3GD1C

Structure of an arrestin/clathrin complex reveals a novel clathrin binding domain that modulates receptor trafficking
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
391
structure length
345
Chain Sequence
DKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCAFRYGRLTFRKDLFVANVQSFPPAKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRASSDVAVELPFTLMHPKPDDIVFEDFAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-arrestin-1
publication title Structure of an arrestin2-clathrin complex reveals a novel clathrin binding domain that modulates receptor trafficking
pubmed doi rcsb
source organism Bos taurus
molecule tags Endocytosis
total genus 66
structure length 345
sequence length 391
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00339 Arrestin_N Arrestin (or S-antigen), N-terminal domain
C PF02752 Arrestin_C Arrestin (or S-antigen), C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.640 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3gd1C02
2.60.40.840 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3gd1C01
4GFXA 1G4RA 4R7XA 1AYRA 2FAUA 1G4MA 3UGXA 3LH9A 2WTRA 4R7VA 4GEIA 1SUJA 4LL4A 5F0MB 3LHAA 4GEJA 3UGUA 3GC3A 4ZRGA 2R51A 2WTRB 1ZSHA 3P2DA 4J2QA 5F0PB 4LL1A 1CF1A 3GD1C 1JSYA 3LH8A 4P2AA 5F0JB 4JQIA 5F0LB
chains in the Genus database with same CATH superfamily
2QV2A 4JFYA 1N8ZA 3TBWA 1I8MB 2XBTA 3PUUA 1HHKA 4L4TE 2BJML 2ATAA 3HTLX 1RIVL 2QVKA 3BX7C 4CU7A 2BSDA 1KB9K 1OAKH 1BX2A 3L9RA 4JG0H 3T0AA 3BN9C 5BW7C 5FYKH 5GS2D 1QVOB 2BNQB 5IHUH 3L4ZA 2IOIA 3FFCA 3K6SB 4LCCA 1CD8A 4K3EL 2EVJA 4KJWC 5GS1A 4YFEA 4XNBA 3O0RL 1T5XB 2EYRB 5AVZB 1U8QA 2OZ4A 3DO7A 3WKYA 4BE5A 3TIEA 1JHLH 5T3ZL 3ARDB 2V37A 3VXTB 3GNML 3Q06A 3FU6A 3TJHD 4HKJB 3I9IA 2OMZB 1GMIA 4A2EA 1VA9A 3KBHE 4LARL 5ESVB 2VDNL 4N9GA 2G2NA 1WZ1H 2JSFA 1N7MH 2IWEA 3ZE0B 1MDAA 4GQ9L 4ODUA 1JF1B 1HSBA 3KNBB 3UIZA 3FU9A 3P4MA 2IO5A 1QW9A 4I3RL 1KXTA 1UM5H 3RWFA 1ZIAA 1DUYA 1F8TH 2L7UA 5DS2A 3ALWA 3WJMA 2VXQH 5DLLA 1HCZA 2J43A 4TPRL 5IKCA 1CTOA 1UWEH 4NWTL 4FLSA 4AK1A 4LPVA 1YN7A 3EJYC 5CD5C 3DK2A 2DQJL 3L3HB 4J7RA 1RQ5A 1KPUA 3D0LB 4Q6YA 3SCMD 1NOLA 1HN1A 4XCNA 5IV2B 3EJTA 2AK4A 3DJTA 1TQCC 4YHLH 2YKLL 1WQVT 3HOGA 2W0LA 4NQDD 5CEXA 4R96B 4R3SB 1P7KB 5JO5B 3U7WL 1F6AA 3PL6A 5D1XB 3P73A 1HOCA 2FYYA 3T8VA 1NCBL 2XPGA 1H3PH 1UJ3C 5G55A 4AQOA 4R4BB 5D7KD 5F3HA 5C3TA 1TZHB 5I0DA 4IBZA 1IMHC 5BQ7B 1XGYH 4DIXA 2YARA 3V6FA 2V4LA 2D7NA 4NRZA 4DK6A 3T65B 3UBXI 4JDTH 1CYXA 5FR3A 5HYFA 2X4TB 2IANB 3MAWA 4R97C 1OE3A 4X6DA 3ZDYE 1R9FA 2X4NB 4HEPG 1B2WH 4HGKC 4JQIL 1F18A 3T8XB 2NDGA 5E2TL 5ANMB 4YR6A 4POZD 2C7UB 1KY7A 5E4OA 1I1AA 2NY2B 2DWYA 3AGWA 1Z7JA 1YLBB 4HUWA 5E6ZA 4LIQH 2DM7A 3IDGA 3F58H 3JT2A 5KVMC 2ENPA 4GW5A 4FLOA 1DANT 1IIIA 1TVBB 3K7UA 3CFJA 2PP9A 3MLZH 2E75C 1MCBA 4ZFQA 3BZEA 1TQBB 3LEYL 2VXVL 3MXWL 3QJFA 4NFDA 4NO0B 1UB6B 4LASL 3DIVA 4XN2A 2F53A 1UXMA 3NRPA 1CVSC 4QYOB 1WBZA 3UYRL 1UGNA 5EV7A 5I8EA 2IAMA 4WI5A 1HHHB 4JO1L 1SDAB 4QXTA 3OAUL 1RFDH 2Z3FA 4JPIA 5EZLB 3SKJH 5DUMH 1GGBH 1M1XA 2FJSA 4P3WA 4HHGA 5KAQG 1EGJA 1HI6B 4YPGB 4L0PB 3UBFA 5HJ3B 3QWOA 3RVTC 4PW4A 4Z95H 2AKRA 2BH0A 2XN1A 4YVNA 2V9RA 3W39A 1HH6A 1HWGB 3BUQA 3QEQB 3AROA 4E5XG 2X4OA 4PV9B 2OMBA 3ZMRA 4CGUB 2HLAB 1NAML 5F1IB 4F8PA 5KN5B 1SN5A 1SXCA 1QRNB 1OD7A 4KU1A 3OKOB 5HSFA 1OT2A 4Z77B 4HUKB 4GOSA 3A21A 5E5RB 5ICXA 1RERA 1NIEA 5GZNC 3EBGA 1JBJA 3B34A 1I7ZA 2FBJH 2F6AA 5T1MA 2G2RB 4HZAA 2RACA 4D0DB 1IQWL 4OTXL 5K69A 5C0CE 1GJIA 1UZ8B 3V2AR 1NC2A 2OBGA 2XBDA 1W0WA 2EDWA 2Z8VC 1VEOA 1T6BX 2R9HC 4HISA 1MQKL 3UC0L 2LLNA 4NZ8A 7CGTA 3ISYA 4M62H 4EO5A 2H2SD 1E0OB 3RX7A 4CNIA 4XNQB 4HHAB 4UB0L 4XMVA 2OR9L 2JLLA 4IOIA 1SOSA 3JV0A 5TE4L 4PRID 4JLRA 1M1SA 4WUKH 1T7YA 3FC8A 2GKIA 3HA0A 3LKRB 5KYNA 4F7MA 5E24E 3ATFA 5HY9B 3FH8A 2DQHL 3BPNB 3HUJE 2PTUA 5DJAA 3FF8A 1Z9SB 1JNJA 2DLEA 2G75B 4HKXB 1V54B 5I76A 4OGAD 3TBVA 4MCNA 1FORL 4DW2L 1N6UA 3WS6A 2CD0A 2FX7H 4CVWA 3BO8A 5F7BA 2YEZB 3U36A 1DVZA 2BVEA 2Z7WA 3RI5F 3US1A 1GC1H 1UJ3B 2XNAA 2D3LA 3LPPA 4RAVB 3O9WB 2IDFA 3PDDA 5F7FA 5L2KE 5IOKA 1GZPA 1KCBA 4KKRA 1OXYA 1ZTXH 1L0PA 3B9DA 3CFEA 3C5SA 4KX7A 4LSRH 3S3JA 2ITCA 4JFPA 2ZCLL 2VN3A 4AM0Q 2VMFA 5DD5L 2BSCA 3OF6D 3HE7A 3FRUA 3HS8A 4NDMB 4BGLA 1C16B 1FVDA 5DUBA 2X10A 5IB5A 1IGIL 1RUMH 3P9LB 3ORJA 4K3JH 2APSA 4FNLL 3O41A 5E2WH 3FRPG 5F96H 1A6TB 1P4IH 4I5BB 1JV5B 4Y5VC 1G9EA 5LB1A 2WCPA 4EUPG 1RK0A 3O2WH 4HWEH 4YDZA 4PVNA 5D71H 1SLXA 2HA1A 3AS0A 1IT9H 1CK0L 1DLHB 1UM4L 3QJRB 4GQZA 3T3PF 5BV7B 4IHOB 4PJCE 4KKZA 5FHAL 3ZE2B 1V27A 5EUKB 4AUYA 2GUOB 2LLLA 3OZ9H 4RWYL 1A6AA 4X6CF 4ZO6A 4KMLB 1TVHA 2MTPA 4Y16C 3SQRA 4NENB 1PSKH 4YHPB 4O02H 5B1BB 4HU8A 1E4WH 1A14H 4FFZH 3VRJA 2PP7A 3K2UH 5DD0L 1MUJA 1G1CA 4L3AA 3BD3A 2QQKH 4JB9L 4TNEA 4R83A 4CMMB 3I6SA 4GS7C 4PJIE 3SGEI 1J8HD 3WTTA 3BLPX 1EJ6A 4PP1C 2W9EL 1NGWB 3DUUB 4LQFH 1G5AA 2Z7UA 4RGMC 4LESA 4V2CB 5F89A 4IRJD 2DV6A 2BRQA 3UAFA 4XBEH 4H20L 1KTRL 4BEIA 3DV4B 1D9KD 1KGXA 4P9HL 2Q6WB 1XCQB 4XNMB 4MKTA 1QPKA 3LRSA 5C70A 4HIPA 5AVSB 1MWOA 5CJXC 3RQ3A 4X8JB 4KRPD 3JZYA 5BZWB 5DK0B 3GO1H 2QJDA 1E6JH 3B9EA 1EX0A 3DYMA 