3GCXA

Pcsk9:egfa (ph 7.4)
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
530
structure length
434
Chain Sequence
SIPWNLERITPPRYRADEYQGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPSTHWQLFCRTVWSAHSGPTRMATAIARCAPDEELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRAVTAVAICCRSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antagonism of Secreted PCSK9 Increases Low Density Lipoprotein Receptor Expression in HepG2 Cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Proprotein convertase subtilisin/kexin type 9
total genus 124
structure length 434
sequence length 530
ec nomenclature ec 3.4.21.-:
pdb deposition date 2009-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
A PF18459 PCSK9_C1 Proprotein convertase subtilisin-like/kexin type 9 C-terminal domain
A PF18463 PCSK9_C3 Proprotein convertase subtilisin-like/kexin type 9 C-terminal domain
A PF18464 PCSK9_C2 Proprotein convertase subtilisin-like/kexin type 9 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.690 Mainly Beta Sandwich Jelly Rolls Proprotein convertase subtilisin/kexin type 9 3gcxA02
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3gcxA01
2W2NA 1CNMA 2Z2XA 1EGQA 2ID8A 3Q5GA 1KDVA 1P7WA 1Y9ZA 4KB5A 5FFNA 1AQNA 1IAVA 1A2QA 3F7MA 3DE7X 1TO1E 2ZWOA 1YJBA 5B1DA 1NDQA 4WOBA 4YN3A 2PWBA 1S2NA 1V5IA 1MPTA 2IXTA 1BFKA 5B1EA 1R0RE 3DVSX 4NE9A 1SCJA 1V6CA 1SBNE 3DE3X 3CNQS 1BE6A 5SICE 5ARBA 3ZXYA 3ZXXA 1P8JA 1ST3A 1DUIA 1NDUA 2PMWB 1SUPA 1SVNA 1Y48E 1Y3CE 2W2OA 3A3OA 1GA4A 1Y3FE 3A3PA 3DE0X 3F7OA 3DDZX 3DE6X 2ZWPA 4H6XA 3WQBA 4AKSA 4LVOA 3VSBA 2XTJA 1GA6A 3H42B 5CW1A 3I34X 4DWWA 1GNVA 3A3NA 4OMDA 5FAXA 2ST1A 1JEAA 1TO2E 1TM4E 2XRMA 3DE4X 3DVQX 3EE6A 3LXUX 2DP4E 3PTLA 4DZTA 5JXJA 3DWEX 1SUDA 1Y4AE 1BFUA 3QFHA 5JXHA 1SELA 1CSEE 1EA7A 2PYZA 3DE2X 1C9MA 3EDYA 3DW1X 3HJRA 1S01A 4Z2AA 5ARDA 1GCIA 1Y1KE 2PKCA 2Z58A 4K8RB 3D43A 2E1PA 1SBIA 1THMA 1TM3E 1C9JA 3GT3A 3GT4A 4C3UA 3VV2A 3WHIA 3GCXA 1AK9A 1ZVJA 1TECE 4NMXB 1SIUA 1R6VA 3WIVA 3LPCA 1SN7A 3Q40A 2W2MA 1T1GA 1SUEA 2Z56A 3BX1A 1HT3A 3TI7A 3DVRX 1AVTA 3SICE 4HVLA 4KPGA 5K7SA 2ZRQA 2SNIE 1GTL1 3EIFA 1VSBA 4H6VA 4C3VA 1TMGE 1KE2A 3DW3X 3VYVA 1SBCA 1BH6A 2W2QA 4FONA 4ZARA 2HD4A 1AH2A 1TM7E 2X8JB 3AJ9A 3T41A 1SBTA 2W2PA 1P7VA 1S02A 1SUCA 2SECE 2TECE 1BJRE 3VHQA 2GKOA 3LPAA 5JXGA 1IC6A 2SBTA 1WVMA 3AFGA 2DUJA 1Y34E 3GCWA 1ZVKA 1Y4DE 1UBNA 3F49S 4JP8A 5AVKA 1YJCA 5I9SA 3BPSA 1KDYA 3VTAA 2WUVA 1SPBS 1Q5PA 4OV6B 5AVJA 1LW6E 1SBHA 2B6NA 1GTG1 3OSZA 3QTLA 3DYBA 1BE8A 4B5LA 3TI9A 1Y33E 4CG0A 2Z2YA 4BWGA 1WSDA 2WV7A 4ZOQI 5JXIA 1R64A 1SIBE 1GNSA 1WMDA 3I2YX 1SCAA 1SCNE 1T1IA 3SQOA 1OT5A 1C3LA 3DE1X 1KDZA 2QTWB 1ST2A 1SUAA 1SCDA 1YU6A 2PQ2A 3LPDA 4RYDA 1PJ8A 3UNXA 5JMOA 4NE7A 3D9QX 5AMXA 2DQKA 3WIUA 5AQEA 2P4EA 3DE5X 1OYOA 2V8BA 3I37X 3BGOS 4OMCA 5FBZA 4DJ5X 1YJAA 1WMFA 3CO0S 4CFYA 4MZDA 2HPZA 2PRKA 3PRKE 5ARCA 1WMEA 3VV3A 3I30X 4M1ZA 2Z57A 4AKTA 3QMPA 4H6WA 2SICE 1SH7A 4GI3A 1PTKA 3TECE 1C9NA 1PFGA 2PWAA 4LVNA 3P5BA 1AF4A 1AV7A 2Z2ZA 3AJ8A 1T1EA 4HX2A 3L1KA 1TM1E 4CFZA 2WWTA 1AU9A 1MEEA 1Y3BE 1TK2A 2WUWE 4I0WB 1NLUA 2ID4A 4J94A 1KE1A 1GT91 1GTJ1 4KG7A 1SIOA 1GA1A 1PEKE 1SUBA 1SCBA 1TM5E 1XF1A 2Z30A 2G4VA 4WOCA 1DBIA 2X8JA 2IY9A 1OYVA 1Y3DE
chains in the Genus database with same CATH superfamily
2BC9A 4XQ0A 5GJCA 2EYQA 1ULGA 2D1QA 4MRAA 3FL7A 1RQXA 4DY5A 4C03A 5E3IA 4S2FA 2OAEA 3MOSA 2FW8A 2G67A 1DXHA 1M34E 1XEWX 5KHOC 1L7OA 4NMMA 4M0UA 4I7EA 4BQ3A 2BZSA 1XZLA 4MGQA 2VCAA 2O59A 1W8HA 3N7JA 3SS9X 2O0LA 3OZWA 3KPVA 2GAFA 1YB4A 1ZM2A 5F1PA 2AOUA 2DPYA 5IJ0A 1QG4A 1SMKA 3GL9A 5C81A 4D8XA 4QKFA 4B82A 1G21B 3JATA 5CIYA 2Q3FA 2JLUA 4KE9A 3THWB 2CV1A 4EI9A 4MLPA 3ACLA 5TGZA 2QTLA 4X20A 1XMOB 5TB5A 2F1HA 3G8BA 3GEEA 1GWLA 3ILXA 4AI6A 5CTJA 1I14A 4UHDA 5SYNA 3OUIA 4XXAA 4MDHA 2YROA 1F14A 4QBGB 4RZUA 4XTRA 1UU5A 1G7RA 3OKCA 3JALA 4LS3A 5D8AB 4RWEA 4URUR 5ITSA 3IHKA 1H8VA 4Q47A 1QU3A 3MCTA 3HM9A 2HU7A 1XTIA 3O2NA 4PV7A 1FLVA 1O1YA 1WPGA 2PMWB 5AJZA 4QYXA 5CMLA 3D1VA 3H42B 2O2GA 4HLUA 3AUXA 1MVOA 1UT8A 4DY4A 1SD5A 4KAXA 1IYZA 1EPWA 1HK7A 4KQ9A 4XX0B 2D5AA 4QUIA 1KMQA 3R0ZA 3MFCA 1MZ6A 5DXFA 4Y2XA 2ADMA 4E7PA 1ZVKA 1GUDA 1R091 4PG5A 2QTVA 3MT8A 4MOAA 4DSZA 5BUCA 1H93A 1S8NA 3RGWS 4KNYA 4CHTA 2YXBA 2BHSA 4PQFA 4FIDA 1NY71 2E87A 4B5KA 3D4BA 3M6WA 3Q0EA 5BN1A 4AGVA 3A0RB 5JRJA 1C9NA 2PMDA 3G9TA 3N6RA 1Y3BE 3PUIA 2G7MC 1XTUA 4GMP3 3DMGA 5ECDA 2DUOA 4B75A 5ANRB 4PONA 1NSTA 2HWB3 3KHUA 3WBKA 4YP0A 5JATA 1DLIA 2D2VA 1RC0A 1V6CA 3J8F3 1GLVA 4ARAA 4BASA 2G9FA 3U7QA 1RWXA 4GNKA 5DO9A 1KAEA 3POIA 1T2VA 3TJZA 4LV5B 4C07A 5AKEA 2W94A 3OZXA 3O92A 2Z5GA 2AYXA 3PHLA 4F4UA 1E0DA 4NYIR 4KXVA 2QTAA 1E98A 4H31A 3GW8A 9ABPA 3L5OA 4MCJA 3TLJA 1AL23 2Q3LA 2YV3A 4Y1XA 1Q95A 3QVXA 2VTBB 3KT4A 4IE0A 4ZI3A 4I9NA 1JOPA 1OJ7A 1VPVA 3DZKA 4Q18A 3LHKA 2V5VA 2GK4A 4QBTA 4DARA 3CE6A 1J1ZA 2QUZA 2G9UA 1IE3A 2XCRB 3D7KA 4OGKA 2BDTA 3DPRC 1DJNA 2F4NA 3CRVA 2IPNA 4JLAA 1CNMA 5IW0A 1AXRA 2HV8A 4RHCA 1L5FA 2JFFA 1E5XA 4F71A 1E9RA 4OQFA 3CE9A 1QJU3 5HDQA 5CZKA 2BHNA 4AKIA 3QU2A 4ESVA 2OCPA 4HYYA 2EKBA 2HWB1 4RS5C 1Q8OA 1EBFA 