3GD1C

Structure of an arrestin/clathrin complex reveals a novel clathrin binding domain that modulates receptor trafficking
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
391
structure length
345
Chain Sequence
b'DKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCAFRYGRLTFRKDLFVANVQSFPPAKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRASSDVAVELPFTLMHPKPDDIVFEDFAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-arrestin-1
publication title Structure of an arrestin2-clathrin complex reveals a novel clathrin binding domain that modulates receptor trafficking
pubmed doi rcsb
source organism Bos taurus
molecule tags Endocytosis
total genus 66
structure length 345
sequence length 391
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00339 Arrestin_N Arrestin (or S-antigen), N-terminal domain
C PF02752 Arrestin_C Arrestin (or S-antigen), C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.640 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3gd1C02
2.60.40.840 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3gd1C01
1ZSHA 4R7VA 4P2AA 2WTRB 2R51A 2WTRA 1G4RA 4GEJA 2FAUA 5F0JB 5F0PB 4GFXA 1G4MA 4R7XA 3LH9A 5F0MB 1JSYA 3UGXA 3GC3A 4JQIA 3LHAA 4J2QA 3P2DA 1CF1A 4LL4A 3UGUA 1AYRA 3LH8A 4GEIA 5F0LB 3GD1C 4LL1A 1SUJA 4ZRGA
chains in the Genus database with same CATH superfamily
2Y1AA 3OHMB 3RTQD 4AZUA 3P30H 5DMGC 1S7QB 2E9BA 4QHNB 3REVA 1IC1A 4NUJA 2QVIA 4YPJA 1ZY9A 3AADB 1AANA 2PPDA 3VYPA 1C16B 2AZUA 1UJ3C 2KUTA 2KL6A 4OZFH 4WTXA 1T4WA 3UXFA 1PNDA 1X9LA 3P0VL 1KCRL 1FNAA 3WL9B 4G8FB 5F7LB 2CD0A 1LK3H 4F7TA 1MUJB 4DGVH 4F37K 2B4CL 2WWNA 2YUZA 4GS7B 4I18C 5H37G 4RAUB 4TLKA 2QVFB 5EB9A 1A6TA 1AIFB 1HXMA 3AREA 4X6CB 5AVYB 3VSVA 2X4PB 3LNGA 4TRPH 3ZLQC 2WB7A 1E4XH 1P4LB 4NPYB 1LEKA 3MRCB 3O6KH 5D7SH 4FFWD 1IAKB 1W8EA 2ADFH 2F54E 4FMVA 1UQSB 2BRRL 3G6DH 3ZTEA 1R34A 3ILDA 4QXVA 4GKZA 3V0HA 4CU7A 4YHLL 3RPIA 2DQGH 4XC1H 2GUYA 4X99A 5DC0A 5KANI 5DJAB 1XB6A 4B9FA 2VQ1A 4CSTA 3BO8A 4YXHH 3CWGA 4N2BA 1HESA 1YRKA 2X7LB 1UZ6E 3I9GH 3QNFA 2ADIA 3O3DA 2HLEB 4LEOA 5IB5A 2FT7A 3D4YA 4M5ZL 4NRZA 3FUJA 4DGUA 4YH6A 4UBDD 1M7DB 1R3JB 4IBUA 1F4YH 1ZAGA 1JS4A 3JZ7A 2HWZH 4IGBD 4FA7B 3LPOA 2WIIA 4QXWA 4UDTB 1AHWA 3DUSA 2ADGA 2H0PA 4L37B 5DVOA 1HEZB 4KK9D 3QWQB 1T1ZA 2XXGA 3VU1A 6PAZA 5EU4A 4Z7UB 5IVXB 1TLKA 2WXJA 4M1GH 4AQ8C 3KGSA 4WKZA 5DVPA 2EDEA 5J6GA 4OM0L 2R2HA 5AW8B 4WUUD 4EPSA 3N5AA 1QKZL 2V9RA 2ZX5A 3F58L 3GJFB 3P0YL 4OTXH 1H9DA 5ISZD 4LE8A 4JVUA 5DT1L 5ECJE 4HIEA 3ORJA 1KJ3L 5AZEL 3HMXH 5J9PB 5DEGA 3IGAB 1KIPB 1DBJL 3UEZA 2VDKL 2RB8A 2DYSB 2FCBA 3JV5A 4GAGL 4HZAA 2J8UA 5J12B 4EKJA 5IROC 5A6IA 5KS9E 3UAJA 2DYPD 4Q56A 2RCSH 3FQTB 3MFFB 1NCAL 4EEEA 1OANA 2E6QA 3LKQB 5IREA 1A8JH 2GAZB 1F8TH 1H6EA 3GD1C 4UT7L 3UP1A 4AXWA 2N7SA 5GGVY 4EVNB 3GHBL 1ZHBA 3X12A 3RA7H 4PVBA 3LEYH 1ZCRA 2DQIH 1GR7A 3ARBC 4Q9QL 2K3TA 1JXKA 3FFCE 5TFSH 2E7HA 3D85A 3MOBL 3KBEA 4HIHB 7TAAA 1MH5A 4BKSC 2E27L 1A6ZA 3NIGB 5F89B 3SCMB 1BJ8A 4EIBA 2YKKA 4QXGH 4YFEA 5E56A 3AXIA 5MEQA 1UZ8B 3CK0H 4JFVA 2QGDA 4KJQC 4Z7QF 3WU1A 2VLRB 3RWCB 4FQHA 1WIUA 5SWZE 1BJMA 4OGYL 5DFTA 5GXBB 1E67A 3KGUA 1UWYA 4Q9RL 1KEGH 35C8H 4L9LA 4GSQA 3SGDH 2NY1B 3RX5A 1TETH 3NP3A 4HEPA 4TLTA 3A6CH 1XCQB 2GK2A 4DKAA 5KN5B 3W81A 4GUCA 1CCZA 2K8MA 4JZOA 4NQVB 3Q8EA 3GI9L 2HAZA 4X4XA 3FQYA 5K69A 2HA1A 2UVEA 5AKSA 4WGVB 3N0PB 4FG4A 4DESA 4KRNA 4L0ZA 1A4KA 4UI2A 4KROC 4KTYA 2HTLD 2NYYD 3DX7A 4LCWB 3HI5H 2EUVA 2JB6B 5KW9L 2I24N 3D4CA 4XPGL 1TCRA 1J9RA 3OMAB 6PCYA 5DHXB 2X05A 1E8WA 2B2XH 1PL3A 4JFDE 1HAUA 3HZKB 3PHAA 3ARDB 5MEPA 3IDUA 4D0CA 5T1JA 1HKLH 3VH8G 5JOPD 3KJ6L 5DVNA 1JZ8A 4LO9A 4N1HB 4I2XB 2EYTA 4IQHA 1H8OA 3ZQ9A 5LXGH 1MLCB 3CX5K 3S9DB 5IP4A 3BGMA 3BUBA 3POCA 4N8PA 4P23B 1AKPA 3ZYOA 5CWSB 4A2LA 5C7XL 3GC3A 4OR1A 4IBWA 1EH9A 2A77L 3QDGA 4HPOH 3PXJA 2WBWB 1YHPA 4D0BA 3MLXH 3MGTB 1MAKA 1UB5A 4X5XB 2VISB 3CFIC 4P3WA 3QORC 1QO3B 4XVTH 5IVZB 1Y1UA 3KM2A 2NYKA 1MFDH 2MRYA 1LK2B 3HB3D 4JJ5A 5GJTH 3MRKB 5IOKA 2J3SA 1RZJC 2AQNA 2O5XL 1BIIA 2IFFH 2FLMA 3Q2VA 3RHWK 1VADB 2APWA 2QPSA 3FQNA 4NGHH 3ARGB 4Y4FC 3P4NA 3V6BR 3Q06A 2CJTA 1L0YA 2ZTBA 3QQ4A 2VDML 4KKBD 5CKGA 5LNEA 4EAEA 1JI2A 2QKIA 3C75A 5BZZA 3NGBC 1AGBA 5JHBA 5T1DH 3GLZA 3LZOA 1OCZB 2Y3NA 3JWDC 3U0PB 3O4LB 5EUOB 4OLVH 1ETJA 1GZHA 1E40A 1EFXB 4QRPD 4XZUB 1UVQA 3MCG1 1E4JA 4Z5RA 3WIAA 2ZPKL 5AL0A 1W0VB 3O3AA 1OGAD 3SE6A 3ULSB 4U33A 1N0LA 2PUQT 5AB1A 4BIKA 5IJKC 4HKXA 4G6KL 5GGTH 5IBUG 4XN5A 5FYKH 4LIQL 3SGJA 1CVSC 5BZXA 3GWJA 1TJIL 2OR7A 3WFBH 5CGYD 3HG1D 5HYSG 4L4VE 1OY3B 3IXTB 3LPWA 1JTTA 1QI3A 5C6TL 1KC5H 3FH8A 4UCFA 4UTAL 1NCCL 1DSYA 2Q2EB 5I6OA 3IPBA 1EAPB 4CNIA 1A1OB 2GJ6D 3LSOA 4PQXA 2XVGA 2QQLH 2OMUB 4PRNA 1OOAA 3CZGA 5ESVA 3RJDA 3IJHB 3BKCL 3G5WA 3IFNL 1FL6A 2WWKO 1JWSA 2APXA 3RAJL 1U3YA 2OTUA 1ROWA 1M7IB 4LLMA 4JGMA 3MJGX 1S7UA 4H5SB 2FL5A 1KGCD 1OSZB 1PG7X 2P8PA 1JDDA 4X5WB 3OAYH 4DP0X 4NHCL 1J9CT 4IKNA 3SYOA 32C2A 1UGKA 1VRSA 2UX6A 2Y1YA 2BP8A 3P4MA 1LD9A 1IQDA 1OOWA 3AG4B 3TV8A 4JPKL 1IAIH 5FKPA 2PW2B 5IR1B 1SBBA 4JCWA 3KXFA 3MNVA 4EMZA 3KL5A 4L1LA 3WJJA 1QHPA 3I3EA 1DFBH 2AJZB 1KGUA 