1CXLA 3UAEA 3UO1H 5IHHA 2WQ8A 4L9LC 3MJ7A 4LLUA 2L3BA 4YBLC 5ESAA 4A7SA 4E9QA 5J1TC 3ULVC 5HHNA 2ZKXA 1BQLL 4QRRB 1P6AB 5A6IA 3VW3H 4MJID 4KI5F 5F7UA 3FO9B 5D6DC 2V9UA 1Q1JH 5D55A 3RJQB 1FHGA 2FEEI 3N1QC 3QHFH 4BSVB 2EDBA 4BSJA 2PO6B 4HPHA 3RJOA 5DWPA 5BZDB 4DKFH 4MMYB 2CJTA 4NZJA 5H35B 1OTSD 4EIBA 1I7UA 1MWAH 2VLKE 5FUOH 3BZFB 3U6RB 1FFPA 4R90L 3LX9A 2PTTA 2HVKA 3KWWB 4OM1L 4F27A 4NNYA 2DLFH 1PEWA 1J8RA 4AL8L 3HPLA 3GRWH 4WW2F 5IFAH 5JHAA 2Y3NA 1TPXC 4P5TA 3PWPD 5TFSL 4R8WH 4F7CB 2KPNA 2D2CC 5ESQB 1NPNA 5GS0H 3KS0H 2WSKA 2R29A 1JIBA 5E9NA 2QADD 3G6AA 3L1OL 3DI2B 3NA4A 2P44B 1KBGH 1XB3A 3QEUA 1WEJH 2YGOA 1H8LA 4NSKA 5GS3A 3GLAA 3R4DA 3B3BA 4PJ7E 2CMRH 5L7XH 3V0WL 4PJ9C 1ONQA 1EHNA 4PRBB 3D4CA 1AOZA 2Q86B 1ECZA 2UZXB 4GSXA 5CEYA 3U0TA 2NY0B 4QKTA 4XCCL 5JW4M 2DBJA 1MCDA 5T3XD 1KJMB 1NEZG 4HS6A 1JWUB 1J0JA 1TKWB 2QPSA 5HDBE 2FWUA 1E5AA 3APFA 4MDIB 3MRQA 3QFJE 1VFBA 3KJ4B 1E8WA 4MNGE 1FA4A 4JFFB 3SE3A 1IBGH 4OD1H 1I31A 4X4KA 2Z93A 4MCYB 4Y5VB 1A7PL 1S9KC 3ZKXB 3SQBB 5C3IA 4DGIH 1CZ8L 5IEKA 3N43B 4KMTH 1DJSA 2OX5A 3GF8A 4UOW1 1P5UA 4FCAA 2E7LA 2PNDA 1HILB 4HA1A 1E9QA 3QR0A 4FYRA 1G9NL 2IXQB 4ELKB 5AWNL 2VN4A 4Z7WF 3N9GL 2OR8A 3L08A 1FNSL 1PZAA 2SEBA 3U1SL 3CN2A 2WLMA 1M3JA 3OSVA 1R5WB 4Y2LA 3L81A 4DJMA 4XNUH 2YXWA 3INUL 1JPTH 3WIHL 2BWDA 5GGVH 3X13A 4JKNA 3VH8A 1AQ8A 1FFNB 4GS7B 1EJFA 4S1RH 3D25B 4HG4K 5BW7A 1LO2H 2VN6A 4I0CC 3QEGH 2ZOUA 2BWQA 4UM9B 1AR1B 1XAKA 5LWYH 2OPCA 2WKOF 2O1AA 3DGGB 1DLFL 4W68A 2HZHA 3J07A 1TO4A 4K8RH 3S48A 3QNZA 3SDDC 4WY7L 5F1SA 4XAKE 3VQ1C 1G7QB 1QBBA 2X44D 5GGTL 2I07B 4QRPE 1RZQA 2VQ1A 1IC7L 3FBKA 4M3HA 2AZUA 5DLML 4U6VL 4C56D 3NSCA 1J87A 1E4JA 5HHMB 4AM0A 2NT1A 3MLSH 3EGSB 1WTGT 4DVBA 1OHQA 3M45A 3MX0B 5C0DB 3L5IA 3GINA 4A2DA 3I02A 3K71A 1GSMA 3B9KD 4YX2L 2AXWA 2CLRB 4S0SD 1INQB 2KQMA 2IDCA 2EDMA 1WWCA 4JPWL 1TUPA 1OP4A 3US9A 5IJVB 1NSNH 5F72S 3PREA 1NFDB 4UYPA 2XG4B 1X5LA 3QC6X 4UBDD 4G6ML 4DN3L 3IMSA 3H9SB 3MCKB 1BPVA 1UD2A 4M7LL 2RB8A 3A6BL 4LU5L 4YHOH 1NUFA 2G5BA 4OCRL 3HS0C 3H3PH 4UIKH 2AXJA 1ZT4A 4FNUA 4J3XA 1LO0H 1FIGL 1WIPA 3D05A 1AS8A 3NCCB 1L0XA 4FFTA 4B0MB 5D1QC 4F8QA 3ZL1A 2ADJA 1NUDA 2C9UA 3EH4B 3H0TB 3ZE0F 1O7DE 5CR8A 5I1IH 5IJBC 4FQHB 4S1SH 3HZVB 2DM2A 4XOBA 1Q0EA 2R8SH 4P4RA 1N10A 2YGVA 1MLBA 3MRIA 1OE1A 4ANUA 1PW3A 1NIBA 3RWIA 4AJYV 1QLRB 4BIKA 3OKYA 4JKMA 5E6IC 4KRLB 4I9XA 4K9EC 1HL4A 3LKSA 1A7OH 5EZOH 4MRCA 1U8NB 1W8OA 5E99H 1AG0A 1UGKA 3AFLA 2Z7ZA 2YAMA 3W81A 2BOLA 4GH7B 4NWUL 3O3DB 2NY1D 5IOPB 1T1ZB 1LEIB 4WTZA 4YDVA 1G9MC 3DBSA 2WMPB 1RUQH 4I0PB 4N2OA 3GDBA 4J1UA 3HB3C 4HUXB 4PG2C 3X3GH 3H6AA 4Z3FA 3LEXA 4JK0D 5DI8B 2VITB 2MNWA 3ME0A 5E5UB 4OVUA 4YSAA 5SX5K 5E00A 5EIIA 2LGNA 3H3KA 1IFRA 3F7YA 1AGDB 4BFOA 2IGTA 1RIHL 2AEQH 1S6NA 4UQ2A 2X4UB 3NSJA 2H6UA 1UT2A 1UD4A 4LBEA 3I75A 2ZX9A 4XP4L 3N04A 3U6XA 3HPJB 3WL9A 3F7LA 3TO4B 4FQIH 1EPFA 4J3OD 5C0AB 3P30H 2X1QA 4NUGH 3UMTA 2HFGH 2IBGA 4JFWA 4YHIA 3QXDA 3WIIL 1JZ7A 2W5PA 5CAYB 3IYLW 5DHMC 1MAJA 1JNNH 4TV3A 5DEFA 4BFEA 5AZEL 4AYEC 3DBXB 5GZNA 3ZTDC 2XWXA 3PQYB 3BXNA 4ABVA 2MNUA 3QRFM 5GGRB 1KIUA 3QORD 5CZVL 2VGLM 1N68A 3IRZA 4W4OC 3RGBA 4ZXBA 3SDDB 4LHQB 5E1AB 1NICA 4X9GA 3PGFH 2AXHA 3U4BL 2P5EE 3DUSA 3L9EA 2JELL 1PJ9A 2I7SA 3OKNA 1TFPA 4FXTA 5J6GA 5JZ7C 3HC0B 5DZNA 1SXSA 2FT7A 1QBML 3VFOB 2EADA 3BKJH 1MFNA 5LCVL 1OF0A 4WKZA 3NP3A 4N6QA 4R26L 3AQYA 4XMKL 3OVUB 5TE7L 3RRQA 5D2NB 3DX6A 3MGTA 4HV8A 3FL7A 3S97C 3VWJC 1UXWB 3LH2L 1HTYA 3BUDA 2CR0A 1A4KB 3Q13A 3FFCD 2NNAA 4OH2A 2MCPL 3QZWB 4XBGB 1KTCA 2VDNB 5DRZB 1P2CB 2NT0A 4AYDC 1U95A 5CFHA 4MA7H 4GB9A 1UOKA 2A83B 4XRCB 6PCYA 5IW1A 2FZ3A 5C08B 5JIPA 3U83A 4XVTL 5FO9B 3VI3E 3CXDL 3SKNB 3QPXL 1PAMA 5ALBL 2K70A 3BKCL 1MCWW 3FT1A 3KPLA 3ARFD 1L7IH 1A9BB 4M1DL 1RZFH 5J1AB 5J57B 5D1QB 2VLJB 3BGMB 5D4QA 1HYSD 1EHXA 3X1GA 4NGHH 1BD2B 1DJGA 2DM3A 5GGUB 2P47B 3D6GA 4N8VG 4TNFA 1FDLL 1X44A 2QFRA 3DX4A 1QFHA 2EKSB 2EJ1A 3IDMB 4E9YA 1PG7X 2VE6B 5E6IB 3IMRA 3IS0X 3MBEA 3QXUA 4XWGH 5ABDE 3HNVL 1SN2A 3F6LA 2LU7A 4HKBB 1ZLSL 2AK4D 1G1OA 3V0JA 2K6YA 3MV8E 3NPZB 2FT8A 5FDWB 5E8PA 3WNNA 2DZEA 4P5RA 4XX1E 2O4EA 2WP3T 5DFVD 2VXUL 2OJEA 4W4NA 5JW5A 4OLZL 5BV7H 1SJEA 1VIWA 4Y9FA 1IV8A 2WSPA 3OXRA 5FGCE 2YPLE 3KG5A 1Y18B 3QNYA 1Y6NR 4JDVB 5HHOA 4RGNE 5IB2B 1YMME 2FTAA 1E9OB 4Y16A 3EJZC 3QIWA 4DFIA 3STZA 5DS8A 3JT0A 1Q0YL 4IRZH 3TT3H 3GXDA 3E0GA 4YHZH 2JKIS 1RU9H 3VGBA 2QHLA 5AUMA 1NOAA 2VR3A 2X1OA 1E7UA 2OP4L 2ADFH 4F5CE 1N6VA 2EEBA 1UKQA 4PJBE 5B3JF 2O6DA 2YFNA 4P46C 1FG9C 2JCCA 4ENED 3I3EA 4PJFB 3CZKA 4WEBL 4Z5RB 1R3IL 4P48A 4DGVH 3ULUE 1S78C 1HQRB 3VM7A 3VWKB 1QTYT 1MHHB 2B1HH 3D3VB 4OZGE 2X12A 3STBA 5L6YH 2VSKB 1A6WL 1P1VA 3FONB 2EDKA 2NW2B 1KG0B 4FLQA 5ADOL 3N5AA 4FFVD 1D7DA 2C3VB 5DHVB 3ZE2F 2E7CA 1AG6A 4EEEA 3LIUA 3SSGA 4JDZA 5I8CA 2FLMA 3VFWB 5K33A 4L9LA 2IAMD 4NQXB 1VZHA 4AXWB 4F58H 1F4WL 1I9JL 3H2QA 3QFDA 3CFBB 3OLIA 3TJEL 1NAMB 4F7KA 1YQVH 5FV1L 3IGAA 1C7SA 1FL3A 1MLCB 3A24A 1N0XH 4WUUA 3CU1A 4RMRA 4CSZA 4N0CD 4IOFC 2EDNA 2J2ZA 4AV4A 3WFEH 2GEEA 3VRIB 5HI5C 3HN3A 3ESNA 5E7FA 5GRJH 4CVZB 4JFDE 4NYLB 4M6NL 1MCPH 2EECA 1JHKL 2BP0B 3MV9B 4OQTH 4JRYE 4H8WC 1N59B 1OTTD 