1KOGA 5BSMA 3DBVO 5B6JA 5LJLA 4JTNA 2ZJBA 3VBSA 2ZRQA 1SWVA 2PQ6A 3WP4A 5GM2A 4IGKA 2FDRA 4HEQA 1YKSA 2FMDA 4JL8A 2KSQA 5FWXA 3WP6A 1E3WA 3FVVA 1R093 3QYJA 3C1TA 4PHFA 1DIAA 2HT6A 1XNTA 1KJ9A 3N4MA 4JLVA 4AICA 2O8VA 1E5VA 3V8MA 4KMOA 2C2KA 1HRI2 1CFJA 2PXCA 2C4VA 5CT8A 1VZ2A 1ZIDA 4AM8A 1E9SA 5EZWA 2TUNA 3QLUA 4WZAE 3QHQA 1OQ1A 3H1BA 3DBRB 5I7UA 2NYRA 1GUFA 2Z8ZA 1O9GA 3I0MA 4FDTA 4ZYTA 2D1SA 1XOYA 3RK0A 4P2GA 4MQ5A 4N0PA 1T2UA 1JALA 3IPRA 4QPJC 1OI3A 3DT8A 1F2TB 5E9WA 4W8JA 4ZP1A 1TJ3A 3WP0A 2CYAA 2ABWA 4ZCMA 3CC8A 1AR91 2YX1A 3L8EA 2LW7A 2GM3A 1RC8A 3UMCA 1AHNA 3RBZA 1Y4ZA 2EFCB 2HJ9A 3WYFA 1UU4A 2JFUA 3V8QA 5JAPA 1ZA1A 3UB3A 2XUHA 2AQKA 1KFJB 3A9RA 4XXPA 5E4FA 3OSUA 1I3CA 1BTOA 2WC2A 5E16A 1TA0A 3SZGA 1E5DA 4JKYA 2NVUB 1IRXA 2POCA 1QQAA 4ZCLA 3FBMA 2HLPA 5EJZB 3C7HA 2Z08A 3JWGA 3HKDB 5IYYA 4NOLA 4D41A 2G1MA 2IBSA 5B6IA 2H1VA 3LBNA 5KMGA 1S0EA 3H1TA 1SD1A 3PMSA 5B4XA 5AKJA 2JG8C 2QL6A 4CDMA 1IZ9A 2ZANA 3WFIA 2FQ1A 1K8RA 1MOSA 3AEUA 3OE4A 3LY7A 3PJYA 2O7RA 3HJRA 4YW6A 1IQUA 3GH3A 4Q66C 4AG3A 1US8A 3NGXA 4YIHA 3T9BA 3K4AA 1B16A 2B0JA 1UWVA 1VI2A 2GCIA 3F2IA 1MABA 3RUPA 1N32B 1TCCA 4M4SA 1SBYA 4LJRA 1V43A 5AP9A 5AKHA 1FYVA 3MSXA 1WXEA 4INDA 3NEJA 3MIIA 4CCCA 4WK2B 4GJZA 2C5HA 3CG4A 1NP7A 1V5FA 4QEZA 4H1TA 4NO4A 5KHJA 1GZVA 4TT8A 3HJFA 4FZ3A 1UFRA 2A71A 3H5OA 3C24A 2VJDA 2YJ5A 3ZFFC 1XNCA 2JARA 3ISJA 4YWAA 4D82A 1OHFA 1JNXX 2A7XA 1HSZA 1XVVA 4JEMA 4KSYA 2ZEXA 1KQ3A 2IU4A 1GTRA 2WTNA 3KSBC 2BY4A 3H6HA 5ARBA 2W08A 4JKMA 1V7QA 2ZTVA 1NXMA 2V97A 5J2TF 1AGYA 4FMDB 4GC9A 4B4WA 4NYIQ 2D2FA 5A32B 3VBFB 1PO11 4JVAA 4QXMA 5DW3A 2PA0A 3G0DA 1KKUA 4D57A 2VXRA 4KWUA 1J0AA 4ZU3A 1ULTA 4WKOA 4B7UA 1CY6A 4XFKA 4ZJZA 2R85A 1LPSA 3O8BA 1WY7A 2PLFA 1KFBB 1X1SA 3JAWB 2C7QA 3IBMA 4QGFA 3VHXB 3UH0A 4BJ1A 1QTQA 3AZPA 4LLFA 2J1VA 2NVOA 5EZYF 3EXAA 1OCEA 2D5LA 1X1DA 3ZS9A 1LLFA 2XMCA 1FBNA 3LW8A 4NBUA 3VJLA 3QVWA 3ZZNA 1ZGHA 4YHBA 5IAOA 1TKCA 1TVGA 4TVSA 4FE7A 4OLLA 4OLJA 4PX5A 3QWIA 5DDJ3 3CZAA 3KXLA 4DY3A 3PVNA 3OMWA 1CZHA 3OEHA 3LUJA 4M8SA 3O12A 3VRHA 3HWSA 4MS1A 1RYYA 2Q4BA 2ZFUA 3DTTA 4QZVA 3WVJA 4S04A 3X0DA 3SBEA 2Y1OA 5I9LA 3V2GA 1AZSC 4F11A 5JVDA 2HRDA 1A96A 3L2YA 1XYNA 3ZY6A 2Y2UA 5K4HA 3DYOA 1S0CA 5D3QA 3UJ3X 3CUSA 2DPLA 4WNCA 4MHRA 1H5QA 3PUHA 1HDXA 3DXTA 4HDCA 5GZDA 3QE3A 1HX7A 1QE0A 5JH7F 4YVWC 2BZGA 4UJ5A 1ZUNB 5AKXA 2AT1A 1UXJA 1GZWB 4DB5A 2WO1A 4BEVA 4OJYA 3I9JA 2VPQA 4KDCA 4UTPA 3W34A 4FU0A 1QQP3 1ADCA 4LRTB 4GX1A 1W6QA 4Y9SA 5A6XA 1EM8A 4DWOA 3F7MA 2VRNA 5JSQA 1B0PA 3HKDA 4KQHA 2FZ4A 3JQ6A 3VPSA 2UKDA 4HQNA 4WCFC 3U17A 4RSGA 4DBZA 4ZV9A 4RMNA 4IHJF 1UPBA 3UHOA 5J5CA 2ZWPA 4BIMA 4D96A 2XQGA 4M01A 1RFLA 4FPEA 4LKRA 4E8DA 2PS0A 5J5VA 3VYUB 5EEGA 3V8VA 1YUMA 3N7AA 4ZOAA 1ENQA 1Z6YA 4XH9B 1ZINA 2ZGMA 3ZDZB 4BNXA 2G40A 4ZN6A 2K87A 5IXJA 1AVTA 2WYOA 2Q3HA 4DZRA 4Z9YA 2GWRA 1M9NA 2PLV3 2UZ4A 1QFYA 2XZDA 4FX2A 3BE5A 4JVMA 1I9GA 2XDWA 2AR9A 2DUPA 4E4DX 4DXRA 1HA3A 1MB0A 3D4PA 1QJEA 3JU3A 3MWJA 2FQPA 1B0ZA 1Z29A 4OVKA 1ODMA 4AHZA 4XF4A 3L41A 4MR7B 3ES4A 1FBTA 1A72A 2HYDA 1Z6XA 2ZI3A 4I50F 2VMGA 3P3PA 1BW9B 4DC1A 4RFVA 2QP3A 3WYDA 2WNUA 4WOCA 4EY8A 2YC2C 1XX6A 2Y6GA 2FXIA 3CMGA 8AT1A 1JDJA 1W06A 2PA3A 4TWIA 3KKPA 2IUWA 3JQCA 3NV9A 4FZ5A 3HXOA 5EHGA 3DOJA 1OD5A 1OLMA 4MVYA 4WUTA 4N43C 2C5LA 1IZ7A 2WIKA 3DXFA 1ADFA 3LDKA 3LFIA 3DEKA 1AUPA 4MYUA 4ILKA 4Y1VA 2YHJA 4BJ5A 4QXQA 1N1TA 4DKXA 3C8UA 1EFUA 4D3DA 1RAGA 3LWBA 2W0MA 4DMUB 4S1TA 1YVUA 1EPUA 2EIEA 3B78A 1X50A 3RZLA 4L15A 5LUBA 2FSPA 2GD0A 4GYJA 4ENRA 5BYKA 3G9UA 1REQA 3G7SA 5AW3A 2V1UA 2ZYRA 4DSNA 3U4CA 1JX6A 2GALA 1JFFB 1T9ZA 3HY6A 2C26A 3TW4A 1U2EA 1Z5UA 2OBLA 5B5SA 3O1VA 1T5LA 3OBRA 2BKVA 2Z6UA 1I2MA 2VUSA 2HPZA 3NCHA 3ZQ4A 4L92A 4C7KA 1RXIA 1QIIA 1PJZA 2I65A 2EEZA 1YZVA 2ZRKA 1MJ5A 2GN8A 2DFNA 3LAGA 3ABOB 3NNNA 4G65A 1VBD3 4LQCA 2H4FA 4GHWA 2ZYDA 3WGYA 4DWVA 1Y9DA 2F1KA 4COZA 5BUQA 4L97A 3AKTA 5JIUA 3H3JA 3KRTA 5FYIA 2XWJI 1XP5A 2JIOA 2EG5A 4HXCA 2HTFA 1DT3A 1JVSA 3T1YB 5KHKA 2Y93A 2JXAA 5CT6A 4TV9F 5DOVA 4DDUA 4PQGA 3ZZMA 4E8CA 2OE2A 4RIHA 2CWMA 2GEUA 5JVDB 5BNOC 3UMVA 1GQPA 4RJLA 2JDMA 1UMBA 3NX4A 3I5YA 2Y99A 2PQQA 3SGLA 4E5UA 4C08A 4WKNA 3AKRA 4IEIA 2FEMA 4GUDA 2HK8A 2I4NA 1SCRA 4I4CA 4TKUA 4P4TA 2R2GA 1O77A 3A4MA 1ZVFA 4IIUA 3A6FA 1YR6A 1R7RA 3RV4A 4S1WA 4XACA 3GFSA 2XQRA 3O1MA 3HIFA 3S7TA 1IFXA 3LX5A 4RTQA 1L5WA 3AV3A 4FFSA 1AKWA 2JLAA 3B89A 4GGMX 1QWRA 1UOFA 4EW6A 3GJXC 1OKQA 5J36A 2PE5A 3VKGA 1CZTA 5A3JA 3OGGA 1NPDA 4YCCA 1K7EB 3DVQX 4LDQA 1G8YA 2QE3A 4YA6A 1GG5A 4OM7A 1QRRA 2IV2X 4E22A 5FFFA 5BWMA 4ANFA 3RK1A 1RLUA 4H3SA 4TKVB 1NXPA 2K7FA 3R7WA 4FCTA 3KD3A 5HIMA 2J3LA 3DMTC 4GYYA 4B79A 2H5LA 4FVVA 1BBT3 3SYMA 4MWZA 4CCSA 2JC3A 2JG8A 4C3ZA 3QMVA 1P9WA 1EAH1 2ZM5A 3M8KA 1RZUA 4REQA 3WWEA 3KKNA 3PL5A 3OQIA 4KPEC 2RHMA 4GX0A 3C45A 4YT8A 1NX9A 3TE6A 1RLTA 5EIHA 2G19A 1WCYA 5ALVA 3ETEA 1MW9X 1NLUA 3K35A 5FLJA 3NHLA 2W0XA 1FVOA 1WZNA 1DQYA 1CRWG 2Y9MB 5J7MA 2FWPA 1OGIA 1GDHA 2XLFA 1SULA 3H2JA 2ZJ6A 4IV5A 4BVBA 4JDUA 1BGWA 3V7WA 1IBLB 5DFAA 4L4SA 4YDHB 2W4QA 4P0PB 1NF8A 1BN6A 4DNQA 1H69A 1T8RA 3QIAA 2VEOA 5DAWA 1ZRSA 2OBYA 4CEHA 3CX6A 4J4TA 4P14A 4NH4A 2H1IA 3ZWDA 