3GCWA

Pcsk9:egfa(h306y)
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
530
structure length
434
Chain Sequence
SIPWNLERITPPRYRADEYQGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPSTHWQLFCRTVWSAHSGPTRMATAIARCAPDEELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRAVTAVAICCRSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antagonism of Secreted PCSK9 Increases Low Density Lipoprotein Receptor Expression in HepG2 Cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Proprotein convertase subtilisin/kexin type 9
total genus 119
structure length 434
sequence length 530
ec nomenclature ec 3.4.21.-:
pdb deposition date 2009-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
A PF18459 PCSK9_C1 Proprotein convertase subtilisin-like/kexin type 9 C-terminal domain
A PF18463 PCSK9_C3 Proprotein convertase subtilisin-like/kexin type 9 C-terminal domain
A PF18464 PCSK9_C2 Proprotein convertase subtilisin-like/kexin type 9 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.690 Mainly Beta Sandwich Jelly Rolls Proprotein convertase subtilisin/kexin type 9 3gcwA02
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3gcwA01
2XRMA 4OV6B 2G4VA 1THMA 1YJCA 2WUVA 2Z30A 3QMPA 1SH7A 3DYBA 5JXGA 1DBIA 1SIBE 1T1GA 2PQ2A 1IC6A 2Z57A 4LVNA 1NDQA 5ARCA 3Q40A 4BWGA 1TM4E 1AH2A 5AVKA 3DDZX 3I30X 3DE4X 3Q5GA 5AVJA 5B1EA 1SN7A 3BX1A 3GT3A 4ZOQI 1Y9ZA 2Z58A 4OMDA 1SIOA 4H6WA 4GI3A 1Y4AE 3TECE 1Y3CE 1YJAA 1SBHA 1NLUA 3DW1X 4HX2A 5FBZA 4HVLA 4RYDA 4H6XA 1T1EA 2W2PA 1TMGE 4C3VA 1S01A 3D9QX 1P7VA 4C3UA 1TM5E 1GTG1 2WUWE 2WWTA 2PYZA 3GT4A 5FFNA 3DE3X 1AF4A 1GA6A 4JP8A 5CW1A 1SCJA 1VSBA 3WIVA 3ZXYA 4WOBA 1R0RE 2GKOA 4DWWA 2DUJA 3T41A 3L1KA 3AFGA 1CSEE 2SICE 1P8JA 2WV7A 4FONA 1GNVA 1KE1A 3SICE 3DE0X 1T1IA 1XF1A 3LXUX 1WVMA 1MPTA 4OMCA 5AMXA 2Z2XA 1JEAA 3VTAA 1A2QA 3AJ9A 1Q5PA 4DJ5X 4YN3A 3I34X 4AKSA 1GNSA 5I9SA 1SCBA 4M1ZA 3ZXXA 1WMDA 3DW3X 3PTLA 1Y3DE 1TM1E 2XTJA 1AK9A 1BH6A 3EE6A 1WMFA 3VHQA 2ST1A 1SELA 1SUAA 4B5LA 5K7SA 5SICE 3LPAA 4KB5A 3A3NA 4LVOA 1BE8A 3F7OA 1Y34E 1SCAA 3WQBA 1AVTA 1AV7A 4H6VA 1S2NA 1BE6A 1Y3BE 1UBNA 1C9MA 1S02A 1PJ8A 3PRKE 3QTLA 2HD4A 1KDVA 1GTL1 1SUEA 3HJRA 4J94A 1YU6A 1ZVJA 2PKCA 2DQKA 2X8JB 3F7MA 2TECE 1SUBA 2ID8A 3DVRX 3AJ8A 1KDZA 2ZWPA 1BFKA 2PWBA 2P4EA 1CNMA 1PEKE 2W2MA 1KDYA 3CO0S 5JMOA 3A3OA 3CNQS 1C9JA 2V8BA 4DZTA 1R6VA 4KG7A 1BJRE 2QTWB 1GTJ1 1GT91 1PFGA 1Y3FE 2HPZA 3LPCA 3DVQX 1KE2A 1PTKA 4NMXB 3DE1X 1TECE 1AQNA 4CFYA 1LW6E 2PWAA 3DVSX 1EGQA 1YJBA 1SUDA 1SVNA 1C3LA 3TI9A 3GCXA 1GCIA 3I37X 3QFHA 4WOCA 1TM7E 2ZRQA 3BPSA 3A3PA 1IAVA 2ID4A 2Z2YA 5ARBA 5AQEA 3VV3A 3OSZA 1BFUA 2Z2ZA 2Z56A 3D43A 1V5IA 2DP4E 1SCNE 1SBCA 1OT5A 4K8RB 1Y48E 1SUCA 1SBIA 3DWEX 3F49S 1WMEA 3VYVA 3DE5X 3BGOS 1C9NA 4NE7A 5FAXA 3LPDA 1TM3E 1DUIA 2W2QA 3VV2A 2PMWB 1ST2A 2SNIE 2IY9A 1TO2E 2ZWOA 3TI7A 5JXIA 4AKTA 1GA1A 4CFZA 2SBTA 4KPGA 1SBNE 1P7WA 2SECE 1WSDA 1TK2A 2PRKA 2W2NA 3SQOA 3UNXA 2B6NA 1OYVA 2W2OA 3EIFA 3H42B 4I0WB 4MZDA 1OYOA 4ZARA 1AU9A 1Y33E 3EDYA 3VSBA 1HT3A 1EA7A 1R64A 1SPBS 1V6CA 1Y1KE 3DE6X 3DE2X 2IXTA 4Z2AA 3DE7X 2X8JA 4NE9A 5ARDA 1SIUA 1Y4DE 1MEEA 1GA4A 5JXJA 3GCWA 5JXHA 3P5BA 1SCDA 3WIUA 3WHIA 1NDUA 1TO1E 1SUPA 1ZVKA 2E1PA 3I2YX 1ST3A 5B1DA 4CG0A 1SBTA
chains in the Genus database with same CATH superfamily
1H8TC 2RMU3 3AZOA 1BQEA 4MVCA 1U5AA 6LDHA 2HJ9A 2XXJA 4OJNA 3CZQA 2AQIA 2HSDA 1H0HA 1P3JA 2IHUA 3OZIA 3VDQA 5DQ0A 4Z3OA 1E1MA 5FPLA 4BFUA 4KO3S 1DYKA 3B6JA 1AJOA 1CUZA 3GFPA 2X0JA 4EHNA 4EUEA 5HK8A 4B32A 3HMYA 2WMOB 5SYAA 3B1ZA 2EZ9A 2G76A 1RXUA 4LJLA 2CDBA 2NW6A 2VDPB 4BJ0A 1XGKA 4DIOA 5D8AB 3P7MA 1O94D 3JZMA 4QJ4A 1TQHA 3KV3O 2M1ZA 2R062 3TI9A 3ZMOA 1YI9A 1Z63A 1XTTA 4EG3A 5C34B 1AKRA 3LY8A 3R4CA 1OTYA 2DWOA 3WYAA 5BSGA 2SKEA 1W0KA 3U7EB 1GP5A 4N41A 5T3NA 5NULA 2NP0A 1ESNA 3GLFB 1SCDA 3K72B 5L36A 3NTQA 3MJCA 1J23A 4I6JA 1SH7A 1UZ0A 4A6SA 3G82C 2VP6A 5ENDA 4RR3A 4BB0A 5DHQA 3WFIA 1ADYA 2FZ5A 1KI9A 4XJXA 1BW9A 1RIRA 1ZMOA 5B64A 1QNWA 5LC1A 3TN93 2CHFA 1VMJA 2X0NA 2X0EA 3VD3A 3QU9A 5JHGB 5CDGA 4LNUB 1E4YA 4A92A 1UMBA 3SI7A 1QSGA 4NIHA 4MUNA 4WESB 2VHEA 3BTOA 4V0QA 4H6PA 4IE4A 2ASVA 5D2AA 3DVAA 2AN9A 1RMYA 4S0ZA 3C0KA 2CN1A 3KYDA 1LX7A 4URFA 4AI0A 1J1TA 4K9NA 2I65A 4YMVA 3URMA 2OHGA 4FOVA 2CNLA 1NC3A 1SBCA 4U7DA 5AVYA 1LOAA 2W1UA 3OCWA 2XMBA 2Q1UA 3NTLA 3ZDBA 1EWRA 1W47A 4URUR 3I6QA 3WV6A 1N3QA 3WL3A 3VPBA 4E46A 2XADA 1VB5A 3J7AC 1UBMS 1ADJA 3CZ9A 2VZQA 1IUOA 1DT3A 2HC9A 3CF6E 3PHIA 2QGZA 4COKA 1F3LA 3QUTA 2A88A 3J7LA 5K3FB 3ZWBA 1H0SA 1NG1A 5BXYA 2VKQA 3L04A 1C4KA 5FYYA 3ZVKA 4ZVUA 4NOLA 1Y8RB 1GLHA 4GAEA 2E49A 5H5JA 2EALA 1TMGE 1NXSA 3RS0A 1IDOA 3HV2A 3S7EA 3FWYA 1BVRA 3G1TA 4CE6A 3OZGA 4PYQA 5L6LB 3ZFFB 1TEZA 2J5XA 3VI4B 5E0KB 1LTEA 4FFFA 1BA3A 3VZJA 1G7SA 3BF8A 4BMPB 1IL0A 2J45A 5A9TA 3RUCA 4X7BA 2DERA 1R6XA 1IZ7A 5LBBA 2VZTA 1OREA 2MIIA 2QTRA 4UTXA 3QIVA 3ABZA 1DAOA 3PFBA 1A9OA 3R5JA 4BAZA 4ARYA 4B4PA 2D2EA 2A1TS 3GHMA 1D7PM 4L97A 3MS7A 4O61A 3MELA 3REOA 4H9GA 2P7IA 1PMIA 5JZVA 1ECGA 5EE1A 1ENOA 3F1LA 1Q8VA 4XJSA 1Z6ZA 3LBFA 2ARAA 3EULA 4BJHB 5K2OA 1K6MA 4L6CA 4TKUA 1QVVA 4RM2A 