3GD3A

Crystal structure of a naturally folded murine apoptosis inducing factor
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
483
structure length
463
Chain Sequence
PSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLQFRQWNGKERSIYFQPPSFYVSAQDLPNIENGGVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRALEKISREVKSITVIGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKILPQYLSNWTMEKVKREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEADYGKGVIFYLRDKVVVGIVLWNVFNRMPIARKIIKDGEQHEDLNEVAKLFNIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apoptosis-inducing factor 1, mitochondrial
publication title Redox-linked conformational dynamics in apoptosis-inducing factor
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 138
structure length 463
sequence length 483
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3gd3A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3gd3A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3gd3A01
5JCKA 3AEDA 3UTFA 1EL5A 1Y56B 4CBQA 2VQ7A 1YY5A 4XWZA 2WPCA 4U8IA 3AYIA 3G5SA 2WU5A 4USQA 1CF3A 3RP6A 4H4SA 3ATQA 3P4SA 2QA2A 2WHDA 4YTMA 4RG3A 2B9YA 1KNPA 5L46A 1FEBA 1YQ3A 3NN0X 5IQ1A 2R46A 2NVKX 3JSKA 2A87A 2YLSA 1ZMCA 3AE6A 3UP5A 2BS4A 1LQUA 4U8OA 3DK4A 2FBWA 4NEWA 2V6OA 3BI4A 3T37A 1ELIA 2YG4A 2XDOA 3CGEA 3ISHA 4Z2RA 4YWOA 4WCTA 1JEHA 1FECA 2HQMA 1DODA 5HXIA 3QJ4A 1XHCA 4AOSA 3GD3A 1AOGA 1W4XA 4B67A 2VZ2A 3M0OA 1E7PA 2R4JA 1EL7A 3NNEA 2VVMA 5HHFA 4EQWA 3LB8A 2GR2A 4A9WA 4Z25A 2X8CA 3H4KA 4CCRA 5EB5A 3RHAA 4FX9A 2YQUA 5U25A 4BK3A 4X9MA 3ICSA 1GXFA 4GDEA 4JN9A 2C67A 4ZCCA 4AOXA 2YLRA 1ZDLA 5KVHA 2V61A 4PABA 2TMDA 3UTGA 1DOEA 5BVAA 3BI5A 2WESA 5KRQA 4U8MA 2CULA 4YSXA 3VRAA 2BA9A 4OVIA 3RNMA 3NT6A 3DJDA 2XYOA 2GH5A 4H4QA 4B1BA 3LZXA 4C3YA 1QLBA 4JNAA 2J3NA 4H4PA 5CQFA 1B5QA 2XLUA 3P4QA 1LQTA 4JNQA 1DNCA 4BK2A 4C5OA 1RYIA 4NZHA 3QFAA 1GNDA 2XLPA 3GMCA 2Q0LA 2YG3A 3AE2A 2C3DA 1PN0A 2DKHA 1GRFA 3AE4A 2C64A 2JB2A 3K7TA 4YT0A 4AT2A 1ZY8A 4NEVA 2QCUA 3RP8A 2ZZ0A 2YLTA 4E0VA 1VQWA 4FK1C 3QSMA 4B68A 2XFPA 2GR0A 4HA6A 4XWRA 3NK2X 1CJ4A 4XXGA 3GWDA 4BV6A 2GMHA 2XLTA 3ICTA 4U2LA 2R0CA 3UOXA 2C70A 1VG9A 2GR1A 3IWAA 1NG3A 3K7MX 4NTEA 1MO9A 3UOZA 2R9ZA 1K0IA 4P9SA 1CC6A 2X3NA 3KKJA 4K2XA 2QAEA 4J36A 2VRLA 1CHUA 2R0PA 1COYA 4LA1A 2RGOA 3P4RA 3S61A 4AP1A 4Z26A 2YVJA 