1HH6B 1CE1L 3EGSA 4OCWH 4TS6A 1BQRA 1ZV9A 3EZJB 5DJYB 3PHSA 3G3LA 3UTTD 2NZIA 4X7TB 1U33A 3D9AL 2YPLE 4FRWA 5IQ9B 1DO6A 1KPRB 1G0DA 4GXVL 4MJ6A 4YHKH 4PJDB 4GY4A 2QL1A 2AQQA 5GGVL 1RUPL 4YXLH 3VYOA 2FR4B 4G70B 2EEDA 3U9PH 3FUMA 2F74B 2X4QB 1L3NA 2WTRA 3KS0J 1R3HB 1UH2A 4WIQA 3OAUH 2EKSB 2ZXDA 4Y2DA 1ZIAA 3TJEH 2X3BA 4JKLA 1L0QA 4Y9EA 5KSAD 4EIUA 3FMGL 1O5PA 1VB9A 3NN8A 5EMYA 2AS5M 3MAWA 1W80A 1CLOH 4JRXE 4PUBH 4L9DA 1XH1A 4M43L 1EEZB 4LSRH 4EO5A 3UBFA 3WIHH 1FL5B 5TE6H 3JUZA 3O3BA 3QFGA 1D6VH 5D8JH 3O9WB 5ICYB 3B1UA 2X1PA 4G9FD 2K1MA 2OFQA 4HLJA 3KLLA 4IKIA 1BD2D 1HI6B 4J12A 1WH0A 3GM0A 2B5IB 1ASPA 3STLA 1VAHA 1PIFA 4JGJA 2JMRA 2QPEB 3U4KA 4TVPH 2WYHA 4PCTA 4YLBA 3QEHB 1F90H 5T33H 5BS0B 2OMTB 4PJ7F 3VXSA 5HGHA 2YPVH 2FX7H 3V0AC 5DZJA 4WU7B 2WK2A 4NKDB 3BIAX 4FNQA 4ONOA 2R59A 4Z77B 4ZOCA 3DV6A 2IPKB 2AQPA 2AKRB 5BV7L 3SE3C 3VDAA 2BMKA 5CINH 2FJHA 1IB5A 1CXHA 3NAAL 3GI8H 5LHDA 3WELA 1EFQA 1Z1WA 4NQCD 4WFGD 4YQXH 3G9AB 4KZ0A 1KCWA 4FEIA 2E7DA 3Q6GL 5H35B 4MAYA 1O9ZA 1G7LA 3IJEA 5EBGA 3GTNA 3M07A 4E5XA 2NLJA 3SODB 4PB0H 1FJ1B 4R26L 3AT0A 2JJSC 4TTDD 3ARTA 2AEWA 3PHOA 4M48H 4X6DF 2HFGL 1D5BA 4ZUWB 4C4UA 4WJG3 1C5CH 2J8OA 5M7QA 5EOTB 4HLZH 1JCKA 3CC5B 5FYKD 1MHHA 1IM9A 1HCZA 2NXYD 4R4BA 4ENED 5JQ6L 1ZVNA 3M1BA 3C6SA 4HD9A 1IC4H 2QR0B 2DBJA 4HH8A 2JLLA 3SDXB 1T03H 2XY1A 3T3PE 4JPVH 4PJGB 1USZA 4K5PA 4QOKD 4OZIA 3NJLA 4LSPL 3LIUA 4FHBD 2XFGB 1EUTA 1MEXL 1OAYH 4GI8A 2I7OA 2X1OA 4PWJA 1AGDB 3ZZQA 5LVEA 4XMWA 3JTSA 4JCLA 1CFSA 1BVNP 4IOSD 4FYSA 5FW6A 1M6UA 2RJMA 3KPRD 4M6NH 5FO8A 4IMLB 5AB2A 2X88A 4N25A 4L3EB 3QUXB 3U6XA 2R1XB 1AKJA 3K2IA 1ODAA 2IH3B 3AS1A 4AVHA 3QIUA 3O41B 4MA3B 2UZIH 1UXSB 3K81A 3BPNB 1SYSA 3TZVB 1S9VB 4YSPA 4GUPA 4UB0H 2XQYG 3BN3B 4PEEA 3FT4A 5I15H 2GTWB 3CHPA 5CSBA 2WN3A 4G6JH 2D0GA 4JBSA 1HIMH 2DM4A 1X44A 3IFOB 4K73A 1CFQA 2Z7ZA 3ECBB 3U36B 3GJEB 5B3JE 3ZJAA 4Y9CA 3FN3A 4FTVB 4PWFA 3U2IA 1IKFH 1CC3A 4LKCB 3NFSH 1U0QA 4AE0A 1K5NA 4ZS6C 1PX3A 2XJKA 4LDEB 3U9UB 5BOPA 4KI5D 5LAPA 3GUTA 5FYJH 1D9KA 1PCSA 5HI5C 4L8CA 4P2RD 1KDJA 5HYJB 5I74B 1Q9KB 3DGGA 3L3GA 4QRBA 1BQ5A 4UM9D 3QZMA 3DK2A 4G43A 4BFEA 1RZKC 1TZHB 3MRGA 4P46D 1K6QL 3S34H 3AS3A 3WTWA 4F2MB 5E2WL 1P4UA 3QW9A 2WLZA 1UT2A 3VI4E 3UP6A 3BKYH 4N2CA 1CLVA 2XIIA 3GRBA 4PGCB 5CU5A 3WE6B 4XPHH 2WBKA 3KYMB 5I9QC 5JNYA 4ZXBD 4DGWC 1FFTB 4NZRH 1N5YL 1XH3A 1DO5A 1F58H 1XF5A 5DA0B 5IHUH 4AJVA 1Q0XL 5C0JB 1EHAA 4HMDA 3EJTA 1D5MA 5CUSL 3VA2C 3ZKQD 5IFAH 1GJWA 3TYGH 1AZCA 2OMWB 3HC3H 4DKEL 1N9PA 5DUBB 4AG4H 3C8HA 2V0AA 1K9TA 2N01B 3CCHA 3ULUL 3O11B 4JZJC 4KJYB 3DOIA 4CKQA 3MROB 4M7LL 3UJTH 5K5YA 3AW5A 5D2LE 3QZWB 5CEZD 2A83B 3QXDA 4BUQA 1BVKA 1M71A 1NIFA 1SUHA 3ISRA 1JNJA 1U8HA 1A3ZA 5I1EL 5CZKA 4X7FC 5IEKA 2WZ6A 4M03A 4Z7VB 1E5UI 1LDPH 2BNQA 3EYQD 4BWUA 4HG4K 1PDKB 4P5MA 1IEHA 3LEXA 4ZD3L 1G9NL 4HKJB 1EO7A 4O9HH 3KPPA 3C5ZB 4CKVX 4ZOAA 5TGBB 4YNYA 5CJOH 4GO6B 1YY8A 2ENSA 5C07B 3K4DA 1B4TA 3UYPB 4M62L 5IWLC 1ZRUA 3GLAA 4PTUB 2AEIT 4XMUA 1FVDA 3OKYA 3GZOA 5B38B 3GXNA 3PQYA 2CJSA 3PIQA 5SWZA 2VABB 1R1CA 3BGAA 1BGXH 3RB7A 4RDQF 5I8KL 2AQTA 2N0MA 3V10A 2HVJB 5F8QC 3MLYL 3SPVA 3ZIMA 3QVAA 5DZNA 1G9ML 2EILB 3CZEA 4GPVA 5JOFB 2OW6A 4AYBA 1AQMA 4JFSA 1HL9A 3APFA 2R8SL 2GG1A 4XI5C 2EO1A 3FT2B 2PO6A 3DRQA 1J5IA 5KYYA 1N4XL 3N9GH 1CO1A 1B6DA 4U1GB 1QLRB 2EDNA 3V7MA 1J1XL 3HHRB 3O8XB 4IKKA 3CX5J 5FK9A 1DUZB 2Y7QA 5EIIB 4OV5B 2VLKE 3EYVB 1SHXA 1B90A 1M57B 3FQ4A 3WO3B 4R7NB 4BZ1L 1N8ZA 3EH2A 4N0FA 2GC7C 4HUWA 1H3GA 3TFKC 1KB3A 4PWHA 2PXYD 2ROXA 3RI5F 3K6SA 2KDYA 2AJXH 3L54A 1DBBL 2PNDA 1H3TA 1DBKL 5T3XD 3VNZA 4F58H 3P9LB 4IBTA 4XWGL 5HDQH 2B4CC 2JK5B 1YPZE 3MCLL 4C55A 3QRGL 3CHXA 1Y7VA 4JB9L 3BT2H 4KX9A 4PJFB 4UNUA 1E6OL 4W1TA 3RUGB 2ZWNA 1NL0H 4PP2A 3GSNA 1M2OA 2ZWYA 4R8WL 3ZE1F 1Q4NX 2A99A 3CZKA 4J4PC 2FSEB 4U1NB 1DLHA 4Y19E 5LN4A 3GK8H 1DQLH 3K72A 4M1DL 4UINH 4DPAX 2WZPA 3V95A 4BZ1A 4JO1H 5DTFA 3SKNB 5D4JA 1IBYA 1AMXA 2H4EA 1TFHA 1UWXH 1VGKB 2IDQA 4G5ZH 3EOTH 4DO6A 2EUZA 1VFBA 2D3VA 1UASA 2YXFA 1MJJA 3P40A 4G2AA 2R0WH 2R1WB 1DANT 1XTLA 4R90H 3JYBA 4WI3A 5EOCH 2IWEA 4FMFA 4XCNB 5B3NA 5I6MA 2OCCB 1I1YA 5DR5H 1H3PH 5AKRA 4F91B 3QC5X 5J13C 2H47C 2DBLH 4BV1A 1K4CB 2Y1ZA 2UWEF 4WI9A 1BM3H 3MNWB 4DVRH 1UA6H 2IAMB 2AABL 1ZV5A 4AV5A 3GMNB 2EDQA 3N41F 4UAHA 3PFQA 3O45B 4LHQB 1QVOA 4JJHA 1OQOA 3D51A 4HS6B 3VDBA 2YN5A 4K8RL 3MRRA 3TO4C 3OVUB 4A2EA 1MG3C 4F3FA 3IMBA 3RZWA 3JVGC 4N8CH 3QIBA 4J7RA 2PR9A 4HIXH 5JMRA 4AEIH 4O4YH 4FFYL 4MNGB 2K3HA 3DJTA 2NW2A 4L4VA 2MPAL 1JF6A 3D3VA 4QRAA 4K71B 5ANME 3ZBMA 4KFMA 3SCMD 1O6VA 2R0KH 1S7RA 5C0AE 3CFDB 2IOIA 3CXHJ 3TESA 4YC2C 2PABA 1XR9B 1EEUA 2DEYX 2VLRD 3LKNB 3QEQE 3B7RL 5FO9A 1OP5H 3WNKA 3RVVD 1AP2A 1U30A 4PJXF 2ZUVA 2NY1D 3D08A 3EHBC 3G5YA 2EDFA 1I8KB 3QG6A 3Q8BA 1U41A 2YUWA 3WO4C 1SUJA 3SGKA 4XP1L 1AS8A 1T0NA 2LAGB 1E43A 1ZHNA 4N87A 2EO9A 3CZFB 1NC2B 4OI7A 4J1UB 4DKFL 4L3FA 5E1IA 5L4IA 4D9RE 3MLRH 4FFYA 1JHTA 3BVVA 3WENA 2BSEA 3JUYA 2H3NA 1TZIB 1DZBA 2W65A 2C9UA 5LWYH 5GRJL 2Y5TB 4WY7L 2VQUA 1E28B 4ZPTB 1T83A 1GGIH 1WQVT 5EEVA 3B2PA 5A3ID 3P9MB 4GLRI 4U6YA 4E5XG 5J6SA 3ZOAA 1GGBL 1E50A 3ARDD 5L9DH 2OTWB 5HHOE 