2OWEA 1V1JA 2P5SA 4LZJA 1U94A 4W6XA 1JAHA 2X1MA 4LOSA 1GCGA 4HTFA 5FKCA 1C3EA 5A7HA 4R8VA 1QG2A 4RF2A 3G5TA 2GEBA 3B5LB 2YZGA 2O0KA 3WWZA 1YU6A 2YIJA 2PQ6A 3LFMA 1EIWA 3AZYA 4G9BA 1PGL1 4HNVA 1OXXK 5IVCA 5D87A 3PDUA 1RMU3 4DFSA 1V3QE 3I37X 2IZWA 4P9IA 2R0HA 2J6HA 1JI0A 2G88A 1PL6A 1QP7A 4OXQA 4K8RB 4IH4A 2C00A 4G1CA 4G5RA 5A3SA 1X13A 1DYPA 1J84A 1V3VA 5EV7A 4AG5A 2P34A 1OZHA 3KQSA 1V5WA 1HH4A 3OIFA 1G63A 1N6HA 4TVOA 1XRLA 2JICA 5AM2A 3WHKA 1JZ7A 1QYIA 4V0KA 5GP1A 3KEFA 4LXTA 1HDZA 2WZPP 3SQNA 2WYOA 1J5PA 2A4KA 4RLFA 3EPRA 4QQPA 1Z7S2 1NRJB 3M6UA 3VR3D 1TIBA 2IUEA 4JGYC 2QKDA 4DWWA 4A27A 4HQOA 1G4UR 3PX3A 3TB6A 1X9GA 1G2QA 1RLJA 4QWNA 3IP1A 4EN9B 2WKWA 2AOTA 1A9RA 1Z5VA 2ZITA 4E5KA 3DLHA 4PCRA 1ORIA 1FMD3 2BTQB 1SXIA 2BBOA 4FYWA 2RK4A 5BT8A 3GLGB 4EHJA 3TUIC 1QFSA 3OPNA 3B70A 3ZX7A 1QJ4A 1GZSA 2H4WA 2O59A 3EC2A 1ONNA 4G1MB 4RH1A 4LLOA 1SLTA 1AZTA 3MTQA 3PUKA 3VC1A 1N8NA 3ND8A 4AMVA 2BYTA 3SYMA 4F56A 3LWBA 1AR91 1RLMA 1DI0A 5IK4A 3CGWA 2UUOA 4HX5A 2V97A 4OMUA 2QIPA 1W8FA 4KP7A 1HW5A 5EIBD 4WTOA 2OB1A 3H9JA 4PX2A 4WFIA 2NADA 4XWGA 3VBHB 3H0CA 1NQTA 1U63A 5JW6A 4X1IA 3BFJA 1FFHA 1DAMA 4D41A 3UETA 1G2PA 2C04A 4D8VA 1JHUA 3M6IA 1B14A 3R6SA 2QVYX 2ERYA 2J9FA 3PGKA 5C8CC 3HA5A 4Q1PA 4C91A 1KFUL 121PA 4PLGA 3KZKA 1XYGA 4BV8A 1UP7A 3TOXA 2OOSA 3I8OA 4NPRA 1YQ9A 2Q6VA 1CC1S 4YCCA 4WD3A 3H2SA 4C7XA 2Q1TA 3BMOA 3AR5A 3MA0A 4PQYA 1UCXA 2ATXA 5FNVA 2FP4A 1RMU1 1N2HA 2SBTA 3V97A 1ZNXA 2QUKA 1CIYA 1RUC3 3OQNA 2YINC 4JXJA 4MDHA 3E6CC 5B36A 1VTKA 1KWGA 1LECA 1OV4A 3D6AA 4MUHA 5JOXA 3E1GA 3W90A 2BI7A 1YRLA 2ARXA 4EIWA 1W9MA 1JYVA 4Y2JA 1X70A 1P31A 4GSYA 4RS5A 3WX5A 4KPYA 4DKXA 1Y3CE 4QBIA 2WUGA 1ZC3A 3NKGA 1OZ0A 2GHRA 1V95A 3EVDA 3CLSD 1RUF2 2E26A 1TZ2A 2QJTA 3DBRA 1VA4A 3VKFC 1VLMA 5HM6A 4YJ3B 5LXTB 4N76A 1PIWA 1VHDA 3SJCA 1JYWA 5F7ZA 1X6VA 2BKVA 1JHYA 3IIEA 2EW1A 4MWSA 1TKAA 4JLPA 4RX1A 1IJFA 3K6KA 3I04M 4R7TA 1U2GA 2PVSA 1UQRA 2OC9A 1EVEA 1ND2C 4LLFA 2RGEA 4X90A 2F3UA 3PL0A 1BFUA 2ZDGA 1U0EA 3W4JA 1E2LA 1NSTA 3DCNA 1YR7A 1NA1B 1O3YA 3ECCA 1TVEA 2DJ5A 4KE9A 2YNMA 2VW0A 2FPRA 3PYXA 1W8TA 1E57A 3QE3A 4HDCA 1E3WB 1D2GA 3IDQA 2PD3A 1AX0A 3BCUA 3BMNA 4DDUA 2ISSD 4XPVA 2AS0A 1WDKA 4DMUB 4RW0A 1UODA 2J85A 3W8RA 4RFSB 2XYGA 3STHA 2C0PA 1I5RA 2ZSKA 2VLBA 5KNDD 2ZVJA 1P8JA 5EP2A 1FY2A 3WISA 2ZX0A 1X19A 3A10A 3LQCA 3RVLA 3L4BC 4CDXB 2GNTA 5SZJA 2E33A 3PTRB 3NIDB 1GWLA 4NCXA 3RFXA 5TF4A 3Q2KA 1MAWA 2RDMA 2EEZA 4HWGA 2BGWA 3EX7C 4QELA 3DAYA 3DV2A 2ZRBA 2HPVA 5C5IA 2G9FA 2B83A 1NCQC 3E18A 3EG9A 1FIUA 4NO4A 2A1UB 1FX0A 2ZPXA 3LMKA 1DEKA 4LHXA 1RLIA 5FWYA 4QA9A 4L9WA 3UMMA 2E0IA 4LJ4A 5CITA 4D6RA 3PFKA 1E69A 3VPAA 3GGDA 4D9CA 3U7QB 4M1EA 2XGGA 1TF7A 2JIBA 1VP6A 3RNLA 1QOQB 3K09C 2FPMA 1U0BB 1T8PA 2BMAA 2FSVC 5B3KA 4ZU3A 3Q9NA 3AG5A 2RGXA 4LC9A 4ALLA 2GAOA 4Z7NB 3T5TA 3FOFC 2V0GA 1UEIA 4R05A 1QCDA 4R98A 5JYBA 1W4ZA 2QS9A 1IXSB 2BUCA 2B8JA 3KTFA 2RJ2A 4L8LA 3JZDA 4JKKA 5CDUA 4GRDA 2L42A 3D0QA 2EFDB 3ASVA 1STOA 2PO7A 1LHUA 4FSXA 3ACLA 1E9RA 1LPBB 5FI0B 4TMFA 3S0JA 3W2GA 3DOFA 4KPUB 1SVOA 2W87A 1JLKA 2R11A 3QLJA 3UW3A 3LHDA 3W4KA 1D5CA 5SY4A 1R0LA 1MBZA 4HPKA 1GRRA 2AR7A 3PKIA 5FD8A 5ADWA 3RS5A 4WLEA 4OX9B 1ZD5A 2HK6A 3Q7EA 2Q62A 4MUAA 1H4GA 3AUFA 4QOIA 1Z0IA 3HLYA 3LA6A 3QVLA 3UJHA 2OP1A 1HNXB 1DBRA 3DHVA 5BRNA 4HQNA 2RCYA 4QTYA 1E2QA 5LQMA 2OQIA 4EO4A 4DOMA 2GMWA 2WD7A 3T4UA 5LA2A 4KN8A 3QVJA 3V5NA 5J40A 1DJMA 3U40A 4DPKA 2XVYA 1ISGA 1YMQA 1LXCA 3UMGA 1L7NA 2TNFA 1R1DA 4BTEA 4AUNA 2EATA 3GVIA 3M4ZA 5AIAA 5C51B 4MCAA 4O59O 3E27A 3N2KB 4GMP1 1NR5A 2A59A 4XOUA 4XZ3A 3V33A 1OF1A 3FZEA 2C9KA 3SJBA 4MGZE 1VIAA 3QWHA 1LZLA 2H2IA 3A6JA 3FWPA 3KDPA 4QOFA 5C1PA 1L7XA 1KO5A 2C2WA 4G1FA 1NW4A 3WBJA 2WBKA 1IUNA 2BGPA 3LO5A 3GYBA 4RSMA 1MLDA 1R4NB 5KQGA 1AGXA 5KNCD 2GJSA 5IJ9A 5G0TA 1KVTA 4KI5M 3POIA 3F3MA 1A2KC 5LUAA 4QPIB 1CAWA 4EBBA 2XRFA 1OWLA 5KX5B 5HTOA 4YG0A 1PS8A 3PGJA 1E58A 1T6ZA 4W1QA 3D8CA 1BLZA 5DM1A 4WK4B 3VOBA 3LBNA 3TYXA 3TAHA 1PZFA 3P9QA 2VZ8A 2A92A 5J1TB 5FYMA 1FYVA 1A5AB 3OLWA 2VCEA 4ZCPA 2HWB1 3C3AA 3SYRA 3POEA 4YPFA 5TMEA 1JHDA 1YRQA 3U2QA 3I45A 2HEIA 1KIFA 3DL7A 1K45A 1E3WA 5JNWA 3ZYZA 1C4RA 3FYTA 4IEUA 4HI0E 3IULA 4XFBA 4NXNB 3NMUF 2I1QA 1NQOA 4DMFA 5E3JA 4IV3C 2HDWA 5BOSA 3WL7A 4GU5A 4RDHA 2PTMA 4BQPA 2PMCA 4O4JA 1A8IA 2HJRA 1ZIYA 1N77A 3M6LA 3T2QA 3WK5A 1T1JA 2DHCA 3K3PA 1GADO 5EP1A 3SSOA 3ZU3A 1HT2E 1Z0ZA 2GEFA 3KM0A 1HOTA 3QHPA 2ZUCA 1NY71 2XRMA 4Y1XA 3DN7A 3G9XA 4ZTUB 4NWWA 4KVZA 3WLQA 2J46A 3ZR4B 3QVWA 1CP2A 4FWBA 5G3YA 3TLAA 2HMWA 1T1EA 2M1XA 4KQMA 4FYHA 2C84A 3OIDA 2WA3A 4Q02A 2ONKA 4L8WB 3WB9A 4DA9A 3OPYB 1KI8A 4PGFA 2ZB4A 3H3LA 4PLPA 3PPWA 3JXSA 4TZ0A 5FPTA 2X40A 4ATNA 4UZFA 1M6WA 1AMNA 1DT5A 16PKA 4RXMA 2APJA 5JRJA 1XQ6A 1P8AA 3BAZA 5CTAA 2GGSA 3C3MA 2C0QA 3EODA 3NEPX 5I51A 2YN0A 4Q34A 1XZGA 4DV3B 2XXBA 4MS3B 1EUYA 4FI9A 1U28A 1T5SA 2G1AA 4OHUA 4P5PA 2XVMA 2WPDA 9ABPA 4P4NA 1EB9A 3DP9A 4A8JA 2NSJA 3I8SA 4DLVA 3OCJA 2WZR1 2HLHA 4QT6A 4JX9A 4Q1CA 2Y6UA 1JDUA 3C8DA 3R0JA 4ZOQI 2WB4A 3GOQA 2PRSA 3BL5A 3HB4X 1AO3A 2ZQZA 3D0KA 4FE4A 5C9AC 4C8DA 4OJTA 2G9UA 4XW3A 3Q88A 1C80A 2AG6A 2D6FA 2NNLD 3BB4A 3GDGA 5BSVA 3FRHA 1CZVA 