3NLCA 2ARDA 2IVEA 3IF9A 1HYUA 2Q0KA 2UZZA 2YWLA 1H83A 4U8KA 3NN6X 3NRNA 4CNJA 2WU2A 3AD7B 2F5ZA 1TYPA 1N1PA 4JDRA 2I0ZA 2XCGA 3I6DA 3AE8A 1PBFA 2YR6A 1E1KA 1TDEA 2YVFA 1IUTA 2PYXA 2VRMA 1H81A 3I3LA 3CGCA 2E1MA 1CJ3A 3CNDA 3NKSA 1PBBA 3PS9A 4X9NA 4OPDA 3AECA 3DGHA 5JCNA 1DOCA 2GV8A 3CPIG 5M10A 1N4VA 3QSSA 4CNKA 4EQSA 2V60A 2TPRA 1GRBA 1S2QA 4J2WA 2GQWA 3ITJA 3GD4A 3CPHG 4TM0A 5KXJA 1K4QA 4IV9A 3K7QX 3K30A 2GEWA 3GWFA 1ZKQA 2RGJA 3UKKA 1H86A 3EANA 5IQ4A 3AE9A 4GUVA 4EM3A 1CL0A 2A8XA 1CJCA 3COXA 4A5LA 3AE3A 3AEFA 3DA1A 4A6NB 2E5VA 3V76A 5TR3A 2C75A 4YKFA 3FG2P 2OLNA 4GDPA 1VRQB 3SQPA 2BC0A 3CIRA 4PAAA 1D4CA 3P1WA 4H4WA 1Q9IA 2ZZCA 3ABVA 3II4A 3CNSA 2BK3A 2PHHA 5LV9A 1IUSA 3IHGA 1D7LA 1IUUA 4ECHA 1EBDA 5FS9A 1L9EA 1BWCA 1GALA 5GRTA 1RSGA 4LIIA 2AAQA 3DGZA 1TDFA 2YM2A 3ALJA 3LJPA 1CBOA 1Y56A 2WETA 4YSZA 2WPFA 2ZBWA 4UDQA 2Z5YA 1PBCA 3VR8A 2XLSA 3SGLA 3B6DA 4OPIA 4K22A 1KF6A 2WDRA 3KA7A 3PVCA 3GYJA 4Z2UA 2BS2A 2BS3A 3UOVA 2ACZA 1PJ5A 4NTCA 4TM3A 2XVFA 4A65A 3KD9A 3CGDA 2X8GA 3DK9A 4TLZA 4EM4A 2C76A 3VRDB 2Y6QA 1PBDA 1H7XA 1SEZA 3F8RA 1PS9A 1ZOYA 3L1RA 1GRGA 1CJ2A 3DJJA 2XFNA 2YM1A 4U8JA 4DSHA 5FS8A 1F8RA 1GRAA 1GETA 2Q7VA 3FMWA 4OPUA 1GEUA 1NDAA 4Z44A 3REDA 3OZ2A 4TM4A 2NPXA 4K7ZA 2BK5A 4U8LA 4H4ZA 4H50A 1L9CA 4DGKA 4EQRA 5JCMA 2H89A 2X50A 4H2QA 4ZN0A 5IPYA 2C65A 3QVPA 2GQFA 2CDUA 4H4RA 4UDPA 1GOSA 1FOHA 1ZMDA 3LXDA 3GDPA 2WBAA 3DMEA 4OCGA 4O5UA 4J57A 3P9UA 4WX1A 2YG6A 3AYLA 2WEUA 3QSEA 5KWFA 3NK1X 1BF3A 4EIPA 1O5WA 2RABA 2X99A 1GREA 1GT8A 3UKHA 1F6MA 2H88A 2JB3A 2XFOA 4FK1A 4NTDA 1DOBA 4YKGA 4OPGA 2BCPA 2FJAA 1VG0A 4JQ9A 3ALLA 2WP9A 1JNRA 1H7WA 3AEEA 3KVEA 3ADAB 1Z6LA 4UDRA 1N4WA 2YG7A 5C2TA 2RGHA 4CY6A 3UKAA 4U2TA 1ZP0A 1BKWA 3ZDNA 2WP5A 1D4DA 2IIDA 3P4PA 1PXAA 2R0GA 1P2EA 2B7RA 3DJEA 3UP4A 3GSIA 3H8IA 4OPCA 1KDGA 1GTEA 3E1TA 3NIXA 3DK8A 3VQRA 1KFYA 1Y0PA 3UTHA 2BACA 1S3BA 2C72A 5ER0A 1IUVA 3AWIA 1EL8A 5U63A 3KPFA 1Q1RA 2X8HA 4IA5A 4H4YA 2WDVA 4B65A 4CCQA 5BULA 3G5QA 4Y4LA 4YTNA 4REKA 3AYJA 2EQ8A 3OC4A 2GVCA 2GF3A 2OAMA 1NHPA 1DJNA 2XVEA 3CGBA 3UKFA 3BI2A 3C96A 1TDOA 2YLZA 4GRTA 1F8WA 2FJDA 2EQ6A 4B66A 1ONFA 2XVIA 2V3BA 1NAAA 1LPFA 4RSLA 2XVHA 1OJCA 3GRSA 4FDCB 1CC4A 1EL9A 2VQBA 2WOWA 2YR5A 3AE5A 3GYIA 4D03A 1NG4A 1PDHA 1JOAA 5KVIA 1D5TA 1VDCA 3BHKA 4BJYA 4YTPA 2XLRA 2JAEA 4Y4NA 5J60A 3BHFA 3C4NA 1BGNA 2APGA 