3GD3A

Crystal structure of a naturally folded murine apoptosis inducing factor
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
483
structure length
463
Chain Sequence
PSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLQFRQWNGKERSIYFQPPSFYVSAQDLPNIENGGVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRALEKISREVKSITVIGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKILPQYLSNWTMEKVKREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEADYGKGVIFYLRDKVVVGIVLWNVFNRMPIARKIIKDGEQHEDLNEVAKLFNIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apoptosis-inducing factor 1, mitochondrial
publication title Redox-linked conformational dynamics in apoptosis-inducing factor
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 138
structure length 463
sequence length 483
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3gd3A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3gd3A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3gd3A01
3CNDA 4A5LA 4I59A 3FIMB 2JB3A 3NK2X 2VRLA 4TLXA 2JKCA 5FS8A 1F6MA 3H8LA 5KWFA 4U8LA 1YQ3A 3AD7B 3GDPA 3LZXA 2GR3A 5KVIA 3AE8A 1MXTA 4Y4LA 2WU5A 2B76A 2VVMA 3GYIA 4FDCB 2BK3A 4DSGA 2VVLA 3ICRA 1VQWA 2GEWA 3CNSA 4JNAA 4U8OA 1PBFA 3QSEA 3CNTA 4YXDA 1H7WA 3AEEA 2GVCA 2EQ8A 4BURA 1NHQA 1OJAA 1PBBA 4X9NA 4A6NA 4PABA 2F5ZA 4H4RA 2OAMA 1KF6A 4NEVA 1YQ4A 3DJDA 1CC4A 3UOZA 2CULA 2BXSA 3I6DA 3AECA 4B68A 1XANA 2E1MA 4J36A 3NK0X 1GXFA 4U8KA 5FS7A 2X3NA 4IVOB 3CPJG 1JOAA 4OPTA 3UOVA 4EMWA 4HA6A 2GR2A 4CY6A 3ZYXA 4XXGA 1E1LA 3L8KA 4U8PA 2R0CA 3GWDA 3V3OA 2GAHB 1KSSA 4TLZA 2X8CA 3UTGA 1TDFA 1GOSA 2W0HA 2OALA 3AD8B 2FBWA 2YG4A 3F8RA 4RSLA 4AP3A 1BZLA 3BNUA 2UZZA 4OPCA 4U8IA 2OLNA 2DKIA 3CNJA 3NN0X 2YVGA 3UP5A 1FECA 4YTMA 3DH9A 1KNRA 4CCRA 2Q0KA 2BYBA 1PJ7A 3M13A 2VOUA 4B1BA 3P4QA 1VG9A 1S3BA 4KPRA 4TM4A 2X8GA 1XHCA 2BABA 5KOXA 3IHGA 4CY8A 4D03A 3QSMA 1S2QA 4TM3A 4WCTA 4WX1A 3UKKA 2BS4A 1EBDA 4AOXA 5IQ1A 4B66A 2XCGA 2GAGB 4IVMB 1IUSA 1H7XA 1ZOVA 3D1CA 5BVAA 2YR5A 3KLJA 3CGEA 4JNQA 2AR8A 3QVRA 3C4NA 1H81A 2R0GA 3QSSA 4GR1A 2R4JA 3LXDA 5U25A 3DGZA 3LB8A 3ALMA 4OPDA 1PBEA 3SQPA 2B9XA 2BXRA 4LU6A 2CDUA 4H2PA 3FG2P 3T37A 3ZDNA 2JBVA 3UKLA 3NTAA 2WP9A 1NHRA 4JN9A 1GALA 1GREA 4BK2A 2VVLG 1E1MA 4FX9A 4H2RA 4YSZA 5JCMA 5JCIA 2C3DA 1ZY8A 4EMIA 2GMJA 3ALJA 2GV8A 4IV9A 1B5QA 4NEWA 3NNEA 1H83A 2BK4A 4H4XA 1MOKA 1PJ5A 3ITJA 4YKFA 3QFBA 2C73A 4LA1A 1LQTA 2XVFA 3NIXA 4H2NA 3SGLA 5IQ4A 4OVIA 2J3NA 1ELIA 2XLTA 3PO7A 3DJGX 2BCPA 3O0HA 1D5TA 3CGDA 3P4PA 4A79A 4J57A 4EQXA 2Y6QA 2X50A 1EL7A 3RP8A 3DGHA 2IIDA 4AT0A 2YQUA 4NTCA 1NG3A 2V60A 3CPHG 1NDAA 2WHDA 1NENA 2JAEA 3RP7A 1D4DA 1FL2A 2BACA 3QVPA 2R46A 3P4SA 4AT2A 2GQWA 5EOWA 3AWIA 2C65A 1VRQB 1V59A 4NTEA 4NZHA 3NG7X 1F8WA 5J7XA 2XDOA 2WP5A 2E5VA 1GETA 2PYXA 2YG7A 3EANA 1IUVA 3AYJA 3VQRA 3VRAA 4ECHA 1NG4A 5DBJA 4Z24A 3LADA 5CQFA 1TDKA 3L1RA 1GNDA 2YLTA 1N1PA 4K22A 4K2XA 1Y56A 4A7AA 2EQ7A 2FJBA 3KVEA 2YLZA 4JY2A 3CGBA 2YG6A 2Z5YA 3UKQA 4YT0A 3AD9B 1M6IA 2C75A 2YWLA 1O94A 2GR1A 2XVHA 2TPRA 4PAAA 4OPIA 2WP6A 3NN6X 2QAEA 5JCLA 4B69A 3BHKA 3UOXA 1H6VA 4A9WA 4K5SA 4DGKA 2JK6A 3NKSA 3UP4A 1D7YA 1GERA 2VQBA 3UCLA 1VDCA 5CKUA 2WU2A 3BI5A 3H4KA 1PS9A 2JB1A 3ICTA 4YTPA 1O95A 3VR8A 1TRBA 1ONFA 2HQMA 2X8HA 3NLCA 3K30A 3GSIA 1YKJA 2YAUA 1CC2A 4I58A 1B37A 1K4QA 2A89A 2WDRA 1Y0PA 1DOEA 1ZMDA 3S5WA 2IVEA 3BI4A 2YM2A 3KD9A 1EL9A 2BK5A 3M0OA 2WDVA 2RABA 3CIRA 2C70A 1H86A 1GRFA 1JNZA 2QA1A 1K0LA 3NYFA 2Q6UA 1B4VA 4AOSA 1P2EA 1GTHA 2V5ZA 2WETA 2ZZCA 2Y6RA 4N9XA 3OZ2A 4UDPA 4Y4NA 3K7MX 3NK1X 3GMCA 5FS6A 5HYMA 1H84A 2BC1A 5U1OA 5M0ZA 2BC0A 4A65A 3B3RA 1GSNA 4M52A 4EMJA 1XDIA 2GQFA 2GRTA 1S2YA 2FJDA 3AE3A 1ZKQA 3B6DA 1IUUA 3DMEA 4MJWA 5LV9A 4H4YA 1XPQA 2YLXA 3G5QA 4U8MA 4Z44A 4C74A 1M64A 2YG3A 4XWZA 3AYLA 4OCGA 4CBQA 3IC9A 3DA1A 4B65A 1Y56B 4EQWA 1L0VA 3Q6JA 3H8IA 1QJDA 2WQYA 2I0ZA 4K5RA 5EB5A 1IUTA 1FOHA 1D4CA 3REDA 2V3AA 2BA9A 1L9EA 2WPCA 1O5WA 3F8DA 3PVCA 1FCDA 1F3PA 5U63A 2AAQA 3UKAA 3FBSA 3AE7A 2B9YA 2RGJA 4APNA 3ALLA 3II4A 3C96A 4IA6A 1GESA 4Z43A 3BHFA 2EQ9A 3AE5A 4A6NB 1L9CA 2XLSA 2B9WA 3GD4A 1CJ3A 2Q0LA 3ADAB 3C4AA 2R45A 3P9UA 4BK3A 4C5OA 2IVDA 2WS3A 1S3EA 1VG0A 1GV4A 2A8XA 3GRTA 3UKPA 2YR4A 4U8JA 2WBAA 1TDOA 3VR9A 3DK8A 1KSUA 1Z6LA 4GCMA 3GRSA 1PHHA 5JCNA 1LV0A 2OA1A 3FPZA 3PS9A 3NYCA 4J2WA 4UDQA 4CCQA 3ICSA 4B64A 3K7TA 5C3JA 3P1WA 1GRGA 2DKHA 2QA2A 1E39A 3NT6A 3RHAA 1OJDA 3AEFA 4UDRA 2R4EA 3CPIG 3IWAA 1NHPA 1EL5A 4J33A 3D8XA 1ZDLA 4GRTA 2XFNA 1LPFA 3UKFA 2C66A 2R9ZA 1DXLA 3ISHA 5J60A 2XLPA 3OC4A 3SFEA 2XVEA 4GUVA 1CJCA 2C76A 2B7SA 4USQA 4H4PA 4BK1A 2O9ZA 4DNAA 3AEDA 2APGA 4Z2RA 1F8RA 2PHHA 4EQRA 3V3NA 1ZP0A 1NEKA 4TM0A 5HHFA 3V76A 3AEGA 3QFAA 5ER0A 3DK9A 3G5RA 4U2SA 5L46A 2H89A 3NGCX 1CC6A 1RSGA 4ZCDA 3P4RA 2VZ2A 4Z2UA 1YY5A 1E7PA 2YLWA 2GB0A 1BKWA 2XVJA 1P2HA 1QLBA 3DJEA 1CBOA 3AE9A 4Y4MA 4KX6A 2JB2A 4Z2TA 1DJNA 3JSKA 3K7QX 2A87A 2C72A 4H4VA 1PBCA 2CFYA 1W4XA 1D7LA 1EL8A 2WESA 1GRAA 1NAAA 1PXAA 4LIIA 3RNMA 2AQJA 2OLOA 4YSYA 4YTNA 1Q1RA 2ZBWA 4E0VA 2X99A 5FMHA 1BGNA 1E6EA 1CHUA 1N4UA 4FK1A 3GYJA 3AE4A 4YSHA 2B7RA 3AYIA 4EIQA 1DJQA 4D04A 4CNKA 5FS9A 3WE0A 2C67A 2ARDA 2C3CA 4HB9A 1NPXA 1BWCA 3UOYA 2WOWA 4C3XA 2TMDA 3ATQA 1Q9IA 2XFQA 3UTFA 3NTDA 1PDHA 1KNPA 1PBDA 4YSXA 2XYOA 1MO9A 4ADWA 1K0IA 3KA7A 4ICYA 2XLRA 4NTDA 2YG5A 5C2TA 1SEZA 2YLSA 3UKHA 1AOGA 1IJHA 2YM1A 1REOA 4EQSA 3COXA 3SFDA 3ABVA 1LJ1A 3RP6A 3I3LA 2ZZBA 4C3YA 4EM3A 5HXIA 4X9MA 3DJJA 1BF3A 1JU2A 4C77A 2WPEA 3KU9A 1UKVG 4O5UA 1LQUA 1F8SA 3AEAA 3CNPA 4GF7A 4J34A 3KKJA 4ZCCA 2NVKX 4X4JA 2FJAA 3NHOX 1QO8A 4BJYA 2WDQA 1ZOYA 4Z26A 1D4EA 1JRZA 2QCUA 1ZK7A 2Z5XA 5BUKA 1OJCA 4UP3A 4H4ZA 3DK4A 5EB4A 1KFYA 1LTXR 2E4GA 5GSNA 2XLUA 3R9UA 4GDPA 3AB1A 1GRTA 4H4TA 4REKA 1N4VA 4OPLA 4EIPA 3EF6A 1CJ4A 2ZZ0A 4CRTA 4H4WA 4H4SA 4Z25A 2XFOA 1ZX9A 4H4QA 4B67A 1PXCA 3Q9TA 3AXBA 1OJ9A 1GRBA 2H88A 3GWFA 1PN0A 4YWOA 2WPFA 4U2TA 4AP1A 1GEUA 1K0JA 1DOCA 1GTEA 2WOVA 4GDEA 4OPUA 2CVJA 3AEBA 3NRNA 4K7ZA 2ACZA 3FMWA 2WEUA 2RGOA 3UTEA 5EBKA 4H7UA 3NH3X 4ZN0A 2YVJA 2V61A 3G5SA 3LJPA 2EQ6A 3VRDB 4BJZA 4XWRA 2NPXA 4J56A 1E1KA 4A99A 2XFUA 3SM8A 3AE2A 3LZWA 1JEHA 1PXBA 3AE6A 5HY5A 4CNJA 1DNCA 4H4UA 3LOVA 3QJ4A 1YQZA 3CN8A 3UTHA 5IPYA 1PJ6A 1OJTA 1CF3A 1H82A 4H2QA 1TYTA 3IF9A 1NHSA 5KXJA 4JQ9A 4RG4A 3URHA 3GMBA 1DODA 2YLRA 1Q1WA 4TM1A 5BRTA 4H50A 4P9SA 2V3BA 4EM4A 3VRBA 1CJ2A 3IHMA 3M12A 1HYUA 1FEBA 1CL0A 1LVLA 1IUXA 2C7GA 1TDNA 3NYEA 4B63A 3BNMA 3GD3A 1COYA 2FJEA 4RG3A 3BI2A 4U8NA 2GR0A 2Q7VA 5KRQA 4OPGA 1E1NA 3CTYA 3ATRA 3EPTA 2BS2A 4FK1C 4O5QA 2RGHA 2YVFA 2BCGG 5M10A 4BV6A 5TR3A 1RYIA 1X31B 4K8DA 1JNRA 3AE1A 4USRA 5KVHA 4JY3A 2GH5A 3KPFA 1L9DA 3S61A 1FEAA 2V6OA 1RP0A 1GPEA 2GF3A 2XVIA 3GDNA 5BULA 3E1TA 1N4WA 2YR6A 4U2LA 1ZMCA 1GT8A 5JCKA 1KDGA 2VQ7A 3CGCA 4JDRA 5GRTA 1B8SA 1DOBA 2XFPA 5KOWA 2WOIA 1TDEA 3F8PA 1GRHA 2BS3A 3HZLA 4YKGA 1TYPA 2R0PA 4J31A 2VRMA 1JRXA 1BGJA 2C64A 1IUWA 2GMHA 4IA5A 1JRYA 4DSHA 3EAOA