2QW8A 3BXGA 5EKDA 2ZUSA 4R7GA 2ZM6B 4YJGA 1YZ3A 3MJTA 4ISCA 1QH8B 3E3MA 5HVNA 3KR9A 2QTWB 5GQSA 2OO3A 4LSGA 1PK6A 4IH9A 3IOYA 2TEPA 3DMRA 2FQPA 3OO0A 3CINA 4AGVA 4LXXA 1RXSA 2CWMA 1B2RA 2J30A 4B4WA 4D4HA 2ZE7A 4JT2A 4V0SA 5IC4A 3JWPA 1MB2A 2Q1WA 4MTCA 3K1AA 3OECA 3TTUA 3GW8A 3V4LA 5JI9A 3DOEA 4FW9A 4IG4A 3VBUB 3IQGX 2ZK7A 1QXJA 4BRUA 2A8YA 4Q05A 1U12A 3GFBA 2R87A 2VZVA 4G86A 3STTA 1DQZA 3IERA 4O7XA 4IJQA 4J90A 4A7YA 1GZ4A 3IBYA 2NUTB 3BIXA 1BE8A 4RO0A 5D3KA 2MHFA 2QU7A 1QV6A 5HHTA 1H6YA 5CK4A 3UJ7A 4LJ9A 1S6YA 5TT0A 2OBBA 3E22A 4RKYA 4Y1UA 4B3DA 1JH9A 3UGJA 2NZ2A 5IK2A 2CWSA 1X9TA 1L5SA 2HR1A 2WUFA 4J6FA 5FZ7A 3WSVA 4ZZ3A 4C1WA 1HDGO 3COVA 3JYOA 2Q9UA 3WG3A 2ZYGA 3OZDA 3PUYA 1Q50A 2XUMA 1T35A 3H3JA 2WO3A 1YMUA 3ESAA 3LEKA 2W8BA 2JG3A 4YW5A 5D21A 2R5WA 3BWCA 3UHOA 4LBVA 1UXZA 1TCVA 1DIGA 2OK8A 2PA3A 4QDXA 1L5YA 3W4IA 4Q18A 5AXDA 4UUAA 1KFJB 1XPJA 5C70A 3T30A 1VM6A 3PS9A 1KYYA 5GINE 3L92A 1TPYA 5CB7A 1AYM3 5I7EA 3BTUA 1U1FA 1IS4A 4J4HA 2C78A 1UPTA 4OAOA 3TNQA 2FJUA 1WKBA 2UVQA 2IXJA 4M38A 2P9GA 5HA5A 4EJMA 3OY2A 1DG1G 3F73A 1JDJA 4J94A 5JALA 3A3KA 4GKKB 4DSZA 3CKHA 3W5DA 2LWIA 1EMDA 2QN1A 1K42A 3KR2A 5FZEA 3A4MA 1DHRA 1HUQA 1PZEA 2GZ2A 3BFVA 3ZS9A 4EMUA 4BBPA 4QHTA 3IDCB 3K75B 3L8GA 1ONSA 4Y67A 2QORA 1M9NA 4P3KA 3OQPA 3B8EA 3PLQA 1XLWA 1G3UA 1MOPA 2WP8J 3KNZA 2QRHA 5D6NA 3ZR5A 4MJ7A 4YWHA 1X7DA 3LUHA 5EIAA 1NOVA 4PLWA 5A9RA 1RUJ2 1H4HA 1U9CA 2AL7A 1B6GA 4AY5A 5C1OA 1HB1A 3MWEA 1L9KA 4R1OA 3VKWA 3D5TA 1CDEA 3SS8A 4JTOA 2CLEB 3DCYA 2JFQA 5B3AA 4L9AA 1N9KA 1VB2A 1YKFA 4C7BA 4V2VA 2I0FA 3AF4A 1NNUA 3OAAD 1LGNA 1DJLA 2R6AA 3ZDQA 5FUWA 3ZGZA 3F3YA 1MD9A 2C5GA 2QQMA 2VQ3A 3RVHA 2W70A 1N25A 4ZHSA 4GB31 4FMBB 3UXEA 1SUDA 1CD3G 2WJAA 4D94A 3U09A 1XNCA 1XZDA 4A4DA 1R0BA 5FPPA 1ZZEA 3TE7A 4U6QA 3RPEA 3HJUA 4KH9A 4EJ6A 1A78A 4LYGA 4OFWA 3HEIA 1NZJA 3MQ2A 3SS9X 2CKDA 1C0LA 1JDBC 3N0RA 2F3QA 4IJKA 1KMMA 2DM6A 2QGNA 1TGVA 4YT5A 1A76A 3HKBA 5H9WA 3OQIA 1X14A 4COUA 1OGJA 2A1TR 3KJXA 3MJEA 5DO9A 2V6BA 1NW9B 4OU5A 4W5QA 3MJSA 5EVJA 4M7OA 3S6JA 3PNKA 3F74A 3I4IA 3CZUA 1EX9A 1D0SA 3L7IA 4P9GA 1T3GA 4EWAA 1Q7GA 2IP1A 2NIPA 1WCSA 2E51A 5AMXA 2BMDA 4IWYA 2B8WA 1ONPA 4D7AA 2G08A 4ZREA 1ASJ3 3SHOA 4TSRA 3EARA 3VR5D 1CAUA 2OCYC 4NZMA 4ARBA 4Q7EA 4Y9SA 1GZWB 4V03A 2GSDA 3T12A 3MRSA 2FMDA 1P4AA 1LH0A 3O4RA 4HYEA 3BGIA 4X0EA 1YJ8A 2M2IA 3RWOA 4I9HA 1UYXA 1DG6A 1H6XA 1E5QA 3KEMA 1G5PA 3ZHSA 1EKXA 5F5NA 1PVDA 1RJ9B 4G07A 2QAGC 1AC5A 3OJBA 2XUDA 4JI2B 3BWVA 5JC1A 4HNAA 3RT1A 2ZJ1A 1L8AA 3VBSC 4KMQA 1ZA4A 2VBFA 3DKVA 3CZJA 3LFHA 2G09A 2I80A 3GLHB 2GPYA 5LB6A 3KHSA 3SZLA 4CCMA 4U2AA 2XE8A 4K6MA 5FZKA 1SFPA 3DW1X 2N1BA 2NZ9A 3GDOA 1E8MA 3ESQA 3NKVA 4F3NA 2PV0A 5BN3A 1GAJA 3H87A 5F21A 5FV7A 1CX4A 2BUKA 4D6SA 3DLPX 3ZFGB 4UU8A 2W08A 2ZULA 1VYVA 2PLV3 1C14A 1NY72 2FRXA 1US8B 3RS7A 3VC3A 4OJQA 1PL7A 3AUUA 3AB8A 1VQ1A 4CM6A 4N7RA 3T0BA 3KQYA 4N7JA 2PIDA 5K8UA 2GKSA 4PHCA 4PZCA 1VFNA 4R52A 2LDXA 3GG2A 4JROA 3KAJA 1DUIA 4NV3A 2PAEA 2CMDA 4JI8B 3BF7A 3AF3A 3SCGA 4Z5XA 3SLRA 2C42A 4FPOB 2JJYA 3L1IA 3R7WB 4UWDA 4JJ4A 4D4KA 2H0BA 2VT7A 4C7VA 1S9DA 4QDJA 4OLJA 4L5YA 2NXJA 3DPUA 3U3ZA 3L4BA 1PYGA 1M2KA 4Z7JA 2A7XA 5FQOA 4FNGA 1PMJX 1BZYA 3FE5A 3MIHA 1LK7A 2H2GA 4BIMA 3N1UA 1N2OA 4JX0A 2EWWA 3ZWAA 1VBD1 5LVAA 1QF3A 3O2SB 4FXKB 3DCJA 4J29A 3ORHA 1L4BA 1SELA 3OOEA 4L9RA 1RBYA 5AXCA 5B7GA 2D5BA 3IO3A 1BG6A 3JZFA 5F64A 3U5TA 1ND5A 5JMOA 1Q0RA 2BY4A 4FUTA 3A4UA 4FZ3A 4J4TA 2Z4SA 3OLXA 1HL7A 2WJZB 1SKYB 5BWMA 2C3PA 4BVBA 1R6UA 3HUEA 5EEGA 4S1OA 1CY0A 3B6KA 4BE4A 3HZOA 4Q1DA 4RLSA 3NGXA 1HFWA 4N5HX 3O14A 4JGBA 1JFFA 2ZRHA 2WT1A 2ZGLA 5EXTA 4GKVA 4DRVA 4BXOB 3AVYA 1W2WB 4F2PA 1ENPA 4DM7A 3RADC 1HZZA 3DEYX 3K51A 1F9AA 3BDAA 4CLHA 3C4JA 1Y43B 3RZZA 4FOSA 2ZAAA 1ULEA 1QIFA 4ZCSA 1V6NA 4M7PA 2GCOB 2QRZA 1KF0A 1U2RA 4UAJA 4GIQA 2B69A 5J2TA 4P38A 4ZPXA 3O8LA 3SHRA 1Z0SA 3FC0A 1ECCA 1DQRA 2PELA 1RPNA 3K1ZA 3DBHB 2CGEA 1H0BA 5JD3A 3QNWA 4P5HA 1E2PA 1NT0A 2VYVA 3PDWA 2FEOA 2QZ4A 1J22A 4AG4A 3NTRA 4WNYA 3K96A 3GJAA 3OY8B 1ZNYA 2QTHA 1ZK2A 3K9FC 2Y76A 4M9RA 2JI8A 3WF4A 1YZVA 2BDRA 3S2EA 1L4GA 3MWDA 2JPDA 4PLTA 3LYAA 4GI1A 4IDEA 4IIYA 2LUWA 3M9XA 1QZ3A 3CO2A 3NAPA 4EN8B 4FQ8A 3G0BA 1GNRA 5C3QA 3E5UA 1BZWA 2DR2A 3PJYA 1VB3A 4CPBD 5DPNA 2Z8ZA 3FYDA 4ET7A 2IP4A 3QV1A 1FPN3 4Z9FA 4XASA 4CDXA 1GR1A 2CVHA 1PZ9A 5CK5A 2ESRA 1AB5A 1P91A 4X6XA 2DPLA 3LW8A 1CD5A 2I6SA 1XZNA 5KYTA 5BNZA 2F6BA 1BVVA 3KJQA 2LIVA 5J3JA 1QHHA 4KMMA 3DE0X 1J9ZA 3ZD9A 4MYDA 1RHI1 4GMFA 2R6HA 3TUZC 1UZAA 2IUTA 3I04A 3OG2A 1X39A 3N36A 3H04A 1P1CA 1KDVA 1MEC3 4EB3A 4UUPA 3THRA 5CNMA 1PJRA 2N0SA 2WFMA 4FP9A 2NAFA 2H0AA 1WZ2A 3U7FB 5DI3B 4A0SA 1I7DA 5F1OA 4DNYA 2C5FA 3OSDA 4IE5A 4TLMB 1HTWA 3U61B 4OLLA 5T3UA 1KEXA 1U7WA 5EJ3A 4WZBE 3AL6A 4M6WA 1YBMA 3G59A 1QMJA 1JXMA 1DKUA 4GVXA 1M6HA 4YRZA 2VK2A 5J5VA 2J3LA 3O2JA 3JQPA 4FNAA 1KJWA 3I58A 2OL4A 1ZEJA 4BX0A 1UC8A 3I83A 1ALYA 1H42A 2OAP1 4F4IA 1FDIA 1QZUA 4DTCA 2C61A 7REQB 2G70A 2IITA 1I33A 4G4JA 5HCBA 2QRKA 3GDWA 2ZE6A 5IK2D 1BNCA 1U4SA 2O23A 5FULA 5AW5A 4F4FA 1CAWB 4ZC8A 2P4HX 4B82A 3Q7QA 3TKYA 3PT9A 4FFVA 3FM9A 3L5KA 1CZSA 1BKSB 3NHAA 3QBEA 1MG0A 1LEMA 