2R4EA 1YQ4A 4U8NA 1JRXA 4OPTA 4ADWA 1OJTA 3DJGX 4BURA 1GERA 2Y6RA 3EPTA 1TDNA 4YXDA 1E1LA 2VOUA 1PJ7A 2AQJA 1TYTA 3ICRA 5HYMA 1ZK7A 4U2SA 1REOA 1JRYA 4Z2TA 3C4AA 4Y4MA 1LJ1A 5J7XA 3V3NA 3WE0A 4CRTA 1N4UA 1NEKA 2BC1A 2WOVA 3AE1A 3FPZA 1PBEA 4GCMA 4EQXA 2OALA 3F8PA 1NHRA 2WOIA 1L0VA 2YG5A 4A7AA 4BJZA 3NTDA 3EF6A 5C3JA 3O0HA 1CC2A 1TRBA 2YR4A 4J56A 4C74A 3AEGA 4D04A 2W0HA 1B37A 2B9XA 2C3CA 1JNZA 2OLOA 3ALMA 5KOXA 1O95A 2A89A 3HZLA 2C66A 3QFBA 3NTAA 4AT0A 1BZLA 5EB4A 2C73A 1MOKA 4H4UA 3VR9A 1GSNA 1K0JA 1MXTA 2BK4A 2WS3A 2BXSA 5GSNA 4EMJA 4K5RA 4A6NA 1GPEA 4JY3A 4H2RA 3EAOA 1GESA 2VVLG 3AE7A 3M12A 3UKQA 3IC9A 4C3XA 3LOVA 5FS6A 3S5WA 1YQZA 2YAUA 2GR3A 3IHMA 2GB0A 1KSSA 1NHQA 1YKJA 4ZCDA 5KOWA 4TM1A 1GTHA 3NHOX 1ZX9A 5BRTA 1LV0A 2JK6A 5BUKA 3URHA 4C77A 4H4XA 4KX6A 4KPRA 1PXCA 1S3EA 1P2HA 2O9ZA 4B69A 1GV4A 1F3PA 1ZOVA 2C7GA 2B76A 2GAGB 3V3OA 1LVLA 4RG4A 3AEBA 3LZWA 3GRTA 4B64A 3CNTA 3D8XA 2WQYA 1M6IA 1RP0A 5U1OA 1FEAA 3CNPA 5M0ZA 2YLWA 4EIQA 5JCIA 3NK0X 4MJWA 1M64A 3SFDA 3UTEA 2CFYA 3UKPA 2QA1A 2BXRA 2EQ7A 1OJ9A 4H7UA 1E1MA 3AEAA 1KNRA 3R9UA 2JBVA 2IVDA 3BNUA 4GF7A 4H2NA 4O5QA 4YSHA 1QO8A 1GRTA 2WPEA 5JCLA 1LTXR 3GDNA 2E4GA 4DNAA 4IVOB 4IVMB 1D7YA 4A79A 1BGJA 4HB9A 4J34A 4USRA 3UKLA 1JU2A 1OJDA 4EMIA 2DKIA 2OA1A 3CN8A 3NH3X 4X4JA 2B7SA 5EOWA 3AD8B 1O94A 2Q6UA 3H8LA 3ATRA 1NENA 4CY8A 4N9XA 1IJHA 1B8SA 4OPLA 3B3RA 1H84A 4M52A 5EBKA 1B4VA 2V3AA 2V5ZA 3FIMB 4A99A 4I58A 3CPJG 2XFUA 1PXBA 2FJBA 3L8KA 3Q6JA 1F8SA 3CNJA 2ZZBA 3G5RA 1TDKA 2R45A 1D4EA 1E1NA 1QJDA 4JY2A 3SM8A 3DH9A 4H4VA 1S2YA 3F8DA 2BCGG 4K5SA 4BK1A 3UCLA 2EQ9A 1DXLA 1H6VA 4IA6A 2VVLA 1NPXA 3Q9TA 4Z24A 3D1CA 1PHHA 3M13A 5FS7A 4B63A 3NYEA 2YVGA 1IUXA 2GRTA 3QVRA 4ICYA 3KU9A 1UKVG 4AP3A 2GAHB 4YSYA 2AR8A 5DBJA 3FBSA 2WP6A 1KSUA 4J33A 1NHSA 1H82A 2FJEA 1V59A 3BNMA 3PO7A 1IUWA 1E39A 4UP3A 4TLXA 5FMHA 1L9DA 3NG7X 2BABA 2Z5XA 4H4TA 4U8PA 1JRZA 3RP7A 3CTYA 4EMWA 1XPQA 4K8DA 2CVJA 2XVJA 4DSGA 1PJ6A 1OJAA 3NYCA 3SFEA 2YLXA 1DJQA 2B9WA 1K0LA 4J31A 1XDIA 2GMJA 1GRHA 2WDQA 3GMBA 3AB1A 1FL2A 3NGCX 4Z43A 1E6EA 1XANA 3VRBA 2JB1A 1FCDA 4APNA 2BYBA 4H2PA 4I59A 3UOYA 5CKUA 3AD9B 5HY5A 3ZYXA 2JKCA 3AXBA 3NYFA 4GR1A 3LADA 1X31B 2XFQA 3KLJA 1Q1WA 4LU6A
chains in the Genus database with same CATH superfamily
