3GD3A

Crystal structure of a naturally folded murine apoptosis inducing factor
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
483
structure length
463
Chain Sequence
PSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLQFRQWNGKERSIYFQPPSFYVSAQDLPNIENGGVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRALEKISREVKSITVIGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKILPQYLSNWTMEKVKREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEADYGKGVIFYLRDKVVVGIVLWNVFNRMPIARKIIKDGEQHEDLNEVAKLFNIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redox-linked conformational dynamics in apoptosis-inducing factor
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords Apoptosis-inducing factor 1, mitochondrial
total genus 138
structure length 463
sequence length 483
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3gd3A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3gd3A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3gd3A01
2R0CA 2GR0A 1JOAA 2R45A 3NNEA 3SFEA 2HQMA 4H4QA 4P9SA 4B69A 2C7GA 2B9WA 4CRTA 5JCKA 3DMEA 1BWCA 3G5SA 3PO7A 1BF3A 2C75A 3B3RA 2FJAA 3IHMA 4H50A 3T37A 2GF3A 1B4VA 2XLUA 4H4UA 2JB2A 3G5RA 4M52A 3CNPA 4N9XA 3UOVA 4B63A 1ZX9A 3UTHA 4IV9A 2E4GA 4U8PA 1H86A 1NG4A 3AYJA 4EQXA 1OJDA 2GR3A 1PBBA 3PVCA 4YWOA 2WETA 5EB5A 4A65A 2R0GA 1YQ3A 4O5UA 4XWZA 3AE4A 2YLTA 5KVHA 4Z25A 4UP3A 1MOKA 3IC9A 1CC4A 2C65A 3WE0A 1PDHA 1PBFA 1OJTA 3GD3A 1CBOA 3QJ4A 2JKCA 4XWRA 4Z44A 3EPTA 3AE1A 3BNUA 1D4EA 3PS9A 4O5QA 1D7YA 3GD4A 3NG7X 1Y56A 3C4AA 2B9XA 4FK1C 3QVPA 2GMJA 4H4ZA 3DJEA 1W4XA 3FMWA 4H2PA 1VDCA 5HYMA 4EM4A 2ZZCA 3BI2A 2IVDA 5BVAA 4H4SA 2WP6A 3URHA 1ZP0A 2BCPA 3NGCX 4D03A 2XFOA 4YKFA 3RNMA 2JB3A 1JRYA 1XDIA 3FPZA 3RHAA 1GRBA 2CDUA 2VRLA 4NEVA 1E7PA 3NK2X 1VG9A 4FX9A 2XCGA 1B5QA 4AT2A 1KSUA 1NHRA 1KF6A 3IF9A 4ECHA 1KFYA 1OJCA 2YLZA 3QFAA 2C76A 4RG4A 1PN0A 2JAEA 3NN0X 1PHHA 1RP0A 2ARDA 4H4WA 1TDNA 2JBVA 3RP8A 4A6NA 1BKWA 1S2QA 2XFQA 2VRMA 2XVHA 2B7SA 4B67A 2OAMA 5BUKA 3II4A 1ZDLA 5C2TA 3LJPA 4TLXA 4BK1A 1K0IA 3AYIA 2CVJA 4Y4MA 1F8WA 5FS9A 2BK5A 3R9UA 3GYJA 4U8KA 4D04A 4BJZA 3UTGA 4A9WA 4GUVA 3ALMA 4EIQA 4Z2TA 5LV9A 3C96A 2BC0A 3BI4A 1GALA 4H2QA 5U63A 4YXDA 1F3PA 4C77A 2ZBWA 3UKAA 4H7UA 5FS7A 3P4PA 3LB8A 2C73A 4OCGA 2YAUA 2ZZBA 1NHQA 2WPCA 3UKHA 4C5OA 2W0HA 3Q6JA 1REOA 3QFBA 1GOSA 4OPCA 5ER0A 2C72A 1Y56B 3V3NA 3AD8B 5EOWA 4J36A 3GDNA 2C67A 2UZZA 3LZWA 3UCLA 5U25A 3UKKA 2YWLA 1O95A 3L8KA 3ITJA 2C64A 2OA1A 3ISHA 2J3NA 3G5QA 4CBQA 1Q9IA 1TDFA 5BULA 4USQA 3GYIA 4REKA 4YSXA 2AQJA 4Y4LA 3AXBA 3NT6A 4LA1A 1NHSA 3NIXA 1JRXA 2X3NA 1CJ2A 1CC6A 1YQZA 3DGHA 1X31B 2XLSA 1XHCA 4AOXA 2B7RA 2V3AA 2YVJA 1XANA 3AE7A 2YVGA 1ZK7A 3DJGX 1FECA 4U8OA 4K7ZA 3AE8A 3B6DA 4WCTA 2RGOA 1NPXA 4H4YA 1NAAA 4GDPA 4H4TA 4GCMA 4GF7A 4BJYA 4H4XA 1JRZA 4J34A 3KD9A 1ZOYA 4BURA 1CHUA 2XFNA 4ADWA 4OPUA 3NYCA 4WX1A 4LU6A 2C3CA 4IA6A 2BABA 1QLBA 2X8CA 4B64A 1PJ6A 1VQWA 2FJBA 2V61A 3AD7B 4GR1A 3CGCA 3I3LA 1TDEA 3QSEA 4DSGA 1BZLA 4EMWA 2EQ8A 1D7LA 2XLTA 1DOCA 1CL0A 2XDOA 3VRDB 4JDRA 1ZMDA 2PYXA 4X9NA 2XLPA 5U1OA 2PHHA 3P9UA 1CJ3A 2X8HA 1MO9A 1NDAA 1JNRA 2GB0A 2GVCA 3NH3X 1O94A 1K0JA 1L0VA 5C3JA 4B65A 3AB1A 2AR8A 3UKLA 2EQ7A 3UP5A 3SFDA 3K7MX 2X50A 1FOHA 1NHPA 4IVOB 2A89A 4K5RA 3FIMB 5J7XA 1PXAA 1ONFA 1KDGA 3COXA 2VQBA 4J57A 4BK3A 1PS9A 5BRTA 1YKJA 5M0ZA 1LPFA 2YG6A 4J2WA 3VRBA 2H88A 3VRAA 2YM1A 4CNJA 3OC4A 4NTCA 5IQ1A 4C74A 1F8SA 3GSIA 3NK0X 2OLOA 1BGNA 4YSZA 1D5TA 5GSNA 3ADAB 2V60A 5KXJA 5M10A 3ZYXA 5TR3A 2XVEA 2XFPA 4UDQA 2XVFA 3GDPA 4EM3A 4YTPA 4JY2A 1N1PA 2WP5A 2BCGG 2YR4A 2X99A 4EQRA 2Y6QA 2QCUA 5DBJA 3DK4A 4X9MA 3ABVA 2H89A 1IUSA 4DGKA 1GRFA 3S61A 4YKGA 1F8RA 1IUUA 2YLSA 1LTXR 1GRHA 4U8LA 2YLRA 2Y6RA 3KPFA 4YT0A 4GRTA 1UKVG 3I6DA 5HHFA 5IQ4A 5EB4A 5EBKA 2WOIA 4A6NB 5HXIA 2JB1A 2XYOA 4B1BA 4BV6A 2F5ZA 1B8SA 5GRTA 1KNPA 4NTDA 2YVFA 1GXFA 2YR5A 1LQUA 5CKUA 3S5WA 3V3OA 4CY6A 1ZOVA 1O5WA 2VVMA 4AT0A 2BACA 3CGEA 4DSHA 1E1KA 3DJJA 2R4JA 4DNAA 3VR9A 1HYUA 2QA1A 2VQ7A 4JN9A 4FDCB 4A7AA 3GMCA 3P1WA 4U8NA 3NYFA 3K7TA 1DJNA 2Z5YA 2GR2A 4ZN0A 1GPEA 4XXGA 1D4CA 1K4QA 3AD9B 4J33A 1MXTA 3LZXA 1GNDA 4TM3A 2GRTA 2WPEA 1SEZA 4YSYA 5HY5A 5J60A 2NVKX 5FS6A 4GDEA 1ZKQA 5FMHA 3FG2P 1L9EA 1K0LA 4IVMB 4TM1A 2AAQA 1GTHA 2V3BA 3QSMA 4K22A 3LADA 4USRA 4NTEA 4BK2A 1Q1WA 3AECA 1DOBA 1VRQB 2YG3A 4K2XA 2WESA 2YQUA 4B68A 1E1MA 3VQRA 2DKIA 3ICRA 3NHOX 1M64A 3ATQA 3D1CA 4H2RA 3ICSA 3EANA 1CJ4A 2B9YA 1GRGA 2C70A 1PXCA 4H4RA 3BI5A 1NENA 3BHFA 3GWFA 1H6VA 2CULA 4OPTA 4TM0A 2GQFA 2BS4A 1GERA 1Q1RA 4NEWA 2BC1A 1LJ1A 1LVLA 4KX6A 3AEGA 4J56A 2Q0KA 4OPGA 2WU5A 3AEFA 3F8RA 4NZHA 4H4PA 3CPJG 3DH9A 4C3YA 3M13A 1E1NA 2GR1A 2A8XA 1Z6LA 2QA2A 1KSSA 2V6OA 1RSGA 2YM2A 1KNRA 4H4VA 1RYIA 1H7WA 2I0ZA 2GEWA 4Z24A 1CC2A 1ZY8A 1NG3A 5JCIA 2BK4A 1E39A 4ICYA 3IHGA 3NTAA 1AOGA 3RP7A 1F6MA 4CY8A 3F8DA 3IWAA 4I59A 4U2TA 3EF6A 1GSNA 2YG5A 1S3EA 2ACZA 2YLXA 2WHDA 2V5ZA 3F8PA 4AP3A 2WQYA 2EQ9A 2B76A 4OVIA 2IVEA 3KA7A 3AE9A 3ICTA 4I58A 1YQ4A 3QVRA 4ZCDA 4OPDA 3AEDA 3DK9A 3KVEA 3UOZA 3CN8A 1VG0A 3O0HA 5KOWA 1GESA 3GRSA 1QJDA 3H8IA 1IJHA 3AYLA 4OPIA 5KRQA 1H83A 1LV0A 1S2YA 4X4JA 1DXLA 4OPLA 2GAGB 2XVIA 4A99A 2C66A 1IUVA 3VR8A 2DKHA 2YLWA 1JU2A 3K7QX 3AEAA 2XFUA 4PABA 4Z43A 2WDRA 5L46A 1EL8A 3CNDA 3AE2A 3DK8A 1V59A 1TYTA 3AE3A 2IIDA 3H8LA 5CQFA 1CJCA 2VVLA 1TDOA 1EL9A 3E1TA 4MJWA 4PAAA 4RSLA 3V76A 1DODA 2C3DA 3AEBA 3CNJA 3CPHG 1CF3A 3P4QA 1ZMCA 2JK6A 1B37A 2BXSA 2OLNA 2FBWA 2WU2A 4EMIA 1H81A 4TM4A 4RG3A 4EIPA 4AOSA 1OJAA 1PBEA 1GREA 1E1LA 3M12A 2YR6A 4JNQA 3UTFA 1N4UA 2WPFA 4E0VA 2TMDA 3CNTA 3NK1X 3RP6A 3NKSA 4JY3A 1FEBA 1ELIA 4HA6A 2GQWA 2XVJA 3H4KA 1IUWA 1QO8A 3OZ2A 2FJDA 4CNKA 2BK3A 2BYBA 2BS2A 1TYPA 2GH5A 3QSSA 1EBDA 1N4VA 3GWDA 1PXBA 1D4DA 4ZCCA 4C3XA 5KVIA 1FCDA 2E5VA 4EQWA 3KU9A 4TLZA 3AE5A 5KOXA 2RGHA 3FBSA 4LIIA 3LOVA 4JNAA 2R0PA 3BNMA 3GMBA 3CGBA 2WDQA 1N4WA 2Z5XA 4KPRA 3UKFA 5IPYA 1PBCA 5JCMA 4U2LA 2WOWA 2WOVA 4CCQA 1DJQA 1L9DA 3CNSA 4YTMA 1DNCA 2OALA 1OJ9A 1P2HA 1YY5A 4U8MA 2YG7A 4U2SA 2QAEA 1PJ5A 2BXRA 2ZZ0A 2GV8A 1TRBA 2WP9A 1XPQA 5KWFA 3Q9TA 4K5SA 3AWIA 4JQ9A 3HZLA 4U8IA 1GTEA 1TDKA 2RGJA 2VVLG 2APGA 1JEHA 1H84A 3NTDA 4B66A 4Z2RA 3AE6A 2GAHB 2R46A 1P2EA 3NRNA 4AP1A 3ZDNA 2EQ6A 3CPIG 5FS8A 1FL2A 1EL5A 2FJEA 2XLRA 2VZ2A 4UDRA 3NLCA 3AEEA 1JNZA 3REDA 3P4RA 1S3BA 4IA5A 1M6IA 3SQPA 3K30A 2R9ZA 5JCNA 3P4SA 4J31A 1GT8A 2VOUA 3DA1A 3L1RA 1COYA 1PBDA 3SGLA 4A5LA 1EL7A 2X8GA 4H2NA 4EMJA 4EQSA 3ATRA 2E1MA 2RABA 3KKJA 2WBAA 3SM8A 2O9ZA 2Q7VA 2YG4A 4YSHA 2R4EA 1NEKA 2TPRA 1IUXA 2BS3A 3D8XA 4U8JA 1GEUA 2NPXA 2GMHA 1LQTA 4APNA 3LXDA 1FEAA 2A87A 3UTEA 3UOXA 1GRTA 2WEUA 3NYEA 3C4NA 3UKPA 1H82A 4Z2UA 4HB9A 1E6EA 1GRAA 2WS3A 3ALLA 4Y4NA 3GRTA 3NN6X 2CFYA 3UKQA 4FK1A 3BHKA 2Q6UA 1GV4A 4K8DA 1PJ7A 4Z26A 2WDVA 3KLJA 4CCRA 3M0OA 1IUTA 3CGDA 3ALJA 3UOYA 1GETA 2Q0LA 1BGJA 3CIRA 3JSKA 3UP4A 3DJDA 3CTYA 1DOEA 4YTNA 1L9CA 1Y0PA 4A79A 1H7XA 4UDPA 2BA9A 5JCLA 3EAOA 3DGZA