4IDOA 3ME2A 4Q24A 3L41A 4MRPA 4BB5A 3IAAA 1BQ3A 4LZLA 1TT7A 3VR4D 3PPIA 2AHOA 1H1TA 1M8PA 3RF6A 1VBB3 3W5BA 2DTWA 4DCPA 3L9XA 1WW2A 1T91A 2I9KA 1WSWA 2DBYA 5AHXA 5AI4A 4ZOLF 1JSCA 1L5MA 1QWOA 5JROA 2XMPA 2VDWB 4BGUA 3PU8A 4GBGA 4ZICA 1AUPA 4N8MA 3G2MA 4R2JA 5D8DA 2OUIA 1XMVA 1GKLA 1T0PA 4EWLA 4FPGA 3VMMA 3C7KA 4UVDA 1YXWA 1ZA7A 2A9RA 2B42B 4TMYA 2G4CA 3UXYA 5EJ1B 5FOQA 5T5PA 2EQBA 3O0DA 4EYGA 5IAEA 5FPUA 1L5GB 4IAOA 1QB8A 5JFTA 4LHEA 2Q2QA 1FCJA 3NRBA 5B4VA 4ZALA 2CEKA 1RTTA 3LQ2A 3I9NA 4RZSA 4BGVA 1WWKA 3CYFA 2VUCA 2WZDA 2XLBA 1NZCA 4ZYVA 1E2NA 4PBSA 2O3UA 3IPVB 1QO7A 4CF4A 1PJZA 1NLZA 1N2XA 2X76A 4NHOA 1MAUA 4I8XA 1JPUA 4ENTA 2L69A 2C8VA 3DQQA 2FMHA 1OF4A 1A77A 2O57A 4JKMA 4WBXC 2IZOA 3EA0A 5JRDS 5F9TA 2AFRA 4B3JA 1T6BY 3HV0A 4D0RA 3QUBA 1KSFX 1WSDA 4HTFB 4C89A 3H7YA 1E3SA 1KO4A 4RD6A 3MTGA 1JYEA 1RVV1 3QEMB 2QTFA 5EQFA 1JEYB 1YJLA 1Q8OA 3ZWDA 3LK7A 2ERXA 2PL5A 1ECFA 3IXLA 1HRI3 4WKNA 2ZAMA 3LI2A 3ENQA 5BNPC 3B82A 1BAPA 1SBHA 4KBGA 1KZHA 1TCCA 1I7QB 5EIWA 2QEQA 3AUAA 5LZ9A 3T9FA 1UBCA 1DGQA 4GYJA 2QTLA 3QMMA 5IVYA 1QGUB 1ZY2A 3VHQA 3O92A 1CKEA 3VSDA 1PZMA 1ZU5A 5BXXA 4CUCA 4IZHA 3NDBB 3GRKA 3OIUA 1QU3A 1DFIA 2H3EA 1XE0A 4XJ9A 3GAFA 1E1QA 3F2ZA 1PR2A 4KNCA 3NPMA 3I01A 4L0PA 1BDIA 3TF5A 5IW8A 2HN9A 2WF8A 1K3TA 1IPJA 3IAQA 3ZJVA 1DAGA 1SCQA 1BK1A 3HN6A 1RUI1 1LEDA 3ZFFA 1NVFA 4PBRA 5CFOA 1XL0A 3KS7A 1LV7A 3JVUA 2GCEA 3K2EA 3N2IA 1MU0A 2X0KA 1C7ZA 4EMSA 1ZEMA 2C98A 2V45A 1O87A 4UAVA 1M75A 1UAAA 2BIFA 4RVHA 4OL0A 3GOHA 3K8QA 2BGKA 1PAUA 3QVXA 5CA0A 1OLMA 4CXYA 2G6BA 4J0FA 1Q8SA 4LDAA 4JP8A 4JRLA 1IIRA 2G5GX 1D4VB 1UO9A 3RHZA 1DC5A 3WG9A 1CBUA 1QZZA 5BV8A 1HYEA 1D2QA 4OGLA 4TWZA 5GONF 1PJ2A 1JG1A 1JJVA 2C9AA 1I8TA 3W58A 3H8SA 2SHKA 4G8CA 4YZ4A 3EGDA 4LHNA 2VPWA 3AVWA 5AW7A 1NCRB 2OECA 4F4JA 1P1HA 4ASMB 3V8PA 5I0UA 3PL5A 1WZXA 3CZCA 5ALEA 1I7NA 1P80A 5JISA 3RNOA 5K0UA 4DQVA 4DCVA 3ACDA 4LA3A 1VG0B 4X91A 1AURA 1ZUHA 3SBXA 3NCHA 3QHQA 4BNLA 5FAXA 1US8A 1O5OA 2Q50A 2D0DA 2PXJA 1LKZA 3Q3GE 2E1RA 3PRHA 3VBHC 1V16B 1ZK3A 2JH8A 1OX4A 4LOJA 4OF4A 4M8LA 1DBWA 4F6RA 1XALA 2D0PB 5BQ5A 5F2WA 4LXQA 1L9XA 5IWCA 4PXYA 3ND7A 2PUBA 2JJ8A 2K87A 2DFNA 3VHPA 4A42A 1YS7A 2VYFA 3PDCA 3NM5A 2HYIC 3AZZA 1YA6A 4OQXA 1OU0A 1SPPB 4PCLA 5C1IA 1KS4A 1QP8A 1GGHA 2NQ2C 4CV2A 3WIVA 1SZCA 3K0FA 3FZGA 2D3WA 1BXRB 4JDMA 1YS9A 1CX1A 3BIJA 1OXCA 4CUJA 4BFCA 4K6HA 1I1HA 4WY5A 3RROA 4I0BA 1R6TA 3NYWA 4GUAA 4N0QA 1YAJA 2NN8A 4QQLA 1H1IA 3THYB 1QZXA 3UWPA 1DWQA 3ZZ0A 2D6KA 1WF6A 3NNLA 4FHZA 4AEMA 3CKLA 1HQNA 3UBTA 4YAFA 1AR93 5EE5B 1GTJ1 2QV7A 4GZMA 2PR2A 4DA6A 2K2QB 4W4ZA 2FUG6 3B2QA 4QC2A 1EV13 2UKDA 4TVSA 2BFUL 2J0QA 3H5LA 2A78A 2C4MA 1JHOA 2ZJOA 5IVBA 2BHNA 4CDGA 3PJGA 3I5YA 4JAAA 4L1KA 3I1FA 1T36A 1GUBA 2R3SA 1N3OA 3I97A 2XNSA 1CVNA 1T2CA 2BV3A 3B2NA 2Y9MB 2JIZA 4YLYA 3TSAA 5IM4A 4KAAA 3SR4A 4LW8A 2BMFA 3KLSA 1OI2A 5CNIA 3KJEA 2WDBA 4F93B 4WCFB 4DUXA 4BBAA 1TQ2A 3VBOA 2G0TA 2Z2KA 1XNJA 1P39A 2QQKA 2NV6A 3KB1A 2WYSA 3SJAA 1GNVA 1CJBA 4E5SA 3PITA 1IEWA 1K7FB 3BDVA 2QT9A 1X7YA 3VQTA 1XFAA 4H7KA 4TWJA 3ELWA 2MPFA 1L1QA 1V1RB 2ZIVB 2D5CA 4KFRA 3SE0A 3IAXA 3M6XA 3AUYA 2QD1A 1QVWA 2VJMB 3GFOA 1M06G 4J75A 1YJ5A 1U0AA 3RYKA 3MIGA 4D96A 4FX2A 2RC6A 3HDVA 5H3CA 5IG2A 2XJPA 2Z43A 1NY6A 2WAAA 4ZEOA 3RI3A 1T0IA 3FUVA 3EVBA 2AG5A 3ONNA 1YLLA 3UC5A 2DY1A 1VSTA 4S2HA 3S5JA 2VP3A 1SXHA 4J16A 5F77A 3NNGA 2YV8A 3RB8A 4WLFA 5K4HA 2ZYVX 2EFCB 2H1VA 4WVMA 2QTBA 1L5HB 3ORJA 2DUMA 4ZT5A 4QPDA 1EVIA 4R1UA 2ORYA 4BS9A 3USUA 3V46A 1FU7A 4ZC1A 3H5RA 2EYUA 4IEPA 3BMQB 4BX9A 1ZK1A 4P34A 1CQIA 1IG3A 3V4OA 2BSQA 1FJHA 3B53X 3MZHA 5AW9A 2AJCA 2Y1EA 5CEJA 2CDNA 2HSZA 5C5UA 4JYCA 1C81A 4BZQA 4BCBA 4EG0A 1UFOA 4LF4B 4N49A 3LZCA 5EQTA 2NVUB 2XL7A 4V3CA 5ALWA 4TMXA 1GSIA 2C03A 1W93A 1NMQA 2EG9A 2EX0A 4LRWA 5CH5A 3U14A 4RGYA 5C9AA 2I67A 3LW7A 2ZGUA 3CISA 3A0RB 4B3HA 3P32A 5FI3A 3C8MA 3IJRA 1ECBA 4S1NA 3MT0A 3TZBA 2J9ZB 1N0HA 3OTHA 4CIYA 3RRBA 4RMHA 3Q8XB 2QQ5A 3DL3A 2RGYA 1KJLA 3GQVA 4PQQA 1T0HB 5J1SB 3L9WA 2QX8A 3WQSB 1JZ6A 4MVXA 4XARA 3N9QA 2IA5A 2H00A 1DYOA 1V47A 4ZQCB 1O95C 4V0ME 2OFXA 3IT8A 5FK8A 1XC7A 2X0RA 2YVAA 3TCNA 3ZWCA 3VFDA 1W8HA 1I3NA 1GGFA 2SKDA 3ICOA 2ZANA 1KQGA 2RIPA 1IBRA 1AHHA 1SU4A 5KU1A 4KIJA 3D8TA 2R7NA 4FPEA 1ZCFA 2YFQA 2ZJFA 3RLFA 2OOKA 3MGGA 1DXQA 3LLSA 2DTYA 3IBCA 3UMSA 4ILKA 2B4KA 4I1PA 1GGNA 3BGWA 4WH0A 3DMPA 4HEA1 1G6Q1 3BRSA 2YOGA 1PBTA 3R74A 2VP4A 2ZGMA 4Q1FA 4X93A 4J1TA 2PGIA 4BEWA 2B9UA 1SA0A 3L6DA 4D0LB 2IV2X 5M29A 2XR4A 4DIDA 2E21A 2FOLA 5IJ0B 4CG3A 1VIDA 5AM1A 5J43A 4WZAA 4URWR 3JQ9A 4EAAA 4UNQA 3O4GA 3KB6A 3CCBA 1XNTA 1VBE2 1W9FA 3GPLA 5MFPA 2I1WA 5A33B 5IZCA 2ZCVA 4GICA 2CKMA 4LEJA 3W1VA 1E3TA 4HX2A 3CQ9A 1I01A 2EBHX 2PKWA 2PAMA 4RA6A 3S3TA 5KVCA 2LD4A 5KHLB 2QN3A 3PQ6A 3LXUX 4AZ3A 4XB6B 1NT4A 2MDTA 3ILYA 1GAQA 5G40A 1AA9A 4QDZA 4RHFA 3CZAA 3CPSA 4BPRA 5LBEA 4WXRA 2JAHA 3F6SA 3R8XA 3VU9B 1RU3A 1YQ2A 4FFHA 1Z74A 2O2IA 3SMQA 4XOGA 5FWEA 4WVLA 1FU8A 4YMHA 2BEWB 5C8CB 1GU1A 2VPPA 4FS3A 4ZDWA 4FINA 2D6MA 3OUJA 3HPNA 1E99A 4KG0A 2BGRA 3WA7A 1IXKA 2R042 2X9GA 1ULTA 1EP2B 2ZS9A 2W4MA 2VQTA 4OM8A 2DPYA 5FZMA 3H4IA 2VW2A 4XETA 5FEMA 4MSUA 4MHSA 