1A7RH 5DMIH 3R19A 2W92A 3VWJB 3FNKA 5IBTH 3VU2A 5TD4A 4ERSL 3KHQA 3BKYH 3BN3B 5GGQL 5T8IA 4FNQA 2YMXL 3FAWA 4NUQA 4MNHB 3MV11 3IFLL 2NLJB 5KVDE 5TE6L 2D8KA 3LHPL 3NIDE 5C0RL 4NNPH 1NC2D 1PZ3A 1FFOA 1FN4A 1M7DA 3FSOA 2ZOKA 1DQDL 1X6LA 1E2ZA 3PNWB 4KKBC 4BUGA 3MLYL 1OALA 5AYTA 3HMXL 4P2RE 2VXTL 3QUXC 4MWFA 4QUOA 4XPBH 3UIYA 5KVGH 1WH0A 1U8JB 2VMDA 4L29A 1YNTB 2X6UA 1SXNA 2BNRE 4MA1B 1GTNA 4XZ4A 3ARXA 4EDXA 1XF3B 1CFTB 1ESOA 2Y1VA 3LYRA 1YNKL 1QSEB 2JB6B 1SJHA 1U8CA 3WDIA 1CC3A 3C8KB 3ZJAA 2YA1A 5I1KH 4AQ1B 5F9OH 3A6CL 3FT3B 4J3UA 4PS4H 3ZKNC 2GJ6B 4P5SA 5E7BA 4XP9L 1E27B 3F7KA 2B14A 5KSBB 3D48R 5ID0B 3WN5C 1JJUA 2RD0A 4DP1X 3WFBH 1CT8A 3QQDB 4EXPX 3D34A 4QLWA 3BP7B 1TJMA 3UJIL 1IX2A 2W95A 4HZ1A 2JFCA 3VTMA 4BH8A 1P84K 1PU0A 3OR6A 4IGBC 2W0FB 1GGTA 2ESVD 2WOYA 3CN1A 3VAEA 1ILUA 1T0OA 4HEMA 3WENA 4DNLA 3DVGB 3JQOB 3RDTB 5FCUH 3U0PB 5L0QC 2YPKA 1BF8A 3LPWA 4R5TA 2A9ML 4NPYB 8FABA 1PQZB 2NY6C 3OKKA 3VH8G 5CM1A 3AS1A 2IALB 2MPAL 1ES0B 4I48B 1P7QA 3MRHB 2D4FA 3UTTE 1CLCA 2X2HA 3VXMD 2IH1A 4JO4L 3SYOA 3HE7D 2H1LM 4P46B 4YWGL 1S7QB 4Q6IB 5CGMA 1IGTB 4CW1A 2CLZB 2LAGB 1UM6L 2XFXB 5DFWH 4N0YH 4N6RB 1TNMA 5CKAA 5H8DA 3W0WD 1R3HB 1JPFB 2HX7A 2IF7A 5JHLL 3DGDA 4XO3A 3DMMA 3PJSA 3FCGA 4ONGH 1M6OB 2E86A 4FADA 2BLFA 2VWEE 4DZ8B 1WUZA 4XMPH 3N43F 4MLIA 5F0JB 3SDYL 4LNRA 5E51A 4N1EA 5GQBA 4N2IA 2UWEE 4ODWA 1JHTB 1B0IA 1ZHKB 5FYLD 2NNFA 4DOHB 5B38B 1K5NB 4KHXH 2VLLA 3WNPA 1OP3K 4GKNB 2P42B 3KXFB 5CP7B 4Z7UA 5SWSB 3PWNB 2WBKA 5HVGB 5CLYA 1I1YA 5BUAA 3MLXL 4ZUVB 1AD9B 2L7JA 3VA2C 3DJRA 2HUEA 1OZTG 3KW8A 1FE8H 1UOLA 3GI8H 2NRDA 2ZYIA 3ML9A 2WYIA 2D3NA 1SQMA 3KMDA 5AOZA 1N5YH 2NSXA 2BDNH 2NTSP 3QNXB 3HI5L 4P2AA 5IESH 5FF6A 2J1ZA 1MFAL 1AGFA 5HJBA 4LEOA 1JV2A 1ZDQA 4ODXA 3HS0A 5EU3B 2KDYA 3PXLA 1JWMB 3ZZQA 2AMGA 1LNUA 1TTGA 4D8PA 1JGEB 2FWSA 1U4FA 1FL5A 3QDJA 4DEPC 3V0HA 2CNYA 4FFYA 3IRCA 2YQ2A 4BQCA 5AG8A 2Y9RT 1ZA6B 3QI9C 5KSUB 2QHRL 5EN3A 1DUZB 4AEHH 2X9XA 1F0LA 4U3CA 4TUJB 4Z9KB 3L3KB 3VFRA 3ULSA 4M1GL 1EJOH 1U58B 1DJXA 4LOEA 5AD0B 4ODHH 4KK5D 3ARVA 4PP2B 1W0YT 4YDKH 3MXVH 4QD2E 3VTTA 1KB5A 4F15C 1NFDF 4WTZG 5DUJA 2VNCA 3H9HA 4LDOB 4OIAA 2QEJA 1JTTA 4DVRH 3ZT6A 1K9TA 4M4PA 2WVUA 1WT5A 2X53A 1TEYA 6FABL 4YZFE 1X5ZA 3L3OC 4EDWL 5BPPA 4MXVE 5DMJB 2ERJB 2NX5A 4OJFL 4HZLB 2B77A 5D70H 4F1ZA 4HH9A 2YD1A 4PG2A 4FTVE 1FH5L 1Z2KA 3S88H 2ZE0A 4GAYA 4KV5E 3HG3A 3EKCA 4NZTL 4LSUL 2Z64C 1MH5B 1XGQB 4UCFA 4W9JC 1IC4L 3LZFH 3QDHA 4IGBB 2YC1A 1QW8A 1ZDSA 2JI2A 4B9YA 5ERWA 4JFZL 1CDJA 2H32A 4POUB 9PCYA 3PF2A 3BYTA 5L0QB 3KBEA 4X0NA 5CIPA 2F58L 2ILLA 3DWTA 2Q7YA 5I75C 1GL4B 2HWZH 3U82B 3UXFA 1USQA 5DA0B 4L3CB 2UXTA 4JR9L 4MDRA 5ICYB 2WP3O 4J6IA 3I9AA 5FLUA 1JD7A 1P6WA 3BEVA 1ZT7A 4J28A 1CGUA 4X7FC 4LKCB 5D7IA 1TYRA 2V2TB 2BXZA 2Y4SA 5I1LB 4PN6A 3PAYA 2DIEA 4QHMB 2FJGA 3GSOA 2ZWZA 2X4QB 5A6MA 4FQJL 4Y1AE 3X14A 4EN3D 2H1PL 4HX1A 3VMNA 1UWXH 1VJSA 1A7NL 1UFGA 3QJUB 4LT7A 2Z91B 5IBUG 4M6OH 1L9RA 5FYKU 5L88L 1OPGL 2UY6B 3DVNB 4PTTA 3QGVA 3DDGA 2JIXA 4NQCA 5CMAB 2VL5B 5FK9A 2B5IC 4KRMB 4FYSA 3JWNE 1U41A 5GRUL 3W11C 1OAJA 5HYJB 1JPSL 4IIQA 2ZUTA 3SDXE 2BY2A 5MHSE 4IBYA 1NWPA 4G7VH 4GXVL 4KVNH 1WBYB 3AU0A 4ZODA 3FFOA 3CDGA 3UAJC 2HVJB 2KHAA 5DQ9A 1VFMA 1BZ7A 1NCCL 5I1CL 2O5XH 3HE6B 3LN4B 3S35L 3T08A 2ARJA 2QSCL 2YPVL 1C5DB 4YXHL 4B9GA 5ICZA 5F7DA 5DZOA 5GJSL 2XACC 4WV1C 4RGOH 4OLXH 1B0RB 4Q9RL 5ETUB 1FI8C 4BKLB 2VDML 2DQJH 3KW7A 2Z35B 3QZMA 3TBTA 2Y36L 1U93A 1FPTL 1A5FH 1B88A 4IDJL 1QI3A 3GSUA 4TSBL 2K3HA 1CFQB 3QI9B 5KYWA 2YKLH 3MRJB 1R3KB 4PMEA 2H7WA 2F8OA 3MUGB 3TYGH 8CGTA 3KGSA 4BFIA 3AM8A 2D3JA 3QRLA 4FHKA 4OV6F 5CD5D 3GMQA 1V05A 1D7CA 3ZSSA 3IDJA 4WWPA 1BM3H 3MV01 4N1HB 3TGXA 3ZQ9A 1L9MA 1CXIA 1K4DB 1MI5E 2CA3A 4NT6B 1MN4A 4M3KB 1D5BA 2XTJC 4Q74A 5TTRA 1V8HA 1X4ZA 3VSTA 4XMXA 4PJGA 1F4YH 4XPHH 5TDNB 1G9MH 2WQSA 3P4OB 1Z0MA 4DQOL 4L3FA 1OSZB 3ABMB 4JQIH 3Q6FB 3CIAA 4NKDB 1KYAA 2Z0BA 2AJYH 2DWDA 3ETBJ 3LMJL 2IPTH 4H2CA 1T1XB 5AW0B 2CA4A 4JZJC 5D9SA 4IOSA 2VABB 3SKMB 4AGPA 2A38A 2R69A 5KEZA 1WGVA 1WCBB 1X6NA 3C12A 5H37A 3IN2A 4ABWA 1O9WA 4LCWA 2YK1H 1K8DB 4DFHA 1FVEA 3BGAA 4RA3A 3PGDA 3S2AA 2ITDA 1KELL 5DF0A 5DJDA 4OCMC 1WE5A 4DN4L 1X9RA 1Q0XL 3FHQA 2X70B 1QSFE 4JY6A 5I75B 1G43A 3GJFK 4QRTB 1YEEH 3KPSA 5GZOD 4KK9C 2EDOA 2MCAA 2D9QB 2ICEA 4AYSA 2CWRA 3QUYD 1CDBA 4HIJB 1U33A 3VFVA 1WC7A 3GSXB 1U21A 4FF9A 2VDLL 1XDTT 2ZXDA 3D0VB 1IKFH 3LKPB 5T1KB 2ZCZA 5DGQA 4CDGC 2WNWA 4Z7VE 3ZYOA 5F88B 5DHVH 1KT2A 4TNVF 2VLRD 3P0GB 4F7TA 4ZFZA 3WXVL 1G7JB 3QA3A 4LGRB 4TUUA 4O9HH 3RURA 4U1NA 4GPVA 2E7DA 3IWUA 1YPZA 4JCWA 4KRNA 2VQTA 2NXZB 2WD0A 3MQIA 2VR5A 4N0UA 5C09A 3UC2A 3WHXB 4E9SA 7FABL 3PDOA 3WI9A 2RFXA 4P2OC 4HOWA 1TU2B 4OV5A 4N2DA 5E8OA 1E5ZA 3CFDB 1FP5A 2ICWA 2R1YB 1WFIA 5B3NA 1BXUA 3JVGC 3GBEA 1I1FB 4PJFF 1CE6B 5J9PB 4UQAA 1AIZA 2G9HB 2VUYA 4NZDA 4A38A 5CO1A 3H1ZA 2DWSA 4MQSB 3L9BA 4NM8H 1NCJA 4YGVA 1QR1B 2CKBA 1JI2A 3E8UL 4D9RE 3VD5A 5EA0L 3KDMB 1ZK9A 2CH8A 1CXKA 3CK0H 1MQKH 3HRZA 1TQVA 4L4JA 1GJWA 4WFFE 1NCGA 4YSQA 1M05A 1JFQL 4HAFA 4CADB 1R24A 4NZUL 1HYRC 1DQIA 1ECYA 4TVPH 2XKSA 1Q1PA 3AU1B 3ILQD 2J73A 1Z66A 3ZDYB 1HAWA 1HNYA 1PTZA 5EOCJ 