chains in the Genus database with same CATH superfamily
2R45A 3NNEA 3SZWA 5JCKA 3DMEA 1E9IA 4H1ZA 4MGGA 3G5SA 3ZVHA 2FJAA 2XLUA 4M52A 1NU5A 4U8PA 3VDGA 3AYJA 4EQXA 4JHMA 1KKOA 4NWZA 5IDZA 3OW1A 2C65A 1CBOA 3QJ4A 4Z44A 2W54A 1D7YA 1FFVC 2GMJA 3DJEA 3FMWA 3ZLHA 1W4XA 5HYMA 4A3RA 2BCPA 2PP3A 3GO2A 2CDUA 2AL2B 1B5QA 3IF9A 4ECHA 3NN0X 1PHHA 1TDNA 2JBVA 1PDYA 4A6NA 1BKWA 2VRMA 4KPLA 1ZDLA 4TLXA 1K0IA 5FS9A 5LV9A 3C96A 4HNLA 1GALA 4C77A 4E4FA 2YAUA 4C5OA 3Q6JA 1REOA 5ER0A 3ZLGA 3V3NA 3AD8B 5FJPA 2PTZA 2C67A 3UCLA 2PTXA 3UKKA 3L8KA 4DX3A 1TDFA 4HYRA 1F9CA 3V5FA 3NT6A 2X3NA 3CAWA 1XANA 2YVGA 1ZK7A 3DJGX 4U8OA 2PP1A 3RO6A 4GF7A 4H4TA 3DIPA 4H4XA 1JRZA 3KD9A 1ZOYA 1CHUA 3NVVB 4G7FA 3NYCA 4K2SA 3AD7B 4GR1A 3VRDB 3SR6B 2OFJA 3PWIA 3D47A 2X50A 1T3QC 4K5RA 5J7XA 4BK3A 5BRTA 1YKJA 3VRAA 3OC4A 4ROPA 1BGNA 1D5TA 3KUMA 3UXLA 5TR3A 1WYGA 3UJEA 2XVFA 3GDPA 3RITA 4JY2A 2WP5A 2X99A 2Y6QA 5DBJA 3DK4A 2PS2A 1F8RA 2YLSA 2YLRA 2Y6RA 3T31A 2GSHA 3MWCA 5EB4A 2WOIA 2JB1A 2XYOA 5KMPA 2YR5A 3V3OA 1ECQA 4IL2A 2R4JA 4DNAA 1TKKA 4JN9A 4FDCB 4A7AA 2PGEA 2GR2A 4ZN0A 2BRAA 3NXLA 4TM3A 1KD0A 3D9XA 3IJLA 4GDEA 4IVMB 2AAQA 4USRA 3UJSA 4F4RA 3TJ4A 3ICRA 3NHOX 3EUB3 4TM0A 1H6VA 3HYXA 2QVHA 1Q1RA 4NEWA 2BC1A 1LVLA 4OPGA 3CPJG 3DH9A 2BRYA 2A8XA 2V6OA 1KNRA 1CC2A 1ZY8A 3RP7A 1F6MA 4CY8A 2OVLA 3UCCA 1GSNA 1S3EA 2ACZA 2YLXA 3F8PA 2EQ9A 2B76A 3KA7A 3IK4A 3AE9A 4I58A 3FVDA 3P93A 3CN8A 1VG0A 3O0HA 3TTEA 1H83A 1LV0A 4OPLA 2W3RA 2GAGB 3MQTA 3N6JA 4ZA0A 3AEAA 5L46A 1NELA 1EL8A 3DK8A 2VVLA 1EL9A 4PAAA 1DODA 2C3DA 3AEBA 3CNJA 3QN3A 2JK6A 2OZTA 4TM4A 4EIPA 4AOSA 1OJAA 1PBEA 1E1LA 4JNQA 1N4UA 3I4KA 3CMMA 3NK1X 3RP6A 3H4KA 3AMZA 2BYBA 3QSSA 5G5HB 1PXBA 4M6UA 3DG6A 4TLZA 2RGHA 3LOVA 4LIIA 4JNAA 2R0PA 3A7UA 2OG9A 2DW7A 2Z5XA 3MY9A 4IHCA 6ENLA 5IPYA 5JCMA 2WOVA 3I6EA 4G6HA 2OX4A 2QAEA 3DG7A 1PJ5A 2BXRA 1TRBA 1XPQA 2VVLG 1H84A 4GGHA 3AE6A 2R46A 1KN0A 1SJCA 2EQ6A 1L8PA 3UXKA 4KWSA 3REDA 4IA5A 3P4SA 1GT8A 3B9JB 1PBDA 3ATRA 2NQLA 2QDEA 3SM8A 4YSHA 3ES8A 1IUXA 3D8XA 3OP2A 3LXDA 1FEAA 3UTEA 1GRTA 2WEUA 3C4NA 4HB9A 4Y4NA 4FK1A 4K8DA 4Z26A 1S7MA 1IUTA 3R10A 3UP4A 2HXUA 1DOEA 3T2ZA 2BA9A 3DGZA 1JOAA 2HQMA 2AKMA 4H4QA 4B69A 2B9WA 1BWCA 3PO7A 3B3RA 2GF3A 2PCEA 3CNPA 1ZX9A 3NVZB 1H86A 3QTPA 1OJDA 3Q4DA 3PVCA 4YWOA 2WETA 1YQ3A 5KVHA 4Z25A 4UP3A 1CC4A 2PTYA 1OJTA 3GD3A 4Z1YA 2JKCA 3U4FA 7ENLA 3BNUA 3PS9A 3TQPA 3S47A 2PODA 1VDCA 2ZZCA 2IVDA 2WP6A 3URHA 4J1OA 2XFOA 3RNMA 2JB3A 1XDIA 4ZCWA 1GRBA 3VFCA 3NK2X 2XCGA 4AT2A 1KSUA 2YLZA 2C76A 2ARDA 2PMQA 3CK5A 2XFQA 2XVHA 4B67A 4H19A 4DYEA 2OAMA 4G73A 5BUKA 4E5TA 5C2TA 3R9UA 4GAVA 3UTGA 4A9WA 3ALMA 4FI4A 4EIQA 4Z2TA 3BI4A 1F3PA 2ZBWA 3P4PA 3THUA 1JRPA 3UKHA 3TOYA 2C72A 1SJAA 5EOWA 2XGZA 5U25A 4CBQA 5BULA 4REKA 4YSXA 1PDZA 2AQJA 3QKEA 3NIXA 3U9IA 2XH4A 2XLSA 3AE7A 3SX6A 1FECA 4K7ZA 3ES7A 3AE8A 2RGOA 1NPXA 4H4YA 1NAAA 4ADWA 3T0KA 2BABA 3QSEA 1BZLA 3HYWA 1N62C 1BQGA 3OTRA 1CL0A 4JDRA 2PYXA 4X9NA 5U1OA 2X8HA 4NNJA 1JNRA 2GVCA 2GB0A 3K1GA 1K0JA 3AB1A 2AR8A 2EQ7A 3K7MX 1SJDA 1PXAA 1KDGA 3V5CA 5M0ZA 1LPFA 2YG6A 3VRBA 1SB3B 4CNJA 2OKTA 5IQ1A 1F8SA 3NK0X 3RRAA 3TCSA 2OLOA 1ELSA 3ZYXA 3N4FA 2XVEA 3BOXA 2XFPA 3UJRA 4EM3A 4YTPA 1JPMA 4EQRA 1GRFA 2P88A 1IUUA 1GRHA 4U8LA 4YT0A 1UKVG 5HHFA 4A6NB 5EBKA 5HXIA 4DHGA 2W3SA 3T4WA 3TW9A 4BV6A 1B8SA 2GGIA 4NTDA 1H2IA 3S5WA 4CY6A 1HYUA 2QA1A 2VQ7A 3P1WA 4U8NA 3K7TA 3CT2A 3PWGA 1VQZA 4J33A 2GRTA 4YSYA 2NVKX 1ZKQA 3UGVA 4TM1A 2V3BA 3QSMA 3AECA 1DOBA 1VRQB 2YG3A 4GAPA 4K2XA 3VQRA 4H2RA 3D1CA 1RM6B 2C70A 1PXCA 1NENA 4G8TA 2GQFA 3V3WA 1GERA 4KX6A 1LJ1A 3AEGA 2Q0KA 3DEQA 4NZHA 3GYXA 3SZFA 3M13A 2FYMA 3H7VA 1SJBA 2YM2A 1H7WA 3CXBA 4Z24A 2OQYA 5JCIA 3N4EA 2DW6A 3IWAA 2WQYA 3RGTA 3ICTA 2CHRA 1YQ4A 3UOZA 1N60C 3GRSA 3H8IA 3FV9A 4GYPA 5KRQA 2XVIA 3RCYA 1IUVA 2YLWA 3K7QX 1MNSA 4Z43A 2WDRA 3H8LA 5CQFA 1CJCA 3E1TA 3V76A 1MDLA 3P4QA 2WU2A 3SN1A 2FBWA 4EMIA 4GYPC 3UCDA 3M12A 3NS1B 3UTFA 4E0VA 3IJIA 4HA6A 2GQWA 3OZ2A 2XVJA 1IUWA 2QJMA 2BK3A 2BS2A 3QPEA 1N4VA 3FCPA 5KVIA 1FCDA 1EBHA 3AE5A 1N61C 3FBSA 3CGBA 4KPRA 5KMSA 1PBCA 2MUCA 2WOWA 4CCQA 3CNSA 1P2HA 4U8MA 1YY5A 1FO4A 2HNEA 2WP9A 5KWFA 3AWIA 1GTEA 1TDKA 4A35A 3NVWB 3NRNA 1FHVA 2VZ2A 3NLCA 3AEEA 3P4RA 1S3BA 1M6IA 3K30A 2R9ZA 3ZLFA 1COYA 1X2HA 1EL7A 2X8GA 4H2NA 2E1MA 1OEPA 3SBFA 2WBAA 2Q7VA 2YG4A 1NEKA 2NPXA 2GMHA 2PA6A 3UOXA 3NYEA 3MZNA 1GRAA 2WS3A 3ALLA 3BHKA 1GV4A 2WDVA 1TZZA 3M0OA 4CCRA 3ALJA 1GETA 1BGJA 3DJDA 4YTNA 1Y0PA 4A79A 1H7XA 3MKCA 3EAOA 3OZMA 5BOFA 2YQUA 3T9PA 2XSXA 2R0CA 3SFEA 2C7GA 2FKPA 1BF3A 3T37A 4H50A 1B4VA 4IP5A 4N9XA 2JB2A 3G5RA 4B63A 3EKGA 1XPYA 4IV9A 2GR3A 5EB5A 2R0GA 5KMQA 4O5UA 3VCCA 1MOKA 3H12A 1PDHA 4XWRA 3EPTA 3AE1A 3NG7X 3C4AA 4FK1C 4H2PA 3GY1A 4H4SA 4Z17A 1JRYA 3RHAA 2VRLA 1E7PA 4FX9A 1NHRA 1KF6A 1KFYA 1OJCA 3QFAA 4RG4A 1PN0A 3OPSA 2JAEA 4H4WA 3RP8A 2B7SA 1FHUA 2PSNA 3H70A 3LJPA 4BK1A 2CVJA 3SXIA 4Y4MA 2BK5A 4JN8A 4U8KA 4D04A 4BJZA 3D46A 3VCNA 4H2QA 5U63A 4YXDA 3UKAA 3H8AA 3T6CA 4H7UA 5FS7A 3LB8A 4OCGA 1NHQA 2E3TA 2WPCA 4MMWA 2W0HA 3JW7A 3QFBA 3RR1A 5BOEA 1Y56B 4J36A 3GDNA 3ETRB 3R1ZA 3LZWA 1O95A 2C64A 2OA1A 2J3NA 3GYIA 4Y4LA 4LA1A 1CJ2A 1YQZA 3DGHA 1X31B 1XHCA 4HCLA 2V3AA 4KEMA 1EC8A 3B6DA 4WCTA 1FFUC 4BJYA 1YEYA 4BURA 3IJQA 2XFNA 3AM9A 4OPUA 4WX1A 2C3CA 4IA6A 2X8CA 1PJ6A 1VQWA 2V61A 3CGCA 1TDEA 4EMWA 2EQ8A 1D7LA 3FXGA 2XDOA 2PHHA 1NDAA 3NH3X 1EC9A 1O94A 1L0VA 4B65A 3BJSA 3UP5A 3SFDA 3R0KA 1ONFA 3COXA 4J57A 1PS9A 3I6TA 2H88A 2YM1A 4NTCA 1R6WA 3KPKA 2OPJA 4YSZA 4IZGA 5KXJA 5M10A 1TE6A 4UDQA 3EEZA 1N1PA 3T14A 5FJTA 4X9MA 1IUSA 1N63C 3S61A 1P48A 4GRTA 3NRZB 4EWJA 3R07C 4GFIA 2YVFA 1GXFA 5CKUA 1ZOVA 2OLAA 2VVMA 5FJOA 2BACA 3CGEA 4J3ZA 1E1KA 4AT0A 3VR9A 2QGYA 2ONEA 4M0XA 2GL5A 3GMCA 3QLDA 5FJRA 3NYFA 4K8GA 1DJNA 1GPEA 2WPEA 5FJUA 5FMHA 3FG2P 2OO6A 1GTHA 2XH7A 4NTEA 2XH0A 1W6TA 2WESA 4B68A 1E1MA 3CXOA 2DKIA 1M64A 1EC7A 2B9YA 1CJ4A 3WE0A 2HXTA 3BHFA 1EBGA 2BS4A 2WU5A 3AEFA 2POZA 3F8RA 4H4PA 4C3YA 2PU1A 1E1NA 2GR1A 2QA2A 1KSSA 2I5QA 4H4VA 3TWBA 2BK4A 3NTAA 1AOGA 2W55A 3F8DA 4U2TA 3EF6A 2YG5A 4GGBA 2V5ZA 4AP3A 3SN4A 2PU0A 3QVRA 3B97A 4IT1A 3P0WA 3AEDA 3DK9A 1GESA 1QJDA 3AYLA 1N5WC 1S2YA 2C66A 3VR8A 1JDFA 1JU2A 3SYIA 2XFUA 4PABA 3AE2A 1TYTA 2IIDA 1TDOA 3SQSA 4RSLA 5KMRA 3HW2A 4H2HA 1ZMCA 2OLNA 1H81A 4RG3A 2MNRA 2PTWA 1GREA 3NZGA 2TMDA 3CNTA 3NKSA 4JY3A 1FEBA 2ZADA 4CNKA 3A7AA 1ONEA 2GH5A 4G6GA 1JPDX 4GMEA 3GWDA 3S5SA 4HPNA 3DG3A 4C3XA 2E5VA 3PFRA 2P3ZA 3GMBA 4TVWA 2WDQA 2P8CA 2GGJA 3UKFA 4HNCA 2RDXA 1DJQA 4YTMA 1DNCA 2OALA 1OJ9A 2YG7A 4JN7A 2ZZ0A 2GV8A 2AKZA 3V4BA 3HZLA 