5KO2A 2WM9B 5GJCA 3RVMA 2Y33A 4FYMA 1MIOB 2JB8A 3JWGA 1FV3A 4RK7A 5DLDA 4F71A 2J42A 5BURA 3A36A 6GPBA 3QIAA 3TQSA 4WZBB 1VHQA 3Q0IA 2ZI3A 1RKUA 2CUTA 2WKSA 1DMSA 2IZ6A 4NCJA 1EE1A 2IVIB 4ZAFA 4D3WA 3HBNA 1PWZA 3C3JA 4J1NA 4LRXA 1MB0A 1C3OA 4Q4HA 2RAVA 5I4CA 4AK9A 3TX6A 3QFRA 1W9WA 5FPZA 5IVIA 3DV9A 2WR8A 4KN6A 3HO8A 2A5YB 3QVMA 1GXSB 2G9QA 5EIHA 3B6IA 3UQZA 4LZWA 3MC1A 2O19A 2ZRNA 1FOEB 2XCSB 5DG1A 2YPJA 2W2QA 5JXIA 3KCNA 3ZTTA 1EFHA 4JI5B 5IF9A 3FSGA 1OPXA 5BSTA 4Q9LA 3QENA 2VJCA 5JS8A 1TFUA 1OBHA 3RZGA 4O4JB 5JWPA 1N4AA 4IDCA 2BZ0A 2J7KA 2Q1SA 2WFF1 3WRXC 1Z82A 2G0NA 4A3ZA 3LOBA 3NBZC 4TV8F 4N6NA 1OFTA 5A71A 2JAWA 3TIXB 3FSEA 4IRUB 3KBBA 5B1YA 3INNA 1K8RA 4LY9A 1JLSA 2ERFA 1K9VF 3OI7A 3H3FA 4LOHA 4J16C 5JMPA 2XR1A 2ZGVA 2ZYIA 4RD3A 1DXOA 1AHPA 4U7GA 3NM4A 3AHCA 3ZDAA 1CQJB 2VXCA 1SQ4A 2F8SA 4NYJR 4EYEA 2QDXA 3JAWB 1V70A 1O94A 2VC2B 4PZDA 1U2SA 2B6HA 4IEYA 4KLNA 2ZXQA 1T8WA 3K1YA 4OOFA 2QQ0A 4YCSA 2V5YA 3WWCA 1V00A 4JV4A 1D8TA 3T9DA 1QJCA 5T64A 3KE8A 5F78A 5DMYA 2RS51 1REDA 2XAAA 5FYIA 2PUHA 1BXRA 3MLKA 5C7OO 4CP9A 1CW2B 3OTFA 3IUYA 2FPIA 4EKNB 3CW2A 4ZANA 4QFMA 4RFT0 1ZI6A 3AMMA 1Y8QA 4N5DA 1H6BA 4N5MA 4PIXA 4ZEVA 1FW8A 4WOBA 3QELB 1E0AA 1V7PC 4CM7A 2RHOA 4QQOA 3ZI0A 3JPWA 3UC9A 1CJMA 3CLSC 4P3NA 3A1FA 5FLYA 4JEHA 4I55F 1UMDB 1C41A 4F9EA 3IV6A 1NVTA 1OIXA 4B17A 1MX3A 4CTJA 3QTLA 1J2UA 1YB2A 2Q4DA 4RKQA 3WGIA 5IBRA 3LRTA 1A2OA 4C0SA 1HYBA 5KC5A 3AIIA 3LPFA 4EPVA 4JDUA 4FP3A 3SZOA 2RGBA 3HB9A 5FYSA 3O84A 2REQB 1DX6A 1Q2XA 1IS6A 1CDOA 4G4FA 4NRDA 3N7JA 2RKBA 5EJ2A 1OBNA 4DTIA 2F4PA 1FTGA 1ZZCA 5JDBA 3ONFA 2ZTUA 3I4LA 2WHEA 1AJEA 2BWJA 3ZPYA 3W5CA 2JDID 1SN7A 2HQRA 2OLEA 3QKIA 3U37A 4MKZA 1PNRA 2UYAA 4I4NA 3WWPA 5I4KA 2JEZA 2VYVD 4FFMA 1ZD8A 3RVKA 2PZGA 3RU7A 1HFKA 1VFPA 2JD2A 3CNAA 3VHXA 1G41A 2PG3A 1YFLA 4KO8A 2C59A 2C83A 4XJ8A 1A9ZA 4EFLA 3LAWA 4I1RA 4BYYA 1FNSA 4EHAA 4EPWA 3HADA 1CY8A 4CUZA 1YB6A 2OVFA 2ODBA 5IAJA 2PPVA 4C0BA 3QFHA 3NW4A 2VVFA 1CUVA 3G88A 4E4DX 4BO9A 1JNYA 3CMCO 1Z4OA 3LPDA 4LPKA 4MCHA 1EDOA 3N35A 2FUNB 5FR3A 1GNHA 3M7AA 1PK6C 1CDZA 1RUC1 1FL9A 2E31A 6YASA 4IUYA 3MUFA 2JEOA 4HXEB 2GTIA 4F86A 3GV0A 1H2XA 4OHRA 4YUVA 1FRFS 5K99A 2WVAA 4YJ3F 2A70A 5LXTF 3VYTB 3S7IA 4YXWD 1PR9A 1V96A 1BVHA 4Y6OA 3NOVA 4IEWA 3M70A 3FSRA 5B3LA 2DFKB 4ZT3A 3EIHA 2D6NA 5FNVF 1V11A 3JALB 2OXRA 1E7SA 1Z0UA 4IFBA 1GNZA 2Z2XA 4LKFA 1S0FA 1MABA 2E85A 3F0TA 5A7WB 4N03A 2RHPA 2JHPA 3AMHA 3AYDA 3AI2A 3WDYA 1L7QA 1JKMA 1M2GA 3FYHA 5A80A 1LU9A 2CBGA 4FDVA 3V2HA 3KOYA 1AL22 3R20A 3FB1A 4IGKA 4CIVA 1XQWA 4B9AA 1P1JA 2XCRB 4L74A 1T4GA 3TRFA 2EJVA 5CDTA 1WB6A 1GARA 3A8TA 2BVNA 3ELYA 5EJZB 3IKWA 3QFTA 4BO0A 3O0TA 5TIIA 1RXIA 1RUG1 1ZJZA 2XZPA 1DPGA 2IYWA 5FZOA 1EXVA 4ESHA 2W5FA 4QX0A 1JLLA 2PS1A 4QPIC 3H2KA 1FQOA 1OLXA 4AYTA 2VZUA 1ZONA 4CTNA 5FF9A 3KB2A 1YCDA 3PUJA 2WWRA 1IBKB 3ZW8A 2C26A 4C07A 5BR4A 4YASA 4V0NA 1CSEE 3NB0A 3R9XA 1PV2A 3D31A 4FFNA 3SFTA 1Q15A 3B9IA 3SHQA 4F5DA 1N5IA 4E1AA 3UPUA 3GXBA 3B1KA 4Q3OA 4R9VA 3ZY6A 4DUGA 2RH5A 5T50A 4DSNA 3FGPA 3LUAA 3PLAE 4TSFD 1JWBB 4QQNA 2XKOA 3WRVA 5L45A 4B6PA 1UDCA 1E0SA 3ZCRA 1GTZA 3VBOB 1BMFD 1SB8A 3NP9A 2R1VA 2QX9A 1TNDA 1QJY1 4QYMA 1A7UA 3MW4A 1EZ1A 4TS4A 1OBCA 2XECA 5FZBA 2W83A 4US2R 1M1YB 2GAFA 3I3QA 1JEQA 4ARXA 2I55A 4B2PA 4FZ5A 4UVIA 1UYZA 2P90A 6AT1A 3A37A 2YUEA 6PFKA 1Z0AA 3TTSA 1JR2A 1KY4A 2RG4A 5B3JA 4R2IA 1YVPA 4CTOA 1WRBA 4OHVA 3Q6NA 3UJBA 5HJEA 2IU6A 3DTYA 4MI6A 4MKIA 4C08A 4QDSA 3GVHA 2ZHNA 4LKEA 2YIDA 2VDKB 4JV5B 2P0EA 3O3NB 3HXTA 1WOYA 1VCHA 5FNVB 2PY6A 2GCOA 4WFKA 4OCTA 1Q77A 3TDMA 4UTOA 2G3YA 1GGVA 4ZJPA 1KSHA 3AY7A 4BGIA 1MJGM 3VKMA 3E5NA 4JUFA 4JEUA 2DWCA 1VBA3 2JKYA 3QOFA 3N2GA 2QVZX 4OULA 4H3HB 3R41A 3OIYA 1Q11A 2IY9A 5K3BA 3DL2A 5DU2A 3KXLA 2YJZA 4JN6B 1G21B 1UMZA 4BLRA 4OUKX 2BWCA 4B7UA 2H5LA 3UA4A 5KCMA 4FR5A 1YH3A 3WAGA 1I2BA 2L2QA 2QP3A 2JJQA 3E81A 4UFJA 2AMVA 1WXDA 3ZV6A 4TLEA 1KHHA 1I2MA 5AJWA 3EGVA 4GP7A 3L46A 4QGLA 3UGQA 3L8YA 1EM8A 3MPUA 4DMLA 1ZVJA 1NFRA 1RI1A 4JWTA 1Q0HA 1W19A 4C6SA 1BYUA 1RHI3 3S7TA 2MSEB 4IDAA 1K6EA 4NMXB 3DC2A 2PBZA 2W39A 4HX9A 3TQHA 2NVWA 4HS9A 4YA6A 3VBEA 4KPEC 2UXDB 3BERA 4WA7A 5K20A 3FCSB 1RXFA 1S2DA 4C9BA 1YGPA 5KJ6A 1W34A 2YPDA 2BBTA 2OT7A 1CHDA 2XJSA 5DTJA 3KHCA 3MT7A 3J8F3 4CZ2A 4G41A 1ECJA 2W6QA 4O2AB 3K9BA 1IEQA 3E22B 4BCDA 4K9LA 3RSSA 4PG7A 3SC6A 2G7ZA 3DAFA 4EQ6B 3C3BA 1BQ4A 1KEPA 3AL2A 2WMYA 1NMSA 3CLVA 4OBWA 3TL6A 4EVIA 4AN4A 4FNOA 2F1OA 3VH1A 2M6SA 1LHWA 5L7YA 5B7QA 2BQPA 3WUDA 1KFEB 3LX8A 1JHQA 2VBBA 1OLOA 1Q5OA 5GVSA 3VZMA 3NV2A 5EIYB 1UBTS 5K01A 1Q3EA 4Y6SA 4EJSB 1B26A 1KZ9A 1ZBA3 4M83A 1BX3A 3BKXA 5F7OA 2JWPA 5J58A 4OTZA 3DLBA 5C33A 1PUXA 2AZTA 3IUQA 3RUPA 3VR0A 1VLQA 3CLHA 5AUQA 2VBPA 4HOOA 4IKOA 3SITA 3PNBA 1UDXA 3FTEA 4GJYA 1R0ZA 3I59A 1YB4A 3O1IC 1QYWA 2QE7A 5TQVA 2E5WA 2XCOA 4G89A 1Q83A 4IEQA 5AJVB 1L1EA 1P2GA 4Y7DA 2D2FA 1XRQA 1PEAA 3MHTA 4L5JA 4MKXA 3GEIA 4BQIA 4YREA 5BO5A 1DP0A 4LBKA 1F9KA 1GDDA 2WZR2 3K53A 3RBAA 4X94A 1QE3A 4MYHA 2X8WA 1COV2 1JIVA 3WQQA 3HJAA 4QX1A 5LIRA 2O0OA 3ZQJA 4I4TB 3GLGE 3KVBA 5JQGF 1A3CA 5A3OA 1U7XA 4S0XA 2CNOA 2HJHA 5FZLA 4LYDA 3DLTA 3UAWA 4WJLA 2RS12 5LY2A 2Y60A 