1P2CB 2XWTA 3NZSA 1MCEA 4ES8A 1J10A 2HRPH 4G6MH 1T0MB 2BSTA 3BP4B 5EZLB 1FUNA 3SPCA 4Z3JA 5EZOL 1FI8C 4P23D 5CLYA 2OPCA 1MWOA 1OTTD 5I75B 2FEEL 3WNLA 1NDGB 1VKXA 5AW7B 3NFPA 5K9OA 3KPNB 4RRPA 5HHNA 1YQVH 5J3HC 4J6RH 3VQ1C 3I85A 4YBQD 5FKAA 4OZHA 1F4WL 3ATAA 4XCFH 5DWUH 4P2QA 5KSUA 3BDYH 3VMPA 2YEZA 4XOBA 1CK0H 1J86A 3ARGD 3D5OF 3MDJA 4XODA 3I3BA 3W2DL 3VD4A 1I7TB 2APBA 3OF6D 4MX7A 4LPYA 4NO3B 1TNNA 3QUHA 4JRFA 2ZZUT 3WUWG 1E42A 5AW0B 4PJ5B 4X4MA 3TM6A 3O4LD 1NMBL 4QRRE 3WJLA 5KVEL 1D5IH 1YYCA 4GAYB 1F4XL 3RWDB 2FIRT 4JHZA 4F27A 2F5AL 3CU7A 1GHFH 3QE5A 1EFXD 1A1MA 3ABLB 3MBWB 4MAUL 3TCLB 3KL0A 3ZKXC 4U3XA 4XMLL 3CH1B 3MJ9H 3U2SA 1JD7A 4HSAC 1CF8L 3QI9C 4M6OH 1LO4L 2HN7B 3D1MC 1DVYA 4FQXA 4M9PA 5M94B 2YBRA 1MIEL 3CDFA 1FGNL 1LO3H 3FFDA 4HALA 5CEXA 1MI5A 3FQRA 3QWRD 2B7DT 3MLZL 2ODHA 4F9PC 3RNQB 4YHNB 3BISA 4H4NA 4EXKA 3KPOB 5F7BA 3FF8A 1CF1A 4YDVA 3ZTDC 1AYRA 2QVMA 1C8QA 3CHQA 4WWOA 2IPUG 2X41A 3OKOB 2PYEE 3VXOB 3CSFA 1CICC 4XWOD 5EOQH 1UA3A 2AXJA 4MMXA 2HJLB 3DSFL 5C6WH 1TR7A 5B21A 3FO0L 5F0MB 3D25B 1TQCB 1SLVA 1J5DA 3N44F 1P84K 1KCVH 2WSDA 3ARFB 1INEH 1OLZA 1DQDH 3L7EA 3T4YB 4XO8A 1E8ZA 2IXQB 4AL8L 2WXFA 3OXRB 1T66D 4Q74A 3Q2WA 1A4AA 2BSSA 3IDMA 4YDIH 3BJ91 1KDIA 5AVUB 2V9TA 4TQEH 2HKHH 1QA9A 4R4FL 2O26U 1A4JA 1FGVL 4PJCE 2HJFA 1AQHA 1QR1B 1NBQA 3BCDA 1CDIA 5GS1A 3MRNB 4PRIA 2ZG3A 3V4PL 4ELKB 5IUSA 2CWRA 4WHYH 1BXVA 4NKMB 4AMKL 2O6EA 1HNGA 4QTIH 4PFEA 1NANH 3ZYJA 3RZCC 3LKSA 3D39B 3TCXA 3CVHH 3O6LH 3S4SB 4WWKA 1TKWB 4U3CA 1RIUH 1S3KL 1T2QL 5PCYA 5EU3A 2Q2LA 2MOVA 4X98A 5J8OA 1XGTA 4UT6A 3HPLB 5I1HH 3QXWA 3VMNA 1BHGA 4JRYE 1P0SE 3LKOB 5JW3H 4ZI8A 1IVLA 1J18A 1XGPB 2I9LB 3SY0B 2XTJB 3V4PA 3P30L 2PWDA 3BEWA 3O9WD 1MCLA 4FFVC 4LSQH 3V6FA 3DX2A 3AU0A 4I3RH 3UTPD 4B9KC 2EACA 4K9JA 3QCTH 5KZCB 3BW9B 1NUFA 1T0PB 4ODUA 2A4ZA 1X5XA 4KZEL 3QQ9C 2D7MA 3PE9A 3SE4C 4DP7X 5BS0D 4GRWB 1B3JA 2CCWA 1LK3L 3TXAA 4LGSB 4DGVL 1PLCA 5A2LH 1S9XB 3ARPA 2FEDC 5DD6A 1B0WA 2V3EA 4N4YB 4S1SH 4W81A 1TTUA 3LNHA 3T77B 4ZMXA 4TRPL 2OP4H 3L3JB 5C0BA 4E9TA 5B3SB 5I71C 1E4XL 1YJDH 5ID0A 1NGXB 3O6KL 1QLFA 5D7SL 3ESMA 3GMPA 4YL4A 2ADFL 4B6ZA 3G6DL 4PJ9C 3H2WA 3K1DA 3LZLA 4I85A 2Q86A 1AXSB 3W56A 4TUOB 3PAUA 3NK4A 3NSYA 4E36A 3QJRB 4WEBH 1S9KC 5K39B 3FONA 2FDBP 3PJLA 3HZYA 4XRCB 2DQGL 4GEJA 4XC1L 3FN0H 3FB8B 4UNTA 3UG3A 4HHGA 1WFJA 1J9SA 1PD0A 2V5SA 4L29A 4G1MA 4YXHL 1SHSA 2Q7NA 3MV9A 2WYZA 1I1AC 4NJ9H 2X53A 4PJ7E 5DJDA 4ZX3A 5FUOL 5IV2A 3I9GL 2BVOB 2NY6C 4A2FA 1PS3A 4LLWB 1HTYA 2CBQA 2N4IA 5C6PB 1IBZA 3LD8C 2V7HB 3OG6B 2WLIA 1F4YL 5BV7C 2HWZL 4PM1A 1GMEA 3P77B 4K07A 3ASOB 2EIZA 1JWUA 2VDQB 2DQJH 5JTWA 2YAHA 2W0PA 4ZBJA 3F7YB 4M1GL 5ACMA 2FO8A 2A9CA 3VFSB 4RGMC 1G7PA 5A2BA 3UPAA 3BP5A 4LEBA 4OTXL 3S3PA 2ZUQC 4JNXA 5E5RB 5EORH 1X5JA 4XP9H 3HMXL 1UM6H 4YR6B 1TENA 4PR5A 4A7TA 1WP6A 2WP3T 1PEWA 4I0KA 4L3ED 4X6DE 1KPVB 3QUXD 4G80A 5EU6E 3WXVH 1JBJA 5E2JA 3SPHA 5LGKA 4UQDA 2V2WB 2DIBA 2ICEA 1ZHKB 4K3HA 5HDBB 3TZVD 2OL3A 4LF3A 2RCSL 3BN9D 4YN3A 4Q8BA 1AI1H 3LXUX 3SJVB 3OB0K 1F8TL 2BCKB 5CMAA 4ANKA 3L5JA 3KPMA 3WUZA 4FTVD 3RA7L 3LEYL 2DQIL 4WO4A 4AJYV 1XMEB 1QSEB 3HW7A 3ZTCC 3MRQA 3KM1A 5D1ZC 5TFSL 3NYKA 4XMXA 3L3IA 3BRFA 1U93B 4QO1A 1MVYA 1XGRB 4EOWH 1I7UB 2KLTA 1RPQA 1NAMA 4F7EA 2GUOA 1MFEH 5JPMC 1B4RA 1HYRC 4QXGL 2Y7NA 3CK0L 4P48A 5HYJD 1T21B 4PMFA 5A16A 2ERJB 2JIXA 1H15A 3B6SB 1CTNA 1EZVX 3G6JA 1KEGL 35C8L 1GW6A 1S7SA 1Z0NA 3ZE2B 4ERSH 4J2XA 1TETL 1NCWH 4B9ZA 3A6CL 1T1YA 5BO0D 2DLHA 1YPZA 2Q5BA 3UO8B 1ZT7B 1T2XA 5IHBA 3LHAA 4MZ2A 4YDJB 3B9EA 4U6HA 3D2UB 5F7KC 3RL2A 3TH3T 2KPNA 5AL8A 5B39A 2Z8RA 1PKQA 5EBWB 1UOLA 4X6BB 2ZYHA 2LV4A 2Y9RT 4FQQB 3GMQB 4U1LA 2BH0A 4J27A 2YAMA 5E9AA 4JZNA 2ZCKH 5CN2A 3NDYE 3HI5L 3PP4H 5FLUA 1UD5A 4N3TA 1U8LA 5ICZA 2ZWSA 4F8TA 5EDSA 4LAQH 4U1MA 4YSUA 2B2XL 3U6RB 3OHXA 4PBWD 1BXAA 4FQ2H 4LCYB 1XZ0B 4ZDHB 3CMGA 2WQXA 1G7HA 5ID1A 4S1RH 3ARRA 3LIZH 3QFDA 3DMMA 5LXGL 4PY7B 3EBHA 4PGEB 1QUPA 4AK1A 4RRPG 5CR1A 2OMVB 2WSKA 2DJUA 5HGBA 3WMPA 2HT4D 4PGDB 4FJ6A 5ACZB 2CRMA 4NQDB 4HPOL 4M29A 4YIQA 2ZX8A 3MLXL 5ICXB 1F02I 2X9WA 4JKPH 3QJTB 4UU9A 3QAZC 5LDUA 4BXVA 3MLUH 2COVD 4XVTL 3C5ZD 1MFDL 5GJTL 3RI5K 1E4KA 5G4NA 1BF2A 3G04B 3N0AA 4Z9KB 3WMQA 1CBJA 1MHEA 4N0CD 5E1HB 3L2NA 1WWCA 3ULUC 3L3HB 4HUXA 5C07D 2IFFL 4UIMB 1AC0A 4NGHL 1ZA3B 3MNZA 4HKBB 1KYAA 4W9KC 1P5UB 1TTAA 3ZRCC 3RVWC 1HZKA 5T1DL 3TNNA 1CXIA 2YPKB 2PTTB 3ENEA 4NKOB 4OLVL 4X7DC 3QUMA 1BVOA 4OZGE 2UX7A 3MN8A 2DWDA 4YBLC 4FHKA 4PS3A 2D73A 3GNMH 3CFKB 1SHMA 4FNSA 4F1ZA 1TLMA 5DHMC 4AM0A 5GGTL 2Q8BH 3RL1B 3O8XD 3QJSB 5FYKL 4KK6D 4DW2H 1T6WA 3GMMA 3WFBL 1WF5A 2CIKB 3DNKA 4NIKB 5F9AC 3PRZA 1KC5L 4BFIA 4ZUSB 4XXWC 1KUMA 4W9DC 4MVBC 5EV7A 2OSLB 4HZ1A 2ED6A 2W0FB 1W8NA 4Y2OA 4UANA 5DRXA 1CDHA 1G9MC 1YECH 2QQLL 3HBPA 3I6KA 3LH2H 4W9JC 5ERWA 5F7WC 25C8H 1HXYB 4NM8H 2AMGA 1RJLB 3LDBC 2G3ZA 4PJIB 1AO7D 3GZPA 4O2EB 3VACA 3GBDA 3M86A 3IK2A 1NWPA 3U46A 5CFAA 1U8QB 1PFOA 1MCWM 3K6OA 3TA3C 2ITDA 4BSWB 4DCQB 1F2XK 1YVLA 2E4TA 4IKLA 5GGTA 2B39A 2YWZA 4OFQA 3HPJA 4BWWA 2IGFH 4I77L 1BYOA 1JV5B 2GEEA 3HR5B 2ZSVB 3VFRA 3KBHE 5CGBA 4ODHH 1IAIL 1BW8A 5E8PA 4ZAKB 4E9SA 5DD1H 3FCBA 