3SJNA 5JCKA 4CBQA 3DG7A 1Y56B 1YY5A 2WPCA 3AYIA 2WHDA 2B9YA 3I6EA 1FEBA 1YQ3A 3R07C 2NVKX 4GGHA 4H1ZA 1LQUA 2FBWA 1JDFA 2V6OA 3T37A 3RR1A 1ELIA 3DDMA 4YWOA 4WCTA 2HQMA 3NNEA 4EQWA 2GR2A 2X8CA 3RGTA 5EB5A 4F4RA 3NVZB 1GXFA 2PGEA 1KCZA 4ZCCA 4AOXA 1ZDLA 2TMDA 3BI5A 3UJEA 4U8MA 4H4QA 2J3NA 3OZYA 1B5QA 3P4QA 4BK2A 3UXKA 3S47A 3QFAA 2XH4A 3GMCA 3AE2A 2DKHA 1GRFA 2C64A 2ZZ0A 2YLTA 4E0VA 3QSMA 2QVHA 4HA6A 4XWRA 2OVLA 3TTEA 2POZA 3GWDA 3NVVB 3ICTA 2GR1A 3MSYA 3UOZA 3EEZA 1W6TA 4P9SA 2MUCA 4J36A 4LA1A 2RGOA 2ARDA 3IF9A 3NRNA 3AM9A 4IP5A 1X2HA 3KUMA 3TQPA 3DG3A 2YR6A 1TDEA 2PYXA 1H81A 4X9NA 1TE6A 3CPIG 4CNKA 4J2WA 4IL2A 4GAVA 7ENLA 3T4WA 1WYGA 3GD4A 5KXJA 4IV9A 3K7QX 2GEWA 4NNJA 1ZKQA 2QDDA 4HPNA 4X2PA 5IQ4A 4GFIA 1CJCA 4G74A 4A6NB 2GGHA 4YKFA 3FG2P 3SQPA 1Q9IA 4IT1A 3II4A 3IJQA 2BK3A 5LV9A 1IUUA 5FS9A 4G7FA 4LIIA 3H70A 1TDFA 1Y56A 2XLSA 3B6DA 4OPIA 1KF6A 3ENLA 3KA7A 3PVCA 2ACZA 1PJ5A 4NTCA 3MQTA 3VRDB 1PBDA 1H7XA 1SEZA 2P8BA 3DJJA 4DSHA 1TZZA 2P88A 1F8RA 1GRAA 1FHVA 3OZ2A 2NPXA 1EC9A 2BK5A 2BRYA 4H4ZA 4H50A 3NFUA 4EQRA 5JCMA 3QVPA 1RVKA 1ZMDA 4KPLA 3DMEA 1N61C 4GAPA 2RABA 1DOBA 4YKGA 4E4UA 3S5SA 2FJAA 3SZFA 1H7WA 5KMSA 5C2TA 4CY6A 2W55A 2WP5A 4A6GA 1D4DA 2IIDA 3P4PA 3OTRA 3CYJA 3H8IA 2PMQA 1GTEA 3VQRA 3DK8A 3UTHA 4FI4A 2C72A 1EL8A 1Q1RA 4E5TA 3G5QA 3OC4A 2GF3A 3UKFA 1XS2A 3UGVA 3C96A 1TDOA 4H2HA 1F8WA 3UJFA 2FJDA 5J04A 4B66A 1ONFA 2XVIA 3ZVHB 5FJPA 3GRSA 1EL9A 2VQBA 3GYIA 4D03A 1PDHA 5KVIA 1D5TA 4Y4NA 4G73A 2XSXA 1JRXA 4OPTA 4ROPA 4HCHA 2AQJA 4U2SA 2W3SA 1LJ1A 3V3NA 4CRTA 1NEKA 1L8PA 4II3A 3FPZA 3P0WA 1PBEA 4GCMA 4A7AA 3TWBA 3CXOA 4D04A 1E9IA 1B37A 2A89A 1BZLA 3VR9A 4GIRA 4ENLA 2BXSA 4A6NA 4JY3A 4H2RA 3S5WA 1YQZA 2GSHA 2GB0A 5KOWA 1GTHA 1LV0A 2JK6A 4ZA0A 4H4XA 1PXCA 1ZOVA 2B76A 3NXLA 3LZWA 4B64A 1JPDX 3ZLHA 4DXKA 1X2GA 4MJWA 2PA6A 3UKPA 2IVDA 4H2NA 2GGIA 3SN0A 1EC7A 4IVOB 4USRA 3UKLA 1OJDA 2OA1A 3NH3X 5EOWA 3V3WA 1O94A 2Q6UA 3H8LA 4CY8A 4N9XA 1IJHA 4DN1A 2OQYA 3CPJG 2ZZBA 1TDKA 1D4EA 4JY2A 1PDZA 2DW7A 4GISA 3IJLA 4K5SA 1SJBA 1H6VA 3IK4A 3M13A 2YVGA 2PPGA 3KU9A 1UKVG 4AP3A 2WP6A 4J33A 3DGBA 3R25A 3CTYA 4EMWA 2CVJA 5KNLA 1OJAA 3NYCA 1DJQA 4J31A 1XDIA 4Z43A 1GRHA 1FL2A 1KN0A 5G5HB 2JB1A 4I59A 3SZWA 3UOYA 3AD9B 2JKCA 4KT2A 3ZVHA 2PTWA 3N6HA 3OW1A 3KLJA 1MRAA 4U8IA 4USQA 3RP6A 3ATQA 2GL5A 4YTMA 1KNPA 5JRBA 2R46A 1IYXA 2A87A 3UP5A 1ZMCA 4U8OA 3PWGA 2PSNA 2XDOA 3NZGA 3ISHA 1FECA 3L5OA 