5JJKA 2AFIB 4FBLA 5KOYA 3VTFA 3CF6R 4WFQA 3D4OA 4PSCA 1KFBB 1C5HA 2GNMA 3KUCA 3FAZA 1RZRA 2Y67A 1U3DA 2EVXA 4JC1A 3JVIA 1RKQA 1GSLA 1QNFA 1Y8QB 1CV2A 2XXAA 4WCVA 3UH0A 3OBZA 4MW0A 4AVTA 4RIHA 2A33A 4TYQA 4CU8A 4Y4YA 3TLGB 1OLRA 3MPBA 4LITA 3L0CA 5CLLA 5I5GA 3NSTA 4HLNA 3WWYA 1JQ3A 4EX6A 3ELDA 5BWBA 2IZ0A 2ZJCA 3FPAA 4HUQB 5KYWB 4DXRA 2B7LA 4ZAYA 1JQJC 1JXOA 4MVJF 4G5QA 1CZOA 2AMFA 2NUBA 3UUEA 1WKYA 1DOHA 3EQZA 3KQQA 4QDTA 4H1TA 4DF3A 3TECE 1Z9BA 2XCLA 1F8VA 2HWYA 4ZODA 1XEXA 3QLQA 1KQNA 2WF7A 4CLOA 2CJXA 3TIGA 1HGXA 4D4GA 2ZRIA 4G81A 4JH0A 1MDFA 4XR4A 1H30A 2QQIA 3UMVA 1VLVA 4F46A 2RMU2 3RU9A 4PTYA 1M1YA 4O4LF 3D6EA 4HUQA 2VQSA 3PGMA 4G0NA 2FWAA 2GN9A 4KXFB 3FBYA 4Z0NA 4WCDA 1SUBA 4DWOA 1A1VA 4DBZA 4F4HA 3PNMA 5LEJA 2G19A 4AS3A 1WUKS 2Q8DA 4ISQA 1YIOA 1BXHA 5AUOB 1IAVA 1QQ7A 3MWGA 5EZ6B 3IYLW 2F3PA 5J23A 2FWJA 3O7MA 2PMEA 1IJEA 4LIVA 1JSRA 3Q15C 4Q9HA 4ZAZA 5CA1F 5C8YA 1Z5ZA 1NQUA 4RPHA 1L1FA 1FYUA 5EZYA 1SKBA 5GJBA 2SECE 4ID3A 4Y0NA 4BV2A 2GTPA 2QUJA 4CMCA 1K7YA 3JQ6A 1V11B 4OA8A 3I3DA 1IPFA 4KLRA 2V5AA 2P9ZA 3ZWKA 3P2MA 4N3CA 4YZ3A 2FPKA 2IOFA 3ETJA 2Q5OA 4IJWA 3F5FA 1LVUA 3L0YA 5FFNA 3BXEA 5KSWB 4PDWA 1ZBDA 4IIVA 5THKA 2C3UA 4LORA 5G4KB 1LJLA 3X43A 3UYKA 1U81A 4LZPA 4CLRA 4UXHA 2KR2A 4JZKA 3RC8A 5FZOB 1KU0A 3CJQA 4PZUA 4ITCA 2P2CA 2XD9A 2QVBA 3GJBA 1CZRA 4N39A 3QWBA 2YFZA 1LW6E 2JJ1A 1KETA 2VMDA 2R8XA 4PEVA 4PANA 2GVZC 3CWQA 2IWGB 2EX1A 4E3WA 2VK1A 2CAVA 5TY0A 4S1PA 3U26A 2W2NA 1E92A 4P83A 2ZWMA 2GN3A 4K6BA 1YHYA 1K0UA 2WFLB 4N54A 2CLFB 5KCZA 3B36A 4HH3C 1X36A 1UP4A 3QWFA 3RJ5A 4CE8A 2PZEA 5HJ2A 5LBFA 4XC9A 1CS0A 4W4TA 4HJRA 4YP1A 3OZWA 1JOPA 1OD6A 1FVFA 3C41J 3R75A 3LT1A 4E5PA 3I0NA 3VVLA 4QU8A 2CMGA 1FYXA 1T5LA 3R7WA 1U2DC 1LQ2A 1HL3A 2OGZA 2Q5LA 2HA6A 1ACLA 1WHSB 1NDHA 4CDWC 4YO7A 3ZSLA 4E5DA 4WVVA 2ZUFA 2VRWA 4ZZ5A 3O8OA 5JD4A 2AYXA 3TJMA 2HBZA 4W8HA 2A14A 3LQYA 5C4GB 3IX7A 4ZVPA 4DQUA 5B7PA 3W34A 4UMEA 3ZWNA 1O1YA 3AOEC 3ILSA 1W5FA 3U75A 1CY7A 5JBNA 1H9CA 2PGAA 4LO5B 3HWX1 1GVHA 1B42A 1KK1A 3OFKA 4Y22A 5IH7A 3ZNOA 2P9CA 4R9CA 1U04A 4L2IB 2R16A 5HGJA 2W2LD 5GAJA 3TJZA 2G1KA 1FUIA 2AZMA 3IE0A 3N8NA 4MO9A 4LMBA 2R8PA 3LA2A 4GALA 4JYMA 3IEIA 3LT0A 3ZHVA 3EBPA 2GXAA 4W8GA 3KFVA 2WJVA 2ZIFA 3OD1A 1AF4A 3A22A 2PUWA 1Q16A 2FG6C 2Y0IA 3AOEA 5E1OA 5GZCA 2ZI5A 1MS0A 1IH8A 5ICGA 4Q4X2 4YIHA 4S2EA 2VO5A 5F2OA 2Z09A 5A9SB 3GEGA 3OUTA 3ROMA 1WZEA 1WPGA 4H35A 3A26A 2NTJA 1W05A 1XZPA 4A2UA 4RGBA 4M3CF 5JSUA 3DYPA 4H7MA 5DN2A 4P81A 1KZ4A 2WZEA 2E6KA 2W6OA 2HEYF 1MRSA 2ZWOA 4EGQA 3S2IA 4PRYA 4HFRA 3O3MB 5DAXA 1TB4A 2CDAA 4I0WB 4GB33 1YJQA 1L7MA 1H3NA 3N5KA 3A0NA 2UUBB 3T7CA 1XWWA 3DL0A 5GPBA 1T8RA 4IIJF 1U5CA 4XVCA 5H8WA 2RCNA 3GCZA 3VR2D 2ZGQA 1LOGA 1CRQA 3FNRA 3HB0A 4CM5A 1GU0A 3AKCA 1KI4A 1AB6A 2NZWA 2I1LA 1KVRA 2PYDA 2O7RA 4M0UA 2FUG1 2H1RA 3ZXYA 3DMNA 4DLWA 2UV8A 3AXSA 4RVCA 5BXQC 4GPD1 4IDQA 1W46A 4KB5A 4IQFA 1A1SA 3OF2A 5A6XA 2WLSA 3BB6A 2W58A 2ORIA 2BZSA 2FSPA 1AS3A 4JLSA 2OZLA 2WNUB 5IVFA 5KQMA 1QXRA 3E9ZA 3IKVA 1G38A 1GCIA 1HWYA 4KKVA 3ZSJA 1UBOS 3FIUA 5CGQB 4WOPA 5TQ0A 4BNZA 4LDPA 5LA6F 3OCYA 1PR3A 4AZWA 3LYHA 2ZBPA 4LMFA 5B12A 5FOWA 2P9QA 5B2ZA 3BK1A 1QU2A 3OBAA 2ZWAA 4K3UA 4U2DA 3PPYA 4OLHA 1YRHA 3THYA 5EZQA 1K12A 1XCMA 1L3BA 4RZIA 1K8ZB 5T41A 4YRNA 4XVHA 4B81A 4HQKA 5EYPA 3EDCA 5JZGA 3IMFA 2D5LA 1E7YA 3A31A 3O47A 2ZVPX 3B3AA 2J67A 1SCUA 5K51A 4FZJA 2CLLB 3PVBB 1POV0 3DXXA 4C20A 4P8RA 2HF9A 4TN5A 3Q11A 2GLUA 4LE4A 5GM2A 3MOSA 4CIAA 4B79A 4YGCA 2QBXA 1CUYA 1PR0A 2FZVA 3OOSA 4R71A 2FDXA 3A1SA 2HHJA 1Z4QA 1JTZX 1GP4A 1GU7A 3GNEA 1X87A 4ZZIA 2GA8A 3H13A 4UW4A 1RHMA 4NP6A 3H8JA 1FZTA 2G72A 3W5AA 1NM5C 1VBKA 3EXIA 5AKXA 2X2EA 2PUVA 3P52A 2QX7A 2X23A 3K0CA 4X7MA 1MFZA 3ZPXA 5U4XA 4I19A 4FPYA 4XDYA 3ST7A 3VV2A 1K97A 1SVUA 3FDIA 1JG2A 1HKUA 3F4BA 4MAFA 4CDQC 4YRMA 4BK4A 5D00A 4AHXA 5AUNB 3VZBA 1GFSA 3I6ZA 1VHLA 1MJHA 2ZZQA 1W8WA 3DDUA 1NFFA 5ITSA 2XZOA 3DKIA 3AEYA 2QLFA 2O1SA 3LD8A 1ZISA 1SXJA 3WMWA 2HWC2 3GRZA 1XZAA 1J3PA 5AHRA 5EP4A 1OMIA 2QL6A 1T4CA 5HKAA 3L6UA 4DCJA 3TZCA 2YYOA 2UYHA 5DBOA 2Q7OE 4LHWA 1FQJA 4R01A 2WWYA 1FFYA 1N0UA 3O4FA 3PK0A 3DBHA 3V55A 1JFSA 1FP7A 2EXIA 1Y7BA 4CIWA 1Z8DA 2AOVA 3FUWA 1SD5A 1AVBA 1Z62A 5J7MA 2YV2A 1EWKA 1WNTA 3VKGA 3ROXA 2X4IA 4QJ3A 5CJPA 8AT1A 4WBSA 5A3QA 1RWVA 3DONA 2YHUA 3HM9A 3PFWO 1NLRA 1GKUB 2OHFA 1D04A 3OQ1A 5KTOA 4UXAA 4DLPA 1A9PA 2P9HA 3R5FA 3ZJ5A 1E5SA 2XBMA 4F3YA 1L7RA 3R7BA 1QJX3 3OFNA 2QDKA 4PLVA 3T7KA 1A8UA 3D3WA 4UAGA 1JYTA 4CYDA 2WYHA 1FQKA 4PLCA 5HBGA 4IHKA 1XWIA 2QRJA 2RBGA 4RXTA 1XTQA 3ORRA 3ZG6A 3G6WA 3WF1A 2VZLA 2WUHA 3DZFA 4QGHA 5F35A 3N9OA 1U5BA 5CUQA 3AJ8A 4EYSA 2WE7A 4HQ0A 4UMDA 4K1ZA 4H7FA 2CYAA 1QAOA 2PGDA 3NHPA 2LPMA 4WGGA 1PO21 1O54A 4KE6A 4Q15A 4IIBA 3KKMA 1IZZA 2C2OA 3MRVA 4QBKA 2Q9CA 4D8WA 1S3FA 2FG7C 1ZH4A 3K9NA 3KQOA 4B4OA 3B9BA 1U8YA 2IOFK 2C1ZA 2RMKA 1XCPA 3EDYA 2KBFA 2F4NA 2MOKA 2FQXA 3TRJA 3FVWA 3RDIA 1T5BA 4N01A 3G7UA 1NU6A 4PHFA 5FQ0B 3TLKA 1NG0A 2A86A 3H8XA 5BNNC 2FJ0A 1BYIA 1ZO8A 3RZKA 1ETUA 3EIXA 2IEYA 4IV1C 5EKSA 5ADUS 4E3ZA 3WY9A 2GKOA 4HZUB 3LA7A 5DGXA 4LMRA 1WCUA 4UBIA 1QKJA 4AW9A 2GF0A 4FPJA 1R4MA 4C7KA 3F7OA 6ABPA 