4GW5B 3RX7A 3NUKA 5GRVK 5EBMB 2WJ7A 1U8NA 1DFBL 1DQMH 3RGBA 3LRSB 2AJYH 3QCUH 4OCWL 5IQMA 3L3DA 3GB7B 1O6SB 2VDRB 2Z1KA 4XVJH 1XX9C 4F92B 3QWNA 2KKQA 3KLAB 1JD9A 1CDCA 4YHMH 4PU2A 3X1GA 3L2LA 3W11D 2YAPA 2Z35B 1KLUB 2IAMD 1GCYA 4MA7H 4UTBH 4QRRA 3NTCH 1MY5A 1YEGH 4YHKL 1IC7H 1U2HA 4HJ0D 4A2HA 3OKKB 2UY7B 3DYMA 5MENE 4YXLL 2Y6SC 1T5WB 2CBMA 4AGNA 4NQEE 2WOBA 4ZMYA 1A3LH 1PF3A 4GI6A 2X6CA 4D9QE 1PYWB 4RIRB 5CCGE 1Z6JT 4DF9A 4GKSA 1XQ4A 3LMJH 2MOGA 3OAUL 2XIBA 2WO4A 1P69B 1VACB 2IANB 3EO0B 3TJEL 3VFWB 4RZCB 1F18A 2VL5A 1QRNE 1KJVB 1JXGA 3TPKA 2MHAB 4BFFA 3CSYA 1CLOL 2YGPA 4PUBL 4JHWH 3EZ8A 1F5WA 3WS6A 1A1NB 1GC1H 4GYBA 1EXGA 4LSRL 4JVWA 4UMGA 3WIHL 1GL4B 5TE6L 1ZS2A 1IO4C 5D8JL 1D6VL 4JQIA 2V7NB 4IIQA 2PYEA 4K8RC 4P9HH 4F7KA 3FW6A 3QDAA 3K71A 4UQ2A 1Z32X 5D55A 1HHKB 3LN9A 3T8XA 2VSKB 4TVPL 1F90L 1NC2D 5T33L 1JF1A 4QLRA 1RY7B 4WV1A 5AVWB 2YPVL 1U2YA 2XZZA 1QBBA 2FX7L 5BQ7A 4UQCA 4GOSA 1UJ3B 2YUXA 4E0RA 4CMHB 4E9XA 3F7QA 5GIRB 3RGVB 4HDIA 2G9HB 2MQCA 3NSXA 4BDVB 4JY6B 4YDLC 5AVZB 4P2CG 3WIHA 1ZA6B 5CINL 3GI8L 4ABUA 4FNPA 2NMSA 4I4WB 5LG6A 4PJXE 4YQXL 4L23A 2NCMA 3HKFA 1VZIA 3IDGA 4GXUN 4WDIB 4PJCA 1UWGH 3HS8A 5FWQA 4PB0L 3HE6B 2YPVA 4TUJB 1ZLEA 4LP8A 3MLTB 4M48L 3LXBA 4LLUB 5CCHE 1RLBA 4IDJH 4BELD 3QUKA 2J25A 4XPAH 4OJCA 3QBTB 1C5CL 1Z5LB 3B5HA 5GRWA 4TSCH 1QSFE 3SBRA 3KGTA 4LMQE 3OB8A 4MJID 1A0QH 3BEVA 1AZVA 2W59A 2VZOA 4Y7OC 1IC4L 3NH7H 1LGVA 4JY5L 1ZWIA 2A74C 1T03L 1R0AH 2X1WL 5HI4C 3V4VB 4JPVL 4B5EA 4EUPA 1SOXA 3RFZA 3CFBA 1WAPA 2VXSH 3OKMB 1JHKH 4IOIA 1BQHB 4L2YA 2DMGA 4PI2A 4E9YA 2CRYA 4JRYA 1PX4A 5DUMH 4YDZA 3HI1A 3HR6A 5HYFA 1Q9OB 3N42B 1U8MB 4M6NL 1LHZA 5INCA 4MBOA 4FL4C 4PJ5D 4XN4A 4DO4A 2OI9B 2EC8A 3DPBB 5KYNA 5IT2H 2BWIA 3P3YA 4J3OH 3FDWA 5DQ9B 2D0HA 2UZIL 1KXQE 3VFTB 1HN1A 1DQJB 4LDLB 2AEPH 2WZAA 2CO6B 4HAKA 4YHYC 7PCYA 3B2VH 1HHIB 1OW0C 5KJRH 4E9RA 4UB0L 3FQUA 2IIJA 3DYPA 1FVEA 5DYOA 5I15L 1Q38A 2Z31A 4G6JL 3MNDA 4EI0A 1HWWA 5IFHH 5FR3A 1HIML 5IVOA 4AVIA 3D34A 3EBAA 4PREB 4LBEB 4FQXC 3AM8C 4OKVA 3IKCA 1AIZA 3J2PA 3NSJA 4E9VA 5EEZA 1F00I 4UILH 3DO7B 1WWAX 2AC0A 3PAZA 4N9GB 1IKFL 3KWUA 3VXRE 4N20A 2ESVE 1AXIB 3NFSL 4L4TB 1S5HB 3HRZA 1KG0A 1N8OE 4HUUB 2J4WH 4JKNA 5DURB 4JFWA 1AFVH 4R0LC 1RV6X 3K6FA 3ARBB 3WFHB 1OM9A 2ZXEB 2IDSA 3TC9A 1PZSA 1R5WB 2VDLB 3S36H 3EJPA 1SYVA 4U05A 1KFGA 4U7MA 2IH9A 3S34L 3QNZA 3LRGA 2OMZA 4DEUA 1CUOA 3OJ2C 4D0DB 2HMID 4TQPA 4N8VB 1NMCC 4V1DA 4CU6A 3BKYL 5I0WA 1AHMA 3HAEH 3ARFD 2PP9A 4XPHL 1XCWA 3U0TA 1WE5A 1T2JA 3IETA 4MWFA 4J3TA 4KK9C 1D5RA 1NIEA 3L3KB 4RFEA 1VFAA 4NZRL 5CEYA 1F58L 4CVZB 2KMWA 5IHUL 5D2NA 2WKOA 2FJGA 3Q2NA 1OAZH 3TYGL 4E41B 3V7AE 3MR9A 4QYOB 3PWJA 2B1AH 3HC3L 2IH8A 3HN3A 4CJ0A 4HQQH 2L7EA 4AG4L 5KYUB 4L3CB 2BOLA 1DCLA 1JRHI 1Z9LA 4KROB 5DJCB 3EW3B 5KJ7E 5B4MD 5EU6A 2BK8A 3T1WA 3MODL 5E8OB 3DX6A 1BECA 3MX0B 4MD0A 3L1GA 3D48R 3MV11 4GW1B 5C0CE 3VXUA 4X9YA 4XH2A 2ED7A 4KO6A 4R7DA 4LLDB 3T2PA 1XCTA 3MUHL 3L5IA 3T6WA 1TIUA 3NMEA 4FXKC 4LCCA 3NZHH 3ZE0E 2C7UB 1RK0B 3BKMH 5B1KA 3OSVA 2K70A 1SPDA 2HVKA 3D39D 2CDGB 3NZ8A 4PRHB 5DI8A 2HT2D 2AJSH 4AL8C 3SPJA 3S35X 3SKOA 3RURA 5EH1A 3KWWB 5GPRA 4O9HL 5CAYB 1LVEA 4JQXA 3TS8A 3S6CA 5G4OA 2COQA 2H0JA 2GJZB 5L2KE 4U6TA 2KC0A 4AYMC 5D5MF 1SM3H 3EGXA 4N0UE 5CJOL 2BIIA 2R29H 4M3JA 4JM4H 1XIWA 2AQSA 4XMKH 2C9VA 2XTJD 3MYJB 4X5PA 2CKBB 2ZXGA 4KI5F 4DKDC 4W6WB 2ADJB 2H32B 2WN2A 5EOCJ 1SJEA 4ELMB 5C0ND 5JZ7D 1OV8A 5KZCD 5BUAA 3W5MA 4W6YB 1QNZH 1S9WB 3EIFA 5GRXG 5D1XC 4A6YA 2ZOTA 2F58H 4Y4FB 5IJDC 3FU6A 4HFUH 1KELH 3TPUB 2BP5M 4KDVA 5DJ0A 4APQB 4MDJA 3N9GL 1CD0A 4N5UA 1Z5YD 4N2FA 1A7OH 1P7BA 1ZLUH 5HD8D 4KJPD 2X4UA 2GC4C 1OP4A 3GSRB 3H9HA 4CADA 2V17H 3ATFA 1KYOK 2NY4B 1MCJA 2HTLC 4LPXA 2KZWA 3DIFB 3LQZB 4QI3A 2XWRA 1JERA 4NNXA 3BZEA 3C2SA 4K9EH 4OLZH 3MNMA 3TFBA 3ARSA 1S5IH 4TLUA 4U6XA 4G1EA 3BP6A 1GY2A 3KYAA 3UTSA 5IB3B 2Y24A 2DWEA 3OZLA 4X8JB 2VN4A 1AGFB 2AJXL 5CP7A 4UT9H 1Z9OA 4ETQA 4F58L 4OH2A 3BGFC 5SWSB 1V7NH 5HDQL 1A2YA 1UKQA 2MIZA 4MD4A 4DZ8A 3BT2L 4PJAB 4NJAH 2OZ4A 2NR6D 1NL0L 2UXFA 3MJ8A 4I0PA 1O7DC 3DI2B 2FWOB 4Y0GA 3QK0A 4OLEA 2QTVA 4NS0A 4ORGB 4OFPA 4PRAB 2X70B 3GK8L 1DQLL 1UH3A 2HFFB 1E5AA 2YJLA 4H20H 2FNWA 3ETTA 5BZWB 3VMOA 3VRIB 4J5VA 2D2CC 4N0YH 1LP9F 4JO1L 3SDAB 4OCXH 1I8MA 3HB3C 2AV7A 1UOWA 5DRZB 3D69B 5JLZA 4G5ZL 3EOTL 1JUFA 1ZVSB 4JFZH 3KEHA 3H4HA 3ZDXE 2R0WL 2X2HA 3HS0A 5T1MA 3LNFA 4R90L 2QEJA 5EOCL 3H9SB 3SD2A 4KKBC 3LJ3A 3VFNA 5DR5L 1NOAA 1Y18A 1H3PL 1REIA 3IFPA 4R6UA 4GB9A 2EKJA 2DBLL 1S9YA 1AD9B 5E7FA 5F7UA 4JN2A 3VXMB 4PY8J 3QNXA 2XU9A 4AH2B 1BM3L 4DVRL 2EIEA 1UA6L 3IVKB 4GRLC 5D7KE 3CFQA 4OZGA 4Q6YA 2BOBB 2X44D 2FVNA 5DJXB 1BCIA 1E9QB 5L2JA 1KIRB 3SJVD 1JK9B 3PABA 1SOSA 1A65A 4PLKD 3QDMB 3NVQA 2VDOB 3WJMB 4KXCA 4N8CL 2F19H 4HIXL 2HRGA 4YOKA 4AEIL 4YX2H 4NQSA 4O4YL 1QSED 5CGYC 5HDOA 3MLWH 4DO5A 4GJTB 1M7XA 1DBAH 4PG9B 4M7KH 1N3NB 3K5SA 1L3WA 2R0KL 3ESPA 3SD5A 2A6JB 3T71A 3R1GH 1ECZA 3IKKA 4KHXH 4OT1H 1RSFA 1UFUA 2VZ1A 1ZOXA 5AB0A 4M3KB 1XBRA 1XGUA 3DKHA 3I9IA 1USQA 1PAMA 2VDRH 4JFEB 5G5DB 2WXMA 1NPNA 2D7PA 1BMZA 5IFJA 1VF5C 1Q9WB 7FABH 5T5NF 3U4EA 2ZXBA 4F33A 2ZUXA 3MRJA 3OKLB 4YZFE 