chains in the Genus database with same CATH superfamily
3CNDA 2JB3A 3A7UA 1YQ3A 3GDPA 2ZC8A 2GR3A 2PCEA 4Y4LA 3T31A 4FDCB 2VVLA 3CNTA 4YXDA 4BURA 4A6NA 4E8GA 3DJDA 3NVZB 1CC4A 2CULA 2X3NA 3Q45A 3CPJG 1JOAA 3UOVA 3ZYXA 3L8KA 3VCCA 3V3OA 1KSSA 2W0HA 3PWIA 2OALA 2OO6A 1VQZA 3CNJA 3NN0X 3NS1B 1KNRA 2Q0KA 2QJNA 1S3BA 4TM4A 3TCSA 4D03A 4WCTA 4AOXA 1EBDA 4B66A 4IVMB 4GAPA 4JN7A 1ZOVA 3D1CA 2RDXA 2AR8A 3ZLFA 4OPDA 3TWBA 2BXRA 4LU6A 2CDUA 3NTAA 2WP9A 4JN9A 3CB3A 2GGGA 2PP3A 4YSZA 5JCMA 2C3DA 4EMIA 3SN0A 2GV8A 2OFJA 4IV9A 4J1OA 4TVWA 3NNEA 3CAWA 3UJEA 3H70A 1MOKA 4OVIA 2XLTA 4EQXA 3DFYA 2Y6QA 3RP8A 2YQUA 3CPHG 1NDAA 1JCTA 2BACA 2OZ8A 2R46A 4II3A 4AT2A 3PG6A 1FIQB 1VRQB 1V59A 1JROA 2XDOA 2WP5A 3VRAA 3L1RA 2YLTA 4K2XA 1Y56A 3KVEA 4M6UA 3STPA 3AD9B 2C75A 1O94A 2GR1A 2WP6A 5FJPA 2AL2A 3ENLA 4B69A 3UOXA 5FJUA 2P8BA 1GERA 1D7YA 3UCLA 3H4KA 3ICTA 3VA8A 3R07C 3SSZA 4I58A 1B37A 1K4QA 2WDRA 2YM2A 2BK5A 2WDVA 3VCNA 1H86A 2QA1A 3T14A 1K0LA 3DDMA 4UDPA 3OZ2A 3V5CA 3GMCA 1NELA 1WUFA 3P93A 1GSNA 2GRTA 2FJDA 1IUUA 3DMEA 2YLXA 1M64A 4CBQA 1Y56B 2QVHA 3Q6JA 2WQYA 5BOEA 5EB5A 3REDA 1L9EA 2WPCA 2PU0A 4A35A 3ES8A 2AL2B 2HNEA 2RGJA 3II4A 3V4BA 1GESA 4Z43A 3C4AA 4BK3A 2A8XA 2OG9A 3UKPA 3VR9A 7ENLA 2OA1A 3NYCA 4GYPA 3NT6A 1EL5A 1ZDLA 3CXOA 3UKFA 1DXLA 3SFEA 2XVEA 2B7SA 4USQA 3GY1A 3VC6A 4H1ZA 2GGIA 4HCDA 2APGA 3SBFA 4G6HA 3V3NA 3BOXA 4TM0A 2GDQA 1CC6A 1E7PA 3DESA 2AKZA 4KX6A 3UJSA 2PP1A 1PBCA 2CFYA 4YSYA 4LIIA 3U4FA 1BGNA 1CHUA 1N4UA 3GYJA 3AE4A 6ENLA 3WE0A 3SZFA 1BWCA 3UOYA 2WOWA 3ATQA 1Q9IA 1PDHA 5KMQA 4YSXA 4ADWA 3KA7A 4NTDA 3UKHA 1XS2A 2GGEA 3EEZA 2YM1A 1REOA 1LJ1A 3I3LA 4X9MA 4C77A 1RVKA 3KKJA 1IYXA 3DGBA 1ZK7A 5BUKA 3DK4A 4A6GA 2XLUA 1EBGA 1N4VA 3SN4A 3RCYA 4H4QA 3Q9TA 4ZA0A 1GRBA 3OW1A 4YWOA 4AP1A 4GDEA 2V61A 3LJPA 3SM8A 2MUCA 4H4UA 1MDLA 3UTHA 2OX4A 3RO6A 5KXJA 4RG4A 1N5WC 1P48A 4P9SA 1CJ2A 3T0KA 4B63A 2C7GA 1COYA 2FJEA 3T2YA 2MNRA 2Q7VA 2PODA 1E1NA 3ATRA 3UGVA 1DTNA 4DXKA 4BV6A 5TR3A 3AE1A 4USRA 5KVHA 4JY3A 3KPFA 2W54A 2V6OA 5EU9A 2YR6A 1KDGA 1DOBA 3ZVIA 2WOIA 3F8PA 4HN8A 1TYPA 4J31A 2C64A 3EAOA 1R0MA 4TLXA 1F6MA 3H8LA 4U8LA 3LZXA 3N6JA 3AE8A 2B76A 2VVMA 3GYIA 3V5FA 4DSGA 3UCDA 2GEWA 3CNSA 3AEEA 1PBBA 2F5ZA 2OAMA 3MY9A 2BXSA 3I6DA 2PA6A 2E1MA 4U8KA 3TW9A 3UXLA 3B9JB 3PWGA 4IVOB 2W3RA 4OPTA 4EMWA 2GR2A 4CY6A 3TQPA 4U8PA 2R0CA 4TLZA 3UTGA 1ELSA 1TDFA 3AD8B 3FJ4A 3BNUA 2CHRA 4OPCA 2OLNA 2I5QA 1FECA 1R6WA 2BYBA 1VG9A 4KPRA 2BABA 5KOXA 3DG3A 3IHGA 3UKKA 2P3ZA 2BS4A 5IQ1A 5KMPA 2GAGB 3HRDC 4JNQA 3KUMA 3GC2A 2R0GA 2R4JA 3LB8A 3SQPA 1SJBA 1XPYA 2JBVA 1GREA 4BK2A 2GMJA 1B5QA 3FV9A 1V97A 1PJ5A 4YKFA 3Q4DA 4DN1A 3QFBA 3SZWA 3SGLA 2OLAA 2QQ6A 3DG6A 2BCPA 3O0HA 1D5TA 4J57A 4HNCA 2X50A 1EL7A 2V60A 1ONEA 2WHDA 3RP7A 3OPSA 3AWIA 2C65A 3RITA 3NG7X 2E5VA 2PYXA 2YG7A 2C4CA 4Z24A 1GNDA 4A7AA 2EQ7A 4JY2A 4YT0A 2Z5YA 2YWLA 3R1ZA 2TPRA 1JRPA 3DIPA 1FHVA 2FKPA 3NN6X 3R10A 5JCLA 1SJCA 3BHKA 4DGKA 2VQBA 2JB1A 2X8HA 2HQMA 4G7FA 3DERA 1Y0PA 1DOEA 3S5WA 3CYJA 3KD9A 3SXIA 4H2HA 4IL0A 1P2EA 2WETA 3K7MX 3NK1X 1EC8A 5M0ZA 2BC0A 3B3RA 3OZYA 1OEPA 1XDIA 2OPJA 1S2YA 4H4YA 4C74A 3G5QA 4HCHA 3AYLA 4MMWA 1L0VA 4EQWA 2I0ZA 3A7AA 3AM9A 1IUTA 1FOHA 3CMMA 4K8GA 3SJNA 1FCDA 5U63A 3UKAA 1N62C 3T9PA 3C96A 3N4EA 4IA6A 3AE5A 3B97A 4A6NB 2XLSA 2Q0LA 2IVDA 1L8PA 2YR4A 1TDOA 3DK8A 4IZGA 5JCNA 3SQSA 1LV0A 4UDQA 4CCQA 4B64A 3ETRB 3RHAA 4G6GA 3D8XA 4GRTA 2C66A 3OC4A 5G5HB 4GUVA 2C76A 1JPMA 1NU5A 3RGTA 3K1GA 2HZGA 2O9ZA 4DNAA 2HXUA 2PHHA 3PK7A 1TE6A 2PP0A 2H89A 3P4RA 2VZ2A 4IL2A 2XVJA 1QLBA 3ZLGA 4Y4MA 3U9IA 1DJNA 2A87A 1W4XA 1F9CA 1D7LA 4YTNA 3RNMA 2X99A 1E6EA 4FK1A 1FFVC 4YSHA 5KMRA 4GGHA 4EIQA 1FFUC 4CNKA 2ARDA 3I4KA 2TMDA 2PTWA 3JVAA 5C2TA 2YLSA 1RM6B 4Z1YA 3SFDA 3ABVA 2PTZA 4EM3A 5HXIA 3THUA 4G8TA 4HYRA 1UKVG 4O5UA 3AEAA 4X4JA 3BJSA 1WUEA 1JRZA 2QCUA 3D47A 4DYEA 4UP3A 4GYPC 1LTXR 3R9UA 4H19A 3EF6A 2ZZ0A 3P0WA 1TKKA 4H4SA 2XFOA 4Z25A 4B67A 2H88A 3P3BA 1PN0A 4U2TA 4J3ZA 2WOVA 4OPUA 4G9KA 3AEBA 3NRNA 4K7ZA 5ENLA 2WEUA 2RGOA 3NH3X 5G5GB 2YVJA 3G5SA 1BQGA 2PGEA 4HPNA 4J56A 1E1KA 3AE2A 1JEHA 1PXBA 4CNJA 5KMSA 1PJ6A 1OJTA 4KEMA 1TYTA 1NHSA 4JQ9A 3URHA 3GMBA 1DODA 2YLRA 1Q1WA 4TM1A 5BRTA 2V3BA 4EM4A 3UCCA 1FEBA 1TDNA 4RG3A 4U8NA 3CK5A 2PU1A 3D46A 5KRQA 2RGHA 2BCGG 5KNLA 3SZCA 4E5TA 1L9DA 1FEAA 4DHGA 1GPEA 2OVLA 1ZMCA 2XH2A 3CGCA 5GRTA 5KOWA 3HZLA 3GO2A 3T6CA 2GMHA 1JRYA 3V3WA 3R0KA 3FIMB 3NK2X 2VRLA 1KKOA 2JKCA 5FS8A 5KWFA 3AD7B 5KVIA 3NXLA 4EWJA 1MXTA 2WU5A 4GMEA 2BK3A 1PBFA 2GVCA 2GL5A 1N61C 1OJAA 4PABA 2DW6A 4NEVA 2NQLA 1KF6A 1YQ4A 3UOZA 3TTEA 1XANA 3NK0X 1GXFA 5FS7A 4KT2A 4XXGA 1E1LA 3GWDA 4IHCA 4U8IA 2YVGA 2PMQA 3UP5A 4YTMA 3M13A 3DFHA 3QSMA 1S2QA 4KPLA 4WX1A 4K2SA 1H7XA 4ZCWA 3TOYA 2YR5A 3KLJA 4IP4A 1H81A 4G74A 3LXDA 5U25A 1YEYA 3FG2P 3T37A 3ZDNA 1NHRA 2VVLG 1E1MA 4H2RA 3SYIA 1ZY8A 3ALJA 4NEWA 1H83A 4ENLA 2PGWA 4H4XA 3ITJA 4G73A 4LA1A 3NIXA 4H2NA 4MGGA 2J3NA 1ELIA 3MZNA 3CGDA 3P4PA 4A79A 4AT0A 3DGHA 2XSXA 1NG3A 3MSYA 1NENA 2JAEA 3QVPA 3P4SA 3JW7A 2GQWA 3RR1A 4NTEA 5J7XA 1GETA 4ECHA 3OP2A 2AKMA 3LADA 1X2GA 4K22A 1TDKA 4JHMA 3VFCA 1N1PA 2FJBA 2YLZA 3CGBA 2XVHA 4OPIA 4K5SA 3NKSA 3DEQA 3UP4A 1VDCA 1EC9A 2BRAA 3BI5A 3QPEA 4YTPA 3VR8A 1TRBA 1ONFA 3NLCA 3GSIA 2YAUA 4GAVA 2IVEA 3BI4A 1WYGA 3M0OA 3CIRA 2C70A 1GRFA 1B4VA 2ZZCA 3IJQA 4N9XA 4Y4NA 1EC7A 2BC1A 5U1OA 4NNJA 4EMJA 2GQFA 3AE3A 2POZA 4U8MA 1VDVA 4XWZA 4OCGA 2PTYA 3DA1A 3SR6B 2GGJA 2AL1A 3IK4A 2V3AA 2BA9A 1O5WA 3F8DA 4FI4A 1KN0A 3FBSA 4APNA 2PPGA 1P43A 3BHFA 2EQ9A 4GIRA 1L9CA 5FJTA 2B9WA 3GD4A 3ADAB 3P9UA 4C5OA 1S3EA 1W6TA 1GV4A 3GRTA 1KSUA 4GCMA 3FPZA 4J2WA 3K7TA 1GRGA 2DKHA 2QA2A 4HCLA 3AEFA 3TJ4A 3PFRA 1NHPA 4J33A 2XFNA 1PDYA 3TWAA 1CJCA 4BK1A 1ZXIC 1KCZA 3AEDA 1EBHA 4Z2RA 1F8RA 4EQRA 1ZP0A 2XH0A 3V76A 3AEGA 3QFAA 3G5RA 3DK9A 4U2SA 3SX6A 4GFIA 3H8AA 1RSGA 4FP1A 4ZCDA 3ES7A 5BOFA 1BKWA 1P2HA 3KPKA 3UJFA 3NVVB 3AE9A 2PTXA 4II2A 3JSKA 1MDRA 1EL8A 2WESA 1GRAA 1NAAA 3N4FA 4E0VA 5FMHA 3S47A 3UJ2A 2B7RA 3AYIA 5FS9A 2C67A 2XFQA 2OKTA 1PBDA 4ICYA 2XLRA 3DG7A 1IJHA 2DW7A 1SJAA 3COXA 2GGHA 4GISA 1BF3A 5IDZA 1JU2A 2OQHA 2WPEA 3KU9A 2OZTA 1LQUA 3CNPA 4GF7A 4J34A 3NHOX 1QO8A 2OQYA 4KWSA 2Z5XA 3D9XA 4H4ZA 5EB4A 1KFYA 4H4TA 4REKA 4EIPA 3FXGA 1N5XA 1STZA 4CRTA 3VC5A 1PXCA 4A3RA 3H12A 3AN1A 3GWFA 1GEUA 1K0JA 1GTEA 1SJDA 2PSNA 3FMWA 3UTEA 1BKHA 4ZN0A 2EQ6A 4BJZA 2NPXA 2XH4A 4A99A 3LZWA 3AE6A 3CXBA 4Z17A 1DNCA 3CN8A 3RRAA 5IPYA 1H82A 4K1WA 4H2QA 3IF9A 4H50A 3VRBA 3M12A 1CL0A 1LVLA 3BNMA 4H83A 3BI2A 1FO4A 1N63C 4OPGA 3CTYA 4FK1C 4O5QA 3TJIA 2YVFA 5M10A 1RYIA 1X31B 