAA 2YRFA 1E96A 2PZAA 3Q2OA 3T12A 3ZDFA 3VYVA 2VP9A 5L3VA 1TZJA 4UVDA 2PSSA 1W5AA 3DZBA 1MOQA 3N58A 1G5HA 3DEAA 2WW8A 4LQCA 4PZPA 3J80A 2PRJA 4KYUA 3K8OE 3GFVA 3MWJA 4I9GA 3WRVA 1Z56C 3MJCA 3EEBA 4Z8XA 4MGZR 3STYA 2QN6A 3SSNA 3ZW8A 1G21E 3E23A 2W6PA 4ZFNA 5A4KA 5BXYA 3OQJA 3P71T 4KUGA 2W4QA 2QY9A 4MH0R 4FXOA 4KBFA 4LBVA 4R7GA 5KVAA 2I22A 4BX0A 5AK0A 1Z47A 1L4NA 1OFIA 3RUCA 1Y8CA 5BWNA 2PUEA 4RH3A 4KJXA 4ZQIA 1U4NA 1N3YA 3PNVA 2P9BA 1ULAA 5E6RA 3WWEA 2FUEA 2R6ZA 2PLAA 4EG7A 1N9GB 2FSGA 1SZJG 3B89A 5KSPA 4LVNA 1GARA 2R4UA 4QUDA 3X1XA 4XRGA 5TGTA 2P7HA 2GK3A 2ZS7A 4GOOD 1KI4A 1P7ZA 3AQIA 2PTHA 4LZAA 2PUJA 3DBRA 2VQEB 4L0DA 2QUJA 1ZVJA 3RTGA 1ZMXA 3QLUA 1L7PA 2LZ0A 2B3DA 5FBLB 2C4VA 2ZYWX 5FNVF 1B6GA 4C30A 3NQ41 1EJ2A 4P2GA 4CM8A 4PYQA 3L82B 2O6LA 2AUNA 4GG1A 4X61A 2AMFA 1CIPA 3QNUA 1X14A 4W1PA 5TMDA 1EFCA 4X63A 4E46A 4EIWA 4GI2A 2PTGA 1JHXA 4CUJA 3AVWA 2HPAA 3VKGA 4KHPB 2AYZA 1ZH0A 2ZWPA 3E9NA 2YQ4A 1DAGA 4C7KA 1Y4DE 3ZTTA 1PBNA 4IWYA 1GN8A 4DM3A 2FDRA 3DWEX 4S1PA 3VZRA