1VDVA 2E5AA 2RGJA 1JEHA 3NTDA 4IP4A 4B66A 4Z2RA 4AP1A 2GAHB 3MSYA 4TVYA 4G9KA 3CPIG 5FS8A 1FL2A 4UDRA 1JNZA 2AL1A 2GDQA 3DDMA 4J31A 4X2PA 2VOUA 3DA1A 4A5LA 4EQSA 2RABA 2O9ZA 2PGWA 2R4EA 3DERA 2TPRA 4H83A 4U8JA 4II3A 1GEUA 2O56A 2A87A 4G74A 3UKPA 1H82A 1MDRA 4Z2UA 1E6EA 2Q6UA 3SJNA 3DFHA 3KLJA 3PG6A 3UOYA 3CIRA 3JSKA 1L9CA 4UDPA 2AL2A 2GR0A 4P9SA 4CRTA 1JCTA 2C75A 3IHMA 3ENLA 4H4UA 4ZOHB 3HRDC 3UOVA 3UTHA 2E4GA 1NG4A 2P0IA 1PBBA 4A65A 4XWZA 3AE4A 2YLTA 3IC9A 1PBFA 4DWDA 1D4EA 4O5QA 3FYYA 3GD4A 1Y56A 3P3BA 2B9XA 3QVPA 4H4ZA 4EM4A 3BI2A 5BVAA 1ZP0A 5KNLA 3NGCX 4D03A 4YKFA 3FPZA 4NEVA 1VG9A 3GD6A 3DESA 3UJFA 3T8QA 2ZC8A 5J04A 1RP0A 3FJ4A 1S2QA 2GGGA 3II4A 3Q45A 1P43A 3AYIA 1F8WA 3GYJA 4GUVA 3JZUA 2BC0A 4E8GA 2QDDA 3DGBA 2C73A 2ZZBA 3SY4A 1GOSA 4OPCA 2UZZA 3R25A 2YWLA 3ITJA 3ISHA 3G5QA 1Q9IA 4USQA 4YWSA 3AXBA 1NHSA 1JRXA 3TWAA 1CC6A 4A6GA 4AOXA 2B7RA 2YVJA 4GDPA 3SZ0A 4GCMA 2QJJA 3NO1A 4J34A 3SZCA 1V97A 3T2YA 1KCZA 4IL0A 4LU6A 4E4UA 1QLBA 4E6MA 4B64A 3I3LA 2FJBA 4DSGA 1WUFA 2P8BA 3PK7A 2PP0A 2XLTA 1DOCA 1ZMDA 3TJIA 2OZ3A 2XLPA 3P9UA 3MUCA 3SN0A 1CJ3A 1MO9A 1WUEA 5C3JA 3UKLA 3R0UA 1FOHA 5ENLA 1NHPA 4IVOB 2A89A 3FIMB 2VQBA 3N6HA 4J2WA 5EU9A 3ZVIA 4C74A 3GSIA 5GSNA 3ADAB 2V60A 3NFUA 3L5OA 2BCGG 2QQ6A 2YR4A 2QCUA 3ABVA 2H89A 4DGKA 4YKGA 1LTXR 3KPFA 4HN8A 3I6DA 5IQ4A 4B1BA 1KKRA 2F5ZA 5GRTA 1R0MA 1KNPA 4K1WA 1MRAA 1LQUA 1O5WA 4DSHA 3DJJA 5JRBA 1XS2A 2Z5YA 4XXGA 1D4CA 1K4QA 3AD9B 1MXTA 3T2KA 3LZXA 1GNDA 1SEZA 5HY5A 5J60A 5FS6A 1FIQB 1K0LA 1L9EA 2QJNA 4K22A 4BK2A 3LADA 1Q1WA 4II2A 1IYXA 3ATQA 3ICSA 3EANA 1GRGA 3BI5A 4H4RA 4OPTA 3GWFA 3HPFA 2CULA 3BSMA 4J56A 2PPGA 3DFYA 3ZVHB 4FP1A 1Z6LA 1RSGA 3AN1A 1RYIA 3UJ2A 2I0ZA 2GEWA 1NG3A 1E39A 4ICYA 3IHGA 4GIRA 4I59A 2WHDA 4OVIA 2IVEA 3JVAA 4ZCDA 4OPDA 4DXKA 3KVEA 5KOWA 4DN1A 1IJHA 4OPIA 4X4JA 1DXLA 2GGHA 4A99A 2XH2A 4ENLA 2DKHA 3STPA 3CNDA 1V59A 3AE3A 1BKHA 4MJWA 4KT2A 2OQHA 3A7RA 1CF3A 3CPHG 3SSZA 1B37A 2BXSA 4HCHA 1STZA 2YR6A 2WPFA 1RVKA 1ELIA 1QO8A 2FJDA 1TYPA 4MKSA 1EBDA 1D4DA 4ZCCA 1X2GA 4EQWA 3KU9A 5KOXA 2OZ8A 3BNMA 3VA8A 1DTNA 1N4WA 4HCDA 3CB3A 4U2LA 1MUCA 1L9DA 4U2SA 3VC5A 3Q9TA 4K5SA 4U8IA 4JQ9A 2APGA 1P2EA 3ZDNA 2XLRA 3HYVA 1EL5A 2FJEA 3VC6A 3SQPA 4GISA 5JCNA 3L1RA 1JROA 3SGLA 4EMJA 3KKJA 3CYJA 2BS3A 3R11A 1LQTA 4APNA 2C4CA 3GRTA 3NN6X 5G5GB 2CFYA 1N5XA 3UKQA 1PJ7A 2HZGA 3GC2A 3CGDA 2GGEA 3NVYB 2Q0LA 3OZYA 1ZXIC 5JCLA 3CTYA
chains in the Genus database with same CATH topology
2R0CA 2GR0A 1JOAA 2R45A 3NNEA 3SFEA 2HQMA 4H4QA 4P9SA 4B69A 2C7GA 2B9WA 3SZWA 5JCKA 4CRTA 3DMEA 1BWCA 3G5SA 3PO7A 1BF3A 2C75A 3B3RA 2FJAA 3IHMA 4H50A 3T37A 2GF3A 1B4VA 2XLUA 4H4UA 2JB2A 3G5RA 4M52A 3CNPA 4N9XA 3UOVA 4B63A 1ZX9A 3UTHA 4IV9A 2E4GA 4U8PA 1H86A 1NG4A 3AYJA 4EQXA 1OJDA 2GR3A 1PBBA 3PVCA 4YWOA 2WETA 5EB5A 4A65A 2R0GA 5KMQA 1YQ3A 4O5UA 4NWZA 4XWZA 3AE4A 2YLTA 5KVHA 4Z25A 4UP3A 1MOKA 3IC9A 1CC4A 2C65A 3WE0A 1PDHA 1PBFA 1OJTA 3GD3A 1CBOA 3QJ4A 2JKCA 4XWRA 4Z44A 3EPTA 3AE1A 3BNUA 1D4EA 3PS9A 4O5QA 1D7YA 3GD4A 3NG7X 1Y56A 3C4AA 2B9XA 4FK1C 3QVPA 2GMJA 4H4ZA 3DJEA 1W4XA 3FMWA 4H2PA 1VDCA 5HYMA 4EM4A 2ZZCA 3BI2A 2IVDA 5BVAA 4H4SA 2WP6A 3URHA 1ZP0A 5KNLA 2BCPA 3NGCX 4D03A 2XFOA 4YKFA 3RNMA 2JB3A 1JRYA 1XDIA 3FPZA 3RHAA 1GRBA 2CDUA 2VRLA 4NEVA 1E7PA 3NK2X 1VG9A 4FX9A 2XCGA 1B5QA 4AT2A 1KSUA 1NHRA 1KF6A 3IF9A 4ECHA 1KFYA 1OJCA 2YLZA 3QFAA 2C76A 4RG4A 1PN0A 2JAEA 3NN0X 1PHHA 1RP0A 2ARDA 4H4WA 1TDNA 2JBVA 3RP8A 4A6NA 1BKWA 1S2QA 2XFQA 2VRMA 2XVHA 2B7SA 4B67A 2OAMA 5BUKA 4G73A 3II4A 1ZDLA 5C2TA 3LJPA 4TLXA 4BK1A 1K0IA 3AYIA 2CVJA 3SXIA 4Y4MA 1F8WA 5FS9A 2BK5A 3R9UA 3GYJA 4GAVA 4U8KA 4D04A 4BJZA 3UTGA 4A9WA 4GUVA 3ALMA 4EIQA 4Z2TA 5LV9A 3C96A 2BC0A 3BI4A 1GALA 4H2QA 5U63A 4YXDA 1F3PA 4C77A 2ZBWA 3UKAA 4H7UA 5FS7A 3P4PA 3LB8A 2C73A 4OCGA 2YAUA 2ZZBA 1NHQA 2WPCA 3SY4A 3UKHA 4C5OA 2W0HA 3Q6JA 1REOA 3QFBA 1GOSA 4OPCA 5ER0A 2C72A 1Y56B 3V3NA 3AD8B 5EOWA 4J36A 3GDNA 2C67A 2UZZA 3LZWA 3UCLA 5U25A 3UKKA 2YWLA 1O95A 3L8KA 3ITJA 2C64A 2OA1A 3ISHA 2J3NA 3G5QA 4CBQA 1Q9IA 1TDFA 5BULA 4USQA 3GYIA 4REKA 4YSXA 2AQJA 4Y4LA 3AXBA 3NT6A 4LA1A 1NHSA 3NIXA 1JRXA 2X3NA 1CJ2A 1CC6A 1YQZA 3DGHA 1X31B 2XLSA 1XHCA 4AOXA 2B7RA 2V3AA 2YVJA 1XANA 3AE7A 2YVGA 3SX6A 1ZK7A 3DJGX 1FECA 4U8OA 4K7ZA 3AE8A 3B6DA 4WCTA 2RGOA 1NPXA 4H4YA 1NAAA 4GDPA 3SZ0A 4H4TA 4GCMA 4GF7A 4BJYA 4H4XA 1JRZA 4J34A 3KD9A 1ZOYA 4BURA 3SZCA 1CHUA 2XFNA 4ADWA 4OPUA 3T2YA 3NYCA 4WX1A 4LU6A 2C3CA 4IA6A 3T0KA 2BABA 1QLBA 2X8CA 4B64A 1PJ6A 1VQWA 2FJBA 2V61A 3AD7B 4GR1A 3CGCA 3I3LA 1TDEA 3QSEA 4DSGA 1BZLA 4EMWA 3HYWA 2EQ8A 1D7LA 2XLTA 1DOCA 1CL0A 2XDOA 3VRDB 4JDRA 1ZMDA 2PYXA 4X9NA 2XLPA 5U1OA 2PHHA 3P9UA 1CJ3A 2X8HA 1MO9A 1NDAA 1JNRA 2GB0A 2GVCA 3NH3X 1O94A 4NNJA 1K0JA 1L0VA 5C3JA 4B65A 3AB1A 2AR8A 3UKLA 2EQ7A 3UP5A 3SFDA 3K7MX 2X50A 1FOHA 1NHPA 4IVOB 2A89A 4K5RA 3FIMB 5J7XA 1PXAA 1ONFA 1KDGA 3COXA 2VQBA 4J57A 4BK3A 1PS9A 5BRTA 1YKJA 5M0ZA 1LPFA 2YG6A 4J2WA 3VRBA 2H88A 3VRAA 2YM1A 4CNJA 3OC4A 4NTCA 5IQ1A 4C74A 1F8SA 3GSIA 3KPKA 3NK0X 2OLOA 1BGNA 4YSZA 1D5TA 5GSNA 3ADAB 2V60A 5KXJA 5M10A 3ZYXA 5TR3A 2XVEA 2XFPA 3L5OA 4UDQA 2XVFA 3GDPA 4EM3A 4YTPA 4JY2A 1N1PA 2WP5A 2BCGG 3T14A 2YR4A 2X99A 4EQRA 2Y6QA 2QCUA 5DBJA 3DK4A 4X9MA 3ABVA 2H89A 1IUSA 4DGKA 1GRFA 3S61A 4YKGA 1F8RA 1IUUA 2YLSA 1LTXR 1GRHA 4U8LA 2YLRA 2Y6RA 3T31A 3KPFA 4YT0A 4GRTA 1UKVG 3I6DA 5HHFA 5IQ4A 5EB4A 5EBKA 2WOIA 4A6NB 5HXIA 2JB1A 2XYOA 4B1BA 4BV6A 2F5ZA 1B8SA 5KMPA 5GRTA 1KNPA 4NTDA 1H2IA 2YVFA 1GXFA 2YR5A 1LQUA 5CKUA 3S5WA 3V3OA 4CY6A 1ZOVA 1O5WA 2VVMA 4AT0A 2BACA 3CGEA 4DSHA 1E1KA 3DJJA 2R4JA 4DNAA 3VR9A 1HYUA 2QA1A 2VQ7A 4JN9A 4FDCB 5JRBA 3GMCA 3P1WA 4U8NA 4A7AA 3NYFA 3K7TA 1DJNA 2Z5YA 2GR2A 4ZN0A 1GPEA 2BRAA 1D4CA 1K4QA 3AD9B 4XXGA 4J33A 1MXTA 3T2KA 3LZXA 1GNDA 4TM3A 2GRTA 2WPEA 1SEZA 4YSYA 5HY5A 3D9XA 5J60A 5FS6A 2NVKX 4GDEA 1ZKQA 5FMHA 3FG2P 1L9EA 1K0LA 4IVMB 4TM1A 2AAQA 2V3BA 1GTHA 3QSMA 4K22A 3LADA 4USRA 4NTEA 4BK2A 1Q1WA 3AECA 1DOBA 1VRQB 2YG3A 4GAPA 4II2A 4K2XA 2WESA 2YQUA 4B68A 1E1MA 3VQRA 2DKIA 3ICRA 3NHOX 1M64A 3ATQA 3D1CA 4H2RA 3ICSA 3EANA 1CJ4A 2B9YA 1GRGA 2C70A 1PXCA 4H4RA 3BI5A 1NENA 3BHFA 3GWFA 1H6VA 2CULA 4OPTA 4TM0A 3HYXA 2GQFA 2BS4A 1GERA 1Q1RA 4NEWA 2BC1A 1LJ1A 1LVLA 4KX6A 3AEGA 4J56A 2Q0KA 4OPGA 2WU5A 3AEFA 3F8RA 4NZHA 4H4PA 3GYXA 3CPJG 3DH9A 3SZFA 4C3YA 2BRYA 3M13A 1E1NA 2GR1A 2A8XA 1Z6LA 2QA2A 1KSSA 2V6OA 1RSGA 2YM2A 1KNRA 4H4VA 1RYIA 1H7WA 2I0ZA 2GEWA 4Z24A 1CC2A 1ZY8A 1NG3A 5JCIA 2BK4A 1E39A 4ICYA 3IHGA 3NTAA 1AOGA 3RP7A 1F6MA 4CY8A 3F8DA 3IWAA 4I59A 4U2TA 3EF6A 1GSNA 2YG5A 1S3EA 2ACZA 2YLXA 2WHDA 2V5ZA 3F8PA 4AP3A 2WQYA 2EQ9A 2B76A 4OVIA 2IVEA 3KA7A 3AE9A 3ICTA 4I58A 1YQ4A 3QVRA 4ZCDA 4OPDA 3AEDA 3DK9A 3KVEA 3UOZA 3CN8A 1VG0A 3O0HA 5KOWA 1GESA 3GRSA 1QJDA 3H8IA 