2GH5A 3T2KA 1PDZA 1RP0A 2XVIA 3GDNA 2GF3A 4GGBA 3I6TA 4U2LA 2VQ7A 3R25A 1B8SA 2QGYA 2XFPA 1TDEA 1GRHA 4YKGA 2R0PA 1JRXA 4E4FA 1IUWA 4A5LA 4I59A 2ONEA 3T8QA 1MRAA 3ICRA 1VQWA 4JNAA 4U8OA 3QSEA 1KKRA 1H7WA 2EQ8A 3HW2A 1FHUA 1NHQA 4X9NA 3GYXA 4H4RA 2W55A 3AECA 4B68A 4J36A 3GD6A 5FJRA 4HA6A 3R0UA 2GAHB 2X8CA 1GOSA 3EKGA 3MQTA 2FBWA 2YG4A 3F8RA 4RSLA 4AP3A 1BZLA 2UZZA 2QDDA 2DKIA 2E5AA 3IJIA 3DH9A 4CCRA 1PJ7A 4B1BA 2VOUA 3P4QA 2X8GA 1XHCA 4CY8A 4TM3A 3N6HA 3MUCA 4IP5A 2XCGA 1IUSA 5BVAA 2P88A 3CGEA 5JRBA 1JDFA 3QVRA 3C4NA 3QSSA 2XH7A 3L5OA 3QN3A 4GR1A 3DGZA 3ALMA 1PBEA 2B9XA 4H2PA 4E4UA 3UKLA 3HYXA 5FJOA 1GALA 4FX9A 5JCIA 4TVYA 2FYMA 2BK4A 2C73A 1LQTA 2XVFA 5IQ4A 2XGZA 3AMZA 3PO7A 4NWZA 3DJGX 2IIDA 4NTCA 1D4DA 1FL2A 3OZMA 1ECQA 1H2IA 5EOWA 4NZHA 1F8WA 3EANA 1IUVA 3AYJA 1MNSA 3VQRA 3MWCA 1NG4A 5DBJA 5CQFA 3HYVA 3SN1A 2QDEA 2YG6A 3UKQA 1M6IA 4PAAA 3QKEA 2QAEA 1H6VA 4A9WA 3NFUA 2JK6A 5CKUA 2WU2A 1PS9A 1O95A 2BRYA 2QJJA 3NZGA 3K30A 3SY4A 1YKJA 2P8CA 1CC2A 3NVWB 2HXTA 2A89A 3FCPA 1ZMDA 2W3SA 1EL9A 2RABA 1JNZA 3NYFA 2Q6UA 4AOSA 1GTHA 2V5ZA 2Y6RA 5FS6A 5HYMA 1H84A 4JN8A 4A65A 2PS2A 4M52A 5LV9A 4MJWA 3B6DA 1ZKQA 1XPQA 4Z44A 3UXKA 3S5SA 2YG3A 1S7MA 3T4WA 3IC9A 4B65A 3H8IA 1QJDA 3ZVHA 4K5RA 1D4CA 3PVCA 1F3PA 2AAQA 3CT2A 3AE7A 2B9YA 3ALLA 3IJLA 1MUCA 3NVYB 3T2ZA 4DX3A 3QLDA 1CJ3A 2R45A 2WS3A 1VG0A 3FVDA 4U8JA 2WBAA 1Z6LA 3GRSA 1PHHA 4ZOHB 3PS9A 4YWSA 3ICSA 3I6EA 5C3JA 3P1WA 1E39A 3SZ0A 4MKSA 1OJDA 4UDRA 2R4EA 3CPIG 3IWAA 1LPFA 2R9ZA 3ISHA 5J60A 2XLPA 3HYWA 4M0XA 4H4PA 1NEKA 1T3QC 5HHFA 5ER0A 5L46A 3ZLHA 3NGCX 3NRZB 3ZVHB 4Z2UA 1YY5A 2YLWA 5J04A 2GB0A 3DJEA 2P0IA 2OZ3A 1CBOA 2QJMA 1N60C 2JB2A 4Z2TA 3K7QX 4IT1A 2C72A 4H4VA 2AQJA 1PXAA 2OLOA 1Q1RA 2ZBWA 2E3TA 2GSHA 1DJQA 4D04A 4HNLA 4E6MA 2C3CA 4HB9A 1NPXA 4C3XA 3UTFA 3NTDA 1KNPA 2XYOA 3A7RA 1MO9A 1K0IA 2YG5A 4X2PA 1SEZA 4F4RA 1AOGA 2O56A 1E9IA 3UJRA 4EQSA 3RP6A 2ZZBA 4C3YA 3DJJA 3QTPA 1F8SA 4ZCCA 2NVKX 2FJAA 4BJYA 2WDQA 1ZOYA 4Z26A 1D4EA 3FYYA 3JZUA 1OJCA 3MKCA 2E4GA 5GSNA 3HPFA 4GDPA 4ROPA 3AB1A 1GRTA 4OPLA 1CJ4A 4H4WA 1KD0A 1ZX9A 3AXBA 1OJ9A 2WPFA 1DOCA 3VDGA 2CVJA 2ACZA 5EBKA 4H7UA 3VRDB 4XWRA 2XFUA 3EUB3 5HY5A 3LOVA 3QJ4A 1YQZA 3BSMA 1TZZA 1CF3A 3IHMA 1HYUA 1IUXA 3NYEA 1JPDX 3H7VA 3GD3A 3NO1A 2GR0A 3EPTA 2BS2A 3R11A 4K8DA 1JNRA 1X2HA 3S61A 5BULA 3E1TA 1N4WA 2ZADA 3OTRA 1GT8A 5JCKA 1SB3B 4JDRA 4DWDA 2BS3A 2VRMA 1BGJA 4IA5A 4DSHA
chains in the Genus database with same CATH topology
3CNDA 4A5LA 4I59A 3FIMB 2JB3A 3NK2X 2VRLA 4TLXA 2JKCA 5FS8A 1F6MA 3H8LA 5KWFA 4U8LA 1YQ3A 3AD7B 3GDPA 3LZXA 2GR3A 5KVIA 3AE8A 1MXTA 4Y4LA 2WU5A 2B76A 2VVMA 3GYIA 3T31A 4FDCB 2BK3A 4DSGA 2VVLA 3ICRA 1VQWA 2GEWA 3CNSA 4JNAA 4U8OA 1PBFA 3QSEA 3CNTA 4YXDA 1H7WA 3AEEA 2GVCA 2EQ8A 4BURA 1NHQA 1OJAA 1PBBA 4X9NA 4A6NA 4PABA 3GYXA 2F5ZA 4H4RA 2OAMA 1KF6A 4NEVA 1YQ4A 3DJDA 1CC4A 3UOZA 2CULA 2BXSA 3I6DA 3AECA 4B68A 1XANA 2E1MA 4J36A 3NK0X 1GXFA 4U8KA 5FS7A 2X3NA 4IVOB 3CPJG 1JOAA 4OPTA 3UOVA 4EMWA 4HA6A 2GR2A 4CY6A 3ZYXA 4XXGA 1E1LA 3L8KA 4U8PA 2R0CA 3GWDA 3V3OA 2GAHB 1KSSA 4TLZA 2X8CA 3UTGA 1TDFA 1GOSA 2W0HA 2OALA 3AD8B 2FBWA 2YG4A 3F8RA 4RSLA 4AP3A 1BZLA 3BNUA 2UZZA 4OPCA 4U8IA 2OLNA 2DKIA 3CNJA 3NN0X 2YVGA 3UP5A 1FECA 4YTMA 3DH9A 1KNRA 4CCRA 2Q0KA 2BYBA 1PJ7A 3M13A 2VOUA 4B1BA 3P4QA 1VG9A 1S3BA 4KPRA 4TM4A 2X8GA 1XHCA 2BABA 5KOXA 3IHGA 4CY8A 4D03A 3QSMA 1S2QA 4TM3A 4WCTA 4WX1A 3UKKA 2BS4A 1EBDA 4AOXA 5IQ1A 5KMPA 4B66A 2XCGA 2GAGB 4IVMB 1IUSA 1H7XA 4GAPA 1ZOVA 3D1CA 5BVAA 2YR5A 3KLJA 3CGEA 4JNQA 5JRBA 2AR8A 3QVRA 3C4NA 1H81A 2R0GA 3QSSA 3L5OA 4GR1A 2R4JA 3LXDA 4G74A 5U25A 3DGZA 3LB8A 3ALMA 4OPDA 1PBEA 3SQPA 2B9XA 2BXRA 4LU6A 2CDUA 4H2PA 3FG2P 3T37A 3ZDNA 2JBVA 3UKLA 3NTAA 2WP9A 3HYXA 1NHRA 4JN9A 1GALA 1GREA 4BK2A 2VVLG 1E1MA 4FX9A 4H2RA 4YSZA 5JCMA 5JCIA 2C3DA 3SYIA 1ZY8A 4EMIA 2GMJA 3ALJA 2GV8A 4IV9A 1B5QA 4NEWA 3NNEA 1H83A 2BK4A 4H4XA 1MOKA 1PJ5A 3ITJA 4YKFA 3QFBA 2C73A 4G73A 3SZWA 4LA1A 1LQTA 2XVFA 3NIXA 4H2NA 3SGLA 5IQ4A 4OVIA 2J3NA 1ELIA 2XLTA 3PO7A 4NWZA 3DJGX 2BCPA 3O0HA 1D5TA 3CGDA 3P4PA 4A79A 4J57A 4EQXA 2Y6QA 2X50A 1EL7A 3RP8A 3DGHA 2IIDA 4AT0A 2YQUA 4NTCA 1NG3A 2V60A 3CPHG 1NDAA 2WHDA 1NENA 2JAEA 3RP7A 1D4DA 1FL2A 2BACA 3QVPA 2R46A 3P4SA 1H2IA 4II3A 4AT2A 2GQWA 3PG6A 5EOWA 3AWIA 2C65A 1VRQB 1V59A 4NTEA 4NZHA 3NG7X 1F8WA 5J7XA 2XDOA 2WP5A 2E5VA 1GETA 2PYXA 2YG7A 3EANA 1IUVA 2C4CA 3AYJA 3VQRA 3VRAA 4ECHA 1NG4A 5DBJA 4Z24A 3LADA 5CQFA 1TDKA 3L1RA 1GNDA 2YLTA 1N1PA 3HYVA 4K22A 1Y56A 4K2XA 2EQ7A 4A7AA 2FJBA 3KVEA 2YLZA 4JY2A 3CGBA 2YG6A 2Z5YA 3UKQA 4YT0A 3AD9B 1M6IA 2C75A 2YWLA 1O94A 2GR1A 2XVHA 2TPRA 4PAAA 4OPIA 2WP6A 3NN6X 2QAEA 5JCLA 4B69A 3BHKA 3UOXA 1H6VA 4A9WA 4K5SA 4DGKA 2JK6A 3NKSA 3UP4A 1D7YA 1GERA 2VQBA 3UCLA 1VDCA 5CKUA 2WU2A 2BRAA 3H4KA 1PS9A 2JB1A 3BI5A 3ICTA 4YTPA 1O95A 3VR8A 2BRYA 1TRBA 1ONFA 2HQMA 2X8HA 3NLCA 3K30A 3SY4A 3GSIA 1YKJA 2YAUA 4GAVA 1CC2A 4I58A 1B37A 1K4QA 2A89A 2WDRA 1Y0PA 1DOEA 1ZMDA 3S5WA 2IVEA 3BI4A 2YM2A 3KD9A 1EL9A 2BK5A 3M0OA 2WDVA 2RABA 3CIRA 3SXIA 2C70A 1H86A 1GRFA 1JNZA 2QA1A 3T14A 1K0LA 3NYFA 2Q6UA 1B4VA 4AOSA 1P2EA 1GTHA 2V5ZA 2WETA 2ZZCA 2Y6RA 4N9XA 3OZ2A 4UDPA 4Y4NA 3K7MX 3NK1X 3GMCA 5FS6A 5HYMA 1H84A 2BC1A 5U1OA 5M0ZA 2BC0A 4A65A 3B3RA 4NNJA 1GSNA 4M52A 4EMJA 1XDIA 2GQFA 2GRTA 1S2YA 2FJDA 3AE3A 1ZKQA 3B6DA 1IUUA 3DMEA 4MJWA 5LV9A 4H4YA 1XPQA 2YLXA 3G5QA 4U8MA 4Z44A 4C74A 1M64A 2YG3A 1S7MA 3AYLA 4XWZA 4OCGA 4CBQA 3IC9A 3DA1A 4B65A 1Y56B 4EQWA 1L0VA 3Q6JA 3H8IA 1QJDA 2WQYA 2I0ZA 4K5RA 5EB5A 1IUTA 1FOHA 1D4CA 3REDA 2V3AA 3CMMA 2BA9A 1L9EA 2WPCA 1O5WA 3F8DA 3PVCA 1FCDA 1F3PA 5U63A 2AAQA 3UKAA 1KN0A 3FBSA 3AE7A 2B9YA 2RGJA 4APNA 3ALLA 3II4A 3C96A 4IA6A 1GESA 4Z43A 3BHFA 2EQ9A 3AE5A 4A6NB 1L9CA 2XLSA 3T2ZA 2B9WA 3GD4A 1CJ3A 2Q0LA 3ADAB 3C4AA 2R45A 3P9UA 4BK3A 4C5OA 2IVDA 2WS3A 1S3EA 1VG0A 1GV4A 2A8XA 3GRTA 3UKPA 2YR4A 4U8JA 2WBAA 1TDOA 3VR9A 3DK8A 1KSUA 1Z6LA 4GCMA 3GRSA 1PHHA 5JCNA 1LV0A 2OA1A 3FPZA 3PS9A 3NYCA 4J2WA 4UDQA 4CCQA 3ICSA 4B64A 3K7TA 5C3JA 3P1WA 1GRGA 2DKHA 2QA2A 1E39A 3SZ0A 3NT6A 3RHAA 1OJDA 3AEFA 4UDRA 2R4EA 3CPIG 3IWAA 4G6GA 1NHPA 1EL5A 4J33A 3D8XA 1ZDLA 4GRTA 2XFNA 1LPFA 3UKFA 2C66A 2R9ZA 1DXLA 3ISHA 5J60A 2XLPA 3OC4A 3SFEA 2XVEA 3HYWA 1CJCA 2C76A 4GUVA 2B7SA 4USQA 4H4PA 4BK1A 2O9ZA 4DNAA 3AEDA 2APGA 4Z2RA 1F8RA 2PHHA 4EQRA 4G6HA 1ZP0A 1NEKA 3V3NA 4TM0A 5HHFA 3V76A 3AEGA 3QFAA 5ER0A 3DK9A 3G5RA 4U2SA 3SX6A 5L46A 2H89A 3NGCX 1CC6A 1RSGA 4ZCDA 3P4RA 2VZ2A 4Z2UA 1YY5A 1E7PA 2YLWA 2GB0A 1BKWA 2XVJA 1P2HA 1QLBA 3DJEA 1CBOA 3KPKA 3AE9A 4II2A 4Y4MA 4KX6A 2JB2A 4Z2TA 1DJNA 3JSKA 3K7QX 2A87A 2C72A 4H4VA 1PBCA 2CFYA 1W4XA 1D7LA 1EL8A 2WESA 1GRAA 1NAAA 1PXAA 4LIIA 3RNMA 2AQJA 2OLOA 4YSYA 4YTNA 1Q1RA 2ZBWA 4E0VA 2X99A 5FMHA 1BGNA 1E6EA 1CHUA 1N4UA 