4X6BA 1T04B 1S7SB 4ZXBD 2HTKD 1JDDA 4UDTB 2ZP9A 3F7VB 4WV1B 4L1BA 4JHBA 4EJ1C 1IEAB 1HU8A 4OZFA 1WBXB 4Y4KB 3RU8L 3RVXD 3APCA 4YFLF 5E6RB 3T4AC 3QUXA 3IJSB 4S1DC 4H88L 4WI6A 3QS2A 3O2DA 2APXA 3HEIB 4QHLB 3VDCA 4UQ3B 3TC9A 1SJVA 3ATBA 4HU2A 2EYSB 4G1EB 3OKDA 3RBSA 3ULUL 4K7FB 2CJ3A 4IJ3C 2FD6H 5CCHE 2D0HA 1NAKL 4LOFA 1SF3A 3RGVB 3O81A 3SJVE 4NO2A 1IM3B 1QPXA 2IWGA 5HGBB 2DMHA 1FG2B 4QHNA 4BZ1H 2CJUL 1R47A 5JXEA 3LPFA 3VD9A 3QR1A 4ZPVB 3BPLB 3WN5A 2XTJB 5E4EC 5TDPB 1INEL 3R0MA 4JMNA 2OULB 3P11H 2HLFC 5LAXB 1MEXH 2AEIT 2DYPA 5DD5H 2QQNL 3CFUA 4TQEH 3SOBH 2WBJC 4KZ0A 1KDJA 1YEKL 1ZLDA 4JZJB 3IXTB 4FNTA 5J8OA 3VXSE 1DVFB 4WF7A 1VRSA 1WAAE 3L4XA 3ZYZA 3BDYH 4HIXL 1GH7A 4FNLH 2WLIB 2DQFB 2PPFA 3RUGA 1PCXA 4V1DE 2BERA 5D2LB 1P4LA 1AGCA 4G3YL 5EBWB 3TEWA 3WUWB 1ZGLP 2AGJL 5C0CB 1UM4H 4ZNEA 1MFBH 1MREL 1KULA 2I9LB 4F9PC 5D5MA 1HSAA 5FB8B 2CXGA 2B0SL 4RWYH 4YHKH 3BFOA 2WAHA 3C09B 2M2DA 3C5JA 3MBED 4QF1A 2ZD0A 2OCFD 2WQXA 3C87A 4YDJB 5KSBF 4HJGA 1T21B 3K2MC 1YECL 2AEOA 4JRXB 4WO4C 1S3KH 5KVDL 3NSXA 5CBAB 1EZLA 1QQDB 2DI9A 1EH9A 3H54A 3DX1A 3ZL2A 4HSQA 5BUGA 2YGQA 4KTGA 2YN3A 2P1YA 4ZS7L 3O4LA 2P43B 1DBBL 2CO2A 3OKEB 3L4CA 1NFKA 2FDBP 2YD9A 2W9EH 4LSDA 5HHOD 5T5NF 3RTQA 3OX8B 1UKSA 4JQXC 2JJSC 3QIWD 4X4ZA 4ZG1A 2HFFB 3VYPA 3KPOA 5D7SL 4HMEA 1AI1L 1T0MA 4Q2ZA 4MSWB 4K3GA 2FATL 4XO9A 3QZWG 2ENYA 4KXDA 3W5MA 4MD0A 3RYMA 1PLCA 4Q0XH 3RAJL 1HJCA 4P2OB 3IXAB 1AGEA 2P24B 3PYCA 4NRXA 4DZBB 2XQBL 4J6RL 5L4JA 1HWHB 5EU6A 3POHA 4KNSA 1S7XA 1FZOA 4N90D 1N64L 2G3ZA 2Y06L 4JO3H 4DUWA 3NOIA 2ZCHH 4JM0A 2R2BB 3PHOB 3QO0A 1ZANL 1UFUA 3BKML 1CGSH 1BQLH 4I77H 4X0KB 1M4KA 1WPCA 2FBOJ 2V7HA 3KWXA 5L2KB 3V5HB 4WHCA 3IJYA 3DOSA 1DQQB 3DV6A 4FC3E 3VFMA 5J6SA 2WIIA 5C0BE 5ISZD 2A9NL 5DS1A 1UZ6E 1KEML 3G6DL 5DD6B 1JOIA 2L4OA 2PCFB 4OZFH 3UCQA 4L3EA 1G1YA 2MNJB 3RIAK 5K59F 4GW1A 3ULVD 3ATAA 4UM8B 1EAOA 3RVVD 4MVBD 1N26A 1QSVA 2G4EA 3OAZK 1JDAA 3B7YA 5BS0A 1CDYA 4X6FB 4D9QD 4N5ED 1NCAH 4WUUD 2K0RA 1S9XA 2OMUB 1HE8A 3MNWB 4LLMA 3X3FL 4Y4FC 2QBWA 1NA8A 1M7IB 1H5BB 5LGYA 3DK0A 1R3JA 1CF1A 2BOCB 4WW1A 4P2QA 4ZT1A 5EZJA 4BSWA 4NIKB 3AG2B 5TGBB 1UTDA 2GAZB 2EC9U 4PJCB 1F1AA 4PB9H 4IJ3B 5M94B 1JDCA 4XGZB 5FPIA 2B1AL 2MIZA 3L1OH 4N2KA 2F5BL 4ODTH 3L3OA 4LSVL 3GLZA 4QXGL 5CKGA 5K93A 3TNNB 1JPGA 3MODL 2WCGA 5I5RA 1Q9WB 4JDEB 3FB5A 3S5YA 3UROR 3EYOB 3FSZA 3OV6A 3MFFB 2WOBA 3MNZA 2VAAA 2NCEA 2V5YA 4PJIB 4U6YA 3NN8A 4XCCH 4I3GA 1JSYA 5T5FA 4HT1H 1F3DH 4JVUA 4DKEL 1BVNT 3QG7L 1FO0A 5KSAC 4NQEE 3OKLA 2WLNA 3FXIC 1D5IH 3MNVB 5KJRL 4EVNB 5J6HA 2YD4A 1MVUB 2DMKA 3WLWD 4NQUA 5D96B 1BFTA 1SOXA 1X5HA 1WO2A 1AMXA 3QXWA 5TF1H 5MP6L 4PJXA 4YSEA 1FZKA 4FQPA 3RVWD 1TT6A 2DEYX 1GOFA 2RCSL 3FZUC 4JPVL 5CP3A 4X4XB 1TJHL 3AAZA 5FFGA 3ZO0A 3QUGA 3D33A 3L3IA 4B9IA 3V8CA 4P3CH 1YUHB 5DJ6A 2PP8A 1HNGA 1YEDA 5AKTA 5I0XA 5HGAA 1KCSH 5DHDA 1RK1B 3JV6A 1WV7T 2A6IA 3GXPA 4PRNA 4N4YB 4Z7WA 3W38A 5EO0A 3MV7B 1I4FB 3LQMA 4B60A 2X9ZA 3DJSA 4WNQA 3R06A 1SXZA 4AENB 1FNLA 2V7NA 4LPYA 2GITB 4UT7H 5JQ6L 1JYXA 5IP4A 4B3VA 5F3BB 3CZLA 4PREA 5F93C 3RWHA 1MZZA 4M7JH 3WELA 5JHDA 3QDGE 3KPMB 4YL4A 4B41A 2XWBA 4NHUB 2HFEB 2CPUA 2Y2YA 4CL7A 4I3SL 4YBQD 4XAWL 4BFJA 2PYFB 4LLVB 3UJJL 3R8BB 4WY7H 3OG4B 2FRGP 2MKWA 2AJZA 2O5ZH 3HVDA 4IMLB 3O6KL 5E1GA 3UAJA 5BRZB 2K9FB 3PWJA 3BVXA 1T5KA 1NC4A 2BC4A 5GRYA 4G80B 2J4WH 4UOW0 5GRXG 4BUQA 4Z78B 5I1DA 3JTBA 1XL4A 3U0WL 3WOVA 5I19L 3NTCH 4PJ7B 1JK9B 2C8NA 1OAQL 5DSCB 1EO8H 2WWMD 3DMMD 4LLDB 3TT1H 5DMGC 1BG1A 4PLOB 5AW2B 4TLKA 4BCYA 3FU0A 4WDIA 3HHSB 3GYRA 4LRNL 3MREB 5GGSY 4JPWH 3RL2A 1MCRA 2BIOA 1KJVB 5IF0B 1PD6A 3O3EB 2WXHA 3MOBH 3EFOB 1VPOH 5IB1B 4MS8D 4HOXA 1LTXA 3JVFC 25C8L 1QVOA 2BNQA 1KPVA 1HKLL 1A6UH 2B8OT 3FQ2A 3IMVA 4JMXA 4UZGA 2Z92B 3LDBC 1PKQA 1NL0L 2VDOL 4LU5H 2CHXA 4OT1L 2MCG1 4MNQD 3SB3A 3QFJB 4HDIA 3VCLA 4R0LC 4POYA 1B0WA 1PYWA 1T5XA 4MNGB 1BQHA 4IRSC 1JMXA 3DETD 4AYMC 3KCPB 1ED3B 1J5HA 4RH4A 4Y4FB 3SDCB 2PCPA 3VXTA 2HN7A 4BQ9A 1RZIB 3U46A 3CJJA 3E7JA 3IETA 5FOBB 1A3RL 3QSKB 1N19A 4FMVA 4RESB 3NJXA 3IFPA 4GKLA 2VQ4A 5IM7B 5BXFA 4L1SA 3C2AL 3O4OB 1LE9A 2CLVB 2VCOA 3TP4A 3GI9L 2O5NA 1D5RA 5G2NA 5EH1A 1KFAL 3T71A 3PABA 4FYTA 5JTWA 3GB7B 2TRYA 4RMQA 2AJXL 2FR4A 1I9RL 4L1HA 3T6WA 5H2BA 5H37G 4MD5B 1T1WB 5BO0D 2XSKA 3QDJD 4L23A 4NCC2 3TYFB 3CSPA 2AV1A 3VXPB 1KEGH 2OL3A 2GY5A 2P5WA 3KLSA 3VXRA 3SZKC 1OAZH 3FQNA 2JJTA 2C3GA 4O4YH 3FQTB 2FL5B 1SPDA 5IV2A 4JHAL 2J7LA 2GSIB 5G5DB 4Q9QH 4KITB 2VC2B 1LMIA 2VLME 3GHEL 4M9PA 1NGZB 2WZ6A 5F7WC 4PRPA 5J13B 5KSAB 5B1CA 2J6EA 1RVFL 3KYNB 4G9DB 1M7UA 3QUML 1CICA 3TO2B 1KLGB 2GB2A 5DO2C 3C08L 5TQ0H 1BZ9A 1BQ5A 4QRPB 1TZHA 1V7NH 4PPTA 1JI1A 1XD0A 3L7FB 5IROC 1RIHH 1DDTA 2OTUA 1J1PL 3V52L 1NLBH 2NX5D 1J1OH 2JWYA 4XP4H 3OWEA 5F9JB 3OB0K 5B38G 4D9LL 1Q9LB 3VO0A 1W0VA 3FUNA 4YFLI 1B4TA 4MXWL 5LBSA 1K4CA 1X3DA 1AVAA 2G4GA 3E6HB 4HJ0D 1NINA 1PZ2A 3MJGX 2ED6A 4ODVL 3LPOA 2C7UA 4YK4C 4LCIL 1MNUL 3WTVA 3WIIH 1ZHLB 4W9FC 3HNSL 2AXGA 3ENEA 2D7QA 4XI5C 1W9XA 3PP3K 2EABA 4OCSL 1RJLB 2IV9A 1T22B 3JVGA 2F61A 3SE9L 3F04A 2Q8BL 2F2HA 4ORGB 5DJZB 4WTQA 3TV3H 2V2WB 4CVUA 4MB3A 1SHMA 1G4MA 1ODAA 4MDJA 1UB6A 4F9LA 