2BRUA 1Z4MA 4FQ4A 2ECFA 3GXOA 1AX2A 5GADl 3IA7A 3PPIA 2DCMA 4OXIA 1MZFA 3E9RA 1F9AA 1C29B 5CDSA 4MI1A 3WB9A 4M83A 1U98A 3MXTA 3WT3A 1E9CA 5C7GA 1OOPB 2AF4C 4U2EA 2PZJA 4HDKB 5FDBA 3RG2A 1JQEA 4IKPA 1SQ6A 2XBO3 2C57A 5EJ6A 2J4DA 4R9RA 3L8YA 3FYSA 5DYNA 2C7BA 3BVPA 4NMWA 1UXXX 1Y37A 2XWBF 1F06A 3KYDA 2B4YA 4M1QA 3L4BC 4H60A 4LJYA 4P31A 4B9EA 2GBGA 1P4AA 1XA0A 2FN4A 3G9XA 4AZSA 4CMIA 1RJDA 3FWZA 1IL0A 5KWSA 2J1RA 1U6JA 4GM4A 4R6WA 2OPWA 3HJTA 3KEMA 2B36A 3G1TA 2P3JA 1L1FA 1CP3A 3QV1A 4IX9A 4O61A 3OQJA 3DC2A 3KVNA 2X9GA 4FW8A 4JGZA 3VBRC 3CNEA 3RNLA 3TXAA 2IXIA 4XUPA 2VZQA 3BG5A 5KDOA 1B0AA 1U4SA 4XQ4A 1O58A 3AR8A 2F7SA 3S7IA 3UY4A 3UMRA 2J42A 2VJQA 5FR1A 2JDNA 3IQFA 3HXLA 4RY0A 3M2MA 2ZI9A 4M9SA 3USCS 3OEAA 1WDTA 1F2VA 4E21A 1E5IA 3I3EA 4F4HA 1Z7BA 4ZVSA 1AKQA 1RMQA 3A2NA 3AF0A 2YNMA 4X00A 1WCXA 5JYEA 1UJBA 4KQ7A 2GVZC 1TKBA 3O1PA 1AK1A 2GYUA 4DQLA 4R68A 4N3CA 1OB2A 2QQMA 5IJRA 3KB5A 1DC7A 4J7XA 3RV3A 1NJGA 1W0JD 1CY8A 2J1EA 3R9XB 1J06A 1E9AA 2OUHA 3WMEA 1EDZA 2V7UA 3R2JA 1AQUA 5DN2A 2C95A 3M4YA 1ORHA 3I97A 1ZL2A 4E0BA 1B00A 2HA5A 1UC4B 1VBA1 1M34B 3GGLA 4IFIA 4GMXA 1RUD3 2UURA 5J48A 3GLHE 3HL0A 4OH1A 2QLBA 3QVSA 1CAUB 2ARKA 3C74A 3DHYA 3PDWA 3OWXA 4J0IA 2IGBA 1EBBA 3PU8A 1YB6A 1DO2A 3Q4GA 2OXFA 2IQ5A 3SIXA 1QX3A 4O2AA 4R1MA 1XV5A 3MGUA 4MDEA 2EEPA 3EDRA 1DKOA 3RFFA 4A5SA 2A1IA 3WK9A 1YVEI 4YRIA 4ZZ3A 4FDMA 5L7OB 5ALWA 4U7TB 5CLIA 1K92A 3OM0A 2VJXA 2CFCA 1P2VA 5E4JA 2HHLA 3IL2A 2I71A 4TXWA 2EIBA 3EVCA 1ZEJA 4BTEA 4AF8A 1WLDA 1YKFA 1R6BX 4UU1A 4NUBA 1W73A 1NCRA 1ZFNA 4FB4A 2WT4A 2QTHA 3GLHB 4ARZB 3UATA 4G5XA 1CWPA 4IFTA 3KUCA 5CIRA 2W2PA 3AZZA 4QT4A 5FBLB 3PLQA 1JR3E 2IX9A 4DPMA 5LQSA 1TIKA 4DLSA 2UVQA 4AJLA 1TZJA 4PQ9A 1I13A 1Z2OX 2K7ZA 3MGBA 4B80A 2F48A 1YFKA 1HQWA 4HGRA 3NS7A 3JUUA 3W3AA 3K4ZA 3BQNB 3ZQUA 4EFNA 5G1NA 4MGHA 5FXMA 2OPKA 1JZSA 1FJGB 4TYPA 4NFLA 4OHZA 4RD4A 3VR1A 2NZUG 3PQDA 5FFNA 4D7TA 1W49A 1E58A 2P8SA 4MB2A 1ULPA 3UCFA 3P32A 3FLPA 5CCBA 2VTFA 4N48A 1X14A 4BUCA 2JGLA 5G3ZA 4Y2HA 1ZD4A 2OILA 4NBKA 2WWFA 4GM1A 3JR3A 5DCLA 1GZ6A 1CF2O 3QU4A 1K9VF 3VBHB 4QB2A 8MHTA 1I6WA 1IHYA 3O82A 2VOVA 3GCXA 5EXTA 4E3WA 4HNSA 1Q17A 2XQVA 1BZWA 4PAOA 2VPVA 2BRUC 1ZBA1 2CJFA 4LHVA 4BWGA 4N1AA 2XCTB 1CEEA 2WWJA 4XYLA 3NV3A 4E46A 4Q27A 4YRPA 3VISA 1GU3A 1XJWA 1PBNA 4LHYA 1Z0AA 5D8DA 3AR5A 1UJNA 3H50A 3I2GA 3RWMB 4ETWA 4EVRA 5DLQC 5TT1A 1UBKS 1RHRA 4C4OA 1F2NA 3TW8B 1KSFX 4MDYA 4AZ0B 1R1DA 3JV7A 4JEUA 5HCFA 4B3NA 1GZ4A 1E2MA 4BQIA 2IS6A 1U1GA 2CF6A 1E4OA 3ZTWA 3FPAA 1J8QA 1KU6A 1NP6A 3U5TA 3THDA 3CBQA 4RK7A 5JPIA 1QIGA 2WFAA 1W2HA 4RQBA 4LORA 3E70C 2AC4A 1I6LA 4YRGA 1SBFA 4LOJA 1GOTA 1U1IA 3ZIAA 5FPQA 1D9XA 4JAAA 2ZS9A 1BJQA 4Y24A 1NBWB 3QU5A 3IV9A 2PHTA 3M6MD 3W7VA 1OXTA 3GMTA 3LCVB 3PNLA 2FPUA 1IXSB 1YZTA 1SBTA 4JJ6A 5C3PA 4DMGA 4DLXA 5FRAA 1VLZA 3ORYA 1U1CA 2YHSA 3BBLA 2UYAA 3FW1A 4X3CA 3FUVA 3JD1A 1M34A 1Z5PA 3G0GA 1PTJA 2GNBA 1GZ5A 5B1IA 3AKCA 1V8PA 4D74A 1GEGA 1OIVA 2N1BA 2IEIA 2I1VB 2BP7A 2D7DA 2LWIA 1XDZA 1P74A 4N39A 1AC5A 2AF3C 4GT1A 2ZGUA 2PKYX 2OAGA 5E7IA 3AKQA 3UV7A 4TXHA 2AWNA 1Q0QA 1NOVA 2PANA 3ID6C 3TZ6A 2D13A 3F5MA 4GP9A 5TGDA 3LPMA 1UPIA 1YS1X 2O7VA 4FGZA 4MW7A 1CSEE 1RMTA 3E22A 1AKMA 4ZXEA 4PLPA 2C58A 3ZN4A 4IXNA 4FYHA 2WA2A 2XMRA 3KPUA 3IPVA 2IA5A 1GRQA 4Z99A 4CHGA 2QQFA 2FY8A 4NHYA 1I30A 3IODA 4GMP0 3SCFA 3SXPA 3GHHA 2XVLA 3VKLA 2WZPP 1QUFA 5JSZA 2RDSA 1WCKA 4OUDB 3MTQA 3S2FA 5HOQA 4IG4A 5A4DA 2VH1A 4DG8A 1RUI3 2KB0A 1HEIA 5JIBA 5FXVA 3ZHVA 5IARA 3JR7A 2X4LA 5LNK1 1VFPA 4D69A 4TL7A 3CB4A 5AC91 1XAGA 3QLJA 5E9JA 1KAMA 5K0ZA 4WH0A 1GRCA 2WSUA 3BCRA 1ASJ2 1JILA 4PNPA 3RHSA 3UMSA 2YS6A 2FZCA 5CIQA 3UAYA 5BXXA 3FBWA 1MZEA 2QD1A 1M1YA 4IKOA 4Q02A 2FG7C 4EHDA 1P62B 3B1VA 4RVDA 2J41A 2ZGKA 1ECFA 1BOOA 3QWAA 2QRQA 1PX3A 3G5AA 2FN7A 2PD6A 3PEYA 2XOKA 2PZMA 4B8EA 3AL0C 1XAIA 2FPWA 4XPIB 3PGJA 1KMIY 3AI2A 3VR4H 5DNUA 2ZTMA 4EW1A 4G4IA 4BZZA 1E2KA 1KERA 1MB3A 5FL7D 4U9HS 4F6CA 4YVWA 2W6QA 5ERYA 2VAPA 1VSVA 1A9PA 5JXIA 3DPIA 1FTNA 3CVXA 1MVNA 2G4IA 4UBMA 3O1IC 3QH6A 3KTAA 3JD3A 4F1KA 3WD5A 3KJHA 5U4QA 5IT9A 1GKYA 1X1AA 4HATA 1RUJ3 1XCPA 3WBFA 3TB6A 1YE8A 3FWYA 3C39A 3SH5A 3JBG1 2ZYWX 2GQ0A 4DMHA 2OZLB 4DGSA 1DKLA 5AUQA 1YI7A 4M7WA 2NSJA 3VDDC 1TOAA 4EENA 1WZUA 5FBWB 3NTUA 4YJFA 2CKMA 3TR6A 2R7MA 1EWYA 2C3YA 2XBLA 4UW9A 1RP1A 3R7BA 3IC5A 3T15A 3BCWA 1D04A 1U0RA 1XJQA 4MZXA 4HSGA 4GI2A 3OQ1A 1USVA 2EC5A 4JI7B 3R09A 3VA7A 3X1JA 2FCUA 3R7LA 2G5PA 4AX4A 5HZKA 2FQWA 3O9VA 2L82A 1V26A 2ZUVA 1NA1A 2GXSA 3TN93 4UHKA 4FAGA 1VDZA 3GAZA 2NYUA 4GOMD 4ZAXA 1TYAE 1UOJA 3E4CA 5FYDA 1WTAA 4KVGA 4MW4A 5G0VA 3DM5A 4B31A 4IS3A 5CA1F 1L8LA 4CIVA 4TYNA 1XVIA 5H3CA 1W47A 1URPA 4F60A 2B82A 1XN1A 5G4KB 3NEPX 3VR4A 4M60A 3PJRA 3WW1A 3EZ2A 1MO5A 2QVXX 3M5CA 1VDMA 2QS9A 1LS1A 3VPDA 3DMYA 3RASA 3DMNA 3ORJA 3RKRA 3TQSA 4Q4W3 4XHXA 5I7AA 3OD0A 1A9SA 1OC4A 5LZ5A 1ZX1A 3IMKA 4XCXA 4B1LA 4P32A 2AUYA 4TLCA 1EDOA 3W4IA 4N90A 2P3KA 1HMYA 1QPGA 3G7DA 4TSVA 2JIRA 3HCCA 1SZPA 1E94E 3I23A 3ZSEA 4EJFA 1M10A 3HY3A 2QK4A 1XTBA 3LGSA 2EV9A 4N53A 5YASA 2MYTA 3NUQA 3IIIA 3SQWA 3U56A 2JJ1D 2CV0A 2WUDA 2JJ8A 3I01A 3U7EB 1KI2A 1VI5A 4V24A 4CA9A 