4FK1A 3GYJA 3AE4A 4YSHA 5KMRA 2B7RA 3AYIA 4EIQA 1DJQA 4D04A 4CNKA 5FS9A 3WE0A 2C67A 2ARDA 2C3CA 3SZFA 4HB9A 1NPXA 1BWCA 3UOYA 2WOWA 4C3XA 2TMDA 3ATQA 1Q9IA 2XFQA 3UTFA 3NTDA 1PDHA 1KNPA 1PBDA 5KMQA 4YSXA 2XYOA 1MO9A 4ADWA 1K0IA 3KA7A 4ICYA 2XLRA 4NTDA 2YG5A 5C2TA 1SEZA 2YLSA 3UKHA 1AOGA 1IJHA 2YM1A 1REOA 4EQSA 3COXA 3SFDA 3ABVA 1LJ1A 3RP6A 3I3LA 2ZZBA 4C3YA 4EM3A 5HXIA 4X9MA 3DJJA 1BF3A 1JU2A 4C77A 2WPEA 3KU9A 1UKVG 4O5UA 1LQUA 1F8SA 3AEAA 3CNPA 4GF7A 4J34A 3KKJA 4ZCCA 2NVKX 4X4JA 2FJAA 3NHOX 1QO8A 4BJYA 2WDQA 1ZOYA 4Z26A 1D4EA 1JRZA 2QCUA 1ZK7A 2Z5XA 5BUKA 1OJCA 4UP3A 3D9XA 4H4ZA 3DK4A 5EB4A 1KFYA 1LTXR 2E4GA 5GSNA 2XLUA 3R9UA 4GDPA 3AB1A 1GRTA 4H4TA 4REKA 1N4VA 4OPLA 4EIPA 3EF6A 1CJ4A 2ZZ0A 4CRTA 4H4WA 4H4SA 4Z25A 2XFOA 1ZX9A 4H4QA 4B67A 1PXCA 3Q9TA 3AXBA 1OJ9A 1GRBA 2H88A 3GWFA 1PN0A 4YWOA 2WPFA 4U2TA 4AP1A 1GEUA 1K0JA 1DOCA 1GTEA 2WOVA 4GDEA 4OPUA 2CVJA 4G9KA 3AEBA 3NRNA 4K7ZA 2ACZA 3FMWA 2WEUA 2RGOA 3UTEA 5EBKA 4H7UA 3NH3X 4ZN0A 2YVJA 2V61A 3G5SA 3LJPA 2EQ6A 3VRDB 4BJZA 4XWRA 2NPXA 4J56A 1E1KA 4A99A 2XFUA 3SM8A 3AE2A 3LZWA 1JEHA 1PXBA 3AE6A 5HY5A 4CNJA 1DNCA 4H4UA 3LOVA 3QJ4A 1YQZA 3CN8A 3UTHA 5KMSA 5IPYA 1PJ6A 1OJTA 1CF3A 1H82A 4H2QA 1TYTA 3IF9A 1NHSA 5KXJA 4JQ9A 4RG4A 3URHA 3GMBA 1DODA 2YLRA 1Q1WA 4TM1A 5BRTA 4H50A 4P9SA 2V3BA 4EM4A 3VRBA 1CJ2A 3IHMA 3M12A 1HYUA 1FEBA 3T0KA 1CL0A 1LVLA 1IUXA 2C7GA 1TDNA 3NYEA 4B63A 3BNMA 3GD3A 1COYA 2FJEA 4RG3A 3T2YA 3BI2A 4U8NA 2GR0A 2Q7VA 5KRQA 4OPGA 1E1NA 3CTYA 3ATRA 3EPTA 2BS2A 4FK1C 4O5QA 2RGHA 2YVFA 2BCGG 5M10A 4BV6A 5KNLA 5TR3A 1RYIA 1X31B 4K8DA 1JNRA 3SZCA 3AE1A 4USRA 5KVHA 4JY3A 2GH5A 3KPFA 3T2KA 1L9DA 3S61A 1FEAA 2V6OA 1RP0A 1GPEA 2GF3A 2XVIA 3GDNA 5BULA 3E1TA 1N4WA 2YR6A 4U2LA 1ZMCA 1GT8A 5JCKA 1KDGA 2VQ7A 3CGCA 4JDRA 5GRTA 1B8SA 1DOBA 2XFPA 5KOWA 2WOIA 1TDEA 3F8PA 1GRHA 2BS3A 3HZLA 4YKGA 1TYPA 2R0PA 4J31A 2VRMA 1JRXA 1BGJA 2C64A 1IUWA 2GMHA 4IA5A 1JRYA 4DSHA 3EAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CND A;  4A5L A;  4I59 A;  3FIM B;  2JB3 A;  3NK2 X;  2VRL A;  4TLX A;  2JKC A;  5FS8 A;  1F6M A;  3H8L A;  5KWF A;  4U8L A;  1YQ3 A;  3AD7 B;  3GDP A;  3LZX A;  2GR3 A;  5KVI A;  3AE8 A;  1MXT A;  4Y4L A;  2WU5 A;  2B76 A;  2VVM A;  3GYI A;  4FDC B;  2BK3 A;  4DSG A;  2VVL A;  3ICR A;  1VQW A;  2GEW A;  3CNS A;  4JNA A;  4U8O A;  1PBF A;  3QSE A;  3CNT A;  4YXD A;  1H7W A;  3AEE A;  2GVC A;  2EQ8 A;  4BUR A;  1NHQ A;  1OJA A;  1PBB A;  4X9N A;  4A6N A;  4PAB A;  2F5Z A;  4H4R A;  2OAM A;  1KF6 A;  4NEV A;  1YQ4 A;  3DJD A;  1CC4 A;  3UOZ A;  2CUL A;  2BXS A;  3I6D A;  3AEC A;  4B68 A;  1XAN A;  2E1M A;  4J36 A;  3NK0 X;  1GXF A;  4U8K A;  5FS7 A;  2X3N A;  4IVO B;  3CPJ G;  1JOA A;  4OPT A;  3UOV A;  4EMW A;  4HA6 A;  2GR2 A;  4CY6 A;  3ZYX A;  4XXG A;  1E1L A;  3L8K A;  4U8P A;  2R0C A;  3GWD A;  3V3O A;  2GAH B;  1KSS A;  4TLZ A;  2X8C A;  3UTG A;  1TDF A;  1GOS A;  2W0H A;  2OAL A;  3AD8 B;  2FBW A;  2YG4 A;  3F8R A;  4RSL A;  4AP3 A;  1BZL A;  3BNU A;  2UZZ A;  4OPC A;  4U8I A;  2OLN A;  2DKI A;  3CNJ A;  3NN0 X;  2YVG A;  3UP5 A;  1FEC A;  4YTM A;  3DH9 A;  1KNR A;  4CCR A;  2Q0K A;  2BYB A;  1PJ7 A;  3M13 A;  2VOU A;  4B1B A;  3P4Q A;  1VG9 A;  1S3B A;  4KPR A;  4TM4 A;  2X8G A;  1XHC A;  2BAB A;  5KOX A;  3IHG A;  4CY8 A;  4D03 A;  3QSM A;  1S2Q A;  4TM3 A;  4WCT A;  4WX1 A;  3UKK A;  2BS4 A;  1EBD A;  4AOX A;  5IQ1 A;  4B66 A;  2XCG A;  2GAG B;  4IVM B;  1IUS A;  1H7X A;  1ZOV A;  3D1C A;  5BVA A;  2YR5 A;  3KLJ A;  3CGE A;  4JNQ A;  2AR8 A;  3QVR A;  3C4N A;  1H81 A;  2R0G A;  3QSS A;  4GR1 A;  2R4J A;  3LXD A;  5U25 A;  3DGZ A;  3LB8 A;  3ALM A;  4OPD A;  1PBE A;  3SQP A;  2B9X A;  2BXR A;  4LU6 A;  2CDU A;  4H2P A;  3FG2 P;  3T37 A;  3ZDN A;  2JBV A;  3UKL A;  3NTA A;  2WP9 A;  1NHR A;  4JN9 A;  1GAL A;  1GRE A;  4BK2 A;  2VVL G;  1E1M A;  4FX9 A;  4H2R A;  4YSZ A;  5JCM A;  5JCI A;  2C3D A;  1ZY8 A;  4EMI A;  2GMJ A;  3ALJ A;  2GV8 A;  4IV9 A;  1B5Q A;  4NEW A;  3NNE A;  1H83 A;  2BK4 A;  4H4X A;  1MOK A;  1PJ5 A;  3ITJ A;  4YKF A;  3QFB A;  2C73 A;  4LA1 A;  1LQT A;  2XVF A;  3NIX A;  4H2N A;  3SGL A;  5IQ4 A;  4OVI A;  2J3N A;  1ELI A;  2XLT A;  3PO7 A;  3DJG X;  2BCP A;  3O0H A;  1D5T A;  3CGD A;  3P4P A;  4A79 A;  4J57 A;  4EQX A;  2Y6Q A;  2X50 A;  1EL7 A;  3RP8 A;  3DGH A;  2IID A;  4AT0 A;  2YQU A;  4NTC A;  1NG3 A;  2V60 A;  3CPH G;  1NDA A;  2WHD A;  1NEN A;  2JAE A;  3RP7 A;  1D4D A;  1FL2 A;  2BAC A;  3QVP A;  2R46 A;  3P4S A;  4AT2 A;  2GQW A;  5EOW A;  3AWI A;  2C65 A;  1VRQ B;  1V59 A;  4NTE A;  4NZH A;  3NG7 X;  1F8W A;  5J7X A;  2XDO A;  2WP5 A;  2E5V A;  1GET A;  2PYX A;  2YG7 A;  3EAN A;  1IUV A;  3AYJ A;  3VQR A;  3VRA A;  4ECH A;  1NG4 A;  5DBJ A;  4Z24 A;  3LAD A;  5CQF A;  1TDK A;  3L1R A;  1GND A;  2YLT A;  1N1P A;  4K22 A;  4K2X A;  1Y56 A;  4A7A A;  2EQ7 A;  2FJB A;  3KVE A;  2YLZ A;  4JY2 A;  3CGB A;  2YG6 A;  2Z5Y A;  3UKQ A;  4YT0 A;  3AD9 B;  1M6I A;  2C75 A;  2YWL A;  1O94 A;  2GR1 A;  2XVH A;  2TPR A;  4PAA A;  4OPI A;  2WP6 A;  3NN6 X;  2QAE A;  5JCL A;  4B69 A;  3BHK A;  3UOX A;  1H6V A;  4A9W A;  4K5S A;  4DGK A;  2JK6 A;  3NKS A;  3UP4 A;  1D7Y A;  1GER A;  2VQB A;  3UCL A;  1VDC A;  5CKU A;  2WU2 A;  3BI5 A;  3H4K A;  1PS9 A;  2JB1 A;  3ICT A;  4YTP A;  1O95 A;  3VR8 A;  1TRB A;  1ONF A;  2HQM A;  2X8H A;  3NLC A;  3K30 A;  3GSI A;  1YKJ A;  2YAU A;  1CC2 A;  4I58 A;  1B37 A;  1K4Q A;  2A89 A;  2WDR A;  1Y0P A;  1DOE A;  1ZMD A;  3S5W A;  2IVE A;  3BI4 A;  2YM2 A;  3KD9 A;  1EL9 A;  2BK5 A;  3M0O A;  2WDV A;  2RAB A;  3CIR A;  2C70 A;  1H86 A;  1GRF A;  1JNZ A;  2QA1 A;  1K0L A;  3NYF A;  2Q6U A;  1B4V A;  4AOS A;  1P2E A;  1GTH A;  2V5Z A;  2WET A;  2ZZC A;  2Y6R A;  4N9X A;  3OZ2 A;  4UDP A;  4Y4N A;  3K7M X;  3NK1 X;  3GMC A;  5FS6 A;  5HYM A;  1H84 A;  2BC1 A;  5U1O A;  5M0Z A;  2BC0 A;  4A65 A;  3B3R A;  1GSN A;  4M52 A;  4EMJ A;  1XDI A;  2GQF A;  2GRT A;  1S2Y A;  2FJD A;  3AE3 A;  1ZKQ A;  3B6D A;  1IUU A;  3DME A;  4MJW A;  5LV9 A;  4H4Y A;  1XPQ A;  2YLX A;  3G5Q A;  4U8M A;  4Z44 A;  4C74 A;  1M64 A;  2YG3 A;  4XWZ A;  3AYL A;  4OCG A;  4CBQ A;  3IC9 A;  3DA1 A;  4B65 A;  1Y56 B;  4EQW A;  1L0V A;  3Q6J A;  3H8I A;  1QJD A;  2WQY A;  2I0Z A;  4K5R A;  5EB5 A;  1IUT A;  1FOH A;  1D4C A;  3RED A;  2V3A A;  2BA9 A;  1L9E A;  2WPC A;  1O5W A;  3F8D A;  3PVC A;  1FCD A;  1F3P A;  5U63 A;  2AAQ A;  3UKA A;  3FBS A;  3AE7 A;  2B9Y A;  2RGJ A;  4APN A;  3ALL A;  3II4 A;  3C96 A;  4IA6 A;  1GES A;  4Z43 A;  3BHF A;  2EQ9 A;  3AE5 A;  4A6N B;  1L9C A;  2XLS A;  2B9W A;  3GD4 A;  1CJ3 A;  2Q0L A;  3ADA B;  3C4A A;  2R45 A;  3P9U A;  4BK3 A;  4C5O A;  2IVD A;  2WS3 A;  1S3E A;  1VG0 A;  1GV4 