1XP5A 3L2HA 4D9GA 4URVR 2B4AA 3UENA 4M9CA 1F5NA 7ABPA 2X9LA 1RMU2 1YJBA 2VWHA 2A3YA 2GCNA 3Q72A 2OKGA 3FHOA 3PX2A 5IYZF 5G4KA 2N1MA 1RWPA 5EWJB 4BGDA 1XTZA 4ZTZB 4Z9YA 2AFVA 2LROA 1N0WA 2HCJB 2DE0X 5A04A 2IU3A 3ZSMA 1H5UA 2HTEA 4HAUA 4EG5A 2PRZA 3C3EA 2D7DA 2FUKA 4FAHA 1NLUA 3EC1A 3B52X 1EFRD 2ZRLA 1WLDA 3VPCA 2YCLA 2JI7A 1JBEA 3CO5A 2QZJA 2Z1NA 3V4PB 3PYMA 5JYEA 2JX9A 2O8BA 5KWEA 3NAMA 1DE0A 4MQ6A 1BE6A 1PO23 1QGOA 2YQ4A 4JGGA 3D7MA 3GGSA 2IZ1A 3FR8A 4M76B 2RGRA 8OHMA 3ITQA 2RHMA 3PHGA 1UBFA 4JQZA 2DQSA 3ITKA 5D2CA 4M89A 3GGLA 2QQWA 3RIMA 1EESA 4M9XA 3E7DA 4XGQA 2R6ZA 3ZFGC 3LXXA 1U0JA 4XCBA 4CW7A 4A9AA 3A25A 3VO1A 1JHRA 5EESA 1XVVA 3KR1A 1RJ8A 2QTGA 1DARA 2PXCA 3U4CA 4BMBA 5E0OA 1LDEA 1HLPA 4EFKA 4XE5A 2ZYRA 4WOKA 4JL8A 5KXCA 2QMQA 4Y6GB 3H7IA 4CM4A 1K7CA 4MAAA 2OXIA 3GMIA 3RVQA 1ESEA 2GN8A 2B45X 4LQCA 3THXA 2HU5A 2JGIA 1KOFA 5AVOA 3JD73 1CR2A 4XJUA 2VHZA 2QE7D 1E1LA 1QNLA 1ZN9A 5ETJA 4KXQA 3QVVA 1WLCA 4OH7A 1GGEA 1HF3A 3PLRA 1C4XA 5JH7A 1U2PA 3I61A 1R8YA 5EJMA 3JBG2 3WXMA 3T08A 4DCGA 4YT8A 1YOBA 5EG5A 4Q21A 5L3SB 4W99A 3NRJA 1DINA 3A9VA 2A57A 4XSVA 4ENSA 5ALPA 2C5DA 1GT91 4YUAA 5AW4A 3LXRA 1DNPA 1D6JA 1KRXA 2AWOA 4W5RA 5JANA 5T52A 4PINA 3BB3A 2X8AA 3LF1A 2FSGA 1VG9B 4I01A 1Z0JA 4C6TA 2CGPA 4L3WA 3W9UA 1NCQA 2XDAA 3NPAA 3WXPA 1Z78A 1JZ5A 1GXSA 4WQMA 4P22A 4QUGA 3RK4A 3WTBA 4C4ZA 4RVDA 4L4XA 3JQFC 3W5UA 2PUFA 5ALZA 5BYBA 2J3KA 4DMKA 2AC7A 5CHYA 2JGRA 2ZYUX 1XKQA 2OESA 1MAVA 2Q2OA 4G4SP 3ZGYA 4M60A 4F97A 1RMQA 4ND5A 4GM0A 4QU0A 2ZBEA 2XWQA 3F6PA 4IV3B 1DDOA 2ZA9A 2J1TA 2QRUA 2CV1A 3GUHA 3OGJA 3KXKA 5CA0B 3GUUA 2AT1A 1XQYA 4PAWA 4MH0R 5JNRA 3NALA 1UZYA 2WOJA 3K1JA 5HV4A 3WJ7A 5LWBA 1W6OB 3GCXA 1WNFA 1ACMA 1MTZA 4UW9A 4F9TA 1KH1A 3D3NA 2P2NA 3JQ7A 3SH5A 3CBNA 1GN9A 5KTPA 4KIUA 2FPGA 2CXPA 4N48A 2C7VA 3UNXA 3NYQA 4Y8VA 3WGTA 2PS0A 5TGZA 2XUGA 2F62A 3FZYA 2VR4A 1W88A 5BPFA 3LDFA 1JG4A 3AHJA 1P0FA 1SRQA 2V6IA 3WFJA 2GCPA 2HI0A 4AP6A 5FZCA 3Q1KA 2ADDA 3AKPA 3PU3A 3NJ4A 4JTNA 2C5SA 2JE9A 4DGQA 4C3UA 3DDOA 221PA 4KWUA 3V48A 3ZKYA 5C7GA 4YXWA 3KVRA 3PCRB 1JEJA 1UY3A 2HT1A 3TW6A 4MRRA 1I36A 4YW6A 3I12A 5DPMA 3KYBA 3I59B 1P18A 1C2YA 4AI3A 3TWIA 4OD0A 4L27A 2AJBA 1KEVA 1GQFA 5CFPA 2PKYX 1Z34A 2ZHLA 3U4GA 1OOPB 2O8CA 3BVPA 3FXAA 1K6XA 3GZJA 3VKNA 5ALQA 4EI2A 1FFGA 3KFXA 4PPFA 2JLYA 1BE1A 4WE3A 3A6HA 4CUAA 4QYTA 2NTYC 5AKGA 2EJWA 1EUCB 2ARBA 1EAYA 5CT5A 3TXXA 1DTSA 5A3VA 4CDRA 3IQXA 5DSZA 2GAUA 4UNIA 3VDBA 2FPUA 1JU4A 3EG9B 2SBAA 3DOCA 5KYGA 2LVBA 3NOOA 2VY0A 4FMDF 1QMPA 3R0ZA 2BEUB 4OQLA 1VCOA 2QD3A 1Q7CA 3ITDA 5IANA 3W6OA 1IRXA 4YECA 1EFRA 3GFGA 2H9AA 3V3KA 3DL4A 3N9NA 2Q5HA 3F67A 1CJCA 2I6UA 1SBYA 2W0MA 5KOIA 3VHRA 2ZGNA 4IUCS 3H19A 4MQFB 3THOA 3AHDA 4TSKA 4TKZA 4J6GA 1NSFA 4QX8A 5ACA2 1B41A 1TTQB 1E1KA 2QMEA 2NU7A 3IL2A 3IAM1 3ZGXA 4DVJA 3A1EA 3OCXA 4AFDA 2WYFA 2P2ZA 2KMLA 1CQWA 1AUQA 3OLVA 4SBVA 3T5DA 3KQMA 4ZA2A 4DCCA 2D2VA 2JJMA 1XF9A 5AI9A 1TMF1 4Z3DA 1NVVQ 1H9WA 3L6BA 2E5LB 1MV8A 4Q4JB 1EM8B 2VL7A 3F46A 5J4KA 3U31A 5MGBA 2ADFA 3IBGA 5IUNC 4B3IA 4BP8A 2DF7A 4COZA 3TEZA 5L7OB 3FF1A 5J9FA 2OZEA 2R65A 3G23A 1BRTA 3L05A 2AOWA 4QGSA 1TUBB 3OEHD 2JFYA 3ZIAD 4DUPA 4X8OA 4FONA 5GJWC 1K8YB 4G09A 3VO2A 4LBYA 3E03A 3AYXB 1QOOA 2B99A 2X6RA 1N5DA 2VOXA 4P9WA 3VDAA 1JR6A 4R0VA 2FPGB 3ETLA 1DPFA 1J9EA 3CVOA 4Q01A 3MJRA 2V73A 4XFHA 5KX5F 4YM3A 1LLCA 2WNVA 1RZRD 2OAQ1 4UYBA 4BMCA 1UOGA 4HDSA 2B4YA 3WGUA 4K28A 3E9DA 4TRRA 2A6VA 2IT1A 4LMAA 2XNKA 3K4ZA 3SXPA 5K0LA 2C7BA 5DDJ3 1LBEA 4P3XA 1ZVMA 4KQ6A 1U98A 3CHYA 2IDJA 3TS1A 3IUNA 2DU0A 3KCQA 2JBAA 5AKHA 1N2CB 3QFSA 2X22A 1U2EA 3AR2A 4RTKA 4RACA 4BLUA 4HL0A 4GB32 4O6VA 1Z7S1 3P3PA 3S1SA 5D6OA 1RWBA 3WINE 3OX4A 4GR9A 4DGSA 5BMVA 1R5JA 1APNA 1EHYA 4DC1A 1QF6A 2ZCWA 1OPOA 2Q9AA 4MW7A 2WWWA 1UQUA 2Z8XA 3LHIA 1FNMA 3P20A 5TNXA 4H7IA 2JH3A 1AUXA 4Q39A 5CYGA 1B3RA 4OQEA 1P74A 1G59A 4GOND 3QNUA 2GPJA 1PVC1 2Y99A 4Q82A 1KBZA 4HDQB 3QZUA 4OKIA 3THPA 3Q41A 1QQ6A 5CVDA 2R751 3KZXA 4CEYA 1DP4A 5C81A 3K1TA 3U81A 4FD3A 3HKEB 2V4VA 2X5NA 3TBKA 5TPWB 3KPYA 2QXTA 1HNNA 3F78A 1GSAA 4M0DA 3BD9A 3UMBA 1U3WA 1G42A 3VPGA 2WM3A 4QUIA 2RJ3A 3OC0A 5HCUA 4JYZA 4AWAA 3L2OB 1FLDA 3HHPA 1ULFA 2H7XA 4RGVA 4JVMA 1F2NA 4FM9A 4I9NA 4XWYA 3FLMA 5BYNA 5DSTA 5UKDA 2OSBA 4IRMA 3FNEA 3FN4A 2E7ZA 1F9EA 2Y71A 1SC9A 1VRWA 1M2HA 5FL7A 2VMHA 3I9FA 3LTEA 4Q7KA 3A23A 2R8OA 2HUNA 4DXSA 3T3EA 2VPXA 4I36A 1L7PA 1QO0D 4QOEA 1FB5A 2UDPA 5E4TA 4BQOA 3WNZA 2ZRCA 4XQCA 4OLAA 3O8CA 4BNVA 3GJXC 2HCTA 4M9ZA 5EJAA 4MGTA 2IYLD 2VTXA 2Y34A 4ZS2A 3U4XA 4BLJA 2ST1A 1CPMA 3NV4A 2JW5A 2XBO2 1OUMA 2VAUA 2CJFA 1BS2A 1SRRA 1L3CA 1VDZA 3TNPB 2QL7A 3VPDA 3CCCA 5KX5A 2XHZA 3CXRA 2OAEA 4KG7A 5LBCA 1ENQA 4LF5B 5I4BA 2OBXA 1QORA 1GCAA 4B6SA 3WX0A 5KSOA 5TSWA 2ZJ0A 3EJ6A 2B1JA 4AVAA 3ZKWB 2EJUA 1C7IA 3ESCA 3FYUC 1ID8A 3W6ZA 3CRVA 1WU7A 2V6MA 3MCZA 3DT6A 3V1YA 2W6IA 3HUTA 5IJWA 2RJNA 4MINA 2W6CX 3C15C 3VHOA 1CQPA 2B98A 5GVRA 2QT0A 4N53C 4HLCA 1KEWA 3VYWA 4OVEA 5JJIA 2QTCA 4DXDA 3K8ZA 2ZTVA 2PKRA 4R40A 1UEJA 4GKXA 1R5NA 2F90A 5IT6A 3GA0A 3X2EA 1CR0A 4F84A 4Y33A 1Y8AA 4NBWA 3DFUA 4IDHA 3MPPG 2FPLA 4COOA 3RK1A 3PURA 3RBZA 4RTRA 5D3MA 1RGSA 4A45A 