3C6LA 3D2UD 1DEDA 3EOAA 3QIWB 2VGLM 2J21A 3CJJA 4QT5B 4N8UA 3MLRL 2H6PA 4PS8A 2EQDA 4WWNA 3E1F1 3BAIA 4AGMA 4LHUB 4K7PH 2P8LB 3GXFA 3QR2A 4MRBA 5LWYL 1WBYA 2YQ2A 5J6HB 3OJDB 4Z7UF 5F88B 5IVXF 4AKQA 5KSBA 1KPUA 4QAMB 1GGIL 4PMEA 3TN0A 4NNYA 5BRZE 2WKOF 5EZIH 1JTPA 3BH8A 5KVEE 2GTZA 4TF4A 4WTZA 4NN5B 2LE9A 2VH5H 4HWNA 4PTTB 4TVUA 3B9KA 5L9DL 4H1LB 5LQBH 1FYTD 1QEWA 3EG9A 2Q9OA 3TX4A 1JVLA 2HRPL 4G6ML 1T1XA 4N0RA 3TWCH 1QFUH 4YEEA 1I31A 3Q5TA 4PSPA 1M05B 1GGCH 3INUH 2QHRH 4X6EA 3U48A 3MACH 3DMMC 4AQAA 3OM3B 3NPSC 2V2XA 1PTZA 3QULA 5GGRB 1WAEA 2G9KA 1YMHA 5E6RB 4EUPG 4XXDB 1LL1A 2R4RH 1BG9A 3VI3B 2BNRA 2IG2H 4DERA 2IADA 1YQVL 5DMKB 4J6RL 1A7BA 4WUUE 3REWB 3TIEA 5IF0A 4B9GA 2ZKHH 4H8QA 3UCQA 1JVOA 1N19A 5KSAC 4XCFL 1QRNA 5DWUL 2NUPB 3BDYL 2P5EB 3QFJA 4P5TA 3VSQA 4GEIA 5FHAH 3NIGF 1CK0L 1F41A 4O51B 1WTLA 1JMZA 1YNKH 3UGEA 1ONQA 1CI3M 2YAQA 1Y0LB 3WTXA 1WEJH 2HLFD 2P5WD 3SYCA 1B2WH 1ZEAH 3I6GB 3Q01A 5B8CB 5C0IA 5I16A 3MRBA 5F0JB 4P2OB 3OZ9H 2H3KA 1TVHA 2EECA 4ES9A 1D5IL 4A55A 1DVFB 1QBLH 1Y1DA 2ZCHH 1GHFL 4JO2H 1LWJA 5E94B 3D4ZA 4B9YA 3FUIA 3NEXA 3MJ9L 3F84A 2O5ZH 2O5YH 1HSAB 1OAKH 1JWMB 1HCVA 4LLVA 3STZB 1MW2A 2GPZA 2IQAA 3QO1A 1OO2A 3D05A 2BVPB 2VDPB 2EABA 3FZUD 4LBAA 2JXMB 2VMEA 1CZ8H 2Y6TE 4NQXA 3MO1A 4QY8B 2NX5A 3DI3B 5HVFB 1A22B 3V4VH 1WT5C 1R75A 2AITA 2WC7A 5I0YA 3M17B 2VZ3A 4NXSA 4LPWA 1ZJBA 1SJMA 4OD2A 1GGUA 4UQAA 2C9SA 3UC0H 5EOQL 4FCAA 5H94B 4U0RC 4TTDC 4OGZA 1EMTH 3L3OA 3K4ZA 4PN6A 1SVBA 3L16A 4Z7QB 1OB1B 1NM4A 4ZUTB 4X5LA 1F1GA 1NSNH 2WWMD 5F9JA 5DZ9A 1QSFA 1ROCA 4ENEC 4NWUH 4AWJC 1INEL 1BVLB 1DQDL 3RP1A 2GKIA 4NUPA 1P5VB 2CR0A 4ODXB 2OTPA 4ZAKD 4MNQB 2WINB 2J12B 4UQ9A 3FH7A 4FQJH 3FQ2A 3GSWB 4OLXH 3QO0B 2P5PA 4XNAA 4RAVB 4YDIL 1A4CA 5JOPE 1MCBA 2HKHL 4NM4H 3V0VB 3U30C 4P57B 4JDVB 5BPPA 3LTVA 5FM4A 2D31B 1BYPA 5JORB 3WAJA 2LLNA 4IU3A 5GZOA 1YEKH 3F12A 5C9JB 1BBDH 4YSTA 4EI6A 5DLMH 1ZK9A 1KXQA 3FXIC 1O7DE 3UJTL 1U58B 3PHQA 4NC1C 2VDLH 5E6IA 1X4YA 4AQEA 3E38A 1IEAA 2ID5A 4M1CD 4QTIL 3QEUB 2WXIA 3DRTB 3GIVB 4HP5A 4J3WA 2XG5A 3ATDA 3CVHL 1X7QB 3GSUA 3O6LL 3DVNB 1HINH 1OSYA 1RIUL 4BCZA 3CFEB 1OCOB 3QR1A 3NACH 2Y36H 3QISA 4EJ1C 2VYRE 3BUDA 1O9WA 2CHWA 4Y1SA 5I1HL 4XO3A 4PW4A 2ESVA 1CE6A 4PYGA 5JW3L 3IE4A 3WS6C 3WKYA 3MMEA 4KI5C 4F7MA 2JH2A 4JFXA 4LSQL 2JE8A 4PRDA 4IIQC 3JWNH 4I3RL 5D1QE 2WXNA 5KG9A 4G42A 4OGQC 3MA7B 4FFZH 2J5LC 1BX2A 1OGAE 2UY6A 5DMGD 4C4KT 4G8EA 2LLGA 4P05A 4XNZB 3EJZC 3REVB 3KVPA 4NUJB 1FYHB 4P4RA 5E0FA 1LLAA 3HG1E 1T22A 3JZYA 4L1HA 2OP4L 3RGVD 1YJDL 3FU8A 1Q94A 2GJ6E 2Z65C 1X7TA 5DD3H 3SQOH 4Q6IC 4KXBA 1OM3H 5AVRB 4F7TB 1L9RA 2VC2B 4OV6F 2XI9A 2LVEA 4WEBL 4ZSOA 1A6TB 3AREB 1HXMB 1MQKH 3BAJA 3FN0L 5ITBH 1LEKB 4QD2E 5IBLD 2PETA 1WZMA 1MVFA 1JZ4A 5HP5A 5IVNA 4GBXC 5HPOA 4OU3A 3BKJH 4X80H 2CKBH 3HE6D 1KGCE 4GKZB 5EEUA 4MMZC 4Y5YA 2HZHA 3DUHA 2H32H 2NUTA 2YD5A 2Q76A 4PJDF 3NA9H 3RPIB 2G3XA 4CILA 5TQ0H 3QG7H 3DVFA 2VITA 2CR3A 1K8IB 1PMYA 2ZUYA 4X99B 4GP4B 3EYQC 5F6IC 5JIIA 5LLIC 2VQ1B 3QDJE 3R19A 2RQEA 4KOBA 1G6RA 3DVGB 4HIPA 4IIZA 5T1LD 4AV4A 4MHHG 1C9SA 2DQJL 4N22A 2O61A 3O3DB 2JKJA 3KDPB 4NRZB 1H8LA 1LM8V 1S3RA 1X4ZA 2GSIA 2K7PA 2PW1A 3S3SA 5I1IH 4N0UA 3EADA 1KGWA 2Y1VA 3UTTE 3O6FC 2DEWX 1FNEB 2B1OA 1MJ8H 2WIIB 1TYRA 1AHWB 1O7VA 3DUSB 2ADGB 5EORL 1RMFH 2ZWLT 1UM6L 1T1ZB 4N85A 4XP9L 4XVOA 1E65A 4FG0A 5EU4B 5SWQA 3ULVH 3WXVL 5DGRA 2CLZA 5E1AB 4OCNC 5A2AA 5J6GB 2R2HB 1U4FA 5AVVB 5F93C 4DN3H 2DN7A 4KO7A 2DLFH 1MLBA 2FHFA 4Q52A 4HIEB 4H13C 4JFQA 1BXXA 2O30A 5H37H 2O72A 5JHDB 2WNXA 3PDOA 5DEGB 3FRPA 4GKNB 2QPFA 4ODWB 1AI1L 4GS7C 2JKWA 5MEOB 1FVCA 1MSPA 4YSOA 5LGJA 4Y7MA 3EUUA 2DL2A 2J8UB 5FGSA 2VMJA 1UYWH 3WS3A 15C8L 4BCYA 4KQ3H 4N2AA 5EC1A 4L4TD 1T0OA 3WEXA 3HUJA 3V52H 4EOWL 1QPXA 3HRZC 5ETUA 5DURD 1MFEL 4FI6A 3FCSA 1IGTA 3OKDA 2J2ZB 4G9FE 2PXYC 1OEZW 3D87B 1ZHBB 3X12B 1BD2E 5BRPA 3ARBD 1SMOA 3NCFB 4IJTA 5CCKH 5AAMC 4F7PA 2EDWA 2C9QA 3D85B 2DWTA 3B5TA 1NPUA 1YCSA 1GS6X 2UZXA 1NCWL 5JMOC 5FS5A 2H2PC 2CO3A 3OWRA 5IJBC 2VDKB 4IRJA 4HW6A 4KUCF 5MEQB 2WD0A 1FP5A 1IAIM 1LILA 2H1LM 4FQHB 3RY6C 1CFBA 3EHBB 4L9LB 1H3VA 3GSOA 4WTZG 1NAKH 3SDXF 5DXWA 5CHNB 1XH0A 2FZ3A 5DC2A 1NA8A 2EC9T 2ZCKL 4KDWA 4KBPA 4PJGF 1L9TA 5ESAA 2VDOH 2YRZA 4JZOB 4NQCE 3N06B 5D2NC 4X4XB 3PP4L 3U82B 2DMBA 1AYOA 2R69A 4E41D 4YEFA 4LP4A 3CFMA 3W1ZA 4I88A 3I6LD 5IY5B 1GYVA 4LAQL 1FZOA 2WWOA 4Q58C 4AIEA 4EDXA 3IDXH 3VQ2C 2LOEA 1FAKT 3MHZA 4KROD 4TOYH 1A4KB 1I3UA 4FQ2L 3WKMH 2WAHA 4QRSA 1NCDH 3DX7B 4QKXB 1E30A 1W16A 3LIZL 1J0YA 5EFIA 4ZNCD 1TCRB 5J12C 5EO1A 2W38A 2X9YA 5FYKE 4W6XB 1YSOA 4LSUH 2D4FA 5MEPB 4YGVB 2D2OA 2FGZA 3WLBA 3EJUA 2RIKA 4P3DA 4PRHD 1XDTT 4D0CB 5TE4H 4TSAH 4IEFB 4MCYA 3GMOA 3BFWA 4O2FA 4ACPA 4QOKE 5FFGA 2OSXA 4BGDA 3MLUL 1GGYA 4IRZA 5AD0A 2DIEA 3BGMB 3AGVA 4OCMC 4QEGA 1RZQA 4AVJA 4E9QA 1OT1A 3RX8A 3QDGB 3KPRE 3K0YA 4AENA 4PG2C 4D0BB 4HLEA 5DRWB 3ARXA 3GGWA 5IHHA 2AAAA 1UB5B 5JIDA 3FYIB 3V55A 3WEMA 1QPKA 2CPUA 3FAXA 1A4BA 4JJ5B 4YSQA 1DQKA 2GYSA 3P69A 2NY1C 4NNPH 3KVDD 3FUHA 5MERA 1BIIB 1MWAA 5A2CA 4P99A 4Y4FD 3FQNB 2DL9A 2WVVA 3P4NB 2DDQH 3UAEA 4WI0A 3QJVB 4MA8H 5I0XA 1BZOA 1JNNH 4APQD 1ET7A 3GNML 