A;  2A8X A;  3GRT A;  3UKP A;  2YR4 A;  4U8J A;  2WBA A;  1TDO A;  3VR9 A;  3DK8 A;  1KSU A;  1Z6L A;  4GCM A;  3GRS A;  1PHH A;  5JCN A;  1LV0 A;  2OA1 A;  3FPZ A;  3PS9 A;  3NYC A;  4J2W A;  4UDQ A;  4CCQ A;  3ICS A;  4B64 A;  3K7T A;  5C3J A;  3P1W A;  1GRG A;  2DKH A;  2QA2 A;  1E39 A;  3NT6 A;  3RHA A;  1OJD A;  3AEF A;  4UDR A;  2R4E A;  3CPI G;  3IWA A;  1NHP A;  1EL5 A;  4J33 A;  3D8X A;  1ZDL A;  4GRT A;  2XFN A;  1LPF A;  3UKF A;  2C66 A;  2R9Z A;  1DXL A;  3ISH A;  5J60 A;  2XLP A;  3OC4 A;  3SFE A;  2XVE A;  4GUV A;  1CJC A;  2C76 A;  2B7S A;  4USQ A;  4H4P A;  4BK1 A;  2O9Z A;  4DNA A;  3AED A;  2APG A;  4Z2R A;  1F8R A;  2PHH A;  4EQR A;  3V3N A;  1ZP0 A;  1NEK A;  4TM0 A;  5HHF A;  3V76 A;  3AEG A;  3QFA A;  5ER0 A;  3DK9 A;  3G5R A;  4U2S A;  5L46 A;  2H89 A;  3NGC X;  1CC6 A;  1RSG A;  4ZCD A;  3P4R A;  2VZ2 A;  4Z2U A;  1YY5 A;  1E7P A;  2YLW A;  2GB0 A;  1BKW A;  2XVJ A;  1P2H A;  1QLB A;  3DJE A;  1CBO A;  3AE9 A;  4Y4M A;  4KX6 A;  2JB2 A;  4Z2T A;  1DJN A;  3JSK A;  3K7Q X;  2A87 A;  2C72 A;  4H4V A;  1PBC A;  2CFY A;  1W4X A;  1D7L A;  1EL8 A;  2WES A;  1GRA A;  1NAA A;  1PXA A;  4LII A;  3RNM A;  2AQJ A;  2OLO A;  4YSY A;  4YTN A;  1Q1R A;  2ZBW A;  4E0V A;  2X99 A;  5FMH A;  1BGN A;  1E6E A;  1CHU A;  1N4U A;  4FK1 A;  3GYJ A;  3AE4 A;  4YSH A;  2B7R A;  3AYI A;  4EIQ A;  1DJQ A;  4D04 A;  4CNK A;  5FS9 A;  3WE0 A;  2C67 A;  2ARD A;  2C3C A;  4HB9 A;  1NPX A;  1BWC A;  3UOY A;  2WOW A;  4C3X A;  2TMD A;  3ATQ A;  1Q9I A;  2XFQ A;  3UTF A;  3NTD A;  1PDH A;  1KNP A;  1PBD A;  4YSX A;  2XYO A;  1MO9 A;  4ADW A;  1K0I A;  3KA7 A;  4ICY A;  2XLR A;  4NTD A;  2YG5 A;  5C2T A;  1SEZ A;  2YLS A;  3UKH A;  1AOG A;  1IJH A;  2YM1 A;  1REO A;  4EQS A;  3COX A;  3SFD A;  3ABV A;  1LJ1 A;  3RP6 A;  3I3L A;  2ZZB A;  4C3Y A;  4EM3 A;  5HXI A;  4X9M A;  3DJJ A;  1BF3 A;  1JU2 A;  4C77 A;  2WPE A;  3KU9 A;  1UKV G;  4O5U A;  1LQU A;  1F8S A;  3AEA A;  3CNP A;  4GF7 A;  4J34 A;  3KKJ A;  4ZCC A;  2NVK X;  4X4J A;  2FJA A;  3NHO X;  1QO8 A;  4BJY A;  2WDQ A;  1ZOY A;  4Z26 A;  1D4E A;  1JRZ A;  2QCU A;  1ZK7 A;  2Z5X A;  5BUK A;  1OJC A;  4UP3 A;  4H4Z A;  3DK4 A;  5EB4 A;  1KFY A;  1LTX R;  2E4G A;  5GSN A;  2XLU A;  3R9U A;  4GDP A;  3AB1 A;  1GRT A;  4H4T A;  4REK A;  1N4V A;  4OPL A;  4EIP A;  3EF6 A;  1CJ4 A;  2ZZ0 A;  4CRT A;  4H4W A;  4H4S A;  4Z25 A;  2XFO A;  1ZX9 A;  4H4Q A;  4B67 A;  1PXC A;  3Q9T A;  3AXB A;  1OJ9 A;  1GRB A;  2H88 A;  3GWF A;  1PN0 A;  4YWO A;  2WPF A;  4U2T A;  4AP1 A;  1GEU A;  1K0J A;  1DOC A;  1GTE A;  2WOV A;  4GDE A;  4OPU A;  2CVJ A;  3AEB A;  3NRN A;  4K7Z A;  2ACZ A;  3FMW A;  2WEU A;  2RGO A;  3UTE A;  5EBK A;  4H7U A;  3NH3 X;  4ZN0 A;  2YVJ A;  2V61 A;  3G5S A;  3LJP A;  2EQ6 A;  3VRD B;  4BJZ A;  4XWR A;  2NPX A;  4J56 A;  1E1K A;  4A99 A;  2XFU A;  3SM8 A;  3AE2 A;  3LZW A;  1JEH A;  1PXB A;  3AE6 A;  5HY5 A;  4CNJ A;  1DNC A;  4H4U A;  3LOV A;  3QJ4 A;  1YQZ A;  3CN8 A;  3UTH A;  5IPY A;  1PJ6 A;  1OJT A;  1CF3 A;  1H82 A;  4H2Q A;  1TYT A;  3IF9 A;  1NHS A;  5KXJ A;  4JQ9 A;  4RG4 A;  3URH A;  3GMB A;  1DOD A;  2YLR A;  1Q1W A;  4TM1 A;  5BRT A;  4H50 A;  4P9S A;  2V3B A;  4EM4 A;  3VRB A;  1CJ2 A;  3IHM A;  3M12 A;  1HYU A;  1FEB A;  1CL0 A;  1LVL A;  1IUX A;  2C7G A;  1TDN A;  3NYE A;  4B63 A;  3BNM A;  3GD3 A;  1COY A;  2FJE A;  4RG3 A;  3BI2 A;  4U8N A;  2GR0 A;  2Q7V A;  5KRQ A;  4OPG A;  1E1N A;  3CTY A;  3ATR A;  3EPT A;  2BS2 A;  4FK1 C;  4O5Q A;  2RGH A;  2YVF A;  2BCG G;  5M10 A;  4BV6 A;  5TR3 A;  1RYI A;  1X31 B;  4K8D A;  1JNR A;  3AE1 A;  4USR A;  5KVH A;  4JY3 A;  2GH5 A;  3KPF A;  1L9D A;  3S61 A;  1FEA A;  2V6O A;  1RP0 A;  1GPE A;  2GF3 A;  2XVI A;  3GDN A;  5BUL A;  3E1T A;  1N4W A;  2YR6 A;  4U2L A;  1ZMC A;  1GT8 A;  5JCK A;  1KDG A;  2VQ7 A;  3CGC A;  4JDR A;  5GRT A;  1B8S A;  1DOB A;  2XFP A;  5KOW A;  2WOI A;  1TDE A;  3F8P A;  1GRH A;  2BS3 A;  3HZL A;  4YKG A;  1TYP A;  2R0P A;  4J31 A;  2VRM A;  1JRX A;  1BGJ A;  2C64 A;  1IUW A;  2GMH A;  4IA5 A;  1JRY A;  4DSH A;  3EAO A; 
#chains in the Genus database with same CATH topology
 3CND A;  2JB3 A;  3A7U A;  1YQ3 A;  3GDP A;  2ZC8 A;  2GR3 A;  2PCE A;  4Y4L A;  3T31 A;  4FDC B;  2VVL A;  3CNT A;  4YXD A;  4BUR A;  4A6N A;  4E8G A;  3DJD A;  3NVZ B;  1CC4 A;  2CUL A;  2X3N A;  3Q45 A;  3CPJ G;  1JOA A;  3UOV A;  3ZYX A;  3L8K A;  3VCC A;  3V3O A;  1KSS A;  2W0H A;  3PWI A;  2OAL A;  2OO6 A;  1VQZ A;  3CNJ A;  3NN0 X;  3NS1 B;  1KNR A;  2Q0K A;  2QJN A;  1S3B A;  4TM4 A;  3TCS A;  4D03 A;  4WCT A;  4AOX A;  1EBD A;  4B66 A;  4IVM B;  4GAP A;  4JN7 A;  1ZOV A;  3D1C A;  2RDX A;  2AR8 A;  3ZLF A;  4OPD A;  3TWB A;  2BXR A;  4LU6 A;  2CDU A;  3NTA A;  2WP9 A;  4JN9 A;  3CB3 A;  2GGG A;  2PP3 A;  4YSZ A;  5JCM A;  2C3D A;  4EMI A;  3SN0 A;  2GV8 A;  2OFJ A;  4IV9 A;  4J1O A;  4TVW A;  3NNE A;  3CAW A;  3UJE A;  3H70 A;  1MOK A;  4OVI A;  2XLT A;  4EQX A;  3DFY A;  2Y6Q A;  3RP8 A;  2YQU A;  3CPH G;  1NDA A;  1JCT A;  2BAC A;  2OZ8 A;  2R46 A;  4II3 A;  4AT2 A;  3PG6 A;  1FIQ B;  1VRQ B;  1V59 A;  1JRO A;  2XDO A;  2WP5 A;  3VRA A;  3L1R A;  2YLT A;  4K2X A;  1Y56 A;  3KVE A;  4M6U A;  3STP A;  3AD9 B;  2C75 A;  1O94 A;  2GR1 A;  2WP6 A;  5FJP A;  2AL2 A;  3ENL A;  4B69 A;  3UOX A;  5FJU A;  2P8B A;  1GER A;  1D7Y A;  3UCL A;  3H4K A;  3ICT A;  3VA8 A;  3R07 C;  3SSZ A;  4I58 A;  1B37 A;  1K4Q A;  2WDR A;  2YM2 A;  2BK5 A;  2WDV A;  3VCN A;  1H86 A;  2QA1 A;  3T14 A;  1K0L A;  3DDM A;  4UDP A;  3OZ2 A;  3V5C A;  3GMC A;  1NEL A;  1WUF A;  3P93 A;  1GSN A;  2GRT A;  2FJD A;  1IUU A;  3DME A;  2YLX A;  1M64 A;  4CBQ A;  1Y56 B;  2QVH A;  3Q6J A;  2WQY A;  5BOE A;  5EB5 A;  3RED A;  1L9E A;  2WPC A;  2PU0 A;  4A35 A;  3ES8 A;  2AL2 B;  2HNE A;  2RGJ A;  3II4 A;  3V4B A;  1GES A;  4Z43 A;  3C4A A;  4BK3 A;  2A8X A;  2OG9 A;  3UKP A;  3VR9 A;  7ENL A;  2OA1 A;  3NYC A;  4GYP A;  3NT6 A;  1EL5 A;  1ZDL A;  3CXO A;  3UKF A;  1DXL A;  3SFE A;  2XVE A;  2B7S A;  4USQ A;  3GY1 A;  3VC6 A;  4H1Z A;  2GGI A;  4HCD A;  2APG A;  3SBF A;  4G6H A;  3V3N A;  3BOX A;  4TM0 A;  2GDQ A;  1CC6 A;  1E7P A;  3DES A;  2AKZ A;  4KX6 A;  3UJS A;  2PP1 A;  1PBC A;  2CFY A;  4YSY A;  4LII A;  3U4F A;  1BGN A;  1CHU A;  1N4U A;  3GYJ A;  3AE4 A;  6ENL A;  3WE0 A;  3SZF A;  1BWC A;  3UOY A;  2WOW A;  3ATQ A;  1Q9I A;  1PDH A;  5KMQ A;  4YSX A;  4ADW A;  3KA7 A;  4NTD A;  3UKH A;  1XS2 A;  2GGE A;  3EEZ A;  2YM1 A;  1REO A;  1LJ1 A;  3I3L A;  4X9M A;  4C77 A;  1RVK A;  3KKJ A;  1IYX A;  3DGB A;  1ZK7 A;  5BUK A;  3DK4 A;  4A6G A;  2XLU A;  1EBG A;  1N4V A;  3SN4 A;  3RCY A;  4H4Q A;  3Q9T A;  4ZA0 A;  1GRB A;  