1MF2L 4HBCH 3CH1A 3LXBA 4ES9A 1J9SA 2XZCH 3Q2CA 2O6CA 2JELH 2W0PA 4JHWH 1CWVA 4NEHB 3OWRA 2XC8A 4YQXH 5KBNC 5EC1A 4OZFG 3L4VA 4LMQI 4ANXA 2XG5A 1NTDA 4YPGA 5LCVH 4BJLA 2VIRA 3CDYA 3DSFH 3C5ZB 2E9JA 3Q6GL 1YDPB 3LS4L 1GR7A 4PV9A 4FKHA 2HLAA 1S8DA 4AVIA 2WTRA 3RNQB 4E41A 3WNIA 4PRHB 3BW9A 1TO5A 2DMBA 5JZ7D 2JIXD 5I9QC 5BCAA 1A9EA 3WMPA 2J8UA 3C75A 3DPDA 2B3RA 1K6QL 3HZKA 3KPRE 4XVTH 4LIQE 1QEWA 1KCVL 3RWEB 1URLA 4U1KB 3WS3B 1KGUA 5ALCL 5ABAA 4E42A 3WD5L 2CDEB 4O51A 4BQ6A 2VDMB 4RNRA 5SV4A 4ADGA 5MENA 5T1DH 5I30L 1GJUA 3ZDYF 1DJHA 1YO4A 2DBLL 3MA7A 1WA1X 1Z5HA 4AQEA 4XNQA 1WZMA 4IQHA 4ZDHA 5IT2H 4RMVA 2R4SL 1CFNA 1NM4A 3GUFA 4AT6B 1SHWA 4OJCA 3RWJA 2WBJA 2R23A 4Y89A 4ZTPL 5HDOA 1VFAA 3DIDA 4DUVA 2ZONA 4JZOA 5B39B 4MMXC 1J9RA 3EH1A 4ELDA 4R2GD 1T7ZA 4YSUA 1QYGL 2A9BA 4H26B 4CUCA 3MOQA 2VXUH 3N0PB 1Z9SA 2J55A 3MKKA 4HKXA 1VKXB 5HVHC 1AOHA 1N2RA 4HJJL 2HJLA 2J6EH 3U79A 3S9DB 4H40A 2QPEB 1ZPLA 3RPIB 2E9IA 4AQZA 2XZAH 3V6ZB 4NHCH 4Y9BA 1I1RA 4DPAX 1S5IL 3QZNA 4HWZA 2DQUH 1QNZL 4BQBA 2P5EB 5AVYB 2EDFA 1AHKA 2X41A 1HX0A 4G5ZH 4DGWC 4WO4A 1LO4H 3CVHA 3O9WA 2OS7A 4PGCB 3DXAE 1U8MA 3CSTA 2OP4H 5EF1A 4XO8A 1BV8A 3P9MB 3KWTA 5CGTA 1MJJA 2DI8A 2NY3C 1J8KA 4JPKH 4ES8A 4ZW5A 1L9PA 3J8F7 3CHXA 2R1WB 4P23B 1X5IA 2NTFB 5I5IA 3EG9B 1FF5A 3LEVH 1GCYA 2BRRL 3RWGB 5FECB 2RALA 3D85B 5DD1L 4MXQD 4YK4B 4QHKJ 3HLKA 1ZLVK 2F54E 5D2LF 1UA3A 5EN2B 1D5MA 2AVFA 2VDLB 4AZ8A 4KZDH 5C07A 4O5LL 4I5BA 1XGRB 4XP1L 3MRFB 5CILH 5J4MA 4GMTH 3WN6A 3VI3B 3QXTA 3S3BB 2IWKA 2Q76B 4UZUA 1DLHA 3NAAH 4QY8B 2ED9A 4IHOA 1IJNA 4P4KA 4K7PL 5KBKA 4TQPA 2FLBT 1GGIH 5IG7A 5KOMC 3MCLL 4WGKA 1KENH 4NENA 3T3PE 3NFPB 3TJEH 2IV8A 2X2JA 3ARBA 5I6XB 4QIRA 1IGJA 4Z8FH 4G6KL 1GPOL 3IJEA 2EVFA 4AMXA 1A7QH 4CMMA 3OGOE 1QFWM 1CD1B 5ELIA 1JHKH 4OZHB 4GAFB 4H8PA 4X6DE 4O2FB 2OSLB 1U3HC 5C09D 4PJHB 4ECNA 4AI7A 3EF7A 3W82A 3MV8B 3LY6A 3BMVA 3B7SA 4R7NA 5GGQH 3AT8A 1XCQA 3U7YL 1YEIL 5DQJB 5I9QB 1F00I 2XV6B 3WNLA 3KR3L 2IVFC 1BZEA 1RZGB 4X8JA 3UTSB 1FGNL 4ZYKA 5BZWA 2YPLB 1ZHNA 1HCFX 1AO7A 3MRGA 3S8WA 4HALA 4OI8A 1DQDH 1YMMB 4GXUN 1UYWL 1E4KC 4MD4B 1BAFH 4G42B 4GO9A 5I26A 1LDPL 3GMNB 5MEOA 3H42L 1Z3GL 1DE4A 3ROLB 1R0AL 3F3HA 4JG1H 4XNXH 2F53E 1CCZA 1ZSDB 1NGXA 2FSEA 4PJBB 4R5VA 2OV0A 5FUZL 5HXMA 2LR4A 4WWNA 3MJ9L 2ED8A 4XTRD 43CAA 5B7MA 3LQZA 5KBPA 5JORB 1R5VA 4KI5E 4MMYA 5L2JA 3EO1B 1MCNA 3GEWB 3MFGB 3QW9A 4K3HA 4J3BA 1A7BA 4PBVC 4J3WA 2X05A 5JPMB 5FAAA 1Z9OA 1KFGA 1CG9B 5E0FA 4IU2B 3Q05A 4XP9H 4WI7A 5B7EA 1DBMH 3IMUA 4MMXB 1X5YA 5IB3B 3LKQB 3EOTL 1AYRA 2AQSA 3ZVVA 4C54A 3LH9A 3MBWA 3VG0L 2H2PD 3BEWB 2R0LL 4Y5XA 1MCQA 4JZNB 3H85A 4PJCF 3BSZL 3V6OC 5ILTH 1MCOL 3EZJB 3MRDA 2OXHA 3AC0A 3LZRA 3W56A 1JGUH 3UTOA 3IVKA 1MHCA 3QXAB 1Q94A 3JWOC 1MRFH 2DJMA 3QDMB 2AEPH 2J8OA 5JXED 1KNOA 1GMEA 3CFNA 4QOKA 4UV7H 3VFTA 2WLLB 3BAXA 4MZRA 3CVHH 2KYIA 2R56H 4YSRA 2BSSA 4JPQA 4KFZC 1XWVA 2ARWA 4G43B 4WI0B 4YXKH 4L8CB 4PJIF 2H3XC 5CZXC 2AP2A 5T1LD 2DYPD 1N67A 4JFDB 4GRLB 3DJ9A 4Z7OE 2Y5TA 4YWGH 1WA2X 1BF5A 1S7WB 4X7TB 2PYEE 1BFVL 4JRYB 3L2MA 5IMOB 4L4VA 2H4EA 3VXUA 3RFZC 4W9EC 3HZMA 3QRGL 1X9LA 3AQXA 4U6XB 2X2UA 2VDRH 1GA2A 2Y1YA 3SO3C 3MRMB 2XZQL 2BMKA 3CX2A 1IFHL 1RJZB 1YYLL 3QJVB 3UYOD 4QTHB 3QBTB 4D2NA 2LHAA 4JN1L 3LNDA 4IYKA 3NJIA 1RZ7H 3P77A 1TTRA 2EE6A 3S4SB 2JK5A 3H9YA 1USZA 1DVUA 3MN8A 4ELKA 1T2XA 2Z31B 1QPPA 1QATA 2A6DB 2C7FA 3O4LD 5DFAA 2BNRB 3MGOA 3FQXA 3ECWA 1UT1A 2F74B 1K8IB 2CNZA 1BFOB 4FS0A 3RTQD 1JZHA 4G6FD 4N22A 4PG9B 4E9VA 2BIHA 1BQHG 2V8LA 3TX4A 1FFNA 2VN5A 2APVA 5IBLC 3A47A 1N3NA 4XVJL 2EE0A 2JKTM 1MFAH 4Y2DD 1KLUB 3MVSA 1U3HB 5CS7A 4D0CA 4UDUA 2W65B 3CZFB 3WKML 4Z3JA 4Z0BL 5FCSH 1GAFL 1OGSA 4XODA 5EU6D 5D7JB 1QTSA 1RUKL 1WWAX 4FG6D 4XZUB 3BQUC 1MJ7L 4JFQA 3T77B 5GISH 1ZT1B 3SBQA 4HCGA 3R1GL 2QHRH 4PJ7F 1JZ8A 1QLEL 5FOJA 2WN2A 5DK2B 5C0DA 3RX5A 3U30C 2GVYA 4JRWA 3II1A 4M1GH 2C9QA 1EFXA 4EF3A 1SY6A 2CLRA 2AQ3A 3HI6L 5CINH 3I2CH 2VYRE 2CKNA 3MMEB 4GINA 3WUWG 5TK2A 4FXGA 4HYTB 2UZYA 1NFDA 4HBQA 4L3ED 1J1XL 4OZIF 4M6ML 3M46A 2VC2H 3PCYA 4PCTA 3LTVA 1OCWH 2ZOOA 2MOVA 3M8OL 4PLKC 5FWQA 5BS0D 1CQYA 4APQB 2FEEL 4BQ8A 2EH7L 3E3QE 2CCWA 2W59A 1A8ZA 3GGWB 4ANKA 3FOMB 4J27A 5CCGE 4P2QD 3MI6A 1FH5H 3MHZA 3D08A 4X7EC 3A4AA 4ZPTA 2HPTA 1HZKA 1HINL 1THAA 4LHUD 2IAAC 2FX8H 5GJTH 4NZTH 1YAZA 3GK8L 3RWDB 3C60C 1IC4H 1CMOA 4H8VA 4UQIM 5CJQH 3V4PL 3HZVA 3DRQB 3O8XD 5IVZB 1UD8A 3ZKMC 2F58H 4KXZH 2GY7B 3HBZA 3BWUC 1IM9D 4EIUA 1QLRA 2FGWH 5CWSB 1TEFA 2KZ1B 3VI4A 1SVZA 1PZSA 3O45A 4H44C 2WVTA 2DLTA 3NPSC 4ZAKB 3U25A 1YEGL 5K9OA 3MLTB 1INDL 3TEZA 4X5PA 5C0JA 5LXGL 3AREC 3IE4A 1OK8A 4OCYL 4RZCB 4TN9A 3TS8A 1JGDB 2ADIB 1OARH 3L3JA 4HWUA 2LT9A 4I0PA 5EUOA 4HC1L 2JMRA 4PRAA 5L9DH 1A6VL 4I1RA 4NBZB 2DEWX 5DJYB 3SO3B 3DA0A 4HCRL 4QO1B 3VXNB 4PS8A 5CFAA 5L4IA 1QBLL 1SFHA 2H1PH 3GXMA 1A7NH 5HGDA 5D1XE 3X17A 2XA3A 4WI8A 5B4MD 3NBNA 1J0YA 4R4FL 1TEGA 2WINB 2B16A 2W81C 2X4UA 1U92A 3GBNL 3RKDD 3EFDL 2X7LB 4PGJA 4OD2A 4XC1L 4OLWL 2EO9A 2YRPA 1JPSH 4FAAB 2TAAA 4WEEA 4WWID 1ZY9A 5I71B 4FD0A 2ZOLA 1EK3A 3O3BB 3UTPD 3NJHA 3UP1A 3QJQB 4AH2B 5ANME 3TJHC 2YRBA 3AB0B 5JHDD 4JG0L 3HR6A 2QSCH 1CUOA 5K9JH 