1IJHA 3AYLA 4OPIA 5KRQA 1H83A 1LV0A 1S2YA 4X4JA 1DXLA 4OPLA 2GAGB 2XVIA 4A99A 2C66A 1IUVA 3VR8A 2DKHA 2YLWA 1JU2A 3K7QX 3AEAA 3SYIA 2XFUA 4PABA 4Z43A 2WDRA 5L46A 1EL8A 3CNDA 3AE2A 3DK8A 1V59A 1TYTA 3AE3A 2IIDA 3H8LA 5CQFA 1CJCA 2VVLA 1TDOA 1EL9A 3E1TA 4MJWA 4PAAA 4RSLA 5KMRA 3V76A 1DODA 2C3DA 3AEBA 3CNJA 3CPHG 1CF3A 3P4QA 1ZMCA 2JK6A 1B37A 2BXSA 2OLNA 2FBWA 2WU2A 4EMIA 1H81A 4TM4A 4RG3A 4EIPA 4AOSA 1OJAA 1PBEA 1GREA 1E1LA 3M12A 2YR6A 4JNQA 3UTFA 1N4UA 2WPFA 4E0VA 3CMMA 2TMDA 3CNTA 3NK1X 3RP6A 3NKSA 4JY3A 1FEBA 1ELIA 4HA6A 2GQWA 2XVJA 3H4KA 1IUWA 1QO8A 3OZ2A 2FJDA 4CNKA 2BK3A 2BYBA 2BS2A 1TYPA 2GH5A 4G6GA 3QSSA 1EBDA 1N4VA 3GWDA 1PXBA 1D4DA 4ZCCA 4C3XA 5KVIA 1FCDA 2E5VA 4EQWA 3KU9A 4TLZA 3AE5A 5KOXA 2RGHA 3FBSA 4LIIA 3LOVA 4JNAA 2R0PA 3BNMA 3GMBA 3CGBA 2WDQA 1N4WA 2Z5XA 4KPRA 3UKFA 5KMSA 5IPYA 1PBCA 5JCMA 4U2LA 2WOWA 2WOVA 4CCQA 1DJQA 1L9DA 3CNSA 4YTMA 1DNCA 2OALA 1OJ9A 1P2HA 1YY5A 4G6HA 2YG7A 4U2SA 4U8MA 2QAEA 1PJ5A 2BXRA 2ZZ0A 2GV8A 1TRBA 2WP9A 1XPQA 5KWFA 3Q9TA 4K5SA 3AWIA 4JQ9A 3HZLA 4U8IA 1GTEA 1TDKA 2RGJA 2VVLG 2APGA 1JEHA 1H84A 3NTDA 4B66A 4Z2RA 3AE6A 2GAHB 2R46A 1P2EA 3NRNA 1KN0A 4AP1A 3ZDNA 2EQ6A 4G9KA 3CPIG 5FS8A 1FL2A 1EL5A 2FJEA 2XLRA 2VZ2A 3HYVA 4UDRA 3NLCA 3AEEA 1JNZA 3REDA 3P4RA 1S3BA 4IA5A 1M6IA 3SQPA 3K30A 2R9ZA 5JCNA 3P4SA 4J31A 1GT8A 2VOUA 3DA1A 3L1RA 1COYA 1PBDA 3SGLA 4A5LA 1EL7A 2X8GA 4H2NA 4EMJA 4EQSA 3ATRA 2E1MA 2RABA 3KKJA 2WBAA 3SM8A 2O9ZA 2Q7VA 2YG4A 4YSHA 2R4EA 1NEKA 2TPRA 1IUXA 2BS3A 3D8XA 4U8JA 4II3A 1GEUA 2NPXA 2GMHA 1LQTA 4APNA 3LXDA 1FEAA 2A87A 3UTEA 3UOXA 4G74A 1GRTA 2WEUA 3NYEA 2C4CA 3C4NA 3UKPA 1H82A 4Z2UA 4HB9A 1E6EA 1GRAA 2WS3A 3ALLA 4Y4NA 3GRTA 3NN6X 2CFYA 3UKQA 4FK1A 3BHKA 2Q6UA 1GV4A 4K8DA 1PJ7A 4Z26A 2WDVA 1S7MA 3KLJA 4CCRA 3M0OA 1IUTA 3CGDA 3PG6A 3ALJA 3UOYA 1GETA 2Q0LA 1BGJA 3CIRA 3JSKA 3UP4A 3DJDA 3CTYA 1DOEA 4YTNA 1L9CA 1Y0PA 3T2ZA 1H7XA 4A79A 4UDPA 2BA9A 5JCLA 3EAOA 3DGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R0C A;  2GR0 A;  1JOA A;  2R45 A;  3NNE A;  3SFE A;  2HQM A;  4H4Q A;  4P9S A;  4B69 A;  2C7G A;  2B9W A;  4CRT A;  5JCK A;  3DME A;  1BWC A;  3G5S A;  3PO7 A;  1BF3 A;  2C75 A;  3B3R A;  2FJA A;  3IHM A;  4H50 A;  3T37 A;  2GF3 A;  1B4V A;  2XLU A;  4H4U A;  2JB2 A;  3G5R A;  4M52 A;  3CNP A;  4N9X A;  3UOV A;  4B63 A;  1ZX9 A;  3UTH A;  4IV9 A;  2E4G A;  4U8P A;  1H86 A;  1NG4 A;  3AYJ A;  4EQX A;  1OJD A;  2GR3 A;  1PBB A;  3PVC A;  4YWO A;  2WET A;  5EB5 A;  4A65 A;  2R0G A;  1YQ3 A;  4O5U A;  4XWZ A;  3AE4 A;  2YLT A;  5KVH A;  4Z25 A;  4UP3 A;  1MOK A;  3IC9 A;  1CC4 A;  2C65 A;  3WE0 A;  1PDH A;  1PBF A;  1OJT A;  3GD3 A;  1CBO A;  3QJ4 A;  2JKC A;  4XWR A;  4Z44 A;  3EPT A;  3AE1 A;  3BNU A;  1D4E A;  3PS9 A;  4O5Q A;  1D7Y A;  3GD4 A;  3NG7 X;  1Y56 A;  3C4A A;  2B9X A;  4FK1 C;  3QVP A;  2GMJ A;  4H4Z A;  3DJE A;  1W4X A;  3FMW A;  4H2P A;  1VDC A;  5HYM A;  4EM4 A;  2ZZC A;  3BI2 A;  2IVD A;  5BVA A;  4H4S A;  2WP6 A;  3URH A;  1ZP0 A;  2BCP A;  3NGC X;  4D03 A;  2XFO A;  4YKF A;  3RNM A;  2JB3 A;  1JRY A;  1XDI A;  3FPZ A;  3RHA A;  1GRB A;  2CDU A;  2VRL A;  4NEV A;  1E7P A;  3NK2 X;  1VG9 A;  4FX9 A;  2XCG A;  1B5Q A;  4AT2 A;  1KSU A;  1NHR A;  1KF6 A;  3IF9 A;  4ECH A;  1KFY A;  1OJC A;  2YLZ A;  3QFA A;  2C76 A;  4RG4 A;  1PN0 A;  2JAE A;  3NN0 X;  1PHH A;  1RP0 A;  2ARD A;  4H4W A;  1TDN A;  2JBV A;  3RP8 A;  4A6N A;  1BKW A;  1S2Q A;  2XFQ A;  2VRM A;  2XVH A;  2B7S A;  4B67 A;  2OAM A;  5BUK A;  3II4 A;  1ZDL A;  5C2T A;  3LJP A;  4TLX A;  4BK1 A;  1K0I A;  3AYI A;  2CVJ A;  4Y4M A;  1F8W A;  5FS9 A;  2BK5 A;  3R9U A;  3GYJ A;  4U8K A;  4D04 A;  4BJZ A;  3UTG A;  4A9W A;  4GUV A;  3ALM A;  4EIQ A;  4Z2T A;  5LV9 A;  3C96 A;  2BC0 A;  3BI4 A;  1GAL A;  4H2Q A;  5U63 A;  4YXD A;  1F3P A;  4C77 A;  2ZBW A;  3UKA A;  4H7U A;  5FS7 A;  3P4P A;  3LB8 A;  2C73 A;  4OCG A;  2YAU A;  2ZZB A;  1NHQ A;  2WPC A;  3UKH A;  4C5O A;  2W0H A;  3Q6J A;  1REO A;  3QFB A;  1GOS A;  4OPC A;  5ER0 A;  2C72 A;  1Y56 B;  3V3N A;  3AD8 B;  5EOW A;  4J36 A;  3GDN A;  2C67 A;  2UZZ A;  3LZW A;  3UCL A;  5U25 A;  3UKK A;  2YWL A;  1O95 A;  3L8K A;  3ITJ A;  2C64 A;  2OA1 A;  3ISH A;  2J3N A;  3G5Q A;  4CBQ A;  1Q9I A;  1TDF A;  5BUL A;  4USQ A;  3GYI A;  4REK A;  4YSX A;  2AQJ A;  4Y4L A;  3AXB A;  3NT6 A;  4LA1 A;  1NHS A;  3NIX A;  1JRX A;  2X3N A;  1CJ2 A;  1CC6 A;  1YQZ A;  3DGH A;  1X31 B;  2XLS A;  1XHC A;  4AOX A;  2B7R A;  2V3A A;  2YVJ A;  1XAN A;  3AE7 A;  2YVG A;  1ZK7 A;  3DJG X;  1FEC A;  4U8O A;  4K7Z A;  3AE8 A;  3B6D A;  4WCT A;  2RGO A;  1NPX A;  4H4Y A;  1NAA A;  4GDP A;  4H4T A;  4GCM A;  4GF7 A;  4BJY A;  4H4X A;  1JRZ A;  4J34 A;  3KD9 A;  1ZOY A;  4BUR A;  1CHU A;  2XFN A;  4ADW A;  4OPU A;  3NYC A;  4WX1 A;  4LU6 A;  2C3C A;  4IA6 A;  2BAB A;  1QLB A;  2X8C A;  4B64 A;  1PJ6 A;  1VQW A;  2FJB A;  2V61 A;  3AD7 B;  4GR1 A;  3CGC A;  3I3L A;  1TDE A;  3QSE A;  4DSG A;  1BZL A;  4EMW A;  2EQ8 A;  1D7L A;  2XLT A;  1DOC A;  1CL0 A;  2XDO A;  3VRD B;  4JDR A;  1ZMD A;  2PYX A;  4X9N A;  2XLP A;  5U1O A;  2PHH A;  3P9U A;  1CJ3 A;  2X8H A;  1MO9 A;  1NDA A;  1JNR A;  2GB0 A;  2GVC A;  3NH3 X;  1O94 A;  1K0J A;  1L0V A;  5C3J A;  4B65 A;  3AB1 A;  2AR8 A;  3UKL A;  2EQ7 A;  3UP5 A;  3SFD A;  3K7M X;  2X50 A;  1FOH A;  1NHP A;  4IVO B;  2A89 A;  4K5R A;  3FIM B;  5J7X A;  1PXA A;  1ONF A;  1KDG A;  3COX A;  2VQB A;  4J57 A;  4BK3 A;  1PS9 A;  5BRT A;  1YKJ A;  5M0Z A;  1LPF A;  2YG6 A;  4J2W A;  3VRB A;  2H88 A;  3VRA A;  2YM1 A;  4CNJ A;  3OC4 A;  4NTC A;  5IQ1 A;  4C74 A;  1F8S A;  3GSI A;  3NK0 X;  2OLO A;  1BGN A;  4YSZ A;  1D5T A;  5GSN A;  3ADA B;  2V60 A;  5KXJ A;  5M10 A;  3ZYX A;  5TR3 A;  2XVE A;  2XFP A;  4UDQ A;  2XVF A;  3GDP A;  4EM3 A;  4YTP A;  4JY2 A;  1N1P A;  2WP5 A;  2BCG G;  2YR4 A;  2X99 A;  4EQR A;  2Y6Q A;  2QCU A;  5DBJ A;  3DK4 A;  4X9M A;  3ABV A;  2H89 A;  1IUS A;  4DGK A;  1GRF A;  3S61 A;  4YKG A;  1F8R A;  1IUU A;  2YLS A;  1LTX R;  1GRH A;  4U8L A;  2YLR A;  2Y6R A;  3KPF A;  4YT0 A;  4GRT A;  1UKV G;  3I6D A;  5HHF A;  5IQ4 A;  5EB4 A;  5EBK A;  2WOI A;  4A6N B;  5HXI A;  2JB1 A;  2XYO A;  4B1B A;  4BV6 A;  2F5Z A;  1B8S A;  5GRT A;  1KNP A;  4NTD A;  2YVF A;  1GXF A;  2YR5 A;  1LQU A;  5CKU A;  3S5W A;  3V3O A;  4CY6 A;  1ZOV A;  1O5W A;  2VVM A;  4AT0 A;  2BAC A;  3CGE A;  4DSH A;  1E1K A;  3DJJ A;  2R4J A;  4DNA A;  3VR9 A;  1HYU A;  2QA1 A;  2VQ7 A;  4JN9 A;  4FDC B;  4A7A A;  3GMC A;  3P1W A;  4U8N A;  3NYF A;  3K7T A;  1DJN A;  2Z5Y A;  2GR2 A;  4ZN0 A;  1GPE A;  4XXG A;  1D4C A;  1K4Q A;  3AD9 B;  4J33 A;  1MXT A;  3LZX A;  1GND A;  4TM3 A;  2GRT A;  2WPE A;  1SEZ A;  4YSY A;  5HY5 A;  5J60 