3OW1 A;  4YWO A;  4AP1 A;  4GDE A;  2V61 A;  3LJP A;  3SM8 A;  2MUC A;  4H4U A;  1MDL A;  3UTH A;  2OX4 A;  3RO6 A;  5KXJ A;  4RG4 A;  1N5W C;  1P48 A;  4P9S A;  1CJ2 A;  3T0K A;  4B63 A;  2C7G A;  1COY A;  2FJE A;  3T2Y A;  2MNR A;  2Q7V A;  2POD A;  1E1N A;  3ATR A;  3UGV A;  1DTN A;  4DXK A;  4BV6 A;  5TR3 A;  3AE1 A;  4USR A;  5KVH A;  4JY3 A;  3KPF A;  2W54 A;  2V6O A;  5EU9 A;  2YR6 A;  1KDG A;  1DOB A;  3ZVI A;  2WOI A;  3F8P A;  4HN8 A;  1TYP A;  4J31 A;  2C64 A;  3EAO A;  1R0M A;  4TLX A;  1F6M A;  3H8L A;  4U8L A;  3LZX A;  3N6J A;  3AE8 A;  2B76 A;  2VVM A;  3GYI A;  3V5F A;  4DSG A;  3UCD A;  2GEW A;  3CNS A;  3AEE A;  1PBB A;  2F5Z A;  2OAM A;  3MY9 A;  2BXS A;  3I6D A;  2PA6 A;  2E1M A;  4U8K A;  3TW9 A;  3UXL A;  3B9J B;  3PWG A;  4IVO B;  2W3R A;  4OPT A;  4EMW A;  2GR2 A;  4CY6 A;  3TQP A;  4U8P A;  2R0C A;  4TLZ A;  3UTG A;  1ELS A;  1TDF A;  3AD8 B;  3FJ4 A;  3BNU A;  2CHR A;  4OPC A;  2OLN A;  2I5Q A;  1FEC A;  1R6W A;  2BYB A;  1VG9 A;  4KPR A;  2BAB A;  5KOX A;  3DG3 A;  3IHG A;  3UKK A;  2P3Z A;  2BS4 A;  5IQ1 A;  5KMP A;  2GAG B;  3HRD C;  4JNQ A;  3KUM A;  3GC2 A;  2R0G A;  2R4J A;  3LB8 A;  3SQP A;  1SJB A;  1XPY A;  2JBV A;  1GRE A;  4BK2 A;  2GMJ A;  1B5Q A;  3FV9 A;  1V97 A;  1PJ5 A;  4YKF A;  3Q4D A;  4DN1 A;  3QFB A;  3SZW A;  3SGL A;  2OLA A;  2QQ6 A;  3DG6 A;  2BCP A;  3O0H A;  1D5T A;  4J57 A;  4HNC A;  2X50 A;  1EL7 A;  2V60 A;  1ONE A;  2WHD A;  3RP7 A;  3OPS A;  3AWI A;  2C65 A;  3RIT A;  3NG7 X;  2E5V A;  2PYX A;  2YG7 A;  2C4C A;  4Z24 A;  1GND A;  4A7A A;  2EQ7 A;  4JY2 A;  4YT0 A;  2Z5Y A;  2YWL A;  3R1Z A;  2TPR A;  1JRP A;  3DIP A;  1FHV A;  2FKP A;  3NN6 X;  3R10 A;  5JCL A;  1SJC A;  3BHK A;  4DGK A;  2VQB A;  2JB1 A;  2X8H A;  2HQM A;  4G7F A;  3DER A;  1Y0P A;  1DOE A;  3S5W A;  3CYJ A;  3KD9 A;  3SXI A;  4H2H A;  4IL0 A;  1P2E A;  2WET A;  3K7M X;  3NK1 X;  1EC8 A;  5M0Z A;  2BC0 A;  3B3R A;  3OZY A;  1OEP A;  1XDI A;  2OPJ A;  1S2Y A;  4H4Y A;  4C74 A;  3G5Q A;  4HCH A;  3AYL A;  4MMW A;  1L0V A;  4EQW A;  2I0Z A;  3A7A A;  3AM9 A;  1IUT A;  1FOH A;  3CMM A;  4K8G A;  3SJN A;  1FCD A;  5U63 A;  3UKA A;  1N62 C;  3T9P A;  3C96 A;  3N4E A;  4IA6 A;  3AE5 A;  3B97 A;  4A6N B;  2XLS A;  2Q0L A;  2IVD A;  1L8P A;  2YR4 A;  1TDO A;  3DK8 A;  4IZG A;  5JCN A;  3SQS A;  1LV0 A;  4UDQ A;  4CCQ A;  4B64 A;  3ETR B;  3RHA A;  4G6G A;  3D8X A;  4GRT A;  2C66 A;  3OC4 A;  5G5H B;  4GUV A;  2C76 A;  1JPM A;  1NU5 A;  3RGT A;  3K1G A;  2HZG A;  2O9Z A;  4DNA A;  2HXU A;  2PHH A;  3PK7 A;  1TE6 A;  2PP0 A;  2H89 A;  3P4R A;  2VZ2 A;  4IL2 A;  2XVJ A;  1QLB A;  3ZLG A;  4Y4M A;  3U9I A;  1DJN A;  2A87 A;  1W4X A;  1F9C A;  1D7L A;  4YTN A;  3RNM A;  2X99 A;  1E6E A;  4FK1 A;  1FFV C;  4YSH A;  5KMR A;  4GGH A;  4EIQ A;  1FFU C;  4CNK A;  2ARD A;  3I4K A;  2TMD A;  2PTW A;  3JVA A;  5C2T A;  2YLS A;  1RM6 B;  4Z1Y A;  3SFD A;  3ABV A;  2PTZ A;  4EM3 A;  5HXI A;  3THU A;  4G8T A;  4HYR A;  1UKV G;  4O5U A;  3AEA A;  4X4J A;  3BJS A;  1WUE A;  1JRZ A;  2QCU A;  3D47 A;  4DYE A;  4UP3 A;  4GYP C;  1LTX R;  3R9U A;  4H19 A;  3EF6 A;  2ZZ0 A;  3P0W A;  1TKK A;  4H4S A;  2XFO A;  4Z25 A;  4B67 A;  2H88 A;  3P3B A;  1PN0 A;  4U2T A;  4J3Z A;  2WOV A;  4OPU A;  4G9K A;  3AEB A;  3NRN A;  4K7Z A;  5ENL A;  2WEU A;  2RGO A;  3NH3 X;  5G5G B;  2YVJ A;  3G5S A;  1BQG A;  2PGE A;  4HPN A;  4J56 A;  1E1K A;  3AE2 A;  1JEH A;  1PXB A;  4CNJ A;  5KMS A;  1PJ6 A;  1OJT A;  4KEM A;  1TYT A;  1NHS A;  4JQ9 A;  3URH A;  3GMB A;  1DOD A;  2YLR A;  1Q1W A;  4TM1 A;  5BRT A;  2V3B A;  4EM4 A;  3UCC A;  1FEB A;  1TDN A;  4RG3 A;  4U8N A;  3CK5 A;  2PU1 A;  3D46 A;  5KRQ A;  2RGH A;  2BCG G;  5KNL A;  3SZC A;  4E5T A;  1L9D A;  1FEA A;  4DHG A;  1GPE A;  2OVL A;  1ZMC A;  2XH2 A;  3CGC A;  5GRT A;  5KOW A;  3HZL A;  3GO2 A;  3T6C A;  2GMH A;  1JRY A;  3V3W A;  3R0K A;  3FIM B;  3NK2 X;  2VRL A;  1KKO A;  2JKC A;  5FS8 A;  5KWF A;  3AD7 B;  5KVI A;  3NXL A;  4EWJ A;  1MXT A;  2WU5 A;  4GME A;  2BK3 A;  1PBF A;  2GVC A;  2GL5 A;  1N61 C;  1OJA A;  4PAB A;  2DW6 A;  4NEV A;  2NQL A;  1KF6 A;  1YQ4 A;  3UOZ A;  3TTE A;  1XAN A;  3NK0 X;  1GXF A;  5FS7 A;  4KT2 A;  4XXG A;  1E1L A;  3GWD A;  4IHC A;  4U8I A;  2YVG A;  2PMQ A;  3UP5 A;  4YTM A;  3M13 A;  3DFH A;  3QSM A;  1S2Q A;  4KPL A;  4WX1 A;  4K2S A;  1H7X A;  4ZCW A;  3TOY A;  2YR5 A;  3KLJ A;  4IP4 A;  1H81 A;  4G74 A;  3LXD A;  5U25 A;  1YEY A;  3FG2 P;  3T37 A;  3ZDN A;  1NHR A;  2VVL G;  1E1M A;  4H2R A;  3SYI A;  1ZY8 A;  3ALJ A;  4NEW A;  1H83 A;  4ENL A;  2PGW A;  4H4X A;  3ITJ A;  4G73 A;  4LA1 A;  3NIX A;  4H2N A;  4MGG A;  2J3N A;  1ELI A;  3MZN A;  3CGD A;  3P4P A;  4A79 A;  4AT0 A;  3DGH A;  2XSX A;  1NG3 A;  3MSY A;  1NEN A;  2JAE A;  3QVP A;  3P4S A;  3JW7 A;  2GQW A;  3RR1 A;  4NTE A;  5J7X A;  1GET A;  4ECH A;  3OP2 A;  2AKM A;  3LAD A;  1X2G A;  4K22 A;  1TDK A;  4JHM A;  3VFC A;  1N1P A;  2FJB A;  2YLZ A;  3CGB A;  2XVH A;  4OPI A;  4K5S A;  3NKS A;  3DEQ A;  3UP4 A;  1VDC A;  1EC9 A;  2BRA A;  3BI5 A;  3QPE A;  4YTP A;  3VR8 A;  1TRB A;  1ONF A;  3NLC A;  3GSI A;  2YAU A;  4GAV A;  2IVE A;  3BI4 A;  1WYG A;  3M0O A;  3CIR A;  2C70 A;  1GRF A;  1B4V A;  2ZZC A;  3IJQ A;  4N9X A;  4Y4N A;  1EC7 A;  2BC1 A;  5U1O A;  4NNJ A;  4EMJ A;  2GQF A;  3AE3 A;  2POZ A;  4U8M A;  1VDV A;  4XWZ A;  4OCG A;  2PTY A;  3DA1 A;  3SR6 B;  2GGJ A;  2AL1 A;  3IK4 A;  2V3A A;  2BA9 A;  1O5W A;  3F8D A;  4FI4 A;  1KN0 A;  3FBS A;  4APN A;  2PPG A;  1P43 A;  3BHF A;  2EQ9 A;  4GIR A;  1L9C A;  5FJT A;  2B9W A;  3GD4 A;  3ADA B;  3P9U A;  4C5O A;  1S3E A;  1W6T A;  1GV4 A;  3GRT A;  1KSU A;  4GCM A;  3FPZ A;  4J2W A;  3K7T A;  1GRG A;  2DKH A;  2QA2 A;  4HCL A;  3AEF A;  3TJ4 A;  3PFR A;  1NHP A;  4J33 A;  2XFN A;  1PDY A;  3TWA A;  1CJC A;  4BK1 A;  1ZXI C;  1KCZ A;  3AED A;  1EBH A;  4Z2R A;  1F8R A;  4EQR A;  1ZP0 A;  2XH0 A;  3V76 A;  3AEG A;  3QFA A;  3G5R A;  3DK9 A;  4U2S A;  3SX6 A;  4GFI A;  3H8A A;  1RSG A;  4FP1 A;  4ZCD A;  3ES7 A;  5BOF A;  1BKW A;  1P2H A;  3KPK A;  3UJF A;  3NVV B;  3AE9 A;  2PTX A;  4II2 A;  3JSK A;  1MDR A;  1EL8 A;  2WES A;  1GRA A;  1NAA A;  3N4F A;  4E0V A;  5FMH A;  3S47 A;  3UJ2 A;  2B7R A;  3AYI A;  5FS9 A;  2C67 A;  2XFQ A;  2OKT A;  1PBD A;  4ICY A;  2XLR A;  3DG7 A;  1IJH A;  2DW7 A;  1SJA A;  3COX A;  2GGH A;  4GIS A;  1BF3 A;  5IDZ A;  1JU2 A;  2OQH A;  2WPE A;  3KU9 A;  2OZT A;  1LQU A;  3CNP A;  4GF7 A;  4J34 A;  3NHO X;  1QO8 A;  2OQY A;  4KWS A;  2Z5X A;  3D9X A;  4H4Z A;  5EB4 A;  1KFY A;  4H4T A;  4REK A;  4EIP A;  3FXG A;  1N5X A;  1STZ A;  4CRT A;  3VC5 A;  1PXC A;  4A3R A;  3H12 A;  3AN1 A;  