2EYTA 3VVVA 4U6HB 1CLOH 4FQQB 5IHUL 1IAOB 2CK2A 1F90H 2WTPA 1C5CH 4I9WD 4PI2A 2VSMB 4JAMB 2FSDA 1BOGA 4IBTA 3SHSA 4AQAA 4Q9RH 2XHNA 1XEDA 2VDMH 3ZZSA 2RMNA 1JHLL 4LBAA 4XBPB 1CYGA 4HGWB 3P69A 1NC4D 3SD5A 3ZOAA 3K80A 2KMWA 3IJ8A 4FKKA 1OGAD 4IDJH 5HVFB 4UINH 4TSBH 4N20A 4NC0B 3HR5B 2DDQL 3EYVB 1WZ1L 1N7ML 3SCMC 3N44B 4PCYA 1SY6H 4U0RC 1T1YA 2XV3A 2R27A 1UM5L 4FQXB 5IQ7H 2H9GB 1F8TL 4P9MH 2VXQL 4AYFB 1UXWA 1T2QL 3NDZE 1UWEL 1J9QA 2BNQD 5GIRB 4ZUWB 2IH3B 3BVTA 3LOWA 2B59B 1QLFA 1HWWA 4Y4HA 5KS9B 4C55A 4LL9A 4G1MB 3U2SA 4ABUA 4L9DA 4X80H 1KIPB 4X9FA 3ARDD 5LN4A 1VENA 4YHLL 1NBYA 2GABA 4GMSH 1EMTH 4BRVA 4Y1AB 4W9CC 1BVLA 2YXFA 3F2LA 3G9VA 4RISH 4LKXA 4K5OA 1H3PL 4GBXB 4POZC 1P1ZA 3BUYA 2GQHA 2BNUB 1XGYL 1NFAA 2P45B 5EIQA 4ANVA 3SPJA 4CN6A 4S2SB 3GD1C 1SNRA 1G6RL 1IQDB 3J2PA 2IPUK 4FG0A 4JDTL 5A2AA 3SDXB 1SYVA 1ZGLM 1JZEA 4QRSA 3X1BA 2FYVA 3IKKA 1OTUD 1B2WL 5FGBA 3QUMB 3VXRD 3WU1A 4G8AC 3UZVA 2VL4A 4DEUA 5SX5H 4B97A 4LEXH 4DGUA 1CFVH 2QR0A 5JOPD 1KCUL 4LIQL 3AREB 5KG9B 1VFOA 5DMKA 2EIKB 4TS6A 4DO4A 1CICD 2BCKB 2W1NA 2CO1A 4N0FB 1NEUA 2VZ1A 4ONFH 4TMPA 3WXVH 1HEZA 3MA9H 1Y18A 3MLZL 4LSTH 4OGZA 4PJ5A 4JDVA 3FU8A 2LE9A 5IB2A 5C8JB 2RTTA 2I5YL 4GNKB 1DDHB 2Q0ZX 1RURH 4N9OB 5KBMA 1BVZA 4QCIA 5BVJA 4IU3B 1JYNA 1A4JA 2IAND 4KZEH 3DHJA 3AWGA 3FPXA 4PJ8A 3VD4A 4NP9A 1RFDL 3SKJL 1U91A 4JY5H 5DUML 1SXAA 2XIBA 4WSJA 2R0KH 4NC1C 2HLEB 3P0YH 3DURB 4KKAD 4Z5RA 4HUUB 4Z95L 3GM8A 5EDSA 2BFVL 5EA0H 4YXLH 5B3JE 2AV7A 4WGWB 5LDUA 1AFVH 2JI1A 1FL6B 2V0AA 4AIXA 1QHOA 5EOTA 1EDYA 3NCBB 4JJ5A 1JFQH 1TTAA 3MLUL 1R3LB 2IQAA 3VI3F 4JFEA 4BK5C 3FONA 5IVXA 1ZWIB 2NW2A 5IFHH 1N18A 3P02A 2NW3A 3B6SA 2H2SC 2Q9OA 1GHFH 5FX3A 5INDB 5CN2A 2FBJL 2YHGA 3M07A 2D7OA 4K5PA 5DYFA 1MIEH 4HGMA 4JKWA 1MVYA 2V17H 3ISWA 1M42A 1TR7A 1P5VB 4HIIA 4NI3A 3CUPB 3SY0B 1HHIA 1ETZA 3ZHNA 4M62L 3H7BB 4R6UA 4N2AA 1DP0A 1JK8B 1NAKH 3QEQD 3UG5A 1AQDB 4OZHF 3LIZA 4U0RB 1FNFA 4YE4H 4ZO9A 4PJHF 1S5HA 3AG4B 4M29A 4OGAC 3V55A 5HHVH 2O93L 2EDLA 1MCLA 4NQDB 5LGKA 4E41D 3AXHA 5DUPH 4HJ1A 3O11B 1XAUA 1UEYA 4JN2B 4WUKL 5E9DA 4BFBD 5HHXH 4FI7A 3T0EA 4Z7VB 3D51A 1OGTA 1XGTB 3HG5A 4NRYB 5IR1B 2LU4A 2ZUYA 3VDAA 3VD7A 2Q2EB 5HPOA 1PDKA 1WSST 1RZ8B 2DWTA 5DEZA 2QQNH 1PD1A 5AW3B 4UYQA 2K4AA 2FJFB 1RJYA 4WQOA 3VFPB 3IPBA 3PNWA 2FX7L 2X89A 2GTWA 1NUGA 5K9KB 5MEND 1NCTA 2OTWB 1K2DB 4PJBF 2E3VA 2IFFH 2P5PA 1U8JA 2QDWA 4TF4A 4A1RA 1MHEB 1YNTA 2CM5A 4QRRE 2ZG3A 3T4YA 1WFOA 1FYTA 1HDMB 1WRFA 4EI6A 1ZA3A 2BHFA 5AVXB 5FYJH 4OUUB 1A1OB 3AUVA 2WBJD 1ZGLB 3SOTA 3CVCA 4NAJA 2J8HA 1RHHA 2BINA 2K7PA 3ZR6A 3RFZA 5AL0A 1DEDA 1YECH 3FT3A 3LCYA 2GJ6A 2Y6SD 5IQMA 2XN2A 4L37B 3QPKA 4OFIA 2ZWYA 3FQRA 3OLEA 4NQVB 1GW0A 4APXA 3FO2B 1FRGH 4K3JL 4UIMB 5E2WL 3BP7A 5F96L 3ZN6A 2MJWA 2V3EA 1P4IL 1DSYA 2IMNA 2UYLA 1I7RB 3MGAA 1EEZB 4I13B 4UQBA 4E0RB 1O6VA 4H1LB 2W0FA 3O2WL 3LNIA 4HWEL 1I8UA 3G3LA 4FFWD 5D71L 1IT9L 2XKNA 5J3HD 1PX4A 1VEMA 1AI1H 3DX3A 4WO4D 3HHMA 3O9WD 3OXSB 3OZ9L 3NJLA 2XIIA 4NPYA 4G8IB 3GJFB 1PSKL 4O02L 4IRJC 5EU4A 1E4WL 1A14L 4FFZL 4HLZH 1TZAA 2HVBA 2NNRA 3IDYC 3K2UL 1EGJL 3L8QA 4QHUB 1ID2A 5E8NB 4HK3N 3V6BR 2Y06H 4X5WB 3SPVB 4L8SC 2QQKL 3VGGA 1EXUB 2ZZUT 4KRPC 3IGLA 4N24A 3QWQB 3LXUX 1B4LA 1PIFA 4IS6B 4JVWA 2CLZA 2XFXA 3BKMH 5I2IA 4LQFL 3JBG7 4F7PA 1JPFA 5ACZB 5L4FA 3N06B 4EOWH 2GTZB 1AKJA 4I2XA 5JPNA 2Y7QB 5D93B 2A9NH 2X1XR 5C0FB 1BOYA 4PGBB 5J56B 2HB0A 2HTLD 3MJ8B 1MDTA 3EOYG 4LCYA 1BHGA 2QGCA 3BQUA 4JFFE 4X4YB 1NDMB 4P4KD 1DQKA 3S2CA 4Z7NE 32C2B 4MA3B 5TQ2H 3T0XA 3AACA 2E5EA 3UO1L 2DWEA 3VXSB 1XZ0A 1OTSC 1ZHKA 3EO9H 1MXDA 3ARBD 3ILPB 2FHCA 3LB6D 2NPLX 3X3FH 3FW6A 4UMSA 4TL4A 4V1DB 4W6YB 1W6LA 4PRIB 1G7HA 4ZUVA 1AD9A 3VW3L 4U2ZA 1T5WA 2N0KA 2PW1B 4EBQH 3CLFH 1A4AA 1J0HA 3U4KA 3QHFL 1BPLB 4Q97A 2A74C 3EDKA 4DKFL 4WRLA 2JCCE 4GIAA 5HI4D 5BVPH 1BDYA 3OPZH 1MWAL 5CR1A 5FUOL 4EN2A 5C0EA 4X4MA 4B95C 2QADC 4RWHA 4OD3L 5DRXA 5MERB 5BMFH 1VAHA 3SYCA 2KQNA 3BPCB 5KVEH 2YUWA 2DLFL 3LD8C 2E4TA 5CU5A 1JGEA 3FYEB 4OGYH 4WI2A 5IFAL 1AO7D 1W6WA 1I8IA 4G82A 2WNGA 5EHFA 1BCIA 5IW6B 3M17A 1NBVH 4R8WL 4DKEH 4FULA 1M7XA 2ADGA 4KXZI 3UAAA 1C12A 5GS0L 3WFCH 1QUNB 4OCRH 1TZIB 4FP8H 3S5LB 4U6TA 3D39E 1H3XA 2YMOA 4P3DB 1KBGL 3W5NA 1AZNA 1CVRA 1WEJL 2WLKA 4XXDA 3ULVE 1T4WA 2CMRL 2P26A 4PP2A 5L7XL 2PO6D 2V33A 1R5IA 4MCMA 4YO0B 4FHJA 1H9VA 4YDMA 2ORBH 2I25N 1ZE3C 1AHWA 1L0YA 2CUIA 4TULL 1Y1UA 1P53A 1TJHH 3N6YA 1KC5H 1BQRA 3WFZA 3CE1A 1BLNB 4FQ2H 4X5XA 1XX9C 2EXTA 3MLPA 1OW0A 1NWOA 3H9SE 2MMXA 3Q2VA 4GO8A 1GVIA 4XVSL 3BAWA 3VFUA 2XWZA 3EO0B 5C0BB 3ULVH 1WFTA 1J9TA 3BZDA 1EJ8A 2G60H 5J89A 1IBGL 4JCMA 2CALA 4WHTB 5I74C 1NDGA 3FZUD 1ZXKA 4L8DA 4ATTA 2DTML 4GAAA 4QOKD 4DUXA 2BP8B 5SWQB 3TWYA 4DGIL 3QC5X 2C1OB 1Z5YD 2NY4B 1RV6X 3HG1A 2R59A 3K72B 4FCHA 1J8HB 1Z9MA 4KMTL 2D4DA 4Y5YA 1OCZB 4I3SH 3RJDA 3Q44A 4JREB 4FG2A 4N2FA 4MZIA 4M5YL 3D06A 4XCFH 4LF3A 3C9NA 1BIIA 1E40A 3IDYB 1D9KB 4XNUL 2Z34A 3CHPA 1JPTL 4L4VD 1WS8A 4PU2A 4HW6A 4AVJA 3UPCA 5I1HL 2YUXA 2C4FU 2G5RA 2NY7H 1KN2H 4S1RL 2GJZA 5EBLA 5CJBA 3QEGL 1KGJA 3M7OA 4S10A 5LWYL 4Z3TA 2AQRA 1J18A 5DJ0A 3FQUA 2XVBA 5TH2B 2G3NA 3I6KA 3FUFA 2JVUA 2DKUA 3Q1SL 1OP3H 