A;  2NVK X;  5FS6 A;  4GDE A;  1ZKQ A;  5FMH A;  3FG2 P;  1L9E A;  1K0L A;  4IVM B;  4TM1 A;  2AAQ A;  1GTH A;  2V3B A;  3QSM A;  4K22 A;  3LAD A;  4USR A;  4NTE A;  4BK2 A;  1Q1W A;  3AEC A;  1DOB A;  1VRQ B;  2YG3 A;  4K2X A;  2WES A;  2YQU A;  4B68 A;  1E1M A;  3VQR A;  2DKI A;  3ICR A;  3NHO X;  1M64 A;  3ATQ A;  3D1C A;  4H2R A;  3ICS A;  3EAN A;  1CJ4 A;  2B9Y A;  1GRG A;  2C70 A;  1PXC A;  4H4R A;  3BI5 A;  1NEN A;  3BHF A;  3GWF A;  1H6V A;  2CUL A;  4OPT A;  4TM0 A;  2GQF A;  2BS4 A;  1GER A;  1Q1R A;  4NEW A;  2BC1 A;  1LJ1 A;  1LVL A;  4KX6 A;  3AEG A;  4J56 A;  2Q0K A;  4OPG A;  2WU5 A;  3AEF A;  3F8R A;  4NZH A;  4H4P A;  3CPJ G;  3DH9 A;  4C3Y A;  3M13 A;  1E1N A;  2GR1 A;  2A8X A;  1Z6L A;  2QA2 A;  1KSS A;  2V6O A;  1RSG A;  2YM2 A;  1KNR A;  4H4V A;  1RYI A;  1H7W A;  2I0Z A;  2GEW A;  4Z24 A;  1CC2 A;  1ZY8 A;  1NG3 A;  5JCI A;  2BK4 A;  1E39 A;  4ICY A;  3IHG A;  3NTA A;  1AOG A;  3RP7 A;  1F6M A;  4CY8 A;  3F8D A;  3IWA A;  4I59 A;  4U2T A;  3EF6 A;  1GSN A;  2YG5 A;  1S3E A;  2ACZ A;  2YLX A;  2WHD A;  2V5Z A;  3F8P A;  4AP3 A;  2WQY A;  2EQ9 A;  2B76 A;  4OVI A;  2IVE A;  3KA7 A;  3AE9 A;  3ICT A;  4I58 A;  1YQ4 A;  3QVR A;  4ZCD A;  4OPD A;  3AED A;  3DK9 A;  3KVE A;  3UOZ A;  3CN8 A;  1VG0 A;  3O0H A;  5KOW A;  1GES A;  3GRS A;  1QJD A;  3H8I A;  1IJH A;  3AYL A;  4OPI A;  5KRQ A;  1H83 A;  1LV0 A;  1S2Y A;  4X4J A;  1DXL A;  4OPL A;  2GAG B;  2XVI A;  4A99 A;  2C66 A;  1IUV A;  3VR8 A;  2DKH A;  2YLW A;  1JU2 A;  3K7Q X;  3AEA A;  2XFU A;  4PAB A;  4Z43 A;  2WDR A;  5L46 A;  1EL8 A;  3CND A;  3AE2 A;  3DK8 A;  1V59 A;  1TYT A;  3AE3 A;  2IID A;  3H8L A;  5CQF A;  1CJC A;  2VVL A;  1TDO A;  1EL9 A;  3E1T A;  4MJW A;  4PAA A;  4RSL A;  3V76 A;  1DOD A;  2C3D A;  3AEB A;  3CNJ A;  3CPH G;  1CF3 A;  3P4Q A;  1ZMC A;  2JK6 A;  1B37 A;  2BXS A;  2OLN A;  2FBW A;  2WU2 A;  4EMI A;  1H81 A;  4TM4 A;  4RG3 A;  4EIP A;  4AOS A;  1OJA A;  1PBE A;  1GRE A;  1E1L A;  3M12 A;  2YR6 A;  4JNQ A;  3UTF A;  1N4U A;  2WPF A;  4E0V A;  2TMD A;  3CNT A;  3NK1 X;  3RP6 A;  3NKS A;  4JY3 A;  1FEB A;  1ELI A;  4HA6 A;  2GQW A;  2XVJ A;  3H4K A;  1IUW A;  1QO8 A;  3OZ2 A;  2FJD A;  4CNK A;  2BK3 A;  2BYB A;  2BS2 A;  1TYP A;  2GH5 A;  3QSS A;  1EBD A;  1N4V A;  3GWD A;  1PXB A;  1D4D A;  4ZCC A;  4C3X A;  5KVI A;  1FCD A;  2E5V A;  4EQW A;  3KU9 A;  4TLZ A;  3AE5 A;  5KOX A;  2RGH A;  3FBS A;  4LII A;  3LOV A;  4JNA A;  2R0P A;  3BNM A;  3GMB A;  3CGB A;  2WDQ A;  1N4W A;  2Z5X A;  4KPR A;  3UKF A;  5IPY A;  1PBC A;  5JCM A;  4U2L A;  2WOW A;  2WOV A;  4CCQ A;  1DJQ A;  1L9D A;  3CNS A;  4YTM A;  1DNC A;  2OAL A;  1OJ9 A;  1P2H A;  1YY5 A;  4U8M A;  2YG7 A;  4U2S A;  2QAE A;  1PJ5 A;  2BXR A;  2ZZ0 A;  2GV8 A;  1TRB A;  2WP9 A;  1XPQ A;  5KWF A;  3Q9T A;  4K5S A;  3AWI A;  4JQ9 A;  3HZL A;  4U8I A;  1GTE A;  1TDK A;  2RGJ A;  2VVL G;  2APG A;  1JEH A;  1H84 A;  3NTD A;  4B66 A;  4Z2R A;  3AE6 A;  2GAH B;  2R46 A;  1P2E A;  3NRN A;  4AP1 A;  3ZDN A;  2EQ6 A;  3CPI G;  5FS8 A;  1FL2 A;  1EL5 A;  2FJE A;  2XLR A;  2VZ2 A;  4UDR A;  3NLC A;  3AEE A;  1JNZ A;  3RED A;  3P4R A;  1S3B A;  4IA5 A;  1M6I A;  3SQP A;  3K30 A;  2R9Z A;  5JCN A;  3P4S A;  4J31 A;  1GT8 A;  2VOU A;  3DA1 A;  3L1R A;  1COY A;  1PBD A;  3SGL A;  4A5L A;  1EL7 A;  2X8G A;  4H2N A;  4EMJ A;  4EQS A;  3ATR A;  2E1M A;  2RAB A;  3KKJ A;  2WBA A;  3SM8 A;  2O9Z A;  2Q7V A;  2YG4 A;  4YSH A;  2R4E A;  1NEK A;  2TPR A;  1IUX A;  2BS3 A;  3D8X A;  4U8J A;  1GEU A;  2NPX A;  2GMH A;  1LQT A;  4APN A;  3LXD A;  1FEA A;  2A87 A;  3UTE A;  3UOX A;  1GRT A;  2WEU A;  3NYE A;  3C4N A;  3UKP A;  1H82 A;  4Z2U A;  4HB9 A;  1E6E A;  1GRA A;  2WS3 A;  3ALL A;  4Y4N A;  3GRT A;  3NN6 X;  2CFY A;  3UKQ A;  4FK1 A;  3BHK A;  2Q6U A;  1GV4 A;  4K8D A;  1PJ7 A;  4Z26 A;  2WDV A;  3KLJ A;  4CCR A;  3M0O A;  1IUT A;  3CGD A;  3ALJ A;  3UOY A;  1GET A;  2Q0L A;  1BGJ A;  3CIR A;  3JSK A;  3UP4 A;  3DJD A;  3CTY A;  1DOE A;  4YTN A;  1L9C A;  1Y0P A;  4A79 A;  1H7X A;  4UDP A;  2BA9 A;  5JCL A;  3EAO A;  3DGZ A; 
#chains in the Genus database with same CATH topology
 2R45 A;  3NNE A;  3SZW A;  5JCK A;  3DME A;  1E9I A;  4H1Z A;  4MGG A;  3G5S A;  3ZVH A;  2FJA A;  2XLU A;  4M52 A;  1NU5 A;  4U8P A;  3VDG A;  3AYJ A;  4EQX A;  4JHM A;  1KKO A;  4NWZ A;  5IDZ A;  3OW1 A;  2C65 A;  1CBO A;  3QJ4 A;  4Z44 A;  2W54 A;  1D7Y A;  1FFV C;  2GMJ A;  3DJE A;  3FMW A;  3ZLH A;  1W4X A;  5HYM A;  4A3R A;  2BCP A;  2PP3 A;  3GO2 A;  2CDU A;  2AL2 B;  1B5Q A;  3IF9 A;  4ECH A;  3NN0 X;  1PHH A;  1TDN A;  2JBV A;  1PDY A;  4A6N A;  1BKW A;  2VRM A;  4KPL A;  1ZDL A;  4TLX A;  1K0I A;  5FS9 A;  5LV9 A;  3C96 A;  4HNL A;  1GAL A;  4C77 A;  4E4F A;  2YAU A;  4C5O A;  3Q6J A;  1REO A;  5ER0 A;  3ZLG A;  3V3N A;  3AD8 B;  5FJP A;  2PTZ A;  2C67 A;  3UCL A;  2PTX A;  3UKK A;  3L8K A;  4DX3 A;  1TDF A;  4HYR A;  1F9C A;  3V5F A;  3NT6 A;  2X3N A;  3CAW A;  1XAN A;  2YVG A;  1ZK7 A;  3DJG X;  4U8O A;  2PP1 A;  3RO6 A;  4GF7 A;  4H4T A;  3DIP A;  4H4X A;  1JRZ A;  3KD9 A;  1ZOY A;  1CHU A;  3NVV B;  4G7F A;  3NYC A;  4K2S A;  3AD7 B;  4GR1 A;  3VRD B;  3SR6 B;  2OFJ A;  3PWI A;  3D47 A;  2X50 A;  1T3Q C;  4K5R A;  5J7X A;  4BK3 A;  5BRT A;  1YKJ A;  3VRA A;  3OC4 A;  4ROP A;  1BGN A;  1D5T A;  3KUM A;  3UXL A;  5TR3 A;  1WYG A;  3UJE A;  2XVF A;  3GDP A;  3RIT A;  4JY2 A;  2WP5 A;  2X99 A;  2Y6Q A;  5DBJ A;  3DK4 A;  2PS2 A;  1F8R A;  2YLS A;  2YLR A;  2Y6R A;  3T31 A;  2GSH A;  3MWC A;  5EB4 A;  2WOI A;  2JB1 A;  2XYO A;  5KMP A;  2YR5 A;  3V3O A;  1ECQ A;  4IL2 A;  2R4J A;  4DNA A;  1TKK A;  4JN9 A;  4FDC B;  4A7A A;  2PGE A;  2GR2 A;  4ZN0 A;  2BRA A;  3NXL A;  4TM3 A;  1KD0 A;  3D9X A;  3IJL A;  4GDE A;  4IVM B;  2AAQ A;  4USR A;  3UJS A;  4F4R A;  3TJ4 A;  3ICR A;  3NHO X;  3EUB 3;  4TM0 A;  1H6V A;  3HYX A;  2QVH A;  1Q1R A;  4NEW A;  2BC1 A;  1LVL A;  4OPG A;  3CPJ G;  3DH9 A;  2BRY A;  2A8X A;  2V6O A;  1KNR A;  1CC2 A;  1ZY8 A;  3RP7 A;  1F6M A;  4CY8 A;  2OVL A;  3UCC A;  1GSN A;  1S3E A;  2ACZ A;  2YLX A;  3F8P A;  2EQ9 A;  2B76 A;  3KA7 A;  3IK4 A;  3AE9 A;  4I58 A;  3FVD A;  3P93 A;  3CN8 A;  1VG0 A;  3O0H A;  3TTE A;  1H83 A;  1LV0 A;  4OPL A;  2W3R A;  2GAG B;  3MQT A;  3N6J A;  4ZA0 A;  3AEA A;  5L46 A;  1NEL A;  1EL8 A;  3DK8 A;  2VVL A;  1EL9 A;  4PAA A;  1DOD A;  2C3D A;  3AEB A;  3CNJ A;  3QN3 A;  2JK6 A;  2OZT A;  4TM4 A;  4EIP A;  4AOS A;  1OJA A;  1PBE A;  1E1L A;  4JNQ A;  1N4U A;  3I4K A;  3CMM A;  3NK1 X;  3RP6 A;  3H4K A;  3AMZ A;  2BYB A;  3QSS A;  5G5H B;  1PXB A;  4M6U A;  3DG6 A;  4TLZ A;  2RGH A;  3LOV A;  4LII A;  4JNA A;  2R0P A;  3A7U A;  2OG9 A;  