3GWF A;  1GEU A;  1K0J A;  1GTE A;  1SJD A;  2PSN A;  3FMW A;  3UTE A;  1BKH A;  4ZN0 A;  2EQ6 A;  4BJZ A;  2NPX A;  2XH4 A;  4A99 A;  3LZW A;  3AE6 A;  3CXB A;  4Z17 A;  1DNC A;  3CN8 A;  3RRA A;  5IPY A;  1H82 A;  4K1W A;  4H2Q A;  3IF9 A;  4H50 A;  3VRB A;  3M12 A;  1CL0 A;  1LVL A;  3BNM A;  4H83 A;  3BI2 A;  1FO4 A;  1N63 C;  4OPG A;  3CTY A;  4FK1 C;  4O5Q A;  3TJI A;  2YVF A;  5M10 A;  1RYI A;  1X31 B;  2GH5 A;  3T2K A;  1PDZ A;  1RP0 A;  2XVI A;  3GDN A;  2GF3 A;  4GGB A;  3I6T A;  4U2L A;  2VQ7 A;  3R25 A;  1B8S A;  2QGY A;  2XFP A;  1TDE A;  1GRH A;  4YKG A;  2R0P A;  1JRX A;  4E4F A;  1IUW A;  4A5L A;  4I59 A;  2ONE A;  3T8Q A;  1MRA A;  3ICR A;  1VQW A;  4JNA A;  4U8O A;  3QSE A;  1KKR A;  1H7W A;  2EQ8 A;  3HW2 A;  1FHU A;  1NHQ A;  4X9N A;  3GYX A;  4H4R A;  2W55 A;  3AEC A;  4B68 A;  4J36 A;  3GD6 A;  5FJR A;  4HA6 A;  3R0U A;  2GAH B;  2X8C A;  1GOS A;  3EKG A;  3MQT A;  2FBW A;  2YG4 A;  3F8R A;  4RSL A;  4AP3 A;  1BZL A;  2UZZ A;  2QDD A;  2DKI A;  2E5A A;  3IJI A;  3DH9 A;  4CCR A;  1PJ7 A;  4B1B A;  2VOU A;  3P4Q A;  2X8G A;  1XHC A;  4CY8 A;  4TM3 A;  3N6H A;  3MUC A;  4IP5 A;  2XCG A;  1IUS A;  5BVA A;  2P88 A;  3CGE A;  5JRB A;  1JDF A;  3QVR A;  3C4N A;  3QSS A;  2XH7 A;  3L5O A;  3QN3 A;  4GR1 A;  3DGZ A;  3ALM A;  1PBE A;  2B9X A;  4H2P A;  4E4U A;  3UKL A;  3HYX A;  5FJO A;  1GAL A;  4FX9 A;  5JCI A;  4TVY A;  2FYM A;  2BK4 A;  2C73 A;  1LQT A;  2XVF A;  5IQ4 A;  2XGZ A;  3AMZ A;  3PO7 A;  4NWZ A;  3DJG X;  2IID A;  4NTC A;  1D4D A;  1FL2 A;  3OZM A;  1ECQ A;  1H2I A;  5EOW A;  4NZH A;  1F8W A;  3EAN A;  1IUV A;  3AYJ A;  1MNS A;  3VQR A;  3MWC A;  1NG4 A;  5DBJ A;  5CQF A;  3HYV A;  3SN1 A;  2QDE A;  2YG6 A;  3UKQ A;  1M6I A;  4PAA A;  3QKE A;  2QAE A;  1H6V A;  4A9W A;  3NFU A;  2JK6 A;  5CKU A;  2WU2 A;  1PS9 A;  1O95 A;  2BRY A;  2QJJ A;  3NZG A;  3K30 A;  3SY4 A;  1YKJ A;  2P8C A;  1CC2 A;  3NVW B;  2HXT A;  2A89 A;  3FCP A;  1ZMD A;  2W3S A;  1EL9 A;  2RAB A;  1JNZ A;  3NYF A;  2Q6U A;  4AOS A;  1GTH A;  2V5Z A;  2Y6R A;  5FS6 A;  5HYM A;  1H84 A;  4JN8 A;  4A65 A;  2PS2 A;  4M52 A;  5LV9 A;  4MJW A;  3B6D A;  1ZKQ A;  1XPQ A;  4Z44 A;  3UXK A;  3S5S A;  2YG3 A;  1S7M A;  3T4W A;  3IC9 A;  4B65 A;  3H8I A;  1QJD A;  3ZVH A;  4K5R A;  1D4C A;  3PVC A;  1F3P A;  2AAQ A;  3CT2 A;  3AE7 A;  2B9Y A;  3ALL A;  3IJL A;  1MUC A;  3NVY B;  3T2Z A;  4DX3 A;  3QLD A;  1CJ3 A;  2R45 A;  2WS3 A;  1VG0 A;  3FVD A;  4U8J A;  2WBA A;  1Z6L A;  3GRS A;  1PHH A;  4ZOH B;  3PS9 A;  4YWS A;  3ICS A;  3I6E A;  5C3J A;  3P1W A;  1E39 A;  3SZ0 A;  4MKS A;  1OJD A;  4UDR A;  2R4E A;  3CPI G;  3IWA A;  1LPF A;  2R9Z A;  3ISH A;  5J60 A;  2XLP A;  3HYW A;  4M0X A;  4H4P A;  1NEK A;  1T3Q C;  5HHF A;  5ER0 A;  5L46 A;  3ZLH A;  3NGC X;  3NRZ B;  3ZVH B;  4Z2U A;  1YY5 A;  2YLW A;  5J04 A;  2GB0 A;  3DJE A;  2P0I A;  2OZ3 A;  1CBO A;  2QJM A;  1N60 C;  2JB2 A;  4Z2T A;  3K7Q X;  4IT1 A;  2C72 A;  4H4V A;  2AQJ A;  1PXA A;  2OLO A;  1Q1R A;  2ZBW A;  2E3T A;  2GSH A;  1DJQ A;  4D04 A;  4HNL A;  4E6M A;  2C3C A;  4HB9 A;  1NPX A;  4C3X A;  3UTF A;  3NTD A;  1KNP A;  2XYO A;  3A7R A;  1MO9 A;  1K0I A;  2YG5 A;  4X2P A;  1SEZ A;  4F4R A;  1AOG A;  2O56 A;  1E9I A;  3UJR A;  4EQS A;  3RP6 A;  2ZZB A;  4C3Y A;  3DJJ A;  3QTP A;  1F8S A;  4ZCC A;  2NVK X;  2FJA A;  4BJY A;  2WDQ A;  1ZOY A;  4Z26 A;  1D4E A;  3FYY A;  3JZU A;  1OJC A;  3MKC A;  2E4G A;  5GSN A;  3HPF A;  4GDP A;  4ROP A;  3AB1 A;  1GRT A;  4OPL A;  1CJ4 A;  4H4W A;  1KD0 A;  1ZX9 A;  3AXB A;  1OJ9 A;  2WPF A;  1DOC A;  3VDG A;  2CVJ A;  2ACZ A;  5EBK A;  4H7U A;  3VRD B;  4XWR A;  2XFU A;  3EUB 3;  5HY5 A;  3LOV A;  3QJ4 A;  1YQZ A;  3BSM A;  1TZZ A;  1CF3 A;  3IHM A;  1HYU A;  1IUX A;  3NYE A;  1JPD X;  3H7V A;  3GD3 A;  3NO1 A;  2GR0 A;  3EPT A;  2BS2 A;  3R11 A;  4K8D A;  1JNR A;  1X2H A;  3S61 A;  5BUL A;  3E1T A;  1N4W A;  2ZAD A;  3OTR A;  1GT8 A;  5JCK A;  1SB3 B;  4JDR A;  4DWD A;  2BS3 A;  2VRM A;  1BGJ A;  4IA5 A;  4DSH A; 
#chains in the Genus database with same CATH homology
 3CND A;  4A5L A;  4I59 A;  3FIM B;  2JB3 A;  3NK2 X;  2VRL A;  4TLX A;  2JKC A;  5FS8 A;  1F6M A;  3H8L A;  5KWF A;  4U8L A;  1YQ3 A;  3AD7 B;  3GDP A;  3LZX A;  2GR3 A;  5KVI A;  3AE8 A;  1MXT A;  4Y4L A;  2WU5 A;  2B76 A;  2VVM A;  3GYI A;  3T31 A;  4FDC B;  2BK3 A;  4DSG A;  2VVL A;  3ICR A;  1VQW A;  2GEW A;  3CNS A;  4JNA A;  4U8O A;  1PBF A;  3QSE A;  3CNT A;  4YXD A;  1H7W A;  3AEE A;  2GVC A;  2EQ8 A;  4BUR A;  1NHQ A;  1OJA A;  1PBB A;  4X9N A;  4A6N A;  4PAB A;  3GYX A;  2F5Z A;  4H4R A;  2OAM A;  1KF6 A;  4NEV A;  1YQ4 A;  3DJD A;  1CC4 A;  3UOZ A;  2CUL A;  2BXS A;  3I6D A;  3AEC A;  4B68 A;  1XAN A;  2E1M A;  4J36 A;  3NK0 X;  1GXF A;  4U8K A;  5FS7 A;  2X3N A;  4IVO B;  3CPJ G;  1JOA A;  4OPT A;  3UOV A;  4EMW A;  4HA6 A;  2GR2 A;  4CY6 A;  3ZYX A;  4XXG A;  1E1L A;  3L8K A;  4U8P A;  2R0C A;  3GWD A;  3V3O A;  2GAH B;  1KSS A;  4TLZ A;  2X8C A;  3UTG A;  1TDF A;  1GOS A;  2W0H A;  2OAL A;  3AD8 B;  2FBW A;  2YG4 A;  3F8R A;  4RSL A;  4AP3 A;  1BZL A;  3BNU A;  2UZZ A;  4OPC A;  4U8I A;  2OLN A;  2DKI A;  3CNJ A;  3NN0 X;  2YVG A;  3UP5 A;  1FEC A;  4YTM A;  3DH9 A;  1KNR A;  4CCR A;  2Q0K A;  2BYB A;  1PJ7 A;  3M13 A;  2VOU A;  4B1B A;  3P4Q A;  1VG9 A;  1S3B A;  4KPR A;  4TM4 A;  2X8G A;  1XHC A;  2BAB A;  5KOX A;  3IHG A;  4CY8 A;  4D03 A;  3QSM A;  1S2Q A;  4TM3 A;  4WCT A;  4WX1 A;  3UKK A;  2BS4 A;  1EBD A;  4AOX A;  5IQ1 A;  5KMP A;  4B66 A;  2XCG A;  2GAG B;  4IVM B;  1IUS A;  1H7X A;  4GAP A;  1ZOV A;  3D1C A;  5BVA A;  2YR5 A;  3KLJ A;  3CGE A;  4JNQ A;  5JRB A;  2AR8 A;  3QVR A;  3C4N A;  1H81 A;  2R0G A;  3QSS A;  3L5O A;  4GR1 A;  2R4J A;  3LXD A;  4G74 A;  5U25 A;  3DGZ A;  3LB8 A;  3ALM A;  4OPD A;  1PBE A;  3SQP A;  2B9X A;  2BXR A;  4LU6 A;  2CDU A;  4H2P A;  3FG2 P;  3T37 A;  3ZDN A;  2JBV A;  3UKL A;  3NTA A;  2WP9 A;  3HYX A;  1NHR A;  4JN9 A;  1GAL A;  1GRE A;  4BK2 A;  2VVL G;  1E1M A;  4FX9 A;  4H2R A;  4YSZ A;  5JCM A;  5JCI A;  2C3D A;  3SYI A;  1ZY8 A;  4EMI A;  2GMJ A;  3ALJ A;  2GV8 A;  4IV9 A;  1B5Q A;  4NEW A;  3NNE A;  1H83 A;  2BK4 A;  4H4X A;  1MOK A;  1PJ5 A;  3ITJ A;  4YKF A;  3QFB A;  2C73 A;  4G73 A;  3SZW A;  4LA1 A;  1LQT A;  2XVF A;  3NIX A;  4H2N A;  3SGL A;  5IQ4 A;  4OVI A;  2J3N A;  1ELI A;  2XLT A;  3PO7 A;  4NWZ A;  3DJG X;  2BCP A;  3O0H A;  1D5T A;  3CGD A;  3P4P A;  4A79 A;  4J57 A;  4EQX A;  2Y6Q A;  2X50 A;  1EL7 A;  3RP8 A;  3DGH A;  2IID A;  4AT0 A;  2YQU A;  4NTC A;  1NG3 A;  2V60 A;  3CPH G;  1NDA A;  2WHD A;  1NEN A;  2JAE A;  3RP7 A;  1D4D A;  1FL2 A;  2BAC A;  3QVP A;  2R46 A;  