5INCB 4K8RL 3B9KC 4ZFGH 2VSCA 3M1BB 5FKAA 3GSNA 4A7QA 4C8XA 2MTAA 3WIHA 1OF2B 3EH3B 5FUCC 3CAFA 2XXGA 1FSKC 1MXGA 1NL0H 3CSGA 3Q43A 4OT1H 1DVSA 5B8CA 4JM4H 1Z1WA 3B3IB 4UBDC 3EOAB 3SCMA 4WAFA 3MLSL 3P40A 1GGCH 3QUZA 2YD6A 4NKOA 2WQAA 4A66A 1XH0A 3NZUA 3VFSB 1RUPH 3NZSA 3WUZA 4E5XB 3VUAA 2P8PB 2Y0SA 3HE6A 1NSNL 4MXVF 2WPGA 1ZVSA 1AR1D 3GUTA 3SDAA 2EIEA 3WE6B 2A74B 4ETQA 4FZEL 1RP8A 1EAQA 3THMH 1KTLA 2PXYB 3TPUA 1TJGH 3X12A 4UTCA 2A3TA 3B5GA 2YFOA 1I9RH 1QLEB 3E2HB 3DX8A 4YHOL 3ABKB 2A4EA 5GRZA 2O30A 2ENJA 1EDHA 1F4XH 1WTLA 2YKKA 4W9LC 1HHGB 4UIKL 3LD8B 5FA4B 1LO0L 2WYHA 4FJZA 2BXYA 3CXHJ 4YNYB 1RPKA 1N6QL 3UTZA 5FO8A 1M9WA 4NUMA 5HHMD 4TSAH 3RHWK 3PV6B 2ZXBA 5SX4H 4AQ8C 3H55A 1CDUA 5I1IL 3WV0A 4MB1A 3N44F 2F68X 3IJHA 3V4VA 3WIFA 3LZLA 1KYFA 4XXCC 4X9YA 1R3KA 3J7HA 2R8SL 2NY1C 3FKUS 5BOJA 2QKIC 4EXKA 1F1DA 4M00A 2VB5A 3QUMH 2OMXB 4ZUTA 3DECA 1L0QA 4WGVB 4GKOA 5KZCB 2YA2A 5B3SB 1B4JH 1BP3B 1S7RB 2RR3A 3BFWA 3QUKA 2WK2A 5HGHA 1A7OL 5EZOL 3RY4A 1J1PH 1A0QH 4PW9A 3G5ZA 2PWEA 5E99L 5C0GA 3RZWA 3V52H 3VB9A 4CC4C 1MJUL 4P5KB 4AJVA 4HPOH 5TDNA 4BBWA 5KS9F 1KTDA 1MCHA 1IBBA 1N5AB 1U2YA 4WFHD 2Y23A 2R1XB 3P4OA 5I0ZA 4L4TA 4GW4A 3FMGH 4MQ7B 4NFCA 4MXWH 5CEZD 5JR1H 3Q6FA 3WJLC 3CDFA 1RUQL 1WS7A 2P8MB 2RQEA 4JFHE 5C08E 4XCEB 4UNIA 3X3GL 2YS4A 4HLZG 1UH3A 3DTDA 4J3OC 3HNSH 3LZQA 1DBJH 3EF4A 5I74B 1XGZA 2XJKA 4QWWD 3VG9C 1ZS8B 1AACA 1DN2A 4PD4J 1K8DA 5D1QE 1NMCB 4DCQB 2AEQL 3BH8A 1KCKA 5AOMA 5GS2H 3SDXF 2BVOA 3SE9H 2NUTB 3QCVH 3BPOC 1U3NA 4FEMA 4XCYB 1EHAA 5IJDC 4JGUA 3BWUF 4NO5B 2CR6A 1BZ8A 4HJTA 2OMYA 3DX9B 4ONHB 5E8EB 2WQUA 3WEXA 2DS4A 4QRTA 2HP4A 5AZ2H 1MF2H 1S7VA 3TURA 5LGHL 3QORC 4MAYA 5AOKA 4RQQB 3SGJC 5IMMA 2ZG1A 5SWZA 4FI6A 4LP8A 2HFGL 1S9YB 1WD8A 5DEGB 4I0PD 3WXWH 5F88A 4BK5A 2K6ZA 2BOBA 4ODBD 1JNNL 1EERB 1UQSA 3WMQA 1KACB 2H6PA 2KBGA 5JOEA 3Q6GH 4AIZB 4KH9A 4A7GF 4FA8A 1G7JA 1XD1A 4LSQL 4LPWA 3B37A 1AP2B 3FB6A 3O6FA 3TZVC 5DC4B 1CLYH 4M48L 3RZCC 4I18C 3B9KB 3I9GH 1I8KB 1UADC 4XNZB 3PGFL 4WJ5A 3AQZA 1CS6A 1FSKB 5HPMA 2R1YA 1XIWB 5GSVA 1CGVA 3FH5A 4WFEE 3MYZA 4UT6H 3TO4D 3TN0B 5GS1C 3ZZ1A 4GG6A 3FTVA 3WFHA 1YY8B 1HCVA 4JFTA 4L48A 5C0AD 4CDHA 3BKJL 1S9VA 2G5UA 3CFCL 3FFDB 5TDOB 1HHJB 1YEJH 2XXFA 3GIVA 2EVHA 2AABL 3WD5H 1A25A 3I9PA 3KDMA 1HZHH 2R15A 3GXNA 1H6UA 3ARFC 5LNEA 1RH8A 3TA3A 3BE1L 2DBLH 5CLTA 4IDLA 1LMKA 3D3VE 3GSQB 4MYWB 1HYSC 2CRYA 2Y5EA 1ERNA 1SJMA 1EIBA 1OSYA 1ZVHA 4MA7L 4X99A 2R4SH 1S7SA 5C9JA 1YEWA 4HJUA 5D7IE 3QQ3B 5FO7A 1F13A 2OMWA 3LKNA 4HKZA 5EEVA 2FIKB 4LLQB 4OZ4B 1TXKA 1L7IL 3P3TA 2YEVB 1RZFL 2MHAA 4JM2B 4PY7B 5DZPA 3B2UC 1QYGH 4LLYA 3ERXA 4OIBA 3V4VH 2B9AA 4JG9A 4OKDA 1E2WA 4XPTH 3S98A 4DESA 4JFXA 1TYEB 4NGHL 2EH8H 3CN4A 3VFGH 4AGMA 3DHPA 4NQCE 4QT5B 1S5IH 5T3ZD 3GMOA 3QQ4A 4OFVA 3EHBC 4PEEA 2WXGA 4R4ND 2N0MA 4PWJA 4ACTA 2E9WA 2ATKB 4Z7VF 3JTTB 3PWUB 1L4IA 1Q72H 2H6OA 3L5WA 1HIMH 2BS9A 3A23A 3Q1EA 4EQ3A 4Y4HD 4XWGL 4HUVB 3L6FA 5KANI 2CQVA 3V0GA 2DW5A 4H1LH 2XQYA 4MJ5B 2DTSA 1R75A 3F12A 4NCC1 4X6EB 3T6VA 1G6RB 4Z76B 3OL2A 2A0LD 3CNKA 3PFQA 4O2EB 4KKPA 5FDYA 2AQQA 3GS0A 4TVPE 1F11A 4ENEC 1TOXA 2BRRH 1M2VB 2I32A 4OKVA 3IXTA 2VLJD 4X5RA 3GJFH 4F1SA 4WNJA 1DVFA 3AQDA 5C92A 2C9PA 3NJNA 4LMQE 3MJWA 2L8AA 4LCUA 4O5LH 3QJHA 4XP1H 4YHZL 3QIBA 1RU9L 5AKVA 2DAVA 3HAEH 5F1NA 3VNYA 1WD9A 4UTBH 2ADFL 3BP6B 4P05A 2OYPA 3U9PL 3T1FB 5C0CA 1G7LB 2NMSA 4L8SA 1CD0A 3QCTH 4O2CA 5ADPH 3R18A 4FFVC 1AH1A 3UZQB 4DGVL 3QORB 2IAMC 2W9DH 5DJ8B 2DEXX 4N87A 4YMPA 3IAPA 2B1HL 2GW5A 5I17B 2XKUA 1TTCA 4U1IA 1G5GA 5L6YL 1G84A 1WZLA 3AWEA 3PNRB 5AKRA 4KDTC 4EZKA 3FN0H 4J8RA 4N0CC 2VM3A 1GOGA 4XT1C 2D3VA 4JFYB 1N8ZB 4RBPH 2J5WA 2L7QA 1SXBA 3IWVA 1LQSR 2AANA 1HHKB 4M5ZH 2PKDA 2C26A 3T0BA 3FSVA 3UPRA 2D9CA 2GI0A 3EYSH 4MSWA 2ZXEB 3TJPA 3FOLA 3HUJA 3K8LA 4PJ8D 4F58L 1BX2B 1OTTC 3L9RB 5GGVY 2DH2A 2KL6A 3CHSA 4JKPL 3FCSA 1E30A 2ETWA 1CR9H 2NXYD 1YQVL 2WKLA 3O3UN 4YHML 4OJEH 1N0XL 4BFGA 2EE9A 4LCWE 2ZJSH 4LCCB 4U1MA 3PWPA 4N8CL 3WFEL 5GS1B 2YQ3A 1UYWH 1U8QB 3VWKD 5GRJL 3DO7B 4HWNA 2X3CA 1ZLEA 1LDPH 2BW4A 5IQ9A 5F6IB 1MCPL 5HYQB 4U3XA 4M7LT 1A64A 3REVA 4H5SB 4OQTL 4X0KA 1R0AH 4M9OA 1A7RL 3CZNA 3II2A 5DMIL 3KPSE 4JFED 3V5HA 1VZGA 1ZK5A 4ZSOA 5IBTL 2FQFA 3OG6B 2AXFA 3I50L 3L9YA 3MJ9H 4GXUM 2UZPA 2BWIA 3K6DA 1KIQB 2AK1L 5ANHA 1CB4A 4D0BA 2X6VA 2P7TA 4EI5B 1DL7H 3EDEA 1LILA 3HHRB 1HSBB 4PBDA 1VZIA 3P4MB 5DD6A 3RWFB 4NNPL 4K23H 1DUYB 2X28A 1WAAF 5IUCA 5IKCB 3AY2A 3WJMB 4QRQB 2XICA 4X6FA 2F54B 1J5OL 1YN7B 2B08A 4TUKH 2WLJA 1MW0A 1W2KT 1KPUB 4XPBL 2DD8H 4DOHE 2YD5A 2DB8A 1O5PA 1W91A 1YPZE 3HLAA 2BOCA 3U7AA 1WYJA 3BSZH 4U3SB 4XCNB 3KXFE 5SWSE 2V2XB 4X8GA 3H6JA 1MSPA 4A37A 2AK4B 1BXAA 4HK0A 1ZTMA 4PJCA 4G11A 4ALAC 5DK3A 3MV9D 3GKZA 3WS6C 5CEXB 3QEHA 5HJDA 3LS5H 5E9DD 2HT4D 3PL6B 3T0ED 3TNNA 3P73B 1HOCB 2FYYB 2XPGB 2CSPA 5I1KL 5IFJA 3HMXA 5F9OL 5F3HB 4PS4L 1S9WA 1YN6A 4Z18A 1QKZH 2X6BA 2XCMC 4PIBA 1CXEA 4NRZB 3V6FB 3EGXB 4NQTA 3WFBL 1CXHA 4PJAE 1WHPA 1KOAA 1E90A 3I6LE 4GRMA 4BFNA 2OAAA 3OR7A 4X6DB 1BFVH 1UT9A 3IDUA 1DJIA 2AW2A 3FQWB 2GYSA 2X89D 3TTYA 3HE7C 3QRBA 2P80A 5A2LH 3CZEA 1QP1A 1UD6A 4ZTEA 1SDYA 4YR6B 3MNVA 5FCUL 4N5UA 