2QKIB 5CNHA 1AGBB 4MB1A 2ARWA 5D5ME 4PD4K 4RVBA 5IQ7H 3LPGA 2EYSA 3LHPH 4PJHE 2Q8BL 1BA9A 1UG9A 2NY4D 4QNPF 5E5MB 1I9IL 4PCYA 4DW2L 4IU2A 3BPOB 1FNGA 3OD3A 2AEQH 3ULVD 4KI5E 1UVQB 4Z5RB 4JX0A 5A3IC 5BRZA 3D09A 4P2RE 5ICUA 3O3AB 3CUPA 4RGNC 3QI9B 1N0LB 2G60H 1OSEA 3EH1A 1F3JA 3U7WH 4HKXB 1C5DA 1IGCH 1JPFA 1NGQL 4NUQA 3LH2L 1YECL 8FABB 25C8L 4NM8L 2VDMB 5C09B 5SWSD 3W9EA 4ZJ9A 3MUY1 2CUAA 5AVXB 8PAZA 4HS8H 3MGOA 3SO3B 4CNIB 4P23C 2FJFA 3LSOB 4BA8A 1MFCH 1SFDA 4LCUA 1JZFA 1JOIA 1NEZA 1OTTC 3PPEA 5FA3A 5HDRA 2IGFL 5T3ZH 4YHPA 4PRNB 1O75A 3UIZA 4APXA 4Z7VF 5HHQA 5ESVB 2RTTA 4I0PC 1UC6A 1F3RB 2X12A 2CJ3A 4KXZH 1FL6B 4YBQC 1IQWH 3SDAD 1QLEH 2OTUB 3BIKB 2XACC 4LLMB 4ODHL 4XN8A 2YD7A 1S7UB 2FL5B 4G9DB 3UZEA 2P7TA 2EIJB 5DD1L 5IW6A 2WQWA 4ZFZA 1NLDH 2P8PB 2SODB 3O3UN 1DQML 1WC7B 2W9DH 4UM8A 2AJYL 3ARGC 3QCUL 4LKXA 2R0ZH 5IB2B 1FWXA 1IGIH 32C2B 3H9SD 2WLHA 4P07A 4M61A 1Z9MA 2BP8B 4XVJL 2NY7H 1LD9B 1IQDB 1Z9SA 3ECQA 5CEZE 3RWEA 1I3RA 3GPEA 5FKPB 5AOIA 4YHML 1RKRA 3VSTA 1HEHC 3VXMD 1Q9LA 4PJEA 3KXFB 3US9A 1RZGA 1NKGA 2R1YA 4MA7L 4UTBL 5C0EA 1THCA 2RGSA 1YEGL 3NTCL 3EGSB 3N1PC 1IC7L 4H0IA 2BC4A 1Z7JA 4RESB 1G1CA 4TL5A 2GT9A 3CZLA 5MP6H 5DVKA 1A3LL 3QDMD 2HT3D 3HOGA 3JSSA 4HUCA 1KXVA 3ISWA 4UOW1 3VRJA 3LMJL 2JTYA 3B7TA 1SNRA 1J8RA 4JJOA 4MJ6B 5FO2A 3V9FA 3P2BA 4PAZA 4G7SB 1JZGA 4HUVA 5BVPH 4AC2A 1OF0A 2Y4SA 1XF4A 4PRPA 2HSIA 1GC1L 2WTRB 3I84A 2LT9A 5HY9B 5I5MA 4MJ5A 3PGDB 4Y2DB 2BO0A 1HHGA 5HPMB 3V6OE 4WQOA 1S8DA 4XWOC 3NN8B 4JFED 3MUGA 1MCRA 4K55A 4P9HL 3VU2A 3VD7A 3FPXA 2YZ1A 3JV6A 4YBHA 1F1AA 3QIWD 4X6CE 3QJOA 3UZVB 3C6LC 3FU0A 1P6WA 3L4XA 3RUGF 1SEBA 3O3BB 1CL7I 2WXHA 3LOWA 2ZJSH 2LU4A 3TBSA 4LHUD 4XE5B 2OXHB 5JQIB 3M6DA 3C09B 4G3YH 3AU1A 3V9CA 1WCBA 3ZKND 4WW1A 1TVBA 3V7AG 1EANA 2MNWA 2C4XA 5EO0A 3STLB 4R83A 2BSCA 2CBTA 1T66C 3UEQA 3T0BA 3DPDA 3VXSB 4GMTH 4H0HB 3AITA 5HGHB 5A6MA 2W0KA 3TO2A 4KKCD 5EA0H 4JKWA 4YSAA 5T3XE 1OXYA 3O6MH 5ECGA 4RSVA 5FYKU 2W60A 3DV6B 3GSQA 1AG0A 4K5OA 4WFED 3IPEA 1UWGL 5DRNB 2BMKB 2XPGA 2FJHB 4JPIB 3ZRSA 5L4JA 4MQ7A 1GTFA 1E2ZA 2H26A 4PWIA 4IDJL 4MKMA 5D71H 2WW8A 1BP3B 4H8HA 4MAYB 4TSCL 1ACXA 3L5XH 3IJEB 4RA0C 4K3JH 1FH5H 4E5XB 4XC3H 2NLJB 1A0QL 1CG9A 4M4RA 5E4AA 2NY6B 4ZOEA 1R0AL 3PHOB 5EWIH 3BH9A 5GGQH 1N5AA 2OCJA 2UUDH 2VXSL 2QPDB 1L9PA 3ILPA 3K1KC 5BXFA 1JHKL 2KZ1B 2P5ED 4PV1C 2BHYA 1T04A 2F7RA 3S2CA 4P5TC 1MHHB 1IM9B 4R4BB 5DUML 3M1BB 3C6SB 2IH1A 1J0IA 1XCXA 3ET9F 5CILH 1KYFA 4O58H 4EN3A 2WCGA 3O9WC 1UD4A 4BINA 4WWPA 2A6DA 3RDTA 4OZIB 5IT2L 1CT8A 3FRPG 4P2OD 5D1QA 4XXCC 5B1AB 2B5IC 2BIHA 1DVFD 2DWSA 3JTSB 3ESUF 1MRCH 2AEPL 1CFSB 5IMMA 3B2VL 3IPFA 5KJRL 5CSZA 2Y69B 1E3ZA 1AKJB 2X89A 5IFHL 2R2BA 3KBFA 2BNUA 3OC8A 3SKJH 2H41A 4OF0A 5ADPH 2BJMH 2P80A 3VXNB 3N41B 3NIGE 1X5LA 4NCC1 4UILL 1KWKA 2MOQA 3VX1A 4ICWA 4F5CE 4HFWA 4GUPB 4A66A 3TBVA 1A64A 3FT4B 4DIXA 3BLBA 1ZD6A 3J07A 4ODTH 5DO2D 1CFQB 2J4WL 4DOHB 4L1DA 1BQSA 1AFVL 3HNSH 5KYXA 3ZR5A 1DVZA 5IJVA 2C8NA 3OKNA 5I19H 4B95C 5DSCA 3S36L 4ISVA 1NCUA 3ZZ1A 2QLYA 1YEHH 4ZS6D 1K5NB 1UWXK 2LGNA 1AZUA 5H8DA 3DURA 3AQYA 5HI5D 3GUTB 2FH8A 4Y4KA 1D9KB 3VQMA 4L8CB 4RISH 4TLSA 2JB5H 4PS4H 1KT2A 4NO0A 2XXCB 3L3GB 3QDJA 1T7XA 4ZMNA 4LCWE 1AS6A 4G43B 4MKTA 2HTKD 3DIDA 3MRGB 2I85A 1AHKA 4MNQD 2CO2A 4WGKA 3CSPA 2A0LC 4AYFA 4D8OA 2BS8A 1N18A 3AROA 4YO0B 3TIDA 1CLZH 2FX8H 4K7PY 1OAZL 3LVEA 4Q89A 3K6NA 2B1AL 4PLJC 3PF2A 2XKSA 4HQQL 1DUYA 4I2XE 3L1OH 3V0IA 1I7ZA 2GSGA 4KZCA 2VT0A 3LN5A 1XH3B 1XF5B 1L5GA 3QUXC 1SN0A 2DPKA 3U4AA 5GZOC 2WBJA 3U9WA 5E2UH 5EN3A 1D5MB 4NIYE 2F2HA 3BPNC 3QEGH 1NGWA 3TZVC 4GMSH 2XKNA 3BKML 3CCHB 1HILA 5FGRA 3KLHD 3IRZA 4LRIA 1ZVYA 1NC4A 2KDGA 2WQRA 2ZP0T 2AJSL 1OP5K 2YEQA 4LLQA 1R24A 3QXDB 1BVKB 1M71B 3C60A 1HE8A 3TEWA 2ZD0A 3PL6A 2WHVA 1U8HB 4AQ1C 4BE6A 4R96A 4KK5C 1EJOH 4AM0Q 1EEQA 1SM3L 3G7TA 4AKPA 2R29L 8CGTA 2BNQB 2QHLA 3AT8A 4JM4L 4DP4X 1YEIH 2GFBA 4P5MB 3LEXB 4XMKL 2VE6B 2C9RA 3QAZB 4OFKA 3KPPB 3BZFA 3O4LE 5I74C 4U7KA 5EUOE 1BD2A 2P24A 1R3IH 5FGCB 2Q6WA 1V5JA 4HV8A 2DD8H 2V5YA 3VGDA 4YNYB 4M02A 1HHJA 2G0KA 1QNZL 1YY8B 3BVDB 2F58L 4N68A 2E7CA 4F24A 4RX4A 4HFUL 1KELL 1ZS8A 1FVDB 3SZ6A 2BW5A 4ZFOL 3PQYB 2VIRB 1KCLA 3PIQB 3HC4H 4LT7A 3KDMA 2RMNA 3V8OA 1A7OL 2HLAA 5C3TA 3SPVB 4FP8L 1ZPUA 4HPHA 2V17L 1Y6MR 2JQAA 1HXKA 1HWHB 3QQNA 2IDFA 3OJMB 4XCEA 3ARYA 5D7HA 6TAAA 4XNYH 1JZ5A 1ORQA 4ONFH 4K9EL 4OLZL 1TZGH 3ARED 3KWVA 4G71B 1S5IL 3T0AA 5FHBH 1V3JA 4NYLA 1RPKA 3K80A 5FK9B 4NQQA 2RD0A 5LBSH 4KTGA 4UT9L 4BWTA 4HUKB 4UOQA 2XXFA 2R83A 1MF2H 4QF1A 1VEOA 4ZFOA 1V7NL 4OF6A 4CN1A 2CHZA 2A4CA 1UH4A 1N8ZB 1K5WA 1I85A 3CSBA 5JIKA 2HT4C 4HUWB 4N0FB 1H6UA 4NJAL 1K3IA 3MZTA 3PJNA 5JIPA 2Z93A 3K6SB 1HK6A 2IV9A 5JW4Q 4HYTB 4MCNA 3ABKB 4QOKA 4H20L 4L5FH 4P4KC 2XXMB 3E8UH 3TA3B 2Z92A 4YLQT 4N0YL 4AGQA 2ENJA 3X3GH 4OCXL 3B2DC 1OLLA 2XZQH 3C2AH 1DVTA 5D93B 2BFVH 1E27B 2XVKA 4N0CC 5LAXA 4JAMB 3H85A 3FUDA 1FO0A 4JFZL 4UT9A 1J8SA 2CA4A 5KEZA 1T89C 2WGXA 4ODSH 3MREA 1S7VA 3K72B 2K78A 1L9QA 2IDTA 2DIJA 4NWTH 4OJYA 1FHNA 5DTFB 3WAKA 4PJDE 3HG5A 4WFFD 2AHIA 4H25A 4Z76B 1DSWA 4FQ1H 1MJJB 5DMIH 2B20A 4R4NC 2BOCA 1KLGA 3ETBJ 3KH3A 4K94H 4C57C 