3P4S A;  1H2I A;  4II3 A;  4AT2 A;  2GQW A;  3PG6 A;  5EOW A;  3AWI A;  2C65 A;  1VRQ B;  1V59 A;  4NTE A;  4NZH A;  3NG7 X;  1F8W A;  5J7X A;  2XDO A;  2WP5 A;  2E5V A;  1GET A;  2PYX A;  2YG7 A;  3EAN A;  1IUV A;  2C4C A;  3AYJ A;  3VQR A;  3VRA A;  4ECH A;  1NG4 A;  5DBJ A;  4Z24 A;  3LAD A;  5CQF A;  1TDK A;  3L1R A;  1GND A;  2YLT A;  1N1P A;  3HYV A;  4K22 A;  1Y56 A;  4K2X A;  2EQ7 A;  4A7A A;  2FJB A;  3KVE A;  2YLZ A;  4JY2 A;  3CGB A;  2YG6 A;  2Z5Y A;  3UKQ A;  4YT0 A;  3AD9 B;  1M6I A;  2C75 A;  2YWL A;  1O94 A;  2GR1 A;  2XVH A;  2TPR A;  4PAA A;  4OPI A;  2WP6 A;  3NN6 X;  2QAE A;  5JCL A;  4B69 A;  3BHK A;  3UOX A;  1H6V A;  4A9W A;  4K5S A;  4DGK A;  2JK6 A;  3NKS A;  3UP4 A;  1D7Y A;  1GER A;  2VQB A;  3UCL A;  1VDC A;  5CKU A;  2WU2 A;  2BRA A;  3H4K A;  1PS9 A;  2JB1 A;  3BI5 A;  3ICT A;  4YTP A;  1O95 A;  3VR8 A;  2BRY A;  1TRB A;  1ONF A;  2HQM A;  2X8H A;  3NLC A;  3K30 A;  3SY4 A;  3GSI A;  1YKJ A;  2YAU A;  4GAV A;  1CC2 A;  4I58 A;  1B37 A;  1K4Q A;  2A89 A;  2WDR A;  1Y0P A;  1DOE A;  1ZMD A;  3S5W A;  2IVE A;  3BI4 A;  2YM2 A;  3KD9 A;  1EL9 A;  2BK5 A;  3M0O A;  2WDV A;  2RAB A;  3CIR A;  3SXI A;  2C70 A;  1H86 A;  1GRF A;  1JNZ A;  2QA1 A;  3T14 A;  1K0L A;  3NYF A;  2Q6U A;  1B4V A;  4AOS A;  1P2E A;  1GTH A;  2V5Z A;  2WET A;  2ZZC A;  2Y6R A;  4N9X A;  3OZ2 A;  4UDP A;  4Y4N A;  3K7M X;  3NK1 X;  3GMC A;  5FS6 A;  5HYM A;  1H84 A;  2BC1 A;  5U1O A;  5M0Z A;  2BC0 A;  4A65 A;  3B3R A;  4NNJ A;  1GSN A;  4M52 A;  4EMJ A;  1XDI A;  2GQF A;  2GRT A;  1S2Y A;  2FJD A;  3AE3 A;  1ZKQ A;  3B6D A;  1IUU A;  3DME A;  4MJW A;  5LV9 A;  4H4Y A;  1XPQ A;  2YLX A;  3G5Q A;  4U8M A;  4Z44 A;  4C74 A;  1M64 A;  2YG3 A;  1S7M A;  3AYL A;  4XWZ A;  4OCG A;  4CBQ A;  3IC9 A;  3DA1 A;  4B65 A;  1Y56 B;  4EQW A;  1L0V A;  3Q6J A;  3H8I A;  1QJD A;  2WQY A;  2I0Z A;  4K5R A;  5EB5 A;  1IUT A;  1FOH A;  1D4C A;  3RED A;  2V3A A;  3CMM A;  2BA9 A;  1L9E A;  2WPC A;  1O5W A;  3F8D A;  3PVC A;  1FCD A;  1F3P A;  5U63 A;  2AAQ A;  3UKA A;  1KN0 A;  3FBS A;  3AE7 A;  2B9Y A;  2RGJ A;  4APN A;  3ALL A;  3II4 A;  3C96 A;  4IA6 A;  1GES A;  4Z43 A;  3BHF A;  2EQ9 A;  3AE5 A;  4A6N B;  1L9C A;  2XLS A;  3T2Z A;  2B9W A;  3GD4 A;  1CJ3 A;  2Q0L A;  3ADA B;  3C4A A;  2R45 A;  3P9U A;  4BK3 A;  4C5O A;  2IVD A;  2WS3 A;  1S3E A;  1VG0 A;  1GV4 A;  2A8X A;  3GRT A;  3UKP A;  2YR4 A;  4U8J A;  2WBA A;  1TDO A;  3VR9 A;  3DK8 A;  1KSU A;  1Z6L A;  4GCM A;  3GRS A;  1PHH A;  5JCN A;  1LV0 A;  2OA1 A;  3FPZ A;  3PS9 A;  3NYC A;  4J2W A;  4UDQ A;  4CCQ A;  3ICS A;  4B64 A;  3K7T A;  5C3J A;  3P1W A;  1GRG A;  2DKH A;  2QA2 A;  1E39 A;  3SZ0 A;  3NT6 A;  3RHA A;  1OJD A;  3AEF A;  4UDR A;  2R4E A;  3CPI G;  3IWA A;  4G6G A;  1NHP A;  1EL5 A;  4J33 A;  3D8X A;  1ZDL A;  4GRT A;  2XFN A;  1LPF A;  3UKF A;  2C66 A;  2R9Z A;  1DXL A;  3ISH A;  5J60 A;  2XLP A;  3OC4 A;  3SFE A;  2XVE A;  3HYW A;  1CJC A;  2C76 A;  4GUV A;  2B7S A;  4USQ A;  4H4P A;  4BK1 A;  2O9Z A;  4DNA A;  3AED A;  2APG A;  4Z2R A;  1F8R A;  2PHH A;  4EQR A;  4G6H A;  1ZP0 A;  1NEK A;  3V3N A;  4TM0 A;  5HHF A;  3V76 A;  3AEG A;  3QFA A;  5ER0 A;  3DK9 A;  3G5R A;  4U2S A;  3SX6 A;  5L46 A;  2H89 A;  3NGC X;  1CC6 A;  1RSG A;  4ZCD A;  3P4R A;  2VZ2 A;  4Z2U A;  1YY5 A;  1E7P A;  2YLW A;  2GB0 A;  1BKW A;  2XVJ A;  1P2H A;  1QLB A;  3DJE A;  1CBO A;  3KPK A;  3AE9 A;  4II2 A;  4Y4M A;  4KX6 A;  2JB2 A;  4Z2T A;  1DJN A;  3JSK A;  3K7Q X;  2A87 A;  2C72 A;  4H4V A;  1PBC A;  2CFY A;  1W4X A;  1D7L A;  1EL8 A;  2WES A;  1GRA A;  1NAA A;  1PXA A;  4LII A;  3RNM A;  2AQJ A;  2OLO A;  4YSY A;  4YTN A;  1Q1R A;  2ZBW A;  4E0V A;  2X99 A;  5FMH A;  1BGN A;  1E6E A;  1CHU A;  1N4U A;  4FK1 A;  3GYJ A;  3AE4 A;  4YSH A;  5KMR A;  2B7R A;  3AYI A;  4EIQ A;  1DJQ A;  4D04 A;  4CNK A;  5FS9 A;  3WE0 A;  2C67 A;  2ARD A;  2C3C A;  3SZF A;  4HB9 A;  1NPX A;  1BWC A;  3UOY A;  2WOW A;  4C3X A;  2TMD A;  3ATQ A;  1Q9I A;  2XFQ A;  3UTF A;  3NTD A;  1PDH A;  1KNP A;  1PBD A;  5KMQ A;  4YSX A;  2XYO A;  1MO9 A;  4ADW A;  1K0I A;  3KA7 A;  4ICY A;  2XLR A;  4NTD A;  2YG5 A;  5C2T A;  1SEZ A;  2YLS A;  3UKH A;  1AOG A;  1IJH A;  2YM1 A;  1REO A;  4EQS A;  3COX A;  3SFD A;  3ABV A;  1LJ1 A;  3RP6 A;  3I3L A;  2ZZB A;  4C3Y A;  4EM3 A;  5HXI A;  4X9M A;  3DJJ A;  1BF3 A;  1JU2 A;  4C77 A;  2WPE A;  3KU9 A;  1UKV G;  4O5U A;  1LQU A;  1F8S A;  3AEA A;  3CNP A;  4GF7 A;  4J34 A;  3KKJ A;  4ZCC A;  2NVK X;  4X4J A;  2FJA A;  3NHO X;  1QO8 A;  4BJY A;  2WDQ A;  1ZOY A;  4Z26 A;  1D4E A;  1JRZ A;  2QCU A;  1ZK7 A;  2Z5X A;  5BUK A;  1OJC A;  4UP3 A;  3D9X A;  4H4Z A;  3DK4 A;  5EB4 A;  1KFY A;  1LTX R;  2E4G A;  5GSN A;  2XLU A;  3R9U A;  4GDP A;  3AB1 A;  1GRT A;  4H4T A;  4REK A;  1N4V A;  4OPL A;  4EIP A;  3EF6 A;  1CJ4 A;  2ZZ0 A;  4CRT A;  4H4W A;  4H4S A;  4Z25 A;  2XFO A;  1ZX9 A;  4H4Q A;  4B67 A;  1PXC A;  3Q9T A;  3AXB A;  1OJ9 A;  1GRB A;  2H88 A;  3GWF A;  1PN0 A;  4YWO A;  2WPF A;  4U2T A;  4AP1 A;  1GEU A;  1K0J A;  1DOC A;  1GTE A;  2WOV A;  4GDE A;  4OPU A;  2CVJ A;  4G9K A;  3AEB A;  3NRN A;  4K7Z A;  2ACZ A;  3FMW A;  2WEU A;  2RGO A;  3UTE A;  5EBK A;  4H7U A;  3NH3 X;  4ZN0 A;  2YVJ A;  2V61 A;  3G5S A;  3LJP A;  2EQ6 A;  3VRD B;  4BJZ A;  4XWR A;  2NPX A;  4J56 A;  1E1K A;  4A99 A;  2XFU A;  3SM8 A;  3AE2 A;  3LZW A;  1JEH A;  1PXB A;  3AE6 A;  5HY5 A;  4CNJ A;  1DNC A;  4H4U A;  3LOV A;  3QJ4 A;  1YQZ A;  3CN8 A;  3UTH A;  5KMS A;  5IPY A;  1PJ6 A;  1OJT A;  1CF3 A;  1H82 A;  4H2Q A;  1TYT A;  3IF9 A;  1NHS A;  5KXJ A;  4JQ9 A;  4RG4 A;  3URH A;  3GMB A;  1DOD A;  2YLR A;  1Q1W A;  4TM1 A;  5BRT A;  4H50 A;  4P9S A;  2V3B A;  4EM4 A;  3VRB A;  1CJ2 A;  3IHM A;  3M12 A;  1HYU A;  1FEB A;  3T0K A;  1CL0 A;  1LVL A;  1IUX A;  2C7G A;  1TDN A;  3NYE A;  4B63 A;  3BNM A;  3GD3 A;  1COY A;  2FJE A;  4RG3 A;  3T2Y A;  3BI2 A;  4U8N A;  2GR0 A;  2Q7V A;  5KRQ A;  4OPG A;  1E1N A;  3CTY A;  3ATR A;  3EPT A;  2BS2 A;  4FK1 C;  4O5Q A;  2RGH A;  2YVF A;  2BCG G;  5M10 A;  4BV6 A;  5KNL A;  5TR3 A;  1RYI A;  1X31 B;  4K8D A;  1JNR A;  3SZC A;  3AE1 A;  4USR A;  5KVH A;  4JY3 A;  2GH5 A;  3KPF A;  3T2K A;  1L9D A;  3S61 A;  1FEA A;  2V6O A;  1RP0 A;  1GPE A;  2GF3 A;  2XVI A;  3GDN A;  5BUL A;  3E1T A;  1N4W A;  2YR6 A;  4U2L A;  1ZMC A;  1GT8 A;  5JCK A;  1KDG A;  2VQ7 A;  3CGC A;  4JDR A;  5GRT A;  1B8S A;  1DOB A;  2XFP A;  5KOW A;  2WOI A;  1TDE A;  3F8P A;  1GRH A;  2BS3 A;  3HZL A;  4YKG A;  1TYP A;  2R0P A;  4J31 A;  2VRM A;  1JRX A;  1BGJ A;  2C64 A;  1IUW A;  2GMH A;  4IA5 A;  1JRY A;  4DSH A;  3EAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...