2PTYA 4AOSA 3GD3A 1W4XA 4B67A 3M0OA 1E7PA 5HHFA 3LB8A 4A9WA 1JROA 1SJAA 4CCRA 5U25A 4X9MA 4GDEA 2C67A 2V61A 3UTGA 4MMWA 1N5XA 2CULA 4YSXA 3RNMA 2OPJA 3DJDA 3NT6A 3LZXA 4C3YA 3R1ZA 1LQTA 3CB3A 1DNCA 2YG3A 3K7TA 1T3QC 2JB2A 4AT2A 4FK1C 2MNRA 4GYPC 4GYPA 1N5WC 1MUCA 2R0CA 2C70A 2RDXA 3BOXA 4K2XA 2VRLA 4E8GA 3IJIA 4Z26A 4AP1A 2Q0KA 1H83A 4U8KA 1STZA 3NN6X 5KMQA 4CNJA 4Z1YA 3AD7B 5G5GB 2I0ZA 4H83A 1IUTA 3TJIA 3I3LA 1CJ3A 3NKSA 4OPDA 2GV8A 1N4VA 3QSSA 1S2QA 4DWDA 1WUEA 2PCEA 4GUVA 4EM3A 1CL0A 4A5LA 3DA1A 1PDYA 2E5VA 2OKTA 3V76A 3SZ0A 1VRQB 3CIRA 3A7AA 1EC8A 2ZZCA 4FP1A 2E5AA 1D7LA 3GC2A 4ECHA 1GALA 2YM2A 2WETA 4YSZA 3BJSA 2Z5YA 3SGLA 2OZTA 3MUCA 2WDRA 3GYJA 2BS2A 3GYXA 3T31A 3UOVA 4A65A 2X8GA 4TLZA 1VQZA 1PS9A 5FS8A 3FMWA 3SYIA 3ETRB 2XH2A 3PWIA 1KKOA 2AKMA 1JPMA 2X50A 4ZN0A 2C65A 4J1OA 3HYVA 3QLDA 1R6WA 1FOHA 3LXDA 3GDPA 2WBAA 4OCGA 4O5UA 4J57A 3P9UA 4WX1A 2WEUA 1BF3A 1O5WA 1GT8A 3UKHA 1F6MA 4OPGA 4JQ9A 2WP9A 3DFYA 1Z6LA 2YG7A 3Q4DA 3UKAA 5ENLA 4G8TA 1PXAA 3UJRA 2R0GA 3DJEA 1Y0PA 2BACA 1S3BA 5ER0A 3AWIA 4IA5A 4B65A 1NU5A 3AYJA 2PP1A 2OAMA 2OZ8A 2YLZA 4GRTA 3MZNA 1FHUA 3GD6A 1NAAA 4RSLA 2XVHA 1ZXIC 3AE5A 5J60A 4IP4A 2JAEA 3C4NA 3OP2A 2R4EA 4U8NA 1YQ4A 2AKZA 2Y6RA 1VDVA 3N4FA 1REOA 1JRYA 3C4AA 3WE0A 1N4UA 3UXLA 5FJTA 2WOVA 2YG5A 3NTDA 2PU1A 1SJDA 4J56A 2W0HA 2OLOA 2C3CA 3ALMA 5KOXA 1O95A 3HZLA 3DG6A 2C66A 1ELSA 6ENLA 5EB4A 2C73A 1MOKA 2CHRA 2PP0A 1K0JA 2WS3A 4EMJA 4K5RA 1GPEA 1GESA 2VVLG 4C3XA 4Z17A 5FS6A 2YAUA 2GR3A 1KSSA 1NHQA 4ZCDA 3NHOX 1ZX9A 4KPRA 1S3EA 1P2HA 3N4EA 2O9ZA 2C7GA 3V3OA 4RG4A 3GRTA 5U1OA 1FEAA 3CNPA 5M0ZA 4EIQA 3FV9A 3FJ4A 3SFDA 2QA1A 2BXRA 2JBVA 1QO8A 5JCLA 3PK7A 2BRAA 4HB9A 4J34A 1MDLA 3PFRA 4EMIA 2B7SA 2QJNA 3B9JB 1NENA 1B4VA 3SBFA 3FIMB 4I58A 2FJBA 3DH9A 3F8DA 1DXLA 4GMEA 4B63A 3H7VA 2PU0A 3NYEA 2GRTA 2GAHB 4YSYA 1KSUA 1NHSA 4MGGA 1H82A 3BNMA 1IUWA 4UP3A 4JN7A 2BABA 4H4TA 3RP7A 3R11A 1XPQA 2XVJA 1PJ6A 3SFEA 2YLXA 1EBGA 2FKPA 4APNA 4H2PA 3HRDC 5CKUA 5HY5A 1WUFA 3NYFA 2XFQA 1Q1WA 3AEDA 3UTFA 3ZVIA 2VQ7A 2PTXA 4H4SA 3T9PA 5L46A 3NN0X 2W3RA 3JSKA 4G6HA 3DK4A 4NEWA 3VFCA 2YG4A 4Z2RA 4IZGA 1JEHA 1DODA 3QJ4A 1AOGA 4K1WA 2R4JA 1EL7A 2VVMA 2HXTA 2I5QA 3RHAA 3ICSA 4JN9A 1N63C 3VDGA 5BVAA 2QGYA 2WESA 5KRQA 3VRAA 2BA9A 4OVIA 4B1BA 2PTZA 1QLBA 3DFHA 4H4PA 5CQFA 2OO6A 4JNQA 3VCNA 1RYIA 2HXUA 4NZHA 