2DW7 A;  2Z5X A;  3MY9 A;  4IHC A;  6ENL A;  5IPY A;  5JCM A;  2WOV A;  3I6E A;  4G6H A;  2OX4 A;  2QAE A;  3DG7 A;  1PJ5 A;  2BXR A;  1TRB A;  1XPQ A;  2VVL G;  1H84 A;  4GGH A;  3AE6 A;  2R46 A;  1KN0 A;  1SJC A;  2EQ6 A;  1L8P A;  3UXK A;  4KWS A;  3RED A;  4IA5 A;  3P4S A;  1GT8 A;  3B9J B;  1PBD A;  3ATR A;  2NQL A;  2QDE A;  3SM8 A;  4YSH A;  3ES8 A;  1IUX A;  3D8X A;  3OP2 A;  3LXD A;  1FEA A;  3UTE A;  1GRT A;  2WEU A;  3C4N A;  4HB9 A;  4Y4N A;  4FK1 A;  4K8D A;  4Z26 A;  1S7M A;  1IUT A;  3R10 A;  3UP4 A;  2HXU A;  1DOE A;  3T2Z A;  2BA9 A;  3DGZ A;  1JOA A;  2HQM A;  2AKM A;  4H4Q A;  4B69 A;  2B9W A;  1BWC A;  3PO7 A;  3B3R A;  2GF3 A;  2PCE A;  3CNP A;  1ZX9 A;  3NVZ B;  1H86 A;  3QTP A;  1OJD A;  3Q4D A;  3PVC A;  4YWO A;  2WET A;  1YQ3 A;  5KVH A;  4Z25 A;  4UP3 A;  1CC4 A;  2PTY A;  1OJT A;  3GD3 A;  4Z1Y A;  2JKC A;  3U4F A;  7ENL A;  3BNU A;  3PS9 A;  3TQP A;  3S47 A;  2POD A;  1VDC A;  2ZZC A;  2IVD A;  2WP6 A;  3URH A;  4J1O A;  2XFO A;  3RNM A;  2JB3 A;  1XDI A;  4ZCW A;  1GRB A;  3VFC A;  3NK2 X;  2XCG A;  4AT2 A;  1KSU A;  2YLZ A;  2C76 A;  2ARD A;  2PMQ A;  3CK5 A;  2XFQ A;  2XVH A;  4B67 A;  4H19 A;  4DYE A;  2OAM A;  4G73 A;  5BUK A;  4E5T A;  5C2T A;  3R9U A;  4GAV A;  3UTG A;  4A9W A;  3ALM A;  4FI4 A;  4EIQ A;  4Z2T A;  3BI4 A;  1F3P A;  2ZBW A;  3P4P A;  3THU A;  1JRP A;  3UKH A;  3TOY A;  2C72 A;  1SJA A;  5EOW A;  2XGZ A;  5U25 A;  4CBQ A;  5BUL A;  4REK A;  4YSX A;  1PDZ A;  2AQJ A;  3QKE A;  3NIX A;  3U9I A;  2XH4 A;  2XLS A;  3AE7 A;  3SX6 A;  1FEC A;  4K7Z A;  3ES7 A;  3AE8 A;  2RGO A;  1NPX A;  4H4Y A;  1NAA A;  4ADW A;  3T0K A;  2BAB A;  3QSE A;  1BZL A;  3HYW A;  1N62 C;  1BQG A;  3OTR A;  1CL0 A;  4JDR A;  2PYX A;  4X9N A;  5U1O A;  2X8H A;  4NNJ A;  1JNR A;  2GVC A;  2GB0 A;  3K1G A;  1K0J A;  3AB1 A;  2AR8 A;  2EQ7 A;  3K7M X;  1SJD A;  1PXA A;  1KDG A;  3V5C A;  5M0Z A;  1LPF A;  2YG6 A;  3VRB A;  1SB3 B;  4CNJ A;  2OKT A;  5IQ1 A;  1F8S A;  3NK0 X;  3RRA A;  3TCS A;  2OLO A;  1ELS A;  3ZYX A;  3N4F A;  2XVE A;  3BOX A;  2XFP A;  3UJR A;  4EM3 A;  4YTP A;  1JPM A;  4EQR A;  1GRF A;  2P88 A;  1IUU A;  1GRH A;  4U8L A;  4YT0 A;  1UKV G;  5HHF A;  4A6N B;  5EBK A;  5HXI A;  4DHG A;  2W3S A;  3T4W A;  3TW9 A;  4BV6 A;  1B8S A;  2GGI A;  4NTD A;  1H2I A;  3S5W A;  4CY6 A;  1HYU A;  2QA1 A;  2VQ7 A;  3P1W A;  4U8N A;  3K7T A;  3CT2 A;  3PWG A;  1VQZ A;  4J33 A;  2GRT A;  4YSY A;  2NVK X;  1ZKQ A;  3UGV A;  4TM1 A;  2V3B A;  3QSM A;  3AEC A;  1DOB A;  1VRQ B;  2YG3 A;  4GAP A;  4K2X A;  3VQR A;  4H2R A;  3D1C A;  1RM6 B;  2C70 A;  1PXC A;  1NEN A;  4G8T A;  2GQF A;  3V3W A;  1GER A;  4KX6 A;  1LJ1 A;  3AEG A;  2Q0K A;  3DEQ A;  4NZH A;  3GYX A;  3SZF A;  3M13 A;  2FYM A;  3H7V A;  1SJB A;  2YM2 A;  1H7W A;  3CXB A;  4Z24 A;  2OQY A;  5JCI A;  3N4E A;  2DW6 A;  3IWA A;  2WQY A;  3RGT A;  3ICT A;  2CHR A;  1YQ4 A;  3UOZ A;  1N60 C;  3GRS A;  3H8I A;  3FV9 A;  4GYP A;  5KRQ A;  2XVI A;  3RCY A;  1IUV A;  2YLW A;  3K7Q X;  1MNS A;  4Z43 A;  2WDR A;  3H8L A;  5CQF A;  1CJC A;  3E1T A;  3V76 A;  1MDL A;  3P4Q A;  2WU2 A;  3SN1 A;  2FBW A;  4EMI A;  4GYP C;  3UCD A;  3M12 A;  3NS1 B;  3UTF A;  4E0V A;  3IJI A;  4HA6 A;  2GQW A;  3OZ2 A;  2XVJ A;  1IUW A;  2QJM A;  2BK3 A;  2BS2 A;  3QPE A;  1N4V A;  3FCP A;  5KVI A;  1FCD A;  1EBH A;  3AE5 A;  1N61 C;  3FBS A;  3CGB A;  4KPR A;  5KMS A;  1PBC A;  2MUC A;  2WOW A;  4CCQ A;  3CNS A;  1P2H A;  4U8M A;  1YY5 A;  1FO4 A;  2HNE A;  2WP9 A;  5KWF A;  3AWI A;  1GTE A;  1TDK A;  4A35 A;  3NVW B;  3NRN A;  1FHV A;  2VZ2 A;  3NLC A;  3AEE A;  3P4R A;  1S3B A;  1M6I A;  3K30 A;  2R9Z A;  3ZLF A;  1COY A;  1X2H A;  1EL7 A;  2X8G A;  4H2N A;  2E1M A;  1OEP A;  3SBF A;  2WBA A;  2Q7V A;  2YG4 A;  1NEK A;  2NPX A;  2GMH A;  2PA6 A;  3UOX A;  3NYE A;  3MZN A;  1GRA A;  2WS3 A;  3ALL A;  3BHK A;  1GV4 A;  2WDV A;  1TZZ A;  3M0O A;  4CCR A;  3ALJ A;  1GET A;  1BGJ A;  3DJD A;  4YTN A;  1Y0P A;  4A79 A;  1H7X A;  3MKC A;  3EAO A;  3OZM A;  5BOF A;  2YQU A;  3T9P A;  2XSX A;  2R0C A;  3SFE A;  2C7G A;  2FKP A;  1BF3 A;  3T37 A;  4H50 A;  1B4V A;  4IP5 A;  4N9X A;  2JB2 A;  3G5R A;  4B63 A;  3EKG A;  1XPY A;  4IV9 A;  2GR3 A;  5EB5 A;  2R0G A;  5KMQ A;  4O5U A;  3VCC A;  1MOK A;  3H12 A;  1PDH A;  4XWR A;  3EPT A;  3AE1 A;  3NG7 X;  3C4A A;  4FK1 C;  4H2P A;  3GY1 A;  4H4S A;  4Z17 A;  1JRY A;  3RHA A;  2VRL A;  1E7P A;  4FX9 A;  1NHR A;  1KF6 A;  1KFY A;  1OJC A;  3QFA A;  4RG4 A;  1PN0 A;  3OPS A;  2JAE A;  4H4W A;  3RP8 A;  2B7S A;  1FHU A;  2PSN A;  3H70 A;  3LJP A;  4BK1 A;  2CVJ A;  3SXI A;  4Y4M A;  2BK5 A;  4JN8 A;  4U8K A;  4D04 A;  4BJZ A;  3D46 A;  3VCN A;  4H2Q A;  5U63 A;  4YXD A;  3UKA A;  3H8A A;  3T6C A;  4H7U A;  5FS7 A;  3LB8 A;  4OCG A;  1NHQ A;  2E3T A;  2WPC A;  4MMW A;  2W0H A;  3JW7 A;  3QFB A;  3RR1 A;  5BOE A;  1Y56 B;  4J36 A;  3GDN A;  3ETR B;  3R1Z A;  3LZW A;  1O95 A;  2C64 A;  2OA1 A;  2J3N A;  3GYI A;  4Y4L A;  4LA1 A;  1CJ2 A;  1YQZ A;  3DGH A;  1X31 B;  1XHC A;  4HCL A;  2V3A A;  4KEM A;  1EC8 A;  3B6D A;  4WCT A;  1FFU C;  4BJY A;  1YEY A;  4BUR A;  3IJQ A;  2XFN A;  3AM9 A;  4OPU A;  4WX1 A;  2C3C A;  4IA6 A;  2X8C A;  1PJ6 A;  1VQW A;  2V61 A;  3CGC A;  1TDE A;  4EMW A;  2EQ8 A;  1D7L A;  3FXG A;  2XDO A;  2PHH A;  1NDA A;  3NH3 X;  1EC9 A;  1O94 A;  1L0V A;  4B65 A;  3BJS A;  3UP5 A;  3SFD A;  3R0K A;  1ONF A;  3COX A;  4J57 A;  1PS9 A;  3I6T A;  2H88 A;  2YM1 A;  4NTC A;  1R6W A;  3KPK A;  2OPJ A;  4YSZ A;  4IZG A;  5KXJ A;  5M10 A;  1TE6 A;  4UDQ A;  3EEZ A;  1N1P A;  3T14 A;  5FJT A;  4X9M A;  1IUS A;  1N63 C;  3S61 A;  1P48 A;  4GRT A;  3NRZ B;  4EWJ A;  3R07 C;  4GFI A;  2YVF A;  1GXF A;  5CKU A;  1ZOV A;  2OLA A;  2VVM A;  5FJO A;  2BAC A;  3CGE A;  4J3Z A;  1E1K A;  4AT0 A;  3VR9 A;  2QGY A;  2ONE A;  4M0X A;  2GL5 A;  3GMC A;  3QLD A;  5FJR A;  3NYF A;  4K8G A;  1DJN A;  1GPE A;  2WPE A;  5FJU A;  5FMH A;  3FG2 P;  2OO6 A;  1GTH A;  2XH7 A;  4NTE A;  2XH0 A;  1W6T A;  2WES A;  4B68 A;  1E1M A;  3CXO A;  2DKI A;  1M64 A;  1EC7 A;  2B9Y A;  1CJ4 A;  3WE0 A;  2HXT A;  3BHF A;  1EBG A;  2BS4 A;  2WU5 A;  3AEF A;  2POZ A;  3F8R A;  4H4P A;  4C3Y A;  2PU1 A;  1E1N A;  2GR1 A;  2QA2 A;  1KSS A;  2I5Q A;  4H4V A;  3TWB A;  2BK4 A;  3NTA A;  1AOG A;  2W55 A;  3F8D A;  4U2T A;  3EF6 A;  2YG5 A;  4GGB A;  2V5Z A;  4AP3 A;  3SN4 A;  2PU0 A;  3QVR A;  3B97 A;  4IT1 A;  3P0W A;  3AED A;  3DK9 A;  1GES A;  1QJD A;  3AYL A;  1N5W C;  1S2Y A;  2C66 A;  3VR8 A;  1JDF A;  1JU2 A;  3SYI A;  2XFU A;  4PAB A;  3AE2 A;  1TYT A;  2IID A;  1TDO A;  3SQS A;  4RSL A;  5KMR A;  3HW2 A;  4H2H A;  1ZMC A;  2OLN A;  1H81 A;  