2IYOA 3JQGB 4LJHA 2B6NA 3UWPA 2RVAA 1EMDA 3QQPA 3QPDA 4DNFA 2EXHA 2EHDA 3N6VA 1C9DB 4QGAA 3LJKA 2Q9UA 4OREX 4MUJA 1T3GA 4B29A 4BQNA 2CMHA 2BCGY 4FFVA 1NLMA 5KC9A 2W7TA 3ND8A 4PCLA 3JQ8A 1EFRA 5DUUA 1S89A 5IM4F 4GGOA 1GNLA 1ZH4A 4L3VA 2RBEA 4DMMA 3SC4A 3UJOA 1R5NA 3BH7A 1DWPA 4U39A 2RHPA 1SFYA 2ZZMA 4OV6B 3EGDB 5KQGA 3BB3A 2GN6A 2XTAA 5B2EA 5D2CA 3FZYA 5FWEA 2H6BA 5APAA 4YXWD 5LK5A 2AXPA 1QU2A 4B3CA 4FBGA 3JQRA 4BM8A 4BNYA 3U48A 2P2ZA 5A1FA 5HFNA 3P5BA 4RA6A 2XONA 3DECA 3ZDRA 3VBHC 2CUNA 3ZHCA 1HTTA 2AXNA 2QAGC 2WE7A 4HMQA 1GIAA 6REQA 4EQVA 3QUAA 4QXCA 1G8FA 2R6DA 5GALA 4L73A 3WP1B 1TVMA 3POBA 1BS2A 3PBKA 4M8NE 3NWBA 3I34X 1A4UA 4YCJA 3R24A 2Z98A 4BCBA 4NV0A 5FX2A 1HSOA 1LPNA 3PFFA 1YFJA 4P80A 3AJZA 1NXQA 3VZMA 5D3MA 4HB2A 1DRJA 4RZQA 2IHBA 2PHUA 1RUNA 4LZAA 4JD5A 2FRVA 4RDXA 2D7JA 4YJ3B 1XJ5A 2AUTA 3CR7A 2QRJA 3EBOA 3TTYA 5FBVB 3QSGA 4ID9A 2PHRA 5LB6A 3Q0TA 4L4XA 4MWGA 2Q3MA 4I3FA 3QMPA 3ACFA 1D2QA 2O1EA 3M89A 5JH7A 3N9PA 4EYEA 3WG3A 4D42A 2PFKA 1OWOA 2J0UB 4IF4A 1LBQA 4CIBA 3FIUA 5DGHA 2XMQA 3H5WA 4Q12A 1I4OA 4DQDA 2AG0A 3W5AA 1EXVA 1NJ1A 3IULA 3JQAA 4AYXA 2HCFA 4NBRA 4GH4A 1UPFA 4ZMSA 2WVAA 2JENA 5DTEA 3HYCA 5G3YA 1KH1A 3GRYA 5C3RA 5EYPB 3ADBA 3ZE9A 1P4HA 3HA2A 5KVAA 3I6IA 2LUOA 3B1YA 1SZJG 3KWJA 2NV0A 3GO4A 1W2NA 4MVJI 2INGX 5DGDA 4WLEA 4EGSA 4G0NA 4OGGA 1PQPA 3I1JA 4JASB 2R48A 2AG8A 3QOWA 4XXHA 3WZMA 3GRPA 3FFBA 3GI1A 2WN2A 4Z4FA 3SZ3A 4EA8A 1UIMA 4UQLA 1KPIA 5DTRA 1ULDA 4XDOA 4R16A 1PJ8A 5JISA 1NXVA 1F9EA 1GD1O 3ZFEA 2JG9B 4JHTA 4PQQA 4UFOA 1WUKS 1XRMA 3AXSA 3SC2A 1RUC3 4XMAA 3OPNA 4IGAA 4KNCA 2AN3A 5HOEA 3VR3A 3RADC 5TPZD 2MEV1 1HW5A 1ZK1A 4J2OA 1CAXA 3AKZA 3TBKA 3EIOA 3NTVA 2SKEA 1T8UA 3Q3HA 1EV13 1ODFA 4M0LA 1LV7A 1Z07A 2ZGNA 4UBNA 4LF4B 1HOXA 2H29A 4Q93A 3LUDA 4NCKA 3TVYA 2BNOA 4TRJA 1ZISA 4B3FX 1CJUC 4DZZA 4MVJF 4KI5M 2R1BA 4V0QA 4FYVA 1Z36A 4OMDA 5T5LA 3VOAA 2ZGOA 4WBNB 1QIJA 1O5OA 2W3JA 3ZKWB 2GZWA 1OSGA 4LV8B 2ZQZA 4QKNA 1WDMA 1YRZA 5KXEA 1DFQA 4G26A 4EG0A 2Q4EA 5GIOE 5EE5B 5HBRA 5A3QA 2J6BA 5DYIA 3SXJA 4BWYA 3A14A 4IERA 4A9AA 1Y8RB 3L7DA 2HWD3 1NVFA 4DS3A 1PGOA 4WY5A 2EJUA 3WE7A 4YM0A 1I2AA 4QDQA 3SC6A 4BNTA 3TGWA 3ENKA 3KQPA 1YLLA 3B52X 2IPLA 3QCWA 4MVXA 4CDUA 4WINA 5JHGB 4I0WB 3FM9A 5EXSA 1HTWA 2WMYA 1MAAA 1UY1A 5AW6A 4DUPA 3DFFA 1LWNA 2O5EA 1Y9MA 2FEAA 1QGAA 4BX8A 3AL2A 3ZJTA 1TZBA 2AVNA 3KOWA 3JB4C 5FF9A 2VPIA 1B73A 2ZRPA 3BDVA 4Q3OA 3T3IA 3BRWA 2Y1KA 3Q9UA 4YCAA 3DE4X 2CHQA 3A6GA 3R3JA 1NM5A 1B2RA 4P9XA 3R6LA 1WJGA 1NQXA 3KB2A 1FUEA 4EBFA 4E3ZA 1S0FA 1FUYB 3ABZA 4J75A 3WQRA 4FI9A 4U00A 4BB3A 3K5PA 3P7MA 3UGKA 3UAOA 4L75A 3NM5A 4EYOA 2JFPA 2BV3A 2JZNA 1WV1A 5THQA 3H2GA 3RS8A 4JENA 4GW3A 3BWVA 4H2DA 1L1QA 4X1YB 3JQBA 1BHO1 1NAHA 1OUMA 3BHMA 4PXAA 1ZNXA 2OZ6A 1IN8A 1MABB 1E63A 1IEQA 1VMAA 4HZGA 4BQ5A 3CVWA 1MJHA 2R6FA 4P4SB 2QG9A 2WJWA 1RCTE 4IIDA 2G9ZA 4AMBA 2VMEA 1EXNA 3U19A 2V3VA 3CTPA 3P2JA 5KOHB 5LBCA 1CVRA 2CBZA 4GLLA 2VOTA 2EW1A 4XUGB 1BROA 3RWNA 3P45A 1DBVO 4RR3C 4F6LA 2NO7A 1CUZA 5IJZA 4JVSB 2BMWA 3HFGA 4JB8A 1WXGA 4PAWA 4NPHA 2PVCA 1A98A 4NY1A 1VM6A 4LR4A 1K4MA 5KI6A 5EWLA 1NMQA 2QB5A 2QXYA 4QU2A 1F2UB 1EFHA 5BO5A 3J9SA 1MEC3 3VXKA 4QPIA 3JATB 1RYBA 1OD3A 1KJRA 3VBRA 3Q88A 5AJVB 4Q4AB 2R84A 1ILWA 3KLSA 3VHNA 1D5WA 5FWYA 4NJ4A 4KQMA 1PJAA 1D4OA 2GN1A 4AY6A 1N3OA 2DKNA 1KFXL 1G1MA 2W5FA 1OIXA 4XX0A 1S2GA 4IEQA 2ZX1A 5E2IA 2IY9A 3LRPA 1OX5A 3NHMA 4O4LA 3Q85A 1MRNA 3IMCA 1F5JA 3PHCA 4UFHA 1VP6A 5DHAA 3ZNPA 1CUWA 2I7DA 3UL2A 4J7AA 4XSHA 2VVFA 3IAHA 4DCOA 4IRMA 4LJ5A 4RE6A 3ZSKA 4AK3A 1F4AA 4UBKA 3VBFC 3E9YA 4F45A 4DUVA 1OPMA 3ROTA 2WSMA 2PCLA 3L0BA 2YHBA 1E2FA 2Y0PA 4NEHB 4PLNA 2TMGA 3KJNA 5JSPA 3QXGA 3CNHA 3FE2A 1GRRA 3GYGA 4FDAA 2CW5A 5KCMA 2NXJA 4M86A 1CFZA 2XQFA 2FW1A 3THXA 3NR2A 4W5JA 3RZZA 2ZPTX 1PM7A 2WF6A 1SVKA 5BVHB 4L5IA 1AKRA 3MTAA 4NIMA 1SXJA 3AUTA 1HN0A 3RU9A 4J0JA 1ZHFA 1BO6A 4KVAA 1DCMA 2I2SA 1XXHA 5T52A 1T9BA 4QQ2A 4MIEA 5HKOA 3Q8LA 1GPWB 3INYA 2WM8A 3HB5X 3QXSA 1TNFA 1Y7HA 3K6JA 5LWBA 2VMDA 5BT8A 1DAFA 3HBNA 3M7AA 4PTLA 3N5CA 3UJCA 1G86A 1MQTA 2JGNA 2B1RA 2CLOB 4PQYA 1J9EA 1M54A 3T0AA 2C4MA 2GEKA 3ZHBA 1PS0A 2WA3A 2DTYA 4FKMA 4AMYA 4I4NA 2XVMA 4KRYA 3ITNA 1W94A 2X0EA 4BO5A 4N8EA 1NAEA 1SIWA 3FPEA 4OG2A 1QS0B 3UW1A 1HUQA 3QPVA 1XZHA 1E2UA 4KAAA 3AY0A 1RZRA 2G06A 1W59A 1M2GA 1EGMB 3ROKA 1OAAA 4N9WA 4QGMA 1NXOA 5KEIA 3PYLA 2RJKA 5EP9A 3D3KA 1UBUS 1EQAA 4AVTA 1OLUA 3KV6A 5AHOA 3AETA 4QJ4A 3M9LA 1ZBE1 4HO1X 1B8OA 4XR9A 4QB6A 3QW4B 4QTTB 2WNUB 2WYIA 3U4DA 1D2GA 4CIXA 3T1OA 3WDMA 2V5AA 2GI4A 4LK7A 3J7HA 4GMDA 4LC9A 5K5EA 1I94B 4BP8A 1U2DC 2OG1A 1WPXA 2CNDA 1RHJA 1Q0SA 5LUAA 4JA0A 1VA5A 4QU0A 3X3HA 5F64A 5IM5A 2OM6A 5H02A 1DARA 1KO7A 4GAZA 1JBQA 2OC4A 1LJLA 2DC1A 2XEXA 2W6PA 4OHWA 1WF3A 2WJJA 5IANA 4JQCA 2VP2A 3H18A 1KRIA 1AL21 1NLYA 1U12A 3PC8A 1ULZA 3ZHZA 3I0ZA 5AHRA 2Q1FA 2XHNA 4OJTA 1ZYBA 2IUYA 3OSZA 4FDUA 2XGMA 4DQVA 1Y6FA 4FM9A 3RRYA 3E18A 4J90A 4DNOA 4QT0A 1F2UA 2O6LA 4V38A 3K72B 3OIFA 4ZU6X 2R8EA 2VO5A 1GSIA 2WHPA 3K5IA 2QAJA 1S2MA 1VG9B 5A7WA 1OYVA 3PPXA 4HLNA 1AS0A 2NNWB 3H1EA 4HFRA 3DR3A 3T3GA 1BMTA 2ATCA 4IPTA 3V4FA 3O8OB 4TMVA 4W7HA 3V4VB 3UJ8A 4Q7EA 