1V8HA 5JHDD 4BFBD 1I1YB 2ICWI 4K3EH 4IRSA 1QFWI 1QWHA 2R56H 2FLRT 2XN9A 4U1GC 3F6IA 1KTJA 5HJDA 3OGCA 5CBEA 3O8XC 4PJHA 3UAJD 4KK6C 4YX2L 4I5BA 4EZKA 3UABA 3HHMA 3MLWL 1QVOB 4Z78B 5DEZA 5EC2A 3BRDA 3NG5A 3MRRB 1DBAL 1QX1A 1I9RH 4M7KL 5CKAA 4F3FB 4X4KA 5J57B 4OVVA 5L6YH 3R1GL 4L1BA 2C3GA 3LEVH 3QIBB 4XAKD 4KHXL 4OT1L 5J1AA 3HN8A 3SBWC 4CUCA 4CVUA 5HYEA 1J5CA 3QPQC 4EZMA 1IM3B 3D85D 4LOFA 3SYAA 2NW2B 4L4VB 2KLRA 2VDRL 2OMXA 5BS0E 3D3VB 4JREB 3H53A 5EIVA 5KVGE 4HWBA 2LTQC 7FABL 4S0HA 3NJJA 4IRJC 1S7RB 2XRAH 5DQJA 3TJHD 2QGEA 2WKGA 1FRGH 2VJ0A 4OSUH 5IG7B 5C2BH 5C08A 1RSYA 4KPHH 5FO9B 2A6KA 4LDOB 1Z3GH 2FLBT 2CO7A 1THAA 4GG6F 1M9SA 2E7LC 3GRWH 3O2DA 5IK3A 4K7PL 3FQXA 1V3KA 1YQ2A 3QG6B 2CPCA 5FX3A 5JOEA 2XTSA 5I8EA 5IB1A 3D33A 1T0NB 3WDHA 1YUHA 1ZHNB 2F61A 5J1SC 5EF1A 4HKZA 2ZXQA 2E76C 1OAQH 2CAKA 5EZIL 3M8OH 1EVTC 4U1JA 1JHTB 4OBRA 4BJLA 5E70A 2VH5L 2H3NB 5F1NA 2W65B 5EPMA 5LQBL 1I3VA 1EA9C 4Z7WA 1M53A 5I2IA 5ITFA 3TWCL 1QFUL 4KK8D 1GGCL 3INUL 2QHRL 2IAMC 3MACL 1LO0H 4HMEA 1DZ0A 1BFOA 4U6YB 5J0BA 3T0DA 2PLTA 2R39A 3OJVC 3FCUB 4HJ0C 5A2IH 2W9LA 3SDXE 2AJVH 1TO5A 2XWTB 4PJGE 1MHCA 2R4RL 3GSVA 3A21A 4XO5A 1BPVA 4OY9A 4AQOA 4NBYB 4W9IC 3QJQB 3ZRFC 2AQ1A 2ZKHL 5E9DB 4M8UA 5F0PB 3VW3H 1ORSA 2AI0H 3QDGD 1VKXB 4TNVK 3NIDB 1JNLH 2NNAA 1FSKB 5FHAL 3D4GA 3NFPB 4NSKA 3CN3A 4NZJA 5HHNB 1ITBB 3P3TA 4KMTH 3R7RA 5KVMC 4Y5VA 1YNKL 3BUIA 3FL7A 5FKAB 4OZHB 1KXTA 2V9UA 1WEJL 3TVMA 2F53E 1B2WL 1ZEAL 3UG5A 3V6OA 4P2QB 3ZE2F 3OZ9L 5KSUB 3DO3A 4G8FA 1U8OA 2YEZB 1QBLL 2ZCHL 4PJBA 2EDOA 5M95B 4JO2L 3Q5OA 4X6CA 4WF7A 4IBZA 4FFTA 4MX7B 2DRUA 2L7JA 4FL4B 4NPYA 4FTVE 2O5ZL 3OMNB 4AYSA 1G0YR 1R47A 1UQSA 2XSKA 1A66A 2I60H 3ZHFA 1OAKL 1J12A 4WHCA 2D7NA 1T5XA 4YHYB 3FPYA 1ZV2A 1XSJA 4BGLA 1CZ8L 1CURA 1WUZA 3FTGB 3GXMA 5HYJE 3U2SB 1S78D 3V4VL 1U6AH 3QI9D 2WNWA 5C1MB 3MLPA 4FQXB 2YBRB 3P1VA 5B1JA 3FFDB 3KLKA 2X7LA 4WAFA 1MI5B 3FQRB 4AGPA 4BRVA 4F2ME 5C09D 1SDYA 3UC0L 2G5UA 2EE9A 1A7RH 2XZAL 5JIQA 2X6VA 1HX0A 1INQB 1EMTL 2YSTA 3FUKA 2WLLA 2K0RA 5BW7C 3PXHA 1IL1B 1FH2A 4FXLA 3N1QC 4QNPE 1NSNL 4PJ6A 3BAEH 2FH6A 4NWUL 4XHJC 3L9EA 3IJ7A 1S7WA 3RJQB 5DJ2A 3VXQA 3GJFA 4FG6D 3S2AA 4PIBA 5IHZA 4ZTEA 3AACA 3HN5A 4FQJL 4OLXL 1FFOA 5BUPA 1NBCA 1TOXA 3X17A 7CGTA 4CSZA 3EFFA 4QHUB 4NM4L 1R5IA 5D1ZI 2A4EA 3L7EB 1MFUA 4NT6A 2B3RA 3FUNA 1JXFA 4L0PB 1QSVA 3VGHA 3T3PB 5DFWH 5J06A 1YEKL 3S5LG 3W0WE 3FO1A 1FDLH 1BBDL 1V3MA 3KXFD 5JO5A 5AAWC 5DLML 1HZHH 4CSSA 5D6DC 3MFFA 4JO4H 5DS1A 3IDMB 2O6CA 4MCZA 3E9UA 3BDBA 1JRHH 2MMXA 2A73A 5TTRA 1QA9B 2ZOUA 3APNA 2VDLL 5JXEA 3FS9A 1HL8A 1DQQA 1RP9A 2I7SA 5I8OH 2ZAGA 4OLWH 4EVNA 2NPLX 2IOMA 1DDHA 5I1GH 2H1PH 4WJKB 5GS1B 1HINL 1U2CA 4PRIB 5FB8A 2IWKA 5HVHC 5DK2A 3AVEA 3UYRH 1CLYH 5C07E 4FXKB 2WM0A 1KBVA 3NACL 2Y36L 3CV5A 4FADA 1HHHA 1UZ8A 1NCHA 2CXGA 3LKSB 3WD5H 3MXWH 3EJQA 3G08B 4G6AC 3ZHDA 3BFQG 3V0DA 4E42A 4Y2DD 5EU3B 1XCQA 5IW1A 2WPGA 1YNTA 5GGSB 1E5CA 2ED8A 4RETB 4X98B 4PJIF 1H0DA 3NDZE 1XGTB 3F5WA 2G3MA 2WQUA 2CA3A 2ZAIA 5DMYA 2YXMA 4FFZL 4F80A 1JAEA 3V4PB 2HMIC 1I1FA 2X28A 3BLPX 3GSXA 3L4UA 1DE4A 3BEWB 3ARFC 3MCKA 4MFHA 3QT2A 2VLJA 4N1EA 4LCWA 4XCYA 1XGQB 5D7LA 5D1XB 3QZPA 5JHLA 3ZMRA 4ODUB 1BWMA 2J55A 3T65A 4M6MH 4TULH 1A6WH 1GC1C 3Q2CA 2X0WA 4UDUA 5DD3L 3LKRA 5GGRY 5DD0H 3ARDA 3SQOL 2V6HA 1RZ7H 1OM3L 2NY5H 3VXSD 2FEDD 1HZLA 3ZHLA 5DD6B 3CDYA 3ZDYB 1MQKL 4I2XA 3DECA 4P9HC 5C0BB 2HG5A 5ITBL 4FFZA 5ID0B 2P3YA 3VSUA 5B4MC 1QLFB 1YMME 3GMPB 4Z7WF 2CK0H 1PJ9A 2YGNA 5JHAA 4PJFE 5CWSA 3BKJL 4X80L 2CKBL 3RUGE 4BFKA 5DJZB 4MMYA 5F3HA 3RU8H 2Q86B 4YDMA 5KBMA 1NEPA 2EDLA 3NA9L 3M1CA 3FONB 2FD6H 3HZYB 5TQ0L 2DWXA 5FM5M 3VWKA 1KJMB 3QG7L 1BMWA 4MAYD 1ASOA 4RAHA 2HT2C 4M8QA 1JZEA 4BQCA 3INOA 1SJHB 4L29B 1CFTA 4G1MB 3WHXA 2B08A 5I28A 3IAGC 3MV9B 3UZQA 3A3YB 5IV2B 2NY6D 3BWSA 4S11A 4M56A 4DEPB 4CVWA 2A9MH 2XPYA 2ZCLH 5GSVA 5I1IL 2XA3A 3D0LA 1E5ZA 1IM9D 2WLIB 4R5XA 4ONHA 4J3VA 5E1GA 1MJ8L 1OT4A 2XTJC 1RMFL 1JWUB 2EIZB 3SBPA 2EZ0C 3T3MF 3U4BH 4B50A 4AIOA 3U0PA 3O4LA 4ZPVA 4ENZA 1RFDH 2YD3A 2Z4TA 3F7VA 5JZ7C 3RDTC 3SHSA 3A24A 5JA8B 4MGXA 2J8HA 3AAZA 4DN3L 1QWNA 1G7PB 4XZUA 4DJMA 2XUWA 3BP5B 3A6OA 5FOBA 3V6ZA 2D03H 4PJBF 5MHSD 4PR5B 4NAMA 1UXWA 3MLSH 3OQ3B 4G80B 3QZBA 1AKJD 1U8CA 3ARVA 3ZKMD 1AMYA 4MNGE 4W4NA 5D9SA 1KYDA 1JZDC 3L4WA 5HD8C 4QRFA 4CC4A 4AI7A 3UDWA 4GRLB 4G8GA 2ICEB 2JSFA 1UYWL 1BQUA 4QRPB 1N0XH 2EXWC 4LF3B 3HE7A 1H8NA 2OV0A 4KQ3L 4QHLA 1ZTXE 4U1HA 2ZX6A 3V52L 2EDJA 3PWVA 1Y6NR 2WCSA 4WW2A 3QXTA 3TNMA 2NZ9D 2YK1H 5CMAB 3B9VA 4J3OC 5H4ZA 3GSNH 3MJ7A 2VKWA 3BWAA 3E6HA 2NDFA 5CCKL 4WO4B 2VQTA 3RWGB 3D06A 2EIKB 2VXVH 4H5SA 3T5WA 2NTFA 3MRQB 1ANUA 2F5BH 3L3IB 2MTPA 4FXGA 2NY2C 1XL4A 3CHSA 4WLCA 3H0TB 4BH7A 4ELDA 1WFNA 1NAMB 2GUOB 4HUNB 2ZG1A 2OK0H 1D9KD 3OBAA 5K1VA 5A16B 2J1KA 2JIXB 4MS8D 3T2QA 1H15B 3TEUA 4XN7A 3G6JB 4G6FB 1CGUA 3W9DA 1IE5A 1W72H 2WVSA 2J1XA 4A37A 1NAKL 2ITFA 4KKPA 1T1YB 3IXAA 3QJZA 1YPZB 3Q8FA 2AJZA 2EAEA 1URIA 2VDOL 5BCAA 1BM7A 3RL2B 1UD2A 2YA2A 4Z95H 4I1RA 2HXAA 4N86A 3DX0A 5B39B 2P46B 1PKQB 4DNLA 3VX0A 3IDXL 3N42F 4Q4EA 1KPRA 2LU5A 4U1LB 2WP3O 4TOYL 4JZNB 3WKML 3MOAH 4I3SH 1NCDL 3BOVA 3H9YA 