4RG3 A;  2MNR A;  2PTW A;  1GRE A;  3NZG A;  2TMD A;  3CNT A;  3NKS A;  4JY3 A;  1FEB A;  2ZAD A;  4CNK A;  3A7A A;  1ONE A;  2GH5 A;  4G6G A;  1JPD X;  4GME A;  3GWD A;  3S5S A;  4HPN A;  3DG3 A;  4C3X A;  2E5V A;  3PFR A;  2P3Z A;  3GMB A;  4TVW A;  2WDQ A;  2P8C A;  2GGJ A;  3UKF A;  4HNC A;  2RDX A;  1DJQ A;  4YTM A;  1DNC A;  2OAL A;  1OJ9 A;  2YG7 A;  4JN7 A;  2ZZ0 A;  2GV8 A;  2AKZ A;  3V4B A;  3HZL A;  1VDV A;  2E5A A;  2RGJ A;  1JEH A;  3NTD A;  4IP4 A;  4B66 A;  4Z2R A;  4AP1 A;  2GAH B;  3MSY A;  4TVY A;  4G9K A;  3CPI G;  5FS8 A;  1FL2 A;  4UDR A;  1JNZ A;  2AL1 A;  2GDQ A;  3DDM A;  4J31 A;  4X2P A;  2VOU A;  3DA1 A;  4A5L A;  4EQS A;  2RAB A;  2O9Z A;  2PGW A;  2R4E A;  3DER A;  2TPR A;  4H83 A;  4U8J A;  4II3 A;  1GEU A;  2O56 A;  2A87 A;  4G74 A;  3UKP A;  1H82 A;  1MDR A;  4Z2U A;  1E6E A;  2Q6U A;  3SJN A;  3DFH A;  3KLJ A;  3PG6 A;  3UOY A;  3CIR A;  3JSK A;  1L9C A;  4UDP A;  2AL2 A;  2GR0 A;  4P9S A;  4CRT A;  1JCT A;  2C75 A;  3IHM A;  3ENL A;  4H4U A;  4ZOH B;  3HRD C;  3UOV A;  3UTH A;  2E4G A;  1NG4 A;  2P0I A;  1PBB A;  4A65 A;  4XWZ A;  3AE4 A;  2YLT A;  3IC9 A;  1PBF A;  4DWD A;  1D4E A;  4O5Q A;  3FYY A;  3GD4 A;  1Y56 A;  3P3B A;  2B9X A;  3QVP A;  4H4Z A;  4EM4 A;  3BI2 A;  5BVA A;  1ZP0 A;  5KNL A;  3NGC X;  4D03 A;  4YKF A;  3FPZ A;  4NEV A;  1VG9 A;  3GD6 A;  3DES A;  3UJF A;  3T8Q A;  2ZC8 A;  5J04 A;  1RP0 A;  3FJ4 A;  1S2Q A;  2GGG A;  3II4 A;  3Q45 A;  1P43 A;  3AYI A;  1F8W A;  3GYJ A;  4GUV A;  3JZU A;  2BC0 A;  4E8G A;  2QDD A;  3DGB A;  2C73 A;  2ZZB A;  3SY4 A;  1GOS A;  4OPC A;  2UZZ A;  3R25 A;  2YWL A;  3ITJ A;  3ISH A;  3G5Q A;  1Q9I A;  4USQ A;  4YWS A;  3AXB A;  1NHS A;  1JRX A;  3TWA A;  1CC6 A;  4A6G A;  4AOX A;  2B7R A;  2YVJ A;  4GDP A;  3SZ0 A;  4GCM A;  2QJJ A;  3NO1 A;  4J34 A;  3SZC A;  1V97 A;  3T2Y A;  1KCZ A;  4IL0 A;  4LU6 A;  4E4U A;  1QLB A;  4E6M A;  4B64 A;  3I3L A;  2FJB A;  4DSG A;  1WUF A;  2P8B A;  3PK7 A;  2PP0 A;  2XLT A;  1DOC A;  1ZMD A;  3TJI A;  2OZ3 A;  2XLP A;  3P9U A;  3MUC A;  3SN0 A;  1CJ3 A;  1MO9 A;  1WUE A;  5C3J A;  3UKL A;  3R0U A;  1FOH A;  5ENL A;  1NHP A;  4IVO B;  2A89 A;  3FIM B;  2VQB A;  3N6H A;  4J2W A;  5EU9 A;  3ZVI A;  4C74 A;  3GSI A;  5GSN A;  3ADA B;  2V60 A;  3NFU A;  3L5O A;  2BCG G;  2QQ6 A;  2YR4 A;  2QCU A;  3ABV A;  2H89 A;  4DGK A;  4YKG A;  1LTX R;  3KPF A;  4HN8 A;  3I6D A;  5IQ4 A;  4B1B A;  1KKR A;  2F5Z A;  5GRT A;  1R0M A;  1KNP A;  4K1W A;  1MRA A;  1LQU A;  1O5W A;  4DSH A;  3DJJ A;  5JRB A;  1XS2 A;  2Z5Y A;  4XXG A;  1D4C A;  1K4Q A;  3AD9 B;  1MXT A;  3T2K A;  3LZX A;  1GND A;  1SEZ A;  5HY5 A;  5J60 A;  5FS6 A;  1FIQ B;  1K0L A;  1L9E A;  2QJN A;  4K22 A;  4BK2 A;  3LAD A;  1Q1W A;  4II2 A;  1IYX A;  3ATQ A;  3ICS A;  3EAN A;  1GRG A;  3BI5 A;  4H4R A;  4OPT A;  3GWF A;  3HPF A;  2CUL A;  3BSM A;  4J56 A;  2PPG A;  3DFY A;  3ZVH B;  4FP1 A;  1Z6L A;  1RSG A;  3AN1 A;  1RYI A;  3UJ2 A;  2I0Z A;  2GEW A;  1NG3 A;  1E39 A;  4ICY A;  3IHG A;  4GIR A;  4I59 A;  2WHD A;  4OVI A;  2IVE A;  3JVA A;  4ZCD A;  4OPD A;  4DXK A;  3KVE A;  5KOW A;  4DN1 A;  1IJH A;  4OPI A;  4X4J A;  1DXL A;  2GGH A;  4A99 A;  2XH2 A;  4ENL A;  2DKH A;  3STP A;  3CND A;  1V59 A;  3AE3 A;  1BKH A;  4MJW A;  4KT2 A;  2OQH A;  3A7R A;  1CF3 A;  3CPH G;  3SSZ A;  1B37 A;  2BXS A;  4HCH A;  1STZ A;  2YR6 A;  2WPF A;  1RVK A;  1ELI A;  1QO8 A;  2FJD A;  1TYP A;  4MKS A;  1EBD A;  1D4D A;  4ZCC A;  1X2G A;  4EQW A;  3KU9 A;  5KOX A;  2OZ8 A;  3BNM A;  3VA8 A;  1DTN A;  1N4W A;  4HCD A;  3CB3 A;  4U2L A;  1MUC A;  1L9D A;  4U2S A;  3VC5 A;  3Q9T A;  4K5S A;  4U8I A;  4JQ9 A;  2APG A;  1P2E A;  3ZDN A;  2XLR A;  3HYV A;  1EL5 A;  2FJE A;  3VC6 A;  3SQP A;  4GIS A;  5JCN A;  3L1R A;  1JRO A;  3SGL A;  4EMJ A;  3KKJ A;  3CYJ A;  2BS3 A;  3R11 A;  1LQT A;  4APN A;  2C4C A;  3GRT A;  3NN6 X;  5G5G B;  2CFY A;  1N5X A;  3UKQ A;  1PJ7 A;  2HZG A;  3GC2 A;  3CGD A;  2GGE A;  3NVY B;  2Q0L A;  3OZY A;  1ZXI C;  5JCL A;  3CTY A; 
#chains in the Genus database with same CATH homology
 2R0C A;  2GR0 A;  1JOA A;  2R45 A;  3NNE A;  3SFE A;  2HQM A;  4H4Q A;  4P9S A;  4B69 A;  2C7G A;  2B9W A;  3SZW A;  5JCK A;  4CRT A;  3DME A;  1BWC A;  3G5S A;  3PO7 A;  1BF3 A;  2C75 A;  3B3R A;  2FJA A;  3IHM A;  4H50 A;  3T37 A;  2GF3 A;  1B4V A;  2XLU A;  4H4U A;  2JB2 A;  3G5R A;  4M52 A;  3CNP A;  4N9X A;  3UOV A;  4B63 A;  1ZX9 A;  3UTH A;  4IV9 A;  2E4G A;  4U8P A;  1H86 A;  1NG4 A;  3AYJ A;  4EQX A;  1OJD A;  2GR3 A;  1PBB A;  3PVC A;  4YWO A;  2WET A;  5EB5 A;  4A65 A;  2R0G A;  5KMQ A;  1YQ3 A;  4O5U A;  4NWZ A;  4XWZ A;  3AE4 A;  2YLT A;  5KVH A;  4Z25 A;  4UP3 A;  1MOK A;  3IC9 A;  1CC4 A;  2C65 A;  3WE0 A;  1PDH A;  1PBF A;  1OJT A;  3GD3 A;  1CBO A;  3QJ4 A;  2JKC A;  4XWR A;  4Z44 A;  3EPT A;  3AE1 A;  3BNU A;  1D4E A;  3PS9 A;  4O5Q A;  1D7Y A;  3GD4 A;  3NG7 X;  1Y56 A;  3C4A A;  2B9X A;  4FK1 C;  3QVP A;  2GMJ A;  4H4Z A;  3DJE A;  1W4X A;  3FMW A;  4H2P A;  1VDC A;  5HYM A;  4EM4 A;  2ZZC A;  3BI2 A;  2IVD A;  5BVA A;  4H4S A;  2WP6 A;  3URH A;  1ZP0 A;  5KNL A;  2BCP A;  3NGC X;  4D03 A;  2XFO A;  4YKF A;  3RNM A;  2JB3 A;  1JRY A;  1XDI A;  3FPZ A;  3RHA A;  1GRB A;  2CDU A;  2VRL A;  4NEV A;  1E7P A;  3NK2 X;  1VG9 A;  4FX9 A;  2XCG A;  1B5Q A;  4AT2 A;  1KSU A;  1NHR A;  1KF6 A;  3IF9 A;  4ECH A;  1KFY A;  1OJC A;  2YLZ A;  3QFA A;  2C76 A;  4RG4 A;  1PN0 A;  2JAE A;  3NN0 X;  1PHH A;  1RP0 A;  2ARD A;  4H4W A;  1TDN A;  2JBV A;  3RP8 A;  4A6N A;  1BKW A;  1S2Q A;  2XFQ A;  2VRM A;  2XVH A;  2B7S A;  4B67 A;  2OAM A;  5BUK A;  4G73 A;  3II4 A;  1ZDL A;  5C2T A;  3LJP A;  4TLX A;  4BK1 A;  1K0I A;  3AYI A;  2CVJ A;  3SXI A;  4Y4M A;  1F8W A;  5FS9 A;  2BK5 A;  3R9U A;  3GYJ A;  4GAV A;  4U8K A;  4D04 A;  4BJZ A;  3UTG A;  4A9W A;  4GUV A;  3ALM A;  4EIQ A;  4Z2T A;  5LV9 A;  3C96 A;  2BC0 A;  3BI4 A;  1GAL A;  4H2Q A;  5U63 A;  4YXD A;  1F3P A;  4C77 A;  2ZBW A;  3UKA A;  4H7U A;  5FS7 A;  3P4P A;  3LB8 A;  2C73 A;  4OCG A;  2YAU A;  2ZZB A;  1NHQ A;  2WPC A;  3SY4 A;  3UKH A;  4C5O A;  2W0H A;  3Q6J A;  1REO A;  3QFB A;  1GOS A;  4OPC A;  5ER0 A;  2C72 A;  1Y56 B;  3V3N A;  3AD8 B;  5EOW A;  4J36 A;  3GDN A;  2C67 A;  2UZZ A;  3LZW A;  3UCL A;  5U25 A;  3UKK A;  2YWL A;  1O95 A;  3L8K A;  3ITJ A;  2C64 A;  2OA1 A;  3ISH A;  2J3N A;  3G5Q A;  4CBQ A;  1Q9I A;  1TDF A;  5BUL A;  4USQ A;  3GYI A;  4REK A;  4YSX A;  2AQJ A;  4Y4L A;  3AXB A;  3NT6 A;  4LA1 A;  1NHS A;  3NIX A;  1JRX A;  2X3N A;  1CJ2 A;  1CC6 A;  1YQZ A;  3DGH A;  1X31 B;  2XLS A;  1XHC A;  4AOX A;  2B7R A;  2V3A A;  2YVJ A;  1XAN A;  3AE7 A;  2YVG A;  3SX6 A;  1ZK7 