2XLPA 2C3DA 1PN0A 3AE4A 1JRPA 4YT0A 2PS2A 4B68A 4DX3A 2GR0A 3MWCA 4KWSA 3NK2X 4XXGA 3FVDA 4BV6A 2XLTA 3UOXA 1VG9A 3IWAA 1NG3A 3K7MX 1MO9A 3P93A 3THUA 2R9ZA 1CC6A 3KKJA 3I4KA 1XPYA 3UJSA 2QAEA 1CHUA 2R0PA 1COYA 1BKHA 3P4RA 3S61A 2UZZA 2YWLA 3K1GA 2F5ZA 1TYPA 1N1PA 3V5FA 2XCGA 2P0IA 3AE8A 1PBFA 1E1KA 2YVFA 5FJOA 3PS9A 1P43A 3GO2A 5JCNA 1DOCA 5M10A 4EQSA 3A7UA 3FYYA 3ITJA 3KPKA 3CAWA 3CPHG 3NVWB 1K4QA 1NELA 2RGJA 1H86A 3AE9A 4ZOHB 2HNEA 3COXA 3AE3A 2QJMA 2C75A 2OLNA 1DTNA 4H4WA 3ABVA 1ONEA 3CNSA 3T2ZA 2PHHA 3JW7A 2ZADA 3RITA 1IUSA 3IHGA 1BWCA 3ALJA 3LJPA 2ZBWA 3VR8A 4K22A 4K8GA 3TWAA 2ONEA 3KD9A 3CGDA 3DK9A 3JZUA 4EM4A 2C76A 3F8RA 1ZOYA 1GRGA 1CJ2A 2XFNA 4U8JA 2AL2B 3REDA 4Z44A 1GEUA 4TM4A 4K7ZA 1L9CA 2GQFA 1OEPA 4UDPA 1GOSA 2OX4A 2YG6A 3QSEA 2OLAA 5KWFA 3NS1B 3CT2A 3NK1X 3VCCA 2XFOA 4FK1A 4NTDA 2XH0A 2BCPA 1VG0A 4A3RA 3ALLA 1JNRA 1MNSA 4UDRA 2RGHA 3SZCA 1S7MA 2ZC8A 4OPCA 2PGWA 1KDGA 3RRAA 1IUVA 5U63A 3KPFA 4H4YA 4CCQA 4G9KA 4Y4LA 4REKA 2EQ8A 3NRZB 3T6CA 1DJNA 3CGBA 3FCPA 3DIPA 2EQ6A 2V3BA 1LPFA 4FDCB 3R0UA 1CC4A 3BHKA 1VDCA 4BJYA 1BGNA 3QN3A 3SX6A 1OJTA 3DJGX 4BURA 1GERA 3EPTA 1TDNA 2OFJA 4YXDA 1E1LA 3P3BA 1PJ7A 3ICRA 1ZK7A 4Z2TA 4Y4MA 5KMPA 5J7XA 3R10A 3F8PA 3CMMA 4BJZA 5C3JA 1TRBA 4C74A 3T14A 1JNZA 4AT0A 5GSNA 3EAOA 5BOEA 3M12A 3RCYA 1FFVC 4M0XA 2OZ3A 1YKJA 3H8AA 3U9IA 4C77A 3UJ2A 4KX6A 4HN8A 1F3PA 2QQ6A 3BSMA 1LVLA 3V4BA 3AEBA 3CNTA 3D8XA 2WQYA 3DERA 3UCCA 1KD0A 2YLWA 5JCIA 3NK0X 3UTEA 2CFYA 1OJ9A 4ZCWA 4H7UA 3D46A 3AEAA 3R9UA 4GF7A 4YSHA 2WPEA 3GDNA 1LTXR 4YWSA 1JU2A 3CN8A 2AL2A 3AD8B 3DESA 3ATRA 1B8SA 3DEQA 1H84A 3B3RA 5EBKA 2V3AA 5BOFA 2V5ZA 2HZGA 3U4FA 3L8KA 2R45A 3SM8A 1E1NA 1QJDA 4H4VA 2FYMA 3TW9A 3UCLA 3NO1A 2EQ9A 4IA6A 2VVLA 4Z24A 3D9XA 1PHHA 5FS7A 1IUXA 4ICYA 2FJEA 3PO7A 1E39A 3QTPA 4TLXA 4IHCA 4G6GA 3NG7X 2Z5XA 4U8PA 1KKRA 1JRZA 3T2KA 4K8DA 3B97A 3RO6A 3R0KA 2B9WA 3GMBA 1H2IA 3NGCX 3AB1A 1F9CA 2OG9A 1E6EA 1XANA 3VRBA 1FCDA 3ZLGA 4IL0A 3HYWA 3AXBA 4GR1A 2GGGA 3SR6B 2P3ZA 4K2SA 4LU6A 3MY9A 1EL5A 4XWZA 1BQGA 2P8CA 3G5SA 2WU5A 4GGBA 4TVYA 1CF3A 3P4SA 2QA2A 4RG3A 5IQ1A 3AE6A 2YLSA 2E3TA 2BS4A 3HPFA 3BI4A 3CGEA 5HXIA 1XHCA 3SY4A 3STPA 2VZ2A 2O56A 3ES7A 4Z25A 1P48A 3H4KA 3H12A 4EWJA 4FX9A 2YQUA 3MKCA 4BK3A 3T0KA 4HCLA 2YLRA 4PABA 5KVHA 4HNLA 1DOEA 3NVYB 2XYOA 2GH5A 5EU9A 4JNAA 2XLUA 4C5OA 3UCDA 1GNDA 