5FYCA 2QYHA 2GH8A 3T0GA 1N2GA 2ONZA 2YXEA 2F43B 1WUJS 1BWRA 4K9SA 3KV3O 2B5WA 1K3FA 3LX8A 2BKLA 2AS0A 5ICCA 3H1AA 2QE7D 4YNIA 4PN7A 5IT6A 2ZYTX 3PQCA 1JG6A 1JXQA 3ENVA 4GVLA 4KXWA 3EEBA 3LCPA 1KE2A 4YRTA 4AROA 2UUPA 3T4UA 1Z4IA 1XDDA 3K77A 3DB1A 1FC0A 3EFOA 2Z2YA 5DWDA 1XA3A 1JHMA 4AFMA 3DSRA 4E31A 1NNSA 4F56A 3QU7A 2IGTA 4HV4A 1MOZA 4O0LA 1HN1A 4BNDA 3K48A 3THXB 2MCFA 3HZOA 1R0XA 3UKDA 4CKXA 1VB2A 4Q7MB 1QXRA 3GGPA 3FHLA 4G63A 4HPKA 1NBIA 1TO1E 1C8M3 4UTOA 3Q7PA 5K1ZA 2WYSA 1SCJA 4FUQA 3GZ4A 5IFTA 1DGLA 1QJY2 4DDKA 4WVWA 3AKYA 3U10A 3HCWA 4Y8VA 1C57A 1KDTA 1UJ6A 3OCCA 1UOOA 4WDQA 2YMZA 3HSKA 5DXDA 3ZN6A 2B1QA 3D43A 1U65A 4LITA 2M9MA 1AJOA 2VCMA 3OEYA 3O5SA 4P22A 2JGEA 3B70A 4MA4A 1FU4A 2JEMA 5FD8A 1KEVA 3I1YA 4P7JA 3UGFA 1Q7BA 4MUHA 1RKQA 1IN5A 1TK3A 2P75A 3JVIA 2LZ0A 2QZ2A 1BFDA 1NI5A 4WXEA 4EHIA 4P93A 1YS9A 1YCIA 4J2HA 5E3JA 1I80A 3F7TA 1VJTA 3V46A 2MIIA 1O9BA 1PR0A 1M6EX 4RY8A 5A4MS 3KQSA 3I3OA 5IU6A 3DG9A 3E1KA 3H2YA 2N9UA 3G1WA 3Q2KA 4GH5A 3JWHA 4YCNA 5IJ9A 4EGAA 2I67A 5FFMA 3RHFA 5DLYA 3R0VA 1CE8A 1QJU2 1H94A 1FSGA 2EZUA 4ET7A 5LBIA 1WQ3A 1CAVB 3NOVA 3E0QA 4RETA 3RKSA 3T9CA 3I9KA 3LOUA 4E88A 3UO8B 1II9A 1TE2A 1AYM3 3B01A 3RREA 5FY7A 1CB7A 3EVFA 3CA8A 5KVCA 4QPNA 4TQUS 4EB8A 4IJWA 2H85A 2OXRA 2WIFA 3HRHA 5LA9A 4OZXA 1QOTA 1Q8SA 4FCAA 1QOOA 2W8ZA 3T9FA 3KJEA 4KPUB 2WNVB 2FF7A 2CLCX 5AVVA 3D3QA 1D1SA 1T25A 5HE9A 3DO8A 2N1MA 5HCUA 1XVUA 1Y8ZA 2GCPA 1YC61 5CKNA 4IZ6A 1N75A 3FAKA 3RD5A 4YMGA 1BHGA 3LWDA 3X1YA 1L8OA 2NZ9A 4EPWA 4A3SA 2BTVC 1BJKA 5JADA 2PGXA 4QOEA 1VRBA 5FHRA 1BFKA 3O21A 4OKSA 4PZ0A 3G2HA 4R9NA 4DXAA 5AOVA 3KQVA 2MYNA 3CX7A 1NU6A 3R6SA 1GWNA 3K92A 1LU9A 1RI2A 2JLBA 2Q29A 2VZTA 4GE0A 3KZXA 4W9NA 3CS3A 4LO6B 2GLTA 1QF3A 2PJZA 2JDIA 3B9PA 3FFAA 3G7NA 2NTYC 3ILSA 3T5CA 1PNFA 4HPKB 1Z08A 2BTEA 2DWCA 4G84A 4MP6A 4P9IA 1QKKA 3D6AA 4AJPA 1YGYA 5KQRA 3GZNA 5HUJA 5F1KA 4GI7A 1K68A 1LECA 4WZZA 1LXCA 3LAWA 3HB0A 1Q1QA 4S12A 3MO4A 4MI3A 1K8ZB 1QGYA 3LLVA 1TRKA 3T0IA 5IDWA 4Q4X3 1NY5A 1E5RA 1EFRD 5BUZA 4X8LA 4RIEA 3OCPA 4I09A 3HO1A 3E7PA 1EFKA 2OAP1 1QO0A 1U80A 5FZGA 1EE9A 5H9VA 2ZCJA 2QIOA 3RIMA 3DO6A 2ZIVB 5FZ6A 5C9AA 3GBVA 4NX2A 4W5OA 4DMCA 2X1LA 3GNLA 1SG3A 5JARA 3KBBA 2FEPA 1E57A 1KTVA 4FMDF 1WLTA 5HJ7A 3QELB 3ON7A 3VU9B 2AV6A 5AXDA 2NO4A 4HZUB 3TAHA 2WTEA 4JP3A 5D01A 3TD9A 1IZZA 4YRAA 2DBIA 4IV3B 2ZJ5A 1PHMA 4YGBA 2WZCA 3GP8A 5IVVA 3AIMA 2HMYB 4G2NA 4PEVA 2AC1A 3H1PA 2MSLA 5BMOA 1VKJA 1NFFA 4RK1A 2C1XA 1RM4A 1WP4A 2FV8A 2BJVA 3FPKA 4CCOA 2E26A 4IDPA 2D44A 4YPOA 1AV7A 4AJKA 4EEZA 4QU1A 2GMMA 1O0SA 4FAHA 4EG5A 4DG9A 1OBFO 3SEAA 1NA1C 2DCTA 3H8RA 2J7MA 4XWKA 3RZGA 5M7EA 1MO3A 3R8XA 4F4JA 1S9DA 4RWZA 4R0MA 2ZSKA 3F1LA 1M4WA 2J9XB 4WI1A 1QJX3 1I3NA 3ZU5A 1UYXA 4UBHA 3NIBA 2EKDA 3MTJA 4UBLA 3LVQE 2VUCA 4NWWA 1W88A 1YFLA 3QI7A 2RIPA 5BY2A 2RS51 1SELA 3U1VA 3MZHA 3Q7EA 1CR7A 1YS7A 1IUNA 2QD5A 2GUGA 1SHKA 3FVWA 3GRVA 2OZVA 3TEMA 5GVSA 5DCYA 3OJBA 3OGVA 1MZVA 2VZRA 4CLOA 2NO1A 1N2EA 2PWZA 4P4UA 2HKIA 1NQAO 1SXPA 3OMLA 3OFNA 1HB4A 1CY1A 3I62A 4D8UA 3T08A 4YZ5A 2QRZA 4KQFA 4MVJH 1QCZA 3HEAA 2YN4A 3OIGA 1N6KA 2RDRA 4Z0PA 1T0HB 5I3CA 4H7IA 2OR3A 1EDEA 3FIJA 2VQSA 4FZRA 3U7HB 4MJ3A 3C85A 4YT4A 1BKYA 1TUGA 4YSFA 1OBCA 2BFBB 2RR11 4GWIA 3FBYA 1R37A 2V6GA 1CQ9A 1QIQA 2A5GA 2AJTA 3Q3GE 3FX2A 1UMBB 3WBJA 1QIFA 1HLDA 1CAWA 4U6NA 3EYWA 3M4NA 3C48A 4FLMA 4DQAA 1GPJA 3UC9A 3TZKA 2R0QC 3RLIA 3KQOA 2I74A 3WBBA 3L2HA 1IY1A 3H83A 1QLJA 1Y9EA 2C9DA 1KYTA 4E33A 3EF3A 3G2KA 4K0KB 4FOVA 1YR9A 3ZO0B 3S7ZA 2HQBA 4XBNA 3MJDA 2Q5EA 1MH9A 3ROZA 3I39X 3E7DA 4JS0A 5K7SA 4MS3B 1QUEA 1P81A 2LR0A 3I4CA 3S2YA 4KREA 1A4IA 3LX6A 3KZNA 2DCJA 3ZH9B 1TF5A 2YZGA 5FYZA 3GWGA 3C3MA 3GJZA 4KLCA 4WQMA 1W36D 5C8YB 2BGIA 2NQ2C 1YF3A 4CFYA 4Z9AA 2PRKA 3DTVD 2IHKA 4BYMA 4XURA 2RC5A 2GLUA 2W2KB 3KT3A 5IJAA 2VWGA 3IAS6 3BWXA 1W0NA 2JFYA 1HB2A 2R1TB 4EABA 1I51A 2YHIB 3AYAA 1NVGA 3N0WA 5E0OA 1RS0A 5K8IA 3FNRA 4B4QA 3E6AA 4GGPA 3DL0A 2AXEA 1R6AA 3CRRA 5GJWC 1NE6A 2FF5A 3D6VA 1AJEA 1H9WA 5ALLA 3PR3A 4LO4B 3HKEA 2ENRA 4E27A 1T0BA 1XCJA 5CDHA 4C1XA 3NKFA 4MRNA 2ZYIA 4CMKA 3ZFFA 4MINA 2NXNA 1P61B 4WLUA 3VNAA 1UNBA 1JN0A 5CYFA 4IEPA 4MV7A 3VH4A 1VLNA 3JVVA 1UOQA 4FT8A 5I5EA 4FBFA 2JG3A 3QKUA 1ODNA 3CUVA 5FY4A 3DA8A 3FVTA 1PGNA 5CG2A 3Q98A 4C6HA 2RGGA 4Z0HO 1X39A 1FP7A 3E27A 3HNPA 1UCFA 4MHUA 2A9PA 4DRXA 2QQOA 4M3CE 4GI5A 5EXDA 1RC1A 4YWHA 4YAOA 4PIZA 5FIXA 3S3TA 3IA2A 3G5TA 4GB32 5BYBA 2XAAA 3QFRA 1U4OA 3P4UA 4CU6A 3NRBA 2VZ8A 4SLIA 3K09C 1KC3A 4XDQA 3LUKA 1YIOA 2ODNA 4PXSA 3DXZA 4IH9A 4I9FA 4JUFA 1J97A 5FPSA 2G1KA 1TNDA 4BEBA 4DLWA 2Z9CA 4TQ9A 1HO3A 4RA9B 2NV6A 3WLHA 3VZKA 3IXQA 5CK5A 5EJ7A 4URFA 1NZJA 4IEUA 5JS1A 1UDRA 4L4UA 4TRMA 2WWIA 3G2OA 1RL3A 4W5TA 1NRJB 2VP6A 3INAA 3CLTD 2FMKA 2B3TA 4BNNA 1ZW1A 4OQPA 2DURA 3IDFA 2FX5A 4NFHA 1KDZA 4OY3A 1F6DA 3OUJA 3GXUA 4EX6A 3BXXA 1YR7A 2VNIA 2Q50A 2YV5A 1J9ZA 4MKXA 4CKCA 4Y26A 4LVNA 2LS6A 1P39A 2XE7A 3CN9A 4RTMA 2WLPA 5DSTA 1BQ4A 4MCIA 1OXMA 3ZYBA 4MGKE 3AJDA 3ZIAD 3SNKA 4LXTA 4X61A 1P3DA 4K2HA 4P9NA 2Z09A 1OFUX 4KFSA 3WUCA 2RHWA 3W9AA 4RX1A 4KN5A 3VBUC 4QXOA 3KC2A 6NULA 4ZI7A 1DGWX 4CQMD 2JVJA 3I8OA 1FNDA 1Y5RA 