A;  3DJG X;  1FEC A;  4U8O A;  4K7Z A;  3AE8 A;  3B6D A;  4WCT A;  2RGO A;  1NPX A;  4H4Y A;  1NAA A;  4GDP A;  3SZ0 A;  4H4T A;  4GCM A;  4GF7 A;  4BJY A;  4H4X A;  1JRZ A;  4J34 A;  3KD9 A;  1ZOY A;  4BUR A;  3SZC A;  1CHU A;  2XFN A;  4ADW A;  4OPU A;  3T2Y A;  3NYC A;  4WX1 A;  4LU6 A;  2C3C A;  4IA6 A;  3T0K A;  2BAB A;  1QLB A;  2X8C A;  4B64 A;  1PJ6 A;  1VQW A;  2FJB A;  2V61 A;  3AD7 B;  4GR1 A;  3CGC A;  3I3L A;  1TDE A;  3QSE A;  4DSG A;  1BZL A;  4EMW A;  3HYW A;  2EQ8 A;  1D7L A;  2XLT A;  1DOC A;  1CL0 A;  2XDO A;  3VRD B;  4JDR A;  1ZMD A;  2PYX A;  4X9N A;  2XLP A;  5U1O A;  2PHH A;  3P9U A;  1CJ3 A;  2X8H A;  1MO9 A;  1NDA A;  1JNR A;  2GB0 A;  2GVC A;  3NH3 X;  1O94 A;  4NNJ A;  1K0J A;  1L0V A;  5C3J A;  4B65 A;  3AB1 A;  2AR8 A;  3UKL A;  2EQ7 A;  3UP5 A;  3SFD A;  3K7M X;  2X50 A;  1FOH A;  1NHP A;  4IVO B;  2A89 A;  4K5R A;  3FIM B;  5J7X A;  1PXA A;  1ONF A;  1KDG A;  3COX A;  2VQB A;  4J57 A;  4BK3 A;  1PS9 A;  5BRT A;  1YKJ A;  5M0Z A;  1LPF A;  2YG6 A;  4J2W A;  3VRB A;  2H88 A;  3VRA A;  2YM1 A;  4CNJ A;  3OC4 A;  4NTC A;  5IQ1 A;  4C74 A;  1F8S A;  3GSI A;  3KPK A;  3NK0 X;  2OLO A;  1BGN A;  4YSZ A;  1D5T A;  5GSN A;  3ADA B;  2V60 A;  5KXJ A;  5M10 A;  3ZYX A;  5TR3 A;  2XVE A;  2XFP A;  3L5O A;  4UDQ A;  2XVF A;  3GDP A;  4EM3 A;  4YTP A;  4JY2 A;  1N1P A;  2WP5 A;  2BCG G;  3T14 A;  2YR4 A;  2X99 A;  4EQR A;  2Y6Q A;  2QCU A;  5DBJ A;  3DK4 A;  4X9M A;  3ABV A;  2H89 A;  1IUS A;  4DGK A;  1GRF A;  3S61 A;  4YKG A;  1F8R A;  1IUU A;  2YLS A;  1LTX R;  1GRH A;  4U8L A;  2YLR A;  2Y6R A;  3T31 A;  3KPF A;  4YT0 A;  4GRT A;  1UKV G;  3I6D A;  5HHF A;  5IQ4 A;  5EB4 A;  5EBK A;  2WOI A;  4A6N B;  5HXI A;  2JB1 A;  2XYO A;  4B1B A;  4BV6 A;  2F5Z A;  1B8S A;  5KMP A;  5GRT A;  1KNP A;  4NTD A;  1H2I A;  2YVF A;  1GXF A;  2YR5 A;  1LQU A;  5CKU A;  3S5W A;  3V3O A;  4CY6 A;  1ZOV A;  1O5W A;  2VVM A;  4AT0 A;  2BAC A;  3CGE A;  4DSH A;  1E1K A;  3DJJ A;  2R4J A;  4DNA A;  3VR9 A;  1HYU A;  2QA1 A;  2VQ7 A;  4JN9 A;  4FDC B;  5JRB A;  3GMC A;  3P1W A;  4U8N A;  4A7A A;  3NYF A;  3K7T A;  1DJN A;  2Z5Y A;  2GR2 A;  4ZN0 A;  1GPE A;  2BRA A;  1D4C A;  1K4Q A;  3AD9 B;  4XXG A;  4J33 A;  1MXT A;  3T2K A;  3LZX A;  1GND A;  4TM3 A;  2GRT A;  2WPE A;  1SEZ A;  4YSY A;  5HY5 A;  3D9X A;  5J60 A;  5FS6 A;  2NVK X;  4GDE A;  1ZKQ A;  5FMH A;  3FG2 P;  1L9E A;  1K0L A;  4IVM B;  4TM1 A;  2AAQ A;  2V3B A;  1GTH A;  3QSM A;  4K22 A;  3LAD A;  4USR A;  4NTE A;  4BK2 A;  1Q1W A;  3AEC A;  1DOB A;  1VRQ B;  2YG3 A;  4GAP A;  4II2 A;  4K2X A;  2WES A;  2YQU A;  4B68 A;  1E1M A;  3VQR A;  2DKI A;  3ICR A;  3NHO X;  1M64 A;  3ATQ A;  3D1C A;  4H2R A;  3ICS A;  3EAN A;  1CJ4 A;  2B9Y A;  1GRG A;  2C70 A;  1PXC A;  4H4R A;  3BI5 A;  1NEN A;  3BHF A;  3GWF A;  1H6V A;  2CUL A;  4OPT A;  4TM0 A;  3HYX A;  2GQF A;  2BS4 A;  1GER A;  1Q1R A;  4NEW A;  2BC1 A;  1LJ1 A;  1LVL A;  4KX6 A;  3AEG A;  4J56 A;  2Q0K A;  4OPG A;  2WU5 A;  3AEF A;  3F8R A;  4NZH A;  4H4P A;  3GYX A;  3CPJ G;  3DH9 A;  3SZF A;  4C3Y A;  2BRY A;  3M13 A;  1E1N A;  2GR1 A;  2A8X A;  1Z6L A;  2QA2 A;  1KSS A;  2V6O A;  1RSG A;  2YM2 A;  1KNR A;  4H4V A;  1RYI A;  1H7W A;  2I0Z A;  2GEW A;  4Z24 A;  1CC2 A;  1ZY8 A;  1NG3 A;  5JCI A;  2BK4 A;  1E39 A;  4ICY A;  3IHG A;  3NTA A;  1AOG A;  3RP7 A;  1F6M A;  4CY8 A;  3F8D A;  3IWA A;  4I59 A;  4U2T A;  3EF6 A;  1GSN A;  2YG5 A;  1S3E A;  2ACZ A;  2YLX A;  2WHD A;  2V5Z A;  3F8P A;  4AP3 A;  2WQY A;  2EQ9 A;  2B76 A;  4OVI A;  2IVE A;  3KA7 A;  3AE9 A;  3ICT A;  4I58 A;  1YQ4 A;  3QVR A;  4ZCD A;  4OPD A;  3AED A;  3DK9 A;  3KVE A;  3UOZ A;  3CN8 A;  1VG0 A;  3O0H A;  5KOW A;  1GES A;  3GRS A;  1QJD A;  3H8I A;  1IJH A;  3AYL A;  4OPI A;  5KRQ A;  1H83 A;  1LV0 A;  1S2Y A;  4X4J A;  1DXL A;  4OPL A;  2GAG B;  2XVI A;  4A99 A;  2C66 A;  1IUV A;  3VR8 A;  2DKH A;  2YLW A;  1JU2 A;  3K7Q X;  3AEA A;  3SYI A;  2XFU A;  4PAB A;  4Z43 A;  2WDR A;  5L46 A;  1EL8 A;  3CND A;  3AE2 A;  3DK8 A;  1V59 A;  1TYT A;  3AE3 A;  2IID A;  3H8L A;  5CQF A;  1CJC A;  2VVL A;  1TDO A;  1EL9 A;  3E1T A;  4MJW A;  4PAA A;  4RSL A;  5KMR A;  3V76 A;  1DOD A;  2C3D A;  3AEB A;  3CNJ A;  3CPH G;  1CF3 A;  3P4Q A;  1ZMC A;  2JK6 A;  1B37 A;  2BXS A;  2OLN A;  2FBW A;  2WU2 A;  4EMI A;  1H81 A;  4TM4 A;  4RG3 A;  4EIP A;  4AOS A;  1OJA A;  1PBE A;  1GRE A;  1E1L A;  3M12 A;  2YR6 A;  4JNQ A;  3UTF A;  1N4U A;  2WPF A;  4E0V A;  3CMM A;  2TMD A;  3CNT A;  3NK1 X;  3RP6 A;  3NKS A;  4JY3 A;  1FEB A;  1ELI A;  4HA6 A;  2GQW A;  2XVJ A;  3H4K A;  1IUW A;  1QO8 A;  3OZ2 A;  2FJD A;  4CNK A;  2BK3 A;  2BYB A;  2BS2 A;  1TYP A;  2GH5 A;  4G6G A;  3QSS A;  1EBD A;  1N4V A;  3GWD A;  1PXB A;  1D4D A;  4ZCC A;  4C3X A;  5KVI A;  1FCD A;  2E5V A;  4EQW A;  3KU9 A;  4TLZ A;  3AE5 A;  5KOX A;  2RGH A;  3FBS A;  4LII A;  3LOV A;  4JNA A;  2R0P A;  3BNM A;  3GMB A;  3CGB A;  2WDQ A;  1N4W A;  2Z5X A;  4KPR A;  3UKF A;  5KMS A;  5IPY A;  1PBC A;  5JCM A;  4U2L A;  2WOW A;  2WOV A;  4CCQ A;  1DJQ A;  1L9D A;  3CNS A;  4YTM A;  1DNC A;  2OAL A;  1OJ9 A;  1P2H A;  1YY5 A;  4G6H A;  2YG7 A;  4U2S A;  4U8M A;  2QAE A;  1PJ5 A;  2BXR A;  2ZZ0 A;  2GV8 A;  1TRB A;  2WP9 A;  1XPQ A;  5KWF A;  3Q9T A;  4K5S A;  3AWI A;  4JQ9 A;  3HZL A;  4U8I A;  1GTE A;  1TDK A;  2RGJ A;  2VVL G;  2APG A;  1JEH A;  1H84 A;  3NTD A;  4B66 A;  4Z2R A;  3AE6 A;  2GAH B;  2R46 A;  1P2E A;  3NRN A;  1KN0 A;  4AP1 A;  3ZDN A;  2EQ6 A;  4G9K A;  3CPI G;  5FS8 A;  1FL2 A;  1EL5 A;  2FJE A;  2XLR A;  2VZ2 A;  3HYV A;  4UDR A;  3NLC A;  3AEE A;  1JNZ A;  3RED A;  3P4R A;  1S3B A;  4IA5 A;  1M6I A;  3SQP A;  3K30 A;  2R9Z A;  5JCN A;  3P4S A;  4J31 A;  1GT8 A;  2VOU A;  3DA1 A;  3L1R A;  1COY A;  1PBD A;  3SGL A;  4A5L A;  1EL7 A;  2X8G A;  4H2N A;  4EMJ A;  4EQS A;  3ATR A;  2E1M A;  2RAB A;  3KKJ A;  2WBA A;  3SM8 A;  2O9Z A;  2Q7V A;  2YG4 A;  4YSH A;  2R4E A;  1NEK A;  2TPR A;  1IUX A;  2BS3 A;  3D8X A;  4U8J A;  4II3 A;  1GEU A;  2NPX A;  2GMH A;  1LQT A;  4APN A;  3LXD A;  1FEA A;  2A87 A;  3UTE A;  3UOX A;  4G74 A;  1GRT A;  2WEU A;  3NYE A;  2C4C A;  3C4N A;  3UKP A;  1H82 A;  4Z2U A;  4HB9 A;  1E6E A;  1GRA A;  2WS3 A;  3ALL A;  4Y4N A;  3GRT A;  3NN6 X;  2CFY A;  3UKQ A;  4FK1 A;  3BHK A;  2Q6U A;  1GV4 A;  4K8D A;  1PJ7 A;  4Z26 A;  2WDV A;  1S7M A;  3KLJ A;  4CCR A;  3M0O A;  1IUT A;  3CGD A;  3PG6 A;  3ALJ A;  3UOY A;  1GET A;  2Q0L A;  1BGJ A;  3CIR A;  3JSK A;  3UP4 A;  3DJD A;  3CTY A;  1DOE A;  4YTN A;  1L9C A;  1Y0P A;  3T2Z A;  1H7X A;  4A79 A;  4UDP A;  2BA9 A;  5JCL A;  3EAO A;  3DGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...