2Q0LA 1ZY8A 4NEVA 2QCUA 3RP8A 1VQWA 2XFPA 1CJ4A 3EUB3 3ES8A 2GMHA 2W54A 4U2LA 4NTEA 1K0IA 3FXGA 2X3NA 3AN1A 3N6JA 2YVJA 3NLCA 2IVEA 1HYUA 3SN1A 2WU2A 4JDRA 3AMZA 3I6DA 2VRMA 3CGCA 2E1MA 3CNDA 1PBBA 1SB3B 3AECA 3DGHA 2V60A 2TPRA 1GRBA 3Q45A 1MDRA 4KEMA 2GQWA 4TM0A 3K30A 3GWFA 3UKKA 4HNCA 3EANA 3A7RA 3JVAA 4A35A 2A8XA 3AEFA 4TVWA 2GGJA 3HW2A 5TR3A 3VA8A 3T2YA 4GDPA 4PAAA 2BC0A 1D4CA 3P1WA 4MKSA 3ZLFA 1EBDA 4E6MA 1L9EA 5GRTA 1RSGA 4DHGA 2AAQA 3DGZA 4HYRA 1CBOA 2WPFA 4UDQA 1PBCA 2OQHA 2XGZA 3TOYA 4Z2UA 4HCDA 2BS3A 4TM3A 2XVFA 4JN8A 2Y6QA 3L1RA 2YM1A 2C4CA 1GETA 2Q7VA 4OPUA 1NDAA 3VC5A 4U8LA 3TJ4A 4DGKA 2H89A 4H2QA 5IPYA 2CDUA 4H4RA 3AYLA 4EIPA 2X99A 1GREA 5IDZA 2H88A 2JB3A 3VC6A 1V97A 3AEEA 3KVEA 3ADAB 1N4WA 2AL1A 4U2TA 1ZP0A 1BKWA 1RM6B 3SQSA 3ZDNA 1P2EA 2B7RA 3UP4A 3GSIA 3SN4A 3E1TA 3NIXA 1KFYA 2X8HA 5BULA 2WDVA 4YTNA 5KMRA 2GVCA 3I6TA 1NHPA 3TCSA 2XVEA 3BI2A 1N60C 1FFUC 1OJCA 2YR5A 2WOWA 1NG4A 4YTPA 1JOAA 2XLRA 3BHFA 2APGA 3HYXA 4ADWA 4E4FA 2VOUA 1TYTA 1EBHA 5HYMA 3SSZA 2BC1A 3AE1A 2QJJA 1L0VA 4EQXA 2OALA 1NHRA 2WOIA 4J3ZA 3EF6A 3O0HA 1CC2A 2YR4A 4H19A 3AEGA 2XH7A 2B9XA 1FO4A 1TKKA 3OPSA 3QFBA 3NTAA 4H4UA 3T8QA 1GSNA 1MXTA 2BK4A 3AE7A 3UKQA 3IC9A 3LOVA 1FIQB 4M6UA 3IHMA 3QPEA 4TM1A 5BRTA 5BUKA 3URHA 1N62C 4B69A 1GV4A 2GAGB 3GY1A 2NQLA 1M6IA 2GDQA 1RP0A 1M64A 1YEYA 2EQ7A 1E1MA 1KNRA 3BNUA 4O5QA 1GRTA 4IVMB 2E4GA 4DNAA 4A79A 1D7YA 5FJRA 1BGJA 2DKIA 3EKGA 4X4JA 4DYEA 4II2A 3SXIA 1SJCA 4OPLA 4M52A 2PODA 4A99A 2XFUA 1PXBA 3CNJA 3Q6JA 1F8SA 3G5RA 3QKEA 1S2YA 3V5CA 2BCGG 4BK1A 3PG6A 3OZMA 4NWZA 1NPXA 3Q9TA 3D1CA 1R0MA 1ECQA 5FJUA 3CK5A 3QVRA 2AR8A 5DBJA 3FBSA 2GGEA 1V59A 2DW6A 5FMHA 1L9DA 3D47A 2QDEA 4DSGA 1K0LA 4JHMA 2GMJA 2WDQA 2BYBA 1JCTA 3CXBA 2PP3A 3ZYXA 3LADA 1X31B
chains in the Genus database with same CATH topology
5JCKA 3AEDA 3UTFA 1EL5A 1Y56B 4CBQA 2VQ7A 1YY5A 4XWZA 2WPCA 4U8IA 3AYIA 3G5SA 2WU5A 4USQA 1CF3A 3RP6A 4H4SA 3ATQA 3P4SA 2QA2A 2WHDA 4YTMA 4RG3A 2B9YA 1KNPA 5L46A 1FEBA 1YQ3A 3NN0X 5JRBA 5IQ1A 2R46A 2NVKX 3JSKA 2A87A 2YLSA 1ZMCA 3AE6A 3UP5A 4G6HA 2BS4A 1LQUA 4U8OA 3DK4A 2FBWA 4NEWA 2V6OA 3BI4A 3T37A 1ELIA 2YG4A 2XDOA 3CGEA 3ISHA 4Z2RA 4YWOA 4WCTA 1JEHA 1FECA 2HQMA 3L5OA 1DODA 5HXIA 3QJ4A 1XHCA 3SY4A 3GD3A 4AOSA 1AOGA 1W4XA 4B67A 2VZ2A 3M0OA 1E7PA 2R4JA 1EL7A 3NNEA 2VVMA 5HHFA 4EQWA 3LB8A 2GR2A 4A9WA 4Z25A 2X8CA 3H4KA 4CCRA 5EB5A 3RHAA 4FX9A 2YQUA 5U25A 4BK3A 4X9MA 3T0KA 3ICSA 1GXFA 4GDEA 4JN9A 2C67A 4ZCCA 4AOXA 2YLRA 1ZDLA 5KVHA 2V61A 4PABA 2TMDA 3UTGA 1DOEA 5BVAA 3BI5A 2WESA 5KRQA 4U8MA 2CULA 4YSXA 3VRAA 2BA9A 4OVIA 3RNMA 3NT6A 3DJDA 2XYOA 2GH5A 4H4QA 4B1BA 3LZXA 4C3YA 1QLBA 4JNAA 2J3NA 4H4PA 5CQFA 1B5QA 2XLUA 3P4QA 1LQTA 4JNQA 1DNCA 4BK2A 4C5OA 1RYIA 4NZHA 3QFAA 1GNDA 2XLPA 3GMCA 2Q0LA 2YG3A 3AE2A 2C3DA 1PN0A 2DKHA 1GRFA 3AE4A 2C64A 2JB2A 3K7TA 4YT0A 4AT2A 1ZY8A 4NEVA 2QCUA 3RP8A 2ZZ0A 2YLTA 4E0VA 1VQWA 4FK1C 3QSMA 4B68A 2XFPA 2GR0A 4HA6A 4XWRA 3NK2X 1CJ4A 4XXGA 3GWDA 4BV6A 2GMHA 2XLTA 3ICTA 4U2LA 2R0CA 3UOXA 2C70A 1VG9A 2GR1A 3IWAA 1NG3A 3K7MX 4NTEA 1MO9A 3UOZA 2R9ZA 1K0IA 4P9SA 1CC6A 2X3NA 3KKJA 4K2XA 2QAEA 4J36A 2VRLA 1CHUA 2R0PA 1COYA 4LA1A 2RGOA 3P4RA 3S61A 4AP1A 4Z26A 2YVJA 3NLCA 2ARDA 2IVEA 3IF9A 1HYUA 2Q0KA 2UZZA 2YWLA 1H83A 4U8KA 3NN6X 3NRNA 5KMQA 4CNJA 2WU2A 3AD7B 2F5ZA 1TYPA 4JDRA 1N1PA 2I0ZA 2XCGA 3I6DA 3AE8A 1PBFA 2YR6A 1E1KA 1TDEA 2YVFA 1IUTA 2PYXA 2VRMA 1H81A 3I3LA 3CGCA 2E1MA 1CJ3A 3CNDA 3NKSA 1PBBA 3PS9A 4X9NA 4OPDA 3AECA 3DGHA 5JCNA 1DOCA 2GV8A 3CPIG 5M10A 1N4VA 3QSSA 4CNKA 4EQSA 2V60A 2TPRA 1GRBA 1S2QA 4J2WA 2GQWA 4GAVA 3ITJA 3KPKA 3GD4A 3CPHG 4TM0A 5KXJA 1K4QA 4IV9A 3K7QX 3K30A 2GEWA 3GWFA 4NNJA 1ZKQA 2RGJA 3UKKA 1H86A 3EANA 5IQ4A 3AE9A 4GUVA 4EM3A 1CL0A 2A8XA 1CJCA 3COXA 4A5LA 3AE3A 4G74A 3AEFA 3DA1A 4A6NB 2E5VA 3V76A 3SZ0A 5TR3A 3T2YA 2C75A 4YKFA 3FG2P 2OLNA 4GDPA 1VRQB 3SQPA 2BC0A 3CIRA 4PAAA 1D4CA 3P1WA 4H4WA 1Q9IA 2ZZCA 3ABVA 3II4A 3CNSA 3T2ZA 2BK3A 2PHHA 5LV9A 1IUSA 3IHGA 1D7LA 1IUUA 4ECHA 1EBDA 5FS9A 1L9EA 1BWCA 1GALA 5GRTA 1RSGA 4LIIA 2AAQA 3DGZA 1TDFA 2YM2A 3ALJA 3LJPA 1CBOA 1Y56A 2WETA 4YSZA 2WPFA 2ZBWA 4UDQA 2Z5YA 1PBCA 3VR8A 2XLSA 3SGLA 3B6DA 4OPIA 4K22A 1KF6A 2WDRA 3KA7A 3PVCA 3GYJA 4Z2UA 2BS2A 3GYXA 2BS3A 3T31A 3UOVA 2ACZA 1PJ5A 4NTCA 4TM3A 2XVFA 4A65A 3KD9A 3CGDA 2X8GA 3DK9A 4TLZA 4EM4A 2C76A 3VRDB 2Y6QA 1PBDA 1H7XA 1SEZA 3F8RA 1PS9A 1ZOYA 3L1RA 1GRGA 1CJ2A 3DJJA 2XFNA 2YM1A 2C4CA 4U8JA 4DSHA 5FS8A 1F8RA 1GRAA 1GETA 2Q7VA 3FMWA 4OPUA 1GEUA 1NDAA 4Z44A 3REDA 3OZ2A 4TM4A 2NPXA 4K7ZA 2BK5A 2BRYA 4U8LA 4H4ZA 4H50A 1L9CA 3SYIA 4DGKA 4EQRA 5JCMA 2H89A 2X50A 4H2QA 4ZN0A 5IPYA 2C65A 3QVPA 2GQFA 2CDUA 3HYVA 4H4RA 4UDPA 1GOSA 1FOHA 1ZMDA 3LXDA 3GDPA 2WBAA 3DMEA 