1JI1A 3S3JA 2ZP9A 3S3CB 1I4FA 1UACH 4GIAA 1GGTA 1GAFH 2Q20A 2HKAA 4U1MB 4LSUL 1OCRB 4WSKA 3OHXB 2C9PA 2AJ3B 4Q9BA 2F74A 1YEDA 2XV0A 2YAOA 4TN9A 4NKQB 4NN6C 1JDCA 4JFFA 3UBGA 5SX4I 2EKSA 4TSAL 5TE4L 4LRIC 5FGBC 1EEYB 3NJFA 1CS6A 1G7HB 5ID1B 4ZMOA 3R8QA 3Q9QA 3DMMB 1IV8A 5ESQA 4K23H 4DEWA 1T3FB 3DXAE 2JCCA 3O0RH 1SQ2N 3PL6C 5D7IE 5HGBB 1OD9A 1DDTA 4FNRA 1KGIA 2BNQD 3RKPA 4PWGA 4YIQB 3C5XA 4PJ5E 4UU9B 3LXCA 3GMRA 3VFUA 2ERJC 5KBKA 4N6QA 2QTEA 5B22A 3PV6A 4YK4C 3FHAA 3ULUD 5AOJA 4NNPL 4HUXB 5ABDE 3MUJA 2WLMA 3MNZB 3ZK0A 2DDQL 2FRGP 5K59F 4MA8L 3LXAA 1JNNL 3PQYD 4NKIH 5SWZD 3R7QA 4OGXH 1JK8A 4C83B 1N2RA 1M4KA 4AUYA 5IQ7L 2DJMA 3LHPL 4UIKH 3UH8A 1MREH 2D9CA 2P52A 3QUZA 4JG1L 5E9NA 3QUMB 1P7QA 1I8LA 3X1EA 1BZEA 1UM4H 3AZUA 2AEQL 1F13A 1WS7A 3T0VA 4KZDH 2G60L 3UACA 4BFJA 3U7WL 4FG2A 4AM0B 1IGCL 1J8HA 1R5VA 1IILE 4DP2X 1EO8H 3PCYA 3GMMB 1KACB 5DO8A 2G5RA 2E0PA 4Y1AB 4WK2B 1XB3A 1L4IA 4BFIB 2XYCA 3BMWA 4HS8L 4U1IA 4LCIH 4N6RA 1MFCL 2PPFA 4EI5A 2FEEI 4Y2OB 3NQIA 5EZJA 3HZMA 3P73A 5DRXB 5T3ZL 5F44A 3U7YL 3I6KB 4JPWH 1HE7A 1SGKA 3L9YA 4MSWA 2VW6A 1YA5A 1D2PA 1D5XA 4EZJA 3EFDH 4YPGA 3TA3D 3U46B 1PZ3A 1IQWL 1QLEL 3F64A 2ITDB 3VH8A 4K9EC 1OP3K 4R2GB 4W4OA 3HPJB 5JR1H 4HCRH 1NLDL 1PW3A 3QGVA 4BSJA 2CLRA 2W9DL 2WVUA 1U3NA 2VM9A 2R0ZL 3GIZH 3Q7JA 1DP0A 1IGIL 2R1XA 4IHOA 2IH3A 3VFRB 2VR4A 2WZPD 4H2CA 3F00A 1P5UC 3VGGA 4QHKI 2F53A 4ELMF 3UGXA 4H8UA 4OCYH 3EJRA 3DSNA 4RWYH 1U8NB 4XMVA 3D39E 3KPLA 1KCUH 1G6VK 3L3DB 3U30B 4ZFFA 4HJSA 1RCYA 3FT3A 4DZBB 5MP6L 3U36A 3QWOA 4IRSC 5FYLH 3WKQA 4FTVA 1TJHH 3TBYA 2PWHA 4I1PA 3CSTA 2ATKA 1FC2D 1HAWA 3BVWA 4GINA 3IFLH 3FZUC 1JGDA 2VXUH 2Y6SD 1XT5A 5H2BA 3SKUD 2OMBA 4Z1PA 5BVPL 3ULVF 3QHTC 2J57A 3EO9H 4GSRA 5HYJA 1UA7A 4GKSB 3QIBD 3A67H 5T1KA 1FBIH 2DLGA 4KX7A 1IZKA 1UM5H 5B1BB 1YAZA 5KVFH 4L4VD 4F2MA 2VL5B 5HJBA 2BVTA 2DQMA 2FHCA 3D3VD 4GRWE 3WTSA 2DQUH 4A39A 5CM1A 3A47A 4OKDA 5HYSA 4PJAF 1YY9D 1OTUD 4DK5A 2ZJSL 2CE6A 2FO1A 4IIQB 2PYEB 2H3XC 2X9ZA 3K71B 2J5LB 1MRFH 4UQ2B 4ZAKC 3ZTNH 2E5EA 3T8XB 2NSMA 3NPZB 5F21B 1ZIBA 4Y16A 1H5BA 2H1XA 1JF1B 4KTDH 1WUNT 4WV1B 1EJ6A 4GMTL 4XB7A 4HOWA 2B77A 3HG4A 4W70A 5EA0L 2BSED 5BQ7B 3QDHA 3T6ZA 4BUGA 2FK9A 3C9NA 1WZKA 3O6ML 1VPOH 4E0RB 1P4BH 1Q0YH 1QBMH 3ELAT 4OAWB 4XBPA 4HDIB 1ZT1A 1KN4H 1W0WB 5AYTA 4KFZC 3W0WA 3BPCB 4Q6IB 3RPBA 1ZSDA 3L13A 1BJ1J 2LQRA 1O5DT 1E0OB 1PDKA 4G59C 5D71L 5EF0A 1AZBA 4UT6H 4M1CC 1IEBA 3C08H 2XWJB 1XGZA 2PTUA 3L5XL 4U1SA 1FH5L 2EEBA 4GBXB 4QHMA 3C5ZA 4KRLB 4XC3L 1R19A 4N2LA 4MMZB 2E46A 1C7SA 5JXAH 2ZNXA 4QMEA 5E9DD 5EWIL 5KBLA 1UTDA 5CD5D 3QUKB 1CU4H 1KBPA 4YGAB 3KHOA 5F9WC 4J3BA 3BEVB 4HX1A 4N26A 3RBGA 3BPLC 3VDCA 5CILL 4IHBA 5HI4D 1ZWIB 5HVWA 1Q72H 4O58L 2L7UA 3VWJA 4EUPB 3RFZB 5HDBE 1ZLUK 3CFBB 3QUYA 4P2QD 2VZVA 4IOIB 3CLEH 4JFYA 2BXYA 3O6FB 4L18A 1ZE3H 3EYFB 5AUMB 4JRYB 1MRCL 3HI1B 2IALA 1HCFX 2P45B 2I25N 3F62A 1XHHA 5GS2H 5EBLA 5C0RH 1QLRA 5INCB 3ZW3A 4WUKH 5A2JH 1DUZA 2JFCA 3BUPA 1QSEE 4NFCA 3SBQA 4CMHC 3SKJL 5ADPL 2BJML 3FFOA 3RGVC 1TQTA 2W0LA 1X5AA 2Z3FA 4R7NA 5TK4A 2ETWA 2X4TA 1CYXA 1NIBA 3FQUB 1JV2A 3RYMA 4CJ1A 2FSDA 1FVEB 5DYOB 2Z31B 4L48A 2N7AA 2YMTA 4ODTL 3C12A 4FQXD 2XA8H 3TV3H 4C56E 1WVZA 5GISH 1TCMA 5KVDH 4OKVB 1OPGH 3HNSL 1MI5D 4WI5A 5B1JC 5IBLC 5GZNA 2JJTC 1YMMA 1HFUA 2VERN 5I19L 3HE6C 4PJFA 3LX9A 2UXVA 4ZO9A 1YEHL 1RJYB 3AY4A 3P4OA 3HRZB 3Q48A 3AQZA 1A6AA 5FYLD 1KG0B 1XGYH 2PXYB 1PZAA 1DJGA 1HWGB 3X1BA 5E03A 4RISL 3QYMA 1I7RA 1DR9A 2JB5L 2WTPA 4PS4L 3SKNA 3PWPE 3VI3F 2MNJB 2EDBA 3VJ6B 3SDCA 1QD0A 2BM3A 4L05A 5F9DC 3SDDA 2DLTA 1B6UA 4V1DB 2WZ0A 1CLZL 2FX8L 1X6LA 4AKOA 5C0GA 3RX9A 2AV1A 2OL3H 3U0TB 3DV4A 3IETB 4MWFB 2A9NH 2I69A 3L1OL 5CEYB 2W94A 4MLSA 3AB0B 1E90A 4JFOB 2OI9C 5D2NB 5E2UL 2FJGB 3QA3A 4WJ5B 1O6TA 4NQDE 1ADQH 2WLKA 3QEGL 5E4IA 1IBBA 3MR9B 2EE2A 3PWJB 2Z8VC 4GMSL 1TSRA 3WIIH 2B59A 3AWFA 4H0GA 3FB6A 3B7YA 5JDSA 3ULAB 1TMQA 1PZUB 1NAMH 2D8KA 4PRID 4P06A 4MD0B 4PLOB 1A21A 3VXUB 4UYPA 5I6NA 4XH2B 4R7DB 1XCTB 4KI1A 4EDWH 5DK3A 1PCXA 5DJ8A 2E75C 3MRLA 1FFRA 3LNIA 5IQOA 3FU5A 4AC4A 5C9KA 4JG0H 3AABA 1WDAA 5DI8B 2HVKB 4XE0A 3NZ8B 3ROLA 3WY4A 1F11A 1YEIL 3SKOB 2P28B 1XF3A 1AR2A 1F1DA 3PNRB 2XQYA 1R3IL 1KTKE 3R06A 2EXYC 2FECL 4BE5A 2DD8L 3EGXB 3DBXA 1WICA 5I23A 1NBZA 1NC2A 3L6FA 5IKCA 4URKA 4GAJH 1XIWB 2X2YA 3A4DA 5E6YA 5AW1B 1TZIA 3NJNA 5I82A 3VM7A 4U2ZA 1QI4A 4JW3A 3APDA 4ZPTA 1E28A 3VG0L 3BSHA 4N2HA 1WAAA 3ZPDA 2QZQA 5D1XD 5FOJA 1MCSA 3H7LA 3P9MA 5I73B 4FLQA 4YMPA 5T5FA 1QNIA 3TA4D 2XBDA 2OTWA 3B9AA 4XNYL 5DJ0B 3SE9H 3VXPA 4MDJB 4ONFL 3IGKA 1HU8A 2WYTA 4PJIE 3JWNC 2O6FA 1SZNA 4H40A 2ZYSA 5C0BD 1GMIA 1G9EA 4YXKH 5FHBL 3B8YA 1JGLH 3H9HB 4CADB 5DZOA 2VDNH 5LBSL 1MF2L 3K2MC 3DO4A 2YRPA 4JM0A 1TITA 4NNXB 3BZEB 4RGNB 4I87A 4U6XB 3BP6B 3UTSB 2DWEB 4B41A 1CQYA 1E9OA 2IBZY 4A38A 1BREA 4ETQB 3MV9D 1RIHH 4L5FL 5AYQA 3UAAA 1CWVA 3E8UL 1A2YB 3X3GL 3DXAA 4MD4B 2EDTA 2XZQL 5D7IA 3IWUA 4DZ8B 3C2AL 4NENB 1NWOA 2BFVL 3GBMH 4KRMB 3DOHA 3MBEA 3MJ8B 1E2VA 3OC5A 4I0PB 4NO3A 5LBSA 3UMTA 4DH2A 3QUMH 4UQBA 1UCTA 2X2IA 4M5TA 4ODSL 2NY0B 4PJ5A 4TPRH 2W92A 2YMXH 4OIIH 1LQBC 1MXGA 4NWTL 1UD8A 4ZZFA 1I8MB 2AV7B 5JLZB