1EPUA 2O0JA 3ZXXA 3PDJA 2V6JA 4EAQA 4WL0A 3GY0A 2R7LA 4C90A 4D7YA 2WD8A 1N32B 1UR5A 1H2FA 1N7GA 4PO1A 5LDGA 1A9YA 4CWAA 2V7QA 1O4TA 3D3WB 3D3EA 4L72A 5FH9A 1Z45A 2BOVA 2EFHB 4FYIA 5AW3A 3WTCA 1N2CE 5DAQA 4I4TF 5LP6C 1H8EA 3BD8A 3F98A 4FCAA 2ZRQA 1HKDA 1V2GA 3T4VA 1H2ZA 1LSJA 2R48A 4C0HA 4QBFA 1B0ZA 4YM2A 2OM2A 5DCUA 2B4QA 4IL5A 4WVMB 1GA1A 2RHHA 1Q1NA 4KMOA 4AULA 1GY8A 4M1KA 2IXIA 4YV2A 4S35A 4RV4A 3T7SA 3CX8A 1ITZA 3UJ9A 3RPQA 4GL4A 1QC5B 3I62A 4UHBA 2B46X 4DA4A 3E9CA 2R2AA 3NHUA 2G1JA 3T9EA 1J1ZA 1NYWA 3N8HA 1O89A 1FFSA 1XROA 1MAAA 1QFMA 3H6HA 4ZYUA 3E6AA 4HFMA 4MPJA 2C2MA 3AR9A 3T7DA 2AFHA 4XFIA 3FYSA 5D84A 3EFOB 1O95D 3GJSA 4RHYA 4KACA 1NJSA 2D13A 4XAEA 2IC1A 1VJCA 2HSEA 4BZPA 4WVZA 5TV2A 1F5SA 4PIMA 5CX4A 1BO6A 2UYOA 1Q7EA 3V1KA 3V6LA 2DFLA 2ODNA 2WY2D 4RD7A 3PTAA 4UCQA 2AZXA 2VZOA 1YR9A 2ZSAA 1EG7A 5LZ6A 1T2FA 2XJVA 2P65A 3K0CC 5FOBB 1PFVA 2YYAA 3PP8A 5HR5A 3O94A 1WD3A 1RP7A 4KGXA 5HZHA 3E6DA 3HYSA 2QAJA 2FJPA 3LFTA 2QE3A 2VJNA 1IUKA 3SR0A 1Q92A 2P69A 1KYTA 3BQNB 3R05A 3SWWA 2Q3BA 1FI2A 4BVKA 3D82A 1IC6A 3MMZA 4OVKA 3UB4A 4BMEA 4L73A 3R6GA 3MUEA 3JQ7B 3X1KA 4B1FA 1GNTA 1WB4A 4LK3A 4OHYA 1ZZBA 3NGMA 4G9EA 4OJYA 3RE1A 4C1BA 1J59A 5AW6A 1BVUA 2CY0A 4A6OA 5KHKA 3CNOA 1X8XA 2MYPA 2NTEA 5M5BA 1WMAA 2IYQA 4QU9A 3PVSA 2ZUVA 2H2WA 4AJ9A 3FPFA 4LUMA 1YQDA 1D1SA 1U6JA 4A7KA 5CCEA 3SG0A 2AOUA 1Z5NA 3IUMA 4WVWA 3CRRA 1JUDA 3EDMA 1SVNA 2WAYA 1JDBB 2VOEA 3GG9A 3DS8A 3E35A 1CIPA 1V41E 3HXLA 2PH1A 2O7SA 1AR62 1YFYA 1DQSA 1XXHE 4CDUA 2C8JA 2J9XB 3VUOA 5EYXA 5IT5A 2G17A 1TVKB 1K2WA 1V4VA 3NW9A 1FP4A 3JAMA 3FPHA 4CBVA 4GE3A 1NBMA 1S2EA 2Y92A 1U7OA 3GLHE 1A8SA 4HXYA 1FUYB 1PG5A 4FLFA 2XYPA 1ASJ1 1NAIA 2CUZA 4JLAA 2RM21 1KE1A 1ZBE3 4UU0A 2I34A 3I3OA 4XF0A 3I34X 4XF3A 4LBNA 5LPNA 1EQ2A 4MGIE 3U4HA 3X1XA 5SZKB 4HMOA 2Z83A 4DIUA 3R7DA 3GRPA 2D3SA 1JHJA 1KEEA 3QU2A 3D0SA 2GUGA 3UCXA 3EJKA 1TKBA 2GUWA 2ZWIA 1UBGA 1M6VB 2ETEA 1TJ3A 1NXOA 1E20A 3WLJA 3N6RA 5LQJA 2GEJA 1FW6A 2VUDA 3VZOA 4EG1A 2Q8CA 2REOA 5LKAA 3JRXA 4LMPA 3GPCA 2DT5A 1E8DA 3GLTA 4KGZA 3RIGA 3S2ZA 2EKDA 5BUZA 3ER8A 5TPZA 1J20A 4RD0A 1PBNA 3RC1A 4PZPA 3P4UA 3BSSA 3FZQA 4TLAA 2RDNA 2GCIA 4BWGA 4V38A 3MFCA 3W06A 5IMBA 1Z6GA 1T10A 3W78A 1LDGA 2RC5A 1G9TA 1F0PA 1VMKA 2WUDA 2YVKA 2GEKA 1FP6A 5JVDB 1Z4LA 4AI6A 4RA9B 1BD3A 3V4SA 4CMJA 1P5RA 4F9FA 5C4WA 3W8FA 1PKEA 2JGJA 2GH1A 2JCBA 3A1WA 1F14A 4BE7B 4X54A 1F2DA 4PYNA 3ZDEA 5HIMA 4LDQA 5EE3A 1UFKA 1S02A 5KC6A 1SK9A 4WZFA 4IRXA 2C7QA 4IEZA 1IBMB 1NZFA 1KDZA 4F6LA 2P4EA 4ZVQA 4CL8A 3WMRA 3NORA 1SLLA 4Q4W1 2HMSA 1IPSA 2CW5A 2EF6A 3K6SB 3FVRA 1P45A 4OQ4A 4BQWA 4B4UA 2HHHB 5FQ0A 2BUAA 1H2RS 2C1XA 3P2IA 3QOXA 2A7AA 1IY0A 4JLNA 2VW1A 1PQPA 3QM1A 2R5NA 4BQ3A 5JAHA 1UBJS 3P2YA 1YB5A 1XX6A 3ZV7A 3VBRA 4N7MA 4OMFG 2G9GA 1ZM1A 5ES4B 3PNAA 2HJVA 5BPHA 2IYZA 1OURA 2EJBA 1ZIXA 2PQ0A 3UK6A 1PO13 1KK2A 4W6ZA 2G1UA 3O8OB 3RHTA 5JZ9A 4JBNA 4IHJA 2HLDA 2Q29A 3FBWA 3CLPA 4IUGA 4OZXA 3EGDB 4ZQGA 1PQUA 5DNUA 4NJEB 2PZJA 3IBSA 4RJKA 1L5FA 2BGGA 2WUWE 3KZCA 3VR6D 2C58A 2DPXA 3L06A 3PFFA 4A6XA 2P3YA 2HWC1 3OJOA 1FX0B 2IBTA 4E07A 3PDQA 3C3KA 3UGHA 1SKAA 1T15A 5TPZD 1SA0B 3MYXA 3H86A 2WS91 5HZGA 4F7DA 3GHNA 3CF4G 3WP4A 2ZI7A 4Z4IA 1G5QA 2FFRA 3C43A 3F5QA 5H02A 3GRUA 4IFEA 5LUBA 2C9YA 3T4XA 1UWLA 3WQ1A 3HOBA 2AH2A 2AEFA 1ADBA 4WEOA 4ZEMA 5DK6A 5A6YA 3T1TA 2X8KA 3R3JA 4Q4W2 4YM1A 1IZ8A 1GDTA 1QHSA 1XYPA 3T9CA 2CNKA 2FSVA 1V6CA 4ZVOA 3U0ZA 3ZDYB 5AK0A 4RABA 4TWAA 1N3PA 1RHRA 2XOKA 1MS3A 3ZXFA 2Y6JA 4RQBA 4NMWA 2VLIA 1P2BA 5DN6D 1PX3A 1BWRA 4BKPA 2F17A 2PZ8A 2EKBA 1BFDA 2PH5A 4ZK6A 1NKVA 2Y66A 3NBAA 4KSCA 2Z5FA 4QX7A 5JJBA 3EMVA 5DCLA 1G5IA 4PAGA 3DBVO 1UYYA 5CJJA 4RPGA 4BP3A 1TZOA 4QEKA 5HJ5A 5I8WA 4P0PB 3EXG2 3ZH9B 1Q44A 5BY2A 4B45A 4S2DA 3UV7A 1XIVA 5AW8A 1KJQA 3KF5A 2X2PA 3OSZA 1KDOA 2XTMA 1UPBA 2P6OA 2BDTA 2AN3A 5JYDA 3RTBA 1WF3A 1NLFA 3DDHA 1YF3A 3CRMA 1OYOA 5C1DA 1JSLA 3KKPA 4H7HA 3OE4A 2YMMA 1FU4A 1CUWA 3OE1A 4INOA 2PL9A 1ORRA 4B4QA 1ZKMA 2P3JA 2KBEA 5DK4A 3J81A 3H8RA 2AW5A 4C29A 5DN9A 5F5LA 4Z1MD 1LPPA 1FK8A 3F9IA 4N0DA 1LBIA 4QU1A 3CLRD 1HKHA 5EWSA 1PZHA 2PXAA 3D6NB 4XFDA 4P93A 3B7PA 3QWAA 5I8PA 1ZJ6A 3DV0A 4Q4LA 3SISA 3H18A 4OI0A 1LOFC 1NW7A 2RBEA 5BOVA 5AVVA 4L3VA 4LE0A 1U8FO 3AIOA 2JLQA 1JBCA 1VKOA 5J3UA 3HFSA 5LA6A 1VMHA 5GZEA 1T5OA 5AI8A 3R6DA 5D3QA 2FR8C 2G5PA 2VCHA 1UPSA 4P36A 1TECE 2C5BA 3AVQA 2FX3A 1TMOA 1R4AA 2XBUA 4UDYX 4EM6A 1MOSA 2VHWA 3W1WA 5TB5A 1E2HA 1USGA 4RKRA 1JHNA 1I2AA 2ZUBA 1XELA 2D2XA 2G63A 4XPIB 3EWSA 3T3HA 1OXUA 3ZCVA 1S1AA 2P5UA 1Y98A 4EV0A 2GH2A 1CAUB 4CYMA 2DY0A 4BXFA 3WIUA 3G0GA 3WV5A 2CFTA 1OFSA 3C6YA 4MVJG 4AAXA 5KHIA 3FZNA 3BA1A 4LDNA 3TEMA 4FMCB 3M6MD 1SHKA 3RRYA 2FOIA 3FKSA 5A0TA 4RF5A 5DGCA 5ALXA 1HNZB 5EYYA 1U4NA 3DQZA 3LF7A 1BMV2 3WDMA 6Q21A 1WXQA 3IRUA 3USSA 4GPZA 3ABSB 3OMXA 4EH1A 5DUXA 2LS6A 3T0DA 4RSGA 4MV3A 3VR1A 2ZI9A 1ULBA 5ERLA 4XDZA 4XDPA 4FGLA 1XYOA 3SC4A 5FLJA 3FLAA 1MVNA 4DXZA 4JI1B 4BO5A 4Y9TA 4GXQA 1D3AA 4MYEA 3VYSB 3SBOA 3W2TA 3IHLA 5IKMA 4QXPA 3DCIA 3R3UA 4FU0A 5L40A 3B7GA 3QBTA 3GZEA 2YBDA 3P0HA 5HGXA 2A6PA 3BCSA 3P9KA 1J70A 3LKDA 3VL8A 2I4OA 3W2HA 5EXSA 4Y30A 5FFMA 4FFGA 4U8HA 5BSKA