4A2GA 2GUYA 4NN7B 1I1AB 2WIMA 3H8NA 4NX0A 2J57A 1RULH 1XF5B 1XL6A 1FYTD 1IFHH 3QYNA 4HUWB 1B4RA 2EXSA 3IDGB 3VGDA 2DQDL 1W72A 4C83A 2I9TA 2FB4L 1G7MA 4N3TA 1QSED 4PV8A 5F97E 3QP3A 3U4AA 3ABLB 4YZWA 3CFJB 5EB9A 3EJRA 4KX8A 4N86A 3Q8AA 3MROA 2GJ6D 1WAPA 1OM3L 3QJFB 4C56A 4XO5A 3PAVA 3COOA 4UNUA 2F53B 4N0YL 1WBZB 5CJ5A 4KO5A 2ODIA 5I8EB 2XN9E 1B3JA 3C6EA 4GKSA 1BVNP 1UZ6F 2QSQA 4QXTB 2DYSB 2HT3C 2MQGA 4JPIB 4LVOC 1M1XB 2M1KA 2X0VA 3OGCA 3GPSA 4ONGL 5F7YC 2VLKA 4FQCH 3QWOB 5F3BA 1CBVH 2JXMA 2AKRB 4P04A 4NUJA 4XMPL 3W39B 5ITFA 1HH6B 1PLGH 1SDDA 5K1VA 5E08H 3ULVL 1UB5A 2X0UA 2XVLA 5D1ZA 2X4OB 4UV4H 1QEXA 4Z0BH 3IDIA 2ZKMX 3MRRA 1GAFH 4KHXL 3TEXA 4AY0A 4J39A 1ACXA 1RUKH 2B20A 5JHLA 3QWNA 5I6MA 1YEFH 4MMZA 2J44A 1PAZA 1T3FA 5ICXB 3EJCA 5I8OL 3ECBA 4QI3A 1I7ZB 2CBMA 3V7AG 3GI8L 3R1GH 5T1MB 4JY4B 4WU7A 1QLEH 1W80A 1N5YL 4PAZA 4FG4A 5E4AA 1NC2B 2BDNL 2E6JA 1W0WB 5IESL 1QHQA 5DSCA 4LLDA 5D5ME 1U8KA 3OAZH 3P3SA 2J25A 1FJ1A 5ENWA 4NNXA 2FR4B 1XCTA 3K2IA 4Z7OB 4KVCL 1L6ZA 1H3TA 5SX4I 5IF0A 3IF1A 2EIJB 3O3EA 4PBWD 4KK5C 1BYOA 3EFOA 5IB1A 2FBRA 1MELA 3KLAA 4CNIB 3EOBA 1SQ2N 4AQ8A 3IAGC 5T3XH 43C9A 2EH7H 1S7TB 5KAQF 3MRBA 1RHFA 4IOIB 3FB7A 4OF7A 4XXCA 1CD9B 4NXKA 4JLRB 3NJFA 5E0QA 4OFYD 4AEHL 2QKIA 3ZUNC 1NCWL 1NLDH 4F7MB 1EJOL 5HYJE 1QSZA 3MDJA 4ODHL 4UQCA 3GTTA 1ZE3H 4YEEA 2ZX5A 4MQXD 5DJAB 3MXVL 1OWRM 5I76B 4TNWK 1U8HA 4ZQKA 2OYLA 5C97A 1OEZW 3PPSA 1YAIA 4DVRL 3IBOA 4IM8A 4ZFOA 2VZTA 3BO8B 3GB7A 3RIAF 3U36B 4UZSA 2V3DA 3BWZA 2VDQB 3WJLA 3IGFA 5D70L 3C8HA 3VD2A 3VRLF 1T66D 1J5CA 4RA0C 1GZPB 3JUYA 3HAEG 4M4RA 3S88L 1BBJA 1UACL 2ZSVA 1HK6A 3CFEB 3C5SB 3FQTA 2ITCB 4JFPB 1Z32X 5G5DA 3LZFL 4GAGH 3ZKMD 1NCOA 2WBWB 3MLWL 3FRUB 3NFNA 3HNTH 1DQMH 4D7BA 5CCJA 2DJ4A 5DUBB 2FT6A 4LE8A 5IB5B 4FDWA 5B1JA 4RAUA 4LK4A 4RMTA 4HCRH 1W72H 4ODSH 2KS0A 1H15A 3S8FB 3O41B 4NN6B 3KL5A 3PG2A 4UTAH 4XN5A 4YSPA 3SGJA 1RK0B 4UOJA 4EN3C 4AG4H 3GBNH 2IG2H 3EFDH 3NUKA 1Y0LA 3CMOH 3M6DA 2E7LC 5LG1A 1NKOA 1A6AB 1UCTA 1TVHB 5DURB 1X7QA 1NGPH 1KGCE 3GRGA 5PAZA 3VRJB 1NGYB 3FCUB 3TZVA 4L1LA 2R4RH 3PP4H 3RZCA 1MUJB 4I18A 3SY6A 3A67H 2QGBA 4GEIA 5CCKH 1XB6A 1OAXH 3DTXB 3HG1D 5AVRB 3QJOA 4M6OL 1T22A 3V0EA 1FBIH 2GSGA 1I9EA 4MJHA 1Y6MR 1T80A 5DJZA 3NABL 5F89B 4HOMA 1NBCA 5FHBH 3HFFA 3IU3A 3T6ZA 1P69B 2ZOWA 1QOKA 1PZ5B 1EHLH 4G7VL 4KVNL 1XMEB 3LRSB 3ARFA 2GEQA 3L1GA 3LQAC 3QFGA 3FUMA 2O5XL 5J11C 2DDQH 1OB1B 3QJZA 3S5LG 1LWRA 4HXBL 4JO2H 4G59C 2DQCH 1O6SB 3MJ7B 4LLUB 5L4MA 3C5ZA 4IBVA 3STLA 3N40F 5IW3A 4GUOA 4RGOL 1IEBA 4OLXL 4P5MA 4HCIA 4TSCL 1T2QH 4FFYL 4UWQB 5AFAA 2B4CC 5ECGA 3TL5A 2QZ5A 1A5FL 4Y9CA 4FN0A 1I7UB 3QUZD 3CPLB 1AQHA 1FFPB 4F33A 1CBJA 2YAEA 2HVKB 3SYPA 3EBHA 2JB5H 4NNYB 2YD3A 3TYGL 1G9HA 1CDCA 3U6XS 3UZEA 3HPLB 2CO7A 4K9EL 3HE6D 4P5TB 3K2KA 4J4PA 3TCLA 1AXSA 1BM3L 3SDAD 5JYMA 5EEWA 3ESOA 4F57H 5C7ZA 5KYYA 1QNIA 1DQTA 5A6LA 1EHKB 1EUTA 1G6RH 4XPHL 1F4YL 4XVOA 5JIKA 4D3CL 4LHJB 3G6AB 1G9ML 5DZAA 3QEUB 5AOLA 2WXKA 1F2QA 4NSKB 3BP5A 4PVBA 1FCCA 4J3TA 3KWUA 1ONQB 2AJYL 1F4HA 1TMQA 1NGQL 1OCOB 2D73A 2IPTL 3ECQA 4J3OH 3U0TB 4JM2F 5CEYB 2J1YA 1NJ9A 2H5UA 1ZV9A 4HIQA 2J72A 5GZOC 4FJYA 3NCEB 5JHBA 1XBRA 2XI9A 3AUWB 3NVQA 3NIGB 3QUYC 4HF5L 3QK0A 3SKUD 1PY0A 1KCUH 4TTGA 3GIZH 3H7LA 4HS6B 2YK1L 3HBPA 4B9ZA 4LSPH 4ZMQA 4MQTB 1SEQL 3WEAA 4PJDA 3V6ZA 3OB0H 1HXMA 3MRQB 3VYOA 2J1KA 4AMKH 2DJSA 4L05A 2ZYRA 4M5TA 1VFBB 1WAEA 4NO3A 2I5YH 2P5EA 4FKEA 5AALA 1YEEL 1D6VH 1XF2A 3BLBA 2Z93B 4CGTA 2XU9A 3CBKB 1LK2A 3WTUA 1OAYL 5EOCL 3ZT7A 1ASQA 4OJYA 1IKFL 3QUHA 4L4TD 5IEKB 3ARPA 4PGEA 2OX5B 2XTJE 3PP3H 4GKZA 1P5UB 4KDTA 1O9ZA 1E9QB 35C8H 4OCNC 4LLAA 2EXYD 3OAWA 2VZUA 4HUMB 2BFVH 1WITA 1UWGH 5KTEH 3JUZA 2SEBB 5I0YA 4J3OF 1IC5H 4O9HL 2JNZA 3GPEA 5FGRA 2E7MA 3X13B 3MLUH 4KH2A 1AQMA 1COBA 1J10A 3VH8B 2P5WE 1JZIA 3P4NA 3S96A 1RCYA 2FO8A 4YIQA 3W9DA 2E7BA 2C1PA 5D2LE 2OZ4H 2Q76A 1WCQA 3ILQC 4Y2NA 4HFUH 4PRPE 1J11A 4M1CD 4MAYD 2E6PA 2C4XA 4KOCA 3HVNA 4ZXBC 2HTKC 4NM8L 2YD2A 5SWZD 1M71A 1T4KA 3NFPA 4TUOA 5T1KD 4HWBA 3PGCA 3IU4H 3CK0L 3RVXC 3RA7L 3TFBA 2VQ1B 4JRXE 2YUZA 3LZOA 3L4TA 1PLAA 3B5TA 5GGSA 1WWWX 4TVPL 3EAKA 2BVQB 5DJ2A 5BO1L 3NH7H 3CWGA 2OXGA 3GMPA 3I02B 3O6FD 3QH3A 3K71B 5EWIH 3HZYA 1XSKA 2NXZD 2VQUA 2VM4A 1IGYA 2WUBL 4ZS6D 3A5VA 2A9CA 3ARGA 2HSIA 2GK2A 1HS6A 3BWAA 1LD9A 4JKLA 4OFDA 3UTQA 2VMJA 3AT9A 5EDXA 4NN5C 3WYRA 2WLYA 1SMAA 2YSSA 3EW3B 3CLEH 2BHYA 4IEFA 4K5MA 1TQCB 5IHZA 2G5BB 4M56A 2FD6L 2RAMA 2EIZA 3VGHA 2DKMA 1OD9A 1ZT4B 1KIRA 3SYAA 3TA3D 5M95B 2ESVA 3DROB 4N25A 4QTFA 4BZ1L 3B9AA 4LP5A 4KJPD 2Z65C 4G72B 3NGBC 4LSSH 4P59H 4F5CA 1ZSDA 4IJTA 2KC0A 4PRDA 2ADJB 4ISVA 3HIZA 5I6NA 4ZW3A 1HT6A 4HULB 4YHNA 2OMVA 1IBZA 3ZHFA 3P54A 3P11L 5JORA 2GIMA 3EO1A 4R97B 2LFGA 1MEXL 4Y4KD 1MLBB 3MRIB 3VXMA 5F7MC 2EO1A 4NM4L 3RWIB 4TQEL 1G7IA 2L7EA 3SOBL 4KJYB 4YL9A 4OZGA 1MHPH 1KBPA 3N85H 2LAAA 2WXJA 1NCUA 3LKSB 4WHDA 3MBEC 5IB3A 1CTMA 2BIPA 5IGXH 3MJ6A 2O72A 1TCRA 5F9WC 4N28A 5GSRA 3BDYL 3W0WA 3BEWA 2OMTA 4OAWA 4ZMZA 1VDGA 3RGVD 1R19A 4M7ZC 1IM3D 2FE0A 2J8UE 3FT4A 3SO5A 5CZRA 4J1UB 4H0GA 1MFBL 2LU3A 1GXEA 1XH2A 1AIFA 3AS2A 3KGRA 2WLLA 3LEXB 1FV1A 3MRCA 3ME0B 1GOHA