2FMYA 5EZYB 3U3JA 2E55A 2J7PD 1UK8A 1B8NA 3T41A 2AH5A 3BIOA 1VCMA 3KVBA 4NBTA 4OHYA 5CVEA 3RQ0A 3QH7A 2FGKA 2PPLA 3C7AA 4ETIA 1GZCA 1NKGA 3ZW8A 4BCUA 1SCUB 1JEOA 2OMKA 4DV6B 5JOXA 4BKRA 2GJSA 5PNTA 4LXUA 2COEA 3U4QA 3VO9A 4LE0A 3VOTA 3Q6NA 4NAHA 2CUKA 1X38A 4XUNA 1U90A 4UEOA 2M1ZA 2YBEA 2VAUA 4JU9A 2PJUA 4LGCA 2Q9CA 4JXXA 5KTNA 5KX5B 5AJTA 1PO7A 5JZBA 2NM0A 1QGED 4IHAA 2EAUA 1UXZA 5CA1B 1NATA 3DF7A 3I28A 5FP9A 5D5HA 1LX7A 2CYCA 3VZNA 2AFRA 3GEMA 2IYLD 5ARDA 5EJAA 4MQBA 1P2UA 2VKQA 3D3NA 3OTQA 3VR5A 2GAOA 1RUJ2 3DN7A 4KBYA 3BODA 2VAMA 1N2HA 2OVUA 1U3GA 4BRWA 4OX9Y 1B42A 2PJDA 4HRYA 3WTCA 3NQ41 5BMVB 5KWJA 4C4SA 3C3XA 3U9LA 1XMJA 2B45X 2EJCA 3WNOA 2WT2A 4NAMA 2GKGA 3OKFA 1J8FA 4DY6A 1AGRA 3HAGA 3IOBA 4K87A 4K9DA 4Z9BA 4OOEA 1PF7E 4MIOA 2XB6A 1GGKA 2D5BA 1CQJB 4U7DA 5FR2A 4KU8A 3Q3JB 1IXRC 4BPRA 2ZZJA 3L1KA 1H23A 3I9NA 1I4LD 4D7SA 1JPNA 4B8WA 2BBAA 2NVWA 3GQBB 3T5PA 1LHVA 2G0NA 1JG3A 4J9VA 3MCWA 4AUNA 2HRRA 1YJBA 1W04A 1SZCA 1R66A 4DYDA 5K9ZA 4G36A 4KWEA 5KINB 2ZGLA 2AW5A 4CF3A 3TOJA 2GX6A 2IXDA 4AC9A 2KBFA 1GNVA 1ZM9A 1OZ0A 1WHSB 4RO0A 2I91A 3DWFA 4WOJA 2MDTA 3UJ6A 1E3JA 2QTGA 2QM8A 3CKKA 5K6AC 2XL7A 3AHCA 4AFDA 2WK1A 3CZUA 2EW8A 2ZI5A 4TGLA 1G66A 2XT6A 4BYGA 4I55F 4GECA 4CEIB 4CKZA 3H11A 3L7BA 1FMD2 1UBEA 3T5GA 3BRSA 2Y60A 5IZ4A 4CKBA 4U6SA 5JNRA 2XR4A 3EAFA 4ERNA 3E3NA 3WK6A 5EQTA 4UEKA 4B46A 5I7VA 1MO4A 4H7EA 2G25A 2P9CA 1XZBA 4I9HA 3CZ9A 4E03A 2GKSA 2P3SA 3P2KA 3I7DA 1DJOA 4UD6A 2IEGA 4MUAA 3W58A 3I73A 3I05A 1YQGA 2Q4TA 5KCZA 1CTQA 5BN5A 4NAOA 2QU8A 2QJVA 3RG0A 2REQB 2BYVE 2J3JA 1GNQA 4JEHA 1X9HA 3EW7A 5GKAC 4DR5B 3IPLA 3ANLA 4YIKA 2OXTA 2PX8A 2WJ6A 1DAHA 3ACBA 4XW3A 3OU2A 1I36A 3I2IA 4RANA 3AESA 3EEIA 1VHLA 2B46X 1XKXA 4AYWA 4B6RA 1V4BA 4LTAA 2D5FA 1VLJA 4M9RA 4Z9XA 3ETJA 1HFEL 3I9OA 3N7LA 4KUEA 5FZFA 2GN4A 4WNIA 3WGIA 4CVNA 4RHV2 4YBRA 2VYNA 5H9WA 3FFQA 3RSZA 2DWUA 4NONA 3UNXA 2YYOA 2H4HA 4LHZA 4FPHA 3HI6A 5LB2A 1JWBB 3O26A 3I2JA 4IIJA 4TXNA 2OFOA 5K0BA 1T91A 1VE5A 3GNSA 5ERLA 1NN1A 3KT1A 4RR3A 3RS0A 4FGWA 1K6MA 1WNFA 2OBBA 1J8VA 1T8PA 4PGFA 3LEGA 1ZL0A 4J03A 1VJ5A 1PJBA 4FGJA 1KARA 2DH5A 5K01A 3GUZA 1YB7A 1IQRA 5CW1A 2I76A 1JI6A 4R98A 3IPCA 1XTJA 2Q62A 2C77A 4BRZA 3ZNNA 3WL7A 4B3XA 3K70D 1RUH1 2ASEA 2PL9A 3KU4A 2QQ0A 3OKAA 5AKZA 2NMNA 3GPIA 5JI7A 1PK8A 3T3YA 1OBNA 4DCMA 1LDMA 4EYSA 1D2CA 4RAQA 5FADA 7MHTA 4OSOA 4B4UA 4B5LA 3RM3A 3GUYA 3A4VA 5CAZA 1VBFA 2EL7A 1L3CA 4BVEA 2P4EA 2I99A 4OSPA 5I0DA 5IVYA 3UESA 1EJ2A 2WJYA 2B9EA 3TECE 2V9CA 1CAUA 2W0SA 2YXSA 2D0IA 1KL7A 1YQ2A 3F3SA 1GWKA 2XMBA 1W76A 3FHJA 3HSYA 1G18A 4TWBA 3HB1A 4LOKA 3D4NA 4HEHA 2JGKA 4XWGA 2AHOA 2EOAA 3SLIA 5TF0A 4MGSA 4CXYA 3MTGA 4JYZA 5AHKA 2O19A 2YBSA 3U11A 2QP4A 3OZTA 1QXJA 1MEOA 4EP1A 4Z54A 5T4EA 3M6UA 1OWPA 4Y5TA 3HB4X 1R18A 4BMXA 3GLIE 1G6KA 1N5MA 3BX1A 4WY2A 5E89A 1Z6GA 5C8ZA 5TVGA 1UDAA 4PE5B 4ZARA 5JZVA 4CDXA 2IJGX 4DIOA 4TTRA 4LZPA 4IM7A 1P18A 4GPEA 4QU9A 3E6BA 5FO8B 4BFYA 5KTSA 2HR1A 4UM9D 4JR2A 5FO0A 3WLEA 2LTNA 3CF6R 2Q4RA 4G56A 4QYWA 3MBKA 3TVDA 2OUIA 1EAMA 2AD5A 1CRZA 1OI4A 2YUIA 3L4BA 1FNSA 4HH0A 2XOXA 2G83A 2BFEA 5BPFA 3LQ1A 2Y9PB 4S1VA 1H2WA 2B5HA 1XBFA 4UCQA 1T1RA 5DM0A 4CM5A 1RTKA 4KR9A 1JG1A 1V70A 1LPOA 1J9GA 5IS2A 1KK3A 4BMEA 3HZHA 1OF1A 3R3WA 1BKSB 3WQ0A 1AX0A 3KGZA 4LVCA 1M2VA 5AOAA 1DRUA 3RIYA 2XZOA 2R47A 3OEBA 3OOWA 1JI3A 1KYZA 4RPKA 5ALSA 3TOVA 1YZLA 5KTRA 3MLAA 2VZOA 2ZOSA 3SKJE 1RBZA 1O8BA 3T5DA 4FLFA 3OAAD 1P2FA 1RTTA 2YIMA 2CZQA 2Z2SB 2X3YA 3D2LA 3DB2A 5HF6A 3DZJA 5IFKA 4D4HA 2D00A 1YJXA 3O95A 2XUZA 5JSYA 1KOJA 1P9RA 2EVWX 4BWOA 3USUA 4LTDA 1U0OC 3LYHA 4NE7A 2HREA 3S7EA 2IZ1A 5EMMA 3KV5A 1Y6QA 1G6HA 1XJ0A 1IK4A 2FKAA 1UC9A 4NJMB 3BMQA 3EF1A 4YCBA 4OF4A 4F04A 4P9YA 1A9RA 1VBKA 1LQ2A 2OHXA 3EIUA 1E96A 2BR4A 4QO7A 2NTEA 3NHRA 5DBEX 5KPJA 2OZLA 3E2PA 4LJKA 7MDHA 4B3TB 4KBZA 3C87A 3DE6X 4BAZA 3SE0A 1RQ2A 3A1UA 5HILA 2MNGA 5A0VA 2WPNA 2BP6A 2FPLA 4K8FA 3UV3A 2OSVA 3VUEA 5DV9A 1H2EA 3ITKA 2ZJ7A 3ILFA 1T0IA 4ZEVA 3C3JA 5IJWA 2GSDA 5LA6F 3PRYA 2QZ9A 1RQRA 3ZD7A 3TSYA 3VPBA 3ROMA 3ANNA 1FLNA 2P65A 2DUJA 2HMWA 2OV1A 3GA7A 3N58A 1Z9BA 3KZ1E 1K12A 1JIVA 4IL5A 2ZCUA 4FPLA 1VPDA 2PQ2A 4CGYA 5KS2A 4XW2A 3AG6A 3HYSA 4GD4A 2GEBA 5P21A 1N3LA 3LOQA 3HPQA 4YJHA 2GNOA 3T2TA 4LQDA 1MIOB 2R25B 2A94A 3GAFA 4W63A 2OQ7A 2IYRA 1NF3A 5D2AA 2R2AA 3OJEA 3B00A 3L8FA 1NVUQ 4WHMA 4PNHA 1K88A 2CJPA 3T5AA 1JDNA 4BZXA 2ZS7A 4LNVA 3H75A 3G9ZA 2RDMA 4RKWA 3TNLA 1G6Q1 1KXGA 1T8WA 4IDCA 1VBB1 1I5PA 2D6NA 3W5MA 5J43A 2AZDA 1PKXA 3ORSA 1P4JA 4QSHA 1SC9A 3UGHA 1CY2A 2ZBPA 3TQRA 4UEJA 2X0DA 2ZDGA 2YJ4A 5GZ3A 1OF4A 3UGJA 5FPBA 2FUNB 4CDWA 3TF5A 1D6JA 4A1OA 4ARCA 1HWYA 3FHOA 1MD9A 4UAGA 4HNVA 2C83A 1YDEA 4NABA 3T3PB 3MT9A 2QENA 2YVUA 4ZC8A 2UUOA 4EUNA 5DQ0A 1UAIA 1YXMA 5JCZA 2DUQA 5F3DA 2P1ZA 5AH0A 4OKIA 5H82A 1SBEA 2I2XB 1JHNA 2ZBRA 1SCBA 4UHHA 3DOEA 2WQ7A 1A1VA 3DBRA 5LQKA 4U2BA 3UFXB 4AIRA 2V59A 3W9UA 3RU7A 2NQTA 1WPQA 1A8PA 3R3UA 4QARA 1N3IA 1J07A 4CUKA 3PWTA 4ZHQA 1HKHA 2QPTA 2ZX4A 4IV1B 3L7AA 1PZ8A 1JQ3A 1X87A 4WE3A 3DHNA 2P6NA 4V0RA 1NE4A 3B2NA 1OU0A 3GIDA 1RZRD 4G67A 4WEOA 4DXTA 1KEKA 2ATIA 4ES9A 4NVPA 1ZW6A 4J0QA 4J8PA 4WBNF 1LOEA 1JQ5A 1LSSA 1HIXA 5HJEA 2OO5C 5ICGA 3GUVA 3G8DA 2A3RA 5G0TA 2GBFA 3ZDCA 1OA1A 4RZHA 3RVMA 3RAEC 1UK7A 3TAXA 4BU0A 2JDUA 1MACA 5ALXA 1KBOA 1BDJA 1DP4A 5H7XA 2OOSA 3GMDA 1T5OA 3NBFA 1MX5A 3LSEA 4MVTA 2HWD2 4ES8A 3I4FA 3CBGA 1B1AA 5H3HA 2WUHA 1CUUA 1UMKA 2OGZA 4RL6A 5EJ4A 1PK9A 2K2QB 1NVVQ 1T4GA 3I0NA 3K1JA 3KQQA 1TQ5A 4ZI5A 4NG4A 4JBWA 1VBNA 4WL0A 1DT5A 1V6SA 4F72A 3FWKA 4DXHA 1TAGA 3HHEA 3OQOA 3B3AA 2X41A 2C59A 1V96A 1Z0SA 3H5NA 2W2MA 3M3HA 4ZEOA 2HF7A 2DLCX 1SBCA 2YWEA 1FDOA 2X8JB 5IHRA 1W2AX 4BIFA 1UBNA 2YTZA 2I4TA 5AVZA 1UJCA 1VRH3 3JD71 1P2DA 4YDRA 1B74A 3MB5A 1N1EA 4GE3A 5EYPA 2NN8A 5JAIA 4RPIA 3K0BA 1QJX2 3K9GA 4YRFA 1PHPA 1BE0A 2BFOA 4HQLA 1JZ2A 3ETCA 4QYIB 5CAEB 3TEJA 1PO21 2YVAA 3LZ6A 2PQSA 3L77A 3T7EA 1UM9A 5LOVA 2P11A 2RHRA 3ZU3A 5JDBA 1XPJA 1NQ5A 4O59O 2C5EA 1I5OA 3Q3VA 4UPDA 1Q20A 5EEHA 3SKXA 2BM8A 2SKCA 4QE3A 1UCXA 3ZHXA 4F1JA 1DCKA 2RHGB 4X8HA 2W71A 1GYPA 2FPRA 1DU3D 1QO0D 3UUWA 4FXKB 4BQSA 3TFWA 3GDBA 2RG4A 4IEEA 3GLUA 5CDFE 4BDTA 5EP1A 4K5QA 3R4DB 2QQKA 1RVF2 4RMJA 4P9JA 2YMQA 1N2SA 5D87A 3T5TA 4UTVA 1H1DA 2PUTA 4EH1A 1UK9A 5JMWA 3L9JT 1NQDA 4N0QA 2V09A 3WL8A 2VP4A 3AHFA 5LW9A 4XJ9A 3NAPB 2PS9A 1VPLA 4KN9S 1LFAA 5KXCA 1H6BA 4CM4B 4CIYA 1CRLA 3O3CA 1B7GO 1UADA 1B3RA 3TM4A 1P7CA 1ZIYA 4P86A 1CUEA 5JXHA 5BNPC 4JNCA 3CLRD 4BZPA 2RI6A 5LY2A 1TVEA 4O2RA 2RGCA 3PHJA 4JXZA 4N82A 1N1SA 4CEHB 1XPOA 4UT5A 4PIVA 5A3OA 4XJXA 5AW7A 1QH1B 3NHYA 1WQ4A 2JDID 1U5BB 1NOKA 1DKMA 3S6PA 3AR6A 4GPAA 3P9PA 4R8KA 3HCEA 3KEFA 1XYPA 3KR0A 3E9NA 1JEYB 3ZDXB 3RFUA 5T5PA 4UW5A 4NYJQ 1W1WA 1CJMA 1M06G 4LOHA 4KR6A 2C20A 4AO8A 4ERXA 2AMFA 1OBHA 2WS92 1RLOA 4KV9A 1ZQ9A 3RKUA 1OPRA 4NK5A 1QSGA 4GYWA 1MOPA 4IX1A 2W83A 2L2QA 3SVLA 2NZ2A 3AI1A 3NONA 1U3UA 1C7IA 2QA5A 1R083 5KHHA 1DPFA 3ZGZA 1NMXA 1RITA 3QEAZ 1Q74A 3BREA 1JRLA 1WTCA 3ER6A 3N3BC 5IWCA 3DEZA 3CM0A 1V1JA 5A3LA 5HW0A 1W6UA 4FCWA 4MW0A 1UX6A 3WRXC 2VW1A 3EUWA 4GL2A 3FPBA 4ATFA 1NUTA 1OVSA 2NP6A 3UGTA 1W9TA 1A71A 2AC2A 4DG5A 3UTDA 3HV0A 2F3UA 4Q2FA 3VJMA 4RA6B 3MJFA 2WZDA 2P6HA 5LP6A 2CB9A 3VZBA 2A6PA 2Q6TA 5A9SA 2JFVA 2VZVA 1T0UA 3DBOB 4Q29A 4NAUA 1RXVA 3U6KA 4JI8B 1G8MA 4BX9A 1JMUB 4L2IA 1MLDA 3EQ9A 1HDGO 1IY9A 4AT1A 5F1RA 2FPKA 4MB6A 4JLDA 4W6ZA 2B8TA 2R8RA 1X7HA 2Q5JA 4N7JA 3N0XA 3UWSA 1EGVB 4ZT7A 2RH4A 3CBNA 3NVCA 1R4NB 4NMHA 2Y27A 1O6UA 3PSHA 3W6ZA 5DZEA 1XZ8A 2EX1A 2JGFA 1RXFA 3L6EA 1QQP2 3DGTA 3N87A 1Y1LA 3AONB 2G6TA 5IHPA 4EIWA 4XJZA 1PL0A 1S7CA 3K70B 2WF7A 1ZICA 1IUPA 5KXDA 1R64A 4K0RA 4FSJA 4IIYA 4CCWA 1N77A 1ONBA 4C0WA 2DQKA 2XLCA 2BFMA 4E2WA 3KGLA 3L6OO 1XD2B 3CMCO 4X1KB 4M89A 3FCOA 1Q8PA 5JRZA 1PU2A 3HMYA 3VU3A 3I6MA 1LRKA 1N1DA 1WABA 2E6UX 3W6NA 1SIOA 4JTOA 4BV3A 3W06A 4EO9A 2AEYA 1DL5A 1FRNA 1KRXA 4CLHA 2I4LA 3FFTA 2PGLA 3NRJA 4KVZA 4H35A 1OKKA 3CVUA 1XYYA 3VPCA 4R2KA 2SBAA 3OM8A 3PXAA 2FDFA 3EH1A 2KHZA 2WD8A 3EC1A 2CXRA 4QUHA 1LW7A 4E2GA 2BH2A 2C24A 4OFWA 4JK3A 2VI5A 3MILA 1L7VC 3EZGA 4DFDA 5A5FA 1V11B 4NCHA 2Q8QA 3OQ6A 3L9XA 3WZ1A 2ZUUA 3BCHA 5B3JC 3AKSA 2GPSA 4B73A 2ZUFA 1REFA 1TM2A 1MGOA 4TWZA 1E6EA 4RADA 3FG9A 4B43A 3SF8B 4JQZA 2V7QD 4CCDA 1U8TA 3SHQA 1SUFA 4J6FA 1R10A 2BWJA 2BGWA 2RKBA 3KNZA 4CQNA 4WAUA 5JANA 4L9WA 2Q0QA 4LIUA 3K6RA 1A7JA 3G7UA 3OBBA 1OF3A 1UFOA 1DAOA 1KVRA 4LE2A 2EL9A 4RDHA 4G8CA 2UYCA 2R0HA 1FFYA 2PEZA 1EY2A 3BGVA 5EQFA 2PX5A 3RDIA 3EBRA 3E3AA 3FLAA 5TMBA 2VLBA 4GXLA 5T5JA 4OHVA 4S2DA 1PJLA 2VK8A 1EWKA 2YOFA 1HL3A 3VHXA 1V3UA 3WQ1A 1XQYA 2RH5A 4C7OB 2RB5A 3PFWO 4AN4A 3NNGA 4LUCA 3B1KA 2E6VA 1KQNA 2ZSJA 3ZEIA 2PSEA 4Q5IA 5DBIA 1AOXA 3K2BA 3DKQA 2HU2A 2FP4A 4ZCIA 1Y98A 2DLDA 2XQXA 3CWCA 4R1LA 5AHWA 1DMSA 3O0DA 3HBFA 3C97A 1MC1A 1JA0A 3BGIA 3IJ5A 2D74A 4RORA 4YQEA 3D54D 1GTG1 1DRWA 4UBOA 1P7PA 2X7XA 1BJTA 1BS9A 2A67A 3HBAA 5ED4A 2Y6JA 1CHDA 1JJAA 4H1HA 1ADBA 4M8LA 2WDZA 5G4LA 1HGXA 3TZLA 1YJKA 2V5YA 1QHHA 4E2YA 1K5MB 5C5DA 5IF9A 4ASKA 5LZ8A 4KG7A 4CDRA 1L5QA 3EEYA 4AJNA 3PENA 4BLOA 2GXQA 3L06A 3FOFC 4LF9B 4W5QA 2AKAB 2QRMA 3FFWA 1KJ8A 4N0DA 3A3PA 1YJ5A 2PIAA 4PNEA 4HAIA 4MQEB 3WLIA 1MQTB 1JEEA 3EE6A 3KPYA 3O8QA 5CTAA 3FCYA 4B7ZA 3O14A 1GZWA 2I62A 3O2QB 3LQKA 1DI0A 4Y2RA 1QWSA 2R071 5JZ9A 4BAUA 1WMSA 4MNTA 3THYA 2O3UA 3MMNA 2D4HA 3AKDA 3E3OA 1YB5A 1XXNA 3C15C 3CEPB 5CB7A 1XNKA 3NEAA 4H7PA 2UUCB 1EP2B 1YB2A 4YR7A 3ESDA 5A7HA 2GASA 3RSJA 1ZIPA 2R8BA 4ZU4A 4LWOA 4N7BA 1YBVA 1D8AA 3H9GA 2Q4OA 3A2KA 5KTPA 4C21A 4RACA 1THTA 1KI6B 3DZHA 3TKAA 3GD5A 3OY8B 4ARSA 2OORC 1FS5A 4RV5A 3ZJVA 3CJIB 1YA8A 1Y4SA 1DVRA 2WEKA 2DH6A 2FSFA 1THZA 1KK1A 1TK9A 1ORTA 3PQ2A 5DGTA 3RWKX 2I6UA 2O2YA 3P9YA 5T50A 3EPRA 4ND6A 3JQEA 4PTYA 4GKBA 4FFDA 2WN3A 1ZNWA 2O2HA 1C0IA 4IVRA 1L9XA 1QRUA 5C7OO 3C8DA 1S4QA 3OTOB 3U0VA 2QV0A 2Q8NA 3WHIA 2BSXA 1OV6A 1TKAA 2VVDA 1EG2A 1G0OA 4GM0A 3QYAA 4HDRB 5EIXA 1SOAA 1V1MA 4XGIA 5BNZA 1AH2A 4TUYA 1S02A 4FPXA 4I50B 4FMCB 3F49S 4PRKA 1TQHA 3W4KA 2J1LA 4R3WA 4NKRA 3U39A 3ONEA 5BN4A 2CLIB 2FD8A 4UASA 4IIXA 2FDKA 3EQ7A 4AVAA 1T2FA 1U8AA 3R9WA 2BNNA 1UPSA 4LXQA 3AMPA 4F97A 2OY0A 4K81B 1AUQA 3N35A 2HXSA 5L3RA 4EE2A 1ZPDA 2LBPA 4L28A 4I6JA 1LNZA 1PN3A 4BV2A 5JD3A 4YN3A 5BR8B 2ODQA 4HONA 3SSMA 5JOYA 5BRAA 3BMOB 2YV8A 4ARVA 2W2OA 2O7SA 1BXHA 4CRWB 2RK6A 2H1FA 4Y6SA 1H0RA 1ZZ9A 1NOJA 2AA3A 1WPRA 3IKVA 2IZ7A 3BOPA 4BCDA 3MCVA 1EA7A 3PNBA 4HAOA 4P58A 4Q8KA 2XKBA 5HBAA 4KG0A 4KQWA 4FZJA 4H7KA 2AJBA 3HDQA 3RVPA 2YN2A 2UZIR 2GXAA 2XUGA 3AXTA 1DJQA 1WXHA 3QG1A 1GDDA 2X05A 3IEVA 1V71A 2JJ2D 3BPSA 4ND3A 4MDFA 4ASLA 2VNOA 4E5DA 4K86A 4UVEA 1QV9A 2PT5A 2RAVA 4NIDA 3WAJA 2Q7DA 2ANCA 1QO9A 4GWGA 3BYZA 2E4YA 5HV4A 1F1BA 3MINB 3WW4A 2PGNA 3D59A 3MIZA 4INOA 3TRJA 4YMTA 1PGL1 1CHNA 1SURA 4GPBA 4N18A 3U09A 3AX6A 1L8XA 2X09A 2XNDD 1KDVA 3I4IA 1FUKA 3UZUA 1DDLA 7ABPA 4LBZA 1NP3A 1W6OB 4CMEA 2VOEA 2W2LD 3DDUA 3PCTA 3VD4A 3QE4A 2Q7XA 1C8BA 5JNTA 4M37A 2OFPA 3C5HA 3QPUA 2G28A 3WTBA 3RNSA 3LBHA 3HXKA 4O1HA 4IV8A 3WRXA 2I3BA 1C9EA 2IOQA 4R31A 5LA0A 2YRWA 4C9BA 2OZEA 2XLGA 4Y9DA 3DW3X 1L5ZA 1QS0A 2P27A 1QYXA 2IEBA 1GU7A 2BYTA 2OD9A 3CUTA 3OTIA 4AXXA 1KEPA 1Q3KA 2OQ2A 4BO7A 2JI8A 1RI1A 3WY6A 2D3WA 2PXHA 4CUAA 5EKSA 4L9SA 4J0FA 4URTA 3DDOA 4RF3A 1RINA 2FSIA 1H1AA 1KBZA 5BYAA 3BILA 3ETLA 1ZRDA 2H2WA 1HDYA 2G76A 1K6JA 1XEXA 4I50A 1FFXA 3GLQA 1F15A 1OX4A 3L0IB 1BCRA 1W8WA 1REQB 4QTYA 1SKUA 5SZIA 3SVTA 3UQYS 4QLOA 3DE0X 2EVXA 5LYJB 2EX0A 3OT1A 1CAVA 2XH6A 3GX1A 1UF9A 5BNNA 2PKCA 2BEVA 1VAMA 4JKLA 4OBWA 3A70A 2IYTA 3ZYFA 4EBBA 2AENA 2H2IA 2B5OA 4QPPA 4ZAGA 3U31A 2BGLA 4KXNA 4QNMA 4M4RA 4XB1A 5B7QA 5BYJA 3RC1A 4IXTA 2PFGA 5FNVF 2CFSA 2GT1A 2BONA 4QDSA 1PR1A 2CLFB 2WY2D 5I8WA 4JSTA 1W8DA 1RHI3 3UUEA 2HF2A 2HFKA 1WVGA 2ALJA 2BBTA 5IAJA 3CLUC 1PFGA 4HETA 4EHFA 2Q3JA 4FYJA 3OZGA 1M67A 4XRRA 2FAXA 3ZUGA 4BP3A 4K9PA 2OXCA 4C5BA 1ZSNA 1V1RB 2GPAA 1FU7A 3KTOA 3ESCA 3O8OA 3JZFA 4C5CA 1QH6A 3T0FA 1UH5A 3TQHA 4B35A 1PIWA 3B8EA 2P5YA 2F55A 1QHFA 1X13A 1LK7A 2HEWF 4UXJA 2RGEA 1XLTA 1N36B 3B1XA 2B99A 2Z58A 9ATCA 4Q1EA 1DAGA 5JS8A 2IXHA 2QQJA 3HADA 1BEUB 1UMDB 3KAJA 3WS7A 1PJ3A 3JD73 2Z4TA 4YMIA 2GC0A 2I0FA 3FWPA 4KPGA 1CS0B 4X3PA 1U5AA 3AFGA 1V39A 3R8CA 4OP1A 2XXZA 3PCXA 4YJGA 4YK7A 2UU8A 1CPYA 4PI0A 4HD8A 3OU7A 3ZYCA 4AZTA 5SV5A 2R6R1 3H8XA 5FZAA 3V6LA 2C4NA 3MF9A 4ZU5A 4JVOA 3JWEA 1KDPA 2HHCA 1K75A 3USZA 4JLPA 2FSVC 3VV3A 2C2BA 1ZH8A 5SV8A 3FVQA 4IL7A 1IN1A 1WD4A 4QX2A 1GNTA 2OA2A 2ADOA 3O3MB 2YC4A 5I9TA 4LJ4A 3RTGA 3NH6A 1YACA 2Z2ZA 1KDKA 4LTNA 3L84A 3GPDG 4X92A 3ZIDA 4BVHA 1XE0A 4IGEA 4N47A 3FNIA 3A05A 3AP7A 4MQFB 3ZIWA 3AVWA 4B17A 3KZCA 3K0KA 1F2TA 1EFPB 4W9NC 5CFOA 3ROQA 1K5JA 4F38A 5GIPE 2BEOA 3FUTA 4TL6A 2VUUA 4ISBA 3M4XA 3LC2O 2C9YA 4DC0A 4WTOA 3H4MA 4CG3A 3PC4A 2X77A 4GWKA 1ESZA 4I1PA 3ZXAC 2HZBA 4XIYA 4Y1RA 1NUUA 3KE9A 4LK2A 4UXIA 4U9IS 3NNDA 2QBYA 4XFDA 1FNNA 2DM6A 1XYOA 2P7IA 1XEAA 3QG5A 4P0TA 2F1JA 2O0JA 3R3ZA 4AO7A 3TBDA 2QV7A 1RRGA 2XUFA 1T36B 2LXNA 4F46A 2O2JA 1M2OB 4K6OA 3A26A 1YJAA 3N86A 4REQB 3R6GA 1XRUA 1UBLS 4C3OB 3VKWA 2QTMA 3R7SA 4MPRA 5DWQA 1TIBA 2HA4A 3F47A 1PT6A 1PR3A 5KAMA 3LI2A 5CCEA 4TLBA 2CUZA 1GGMA 1DFIA 4IS2A 1IWOA 4K6GA 4MB0A 4CMEC 1UKRA 4H16A 4HNHA 3H0CA 4F7DA 4XQEA 2DWRA 4DUZB 2YXDA 5CH3A 3TNDA 3OT1B 2BGMA 3WOGA 2EAAA 4Q4JB 3ZCPA 4ZDKA 3EYAA 5CW2A 4ZYLA 4TTTS 1H2HA 3UETA 4FGLA 3KCQA 3IR5A 4D26A 3B5EA 2TECE 1DFGA 2GJAA 1YZUA 5DT2A 3VDCA 2PK3A 5FZ9A 1NVDA 1SO8A 1X7WB 3ON5A 1FFCA 3ZN2A 3JSAA 5EJMA 3NH9A 2E3JA 2W2IA 4BKOA 1PKEA 4Y2UA 3RVJA 2RS13 4XFAA 3KHTA 4JJGA 2O5CA 2O2IA 3EGOA 3OLYA 5J37A 2J3DA 1ZBE3 4F3CA 1KAOA 1HKDA 2I5PO 4BU1A 4MYDA 4Y2VA 1BKDR 1U6IA 4J94A 5K3OA 4P98A 2RHTA 2ZIWB 1G5TA 5C31A 2HSJA 1UZWA 4JBYA 3NC1C 1GL7A 5HWSA 1MTOA 2ZP1A 4H6XA 1GOHA 5DOZA 2PYDA 1JEAA 1KAQA 2R6JA 4C0BA 4LWQA 1JA9A 3PQ4A 3R5HA 4XPIA 1XRQA 1D07A 4LRYA 3OM1A 3MJEA 3PVBB 2WJSA 1A9QA 1VBC3 1Z4JA 1K8QA 2MYUA 1K1EA 4KUHA 4BRUA 2JKZA 4BBJA 1CS0A 3FGPA 2V73A 1EKXA 4E30A 3ZGVA 2Y2VA 4JGBA 3LECA 4EELA 2XJSA 1E6CA 5FKJA 2X8WA 4CCKA 2J6HA 2QY6A 2IQIA 2FSUA 4PAMA 1SPPA 2SICE 3VV1A 2JGMA 1YBHA 3VH3A 1J2JA 2BU9A 2BI8A 2YY6A 3ZSLA 4Q24A 3VTZA 3KVAA 2M6KA 1FXWF 2XCSB 2IIVA 3MTBA 4EGFA 3G0CA 1ZMXA 1U7UA 4WXHA 2FMTA 3D81A 5KTTA 4MVJG 5SYMA 4KAJA 2IYQA 1USIA 3QLTA 2HCJB 3D0OA 2Z6VA 3PURA 2ZI4A 3POYA 1GKUB 2V9PA 4Q39A 2RHHA 5FYVA 4ZQBA 5JC1A 1VRH2 2D0DA 1HZZA 1NJ2A 4EZBA 4HNAA 2Q5HA 1PUIA 2VJMB 3CEHA 2A92A 4Q7QA 4AQTA 4F85A 2CD9A 1FDUA 1SHWB 4F93B 1AKNA 1KH3A 1SA0B 2PSSA 1EUZA 3AF2A 5H0IA 5TC4A 1K97A 5LCWL 2QNKA 4WCFA 3BE6A 4WUVA 4I1SA 1LW6E 2QMZA 1AMNA 2VUTA 3HJUA 1NW9B 2QQGA 4L72A 4AVSA 4EDHA 1WBJB 3DV0A 1M7HA 1SUSA 3BEOA 1AL0G 4E4SA 1DZRA 5B3KA 5IHXA 3J26N 5LDGA 3TTWA 2RR13 3JQFA 4O6VA 1TTQB 1FNMA 2J30A 4N9QA 3AHDA 3WMRA 4CLEA 4OHOA 3GPBA 4J0EA 4DRXB 3LFTA 4DSAA 3GGGA 3TLZA 4IJQA 4QDOA 2I80A 1YT5A 4G5RA 2X8LA 3E1GA 1OAKA 2VBIA 3M1AA 3AEQB 2YKGA 3W1VA 2OA0A 2WKRA 1RE0A 4X6XA 4LZWA 4OO3A 4PJYA 3KPJA 1RJFA 3AY7A 4HXYA 4PYQA 5C9ZA 2JLRA 2P7HA 3GMIA 5BWNA 1NMYA 1U1DA 1OH4A 3L05A 5CPFA 1W44A 5JLJA 1NWCA 1W4AA 4YAIA 4EWDA 1YR2A 5JCOA 3WYBA 2AI1A 1AHPA 3U6BA 1OLOA 1PZGA 2V8OA 2PL3A 3E0XA 3T12A 3E1SA 3MHPA 5F3RA 2P4UA 1VB3A 3EBLA 5JDCC 4URVR 3VJRA 2FZWA 5K3CA 4JCKA 2HO5A 3HWWA 4WY8A 1DP0A 1JZQA 3U26A 5F9TA 1PR6A 4MGEA 1E9VA 1R3DA 4KGXA 4V0SA 1TZCA 3HO6A 4CCEA 2R6ZA 1CKEA 3Q8CA 4GR9A 2O8DA 2F67A 4BB6A 5K8LA 3CGGA 1TB4A 3B82A 2BKUA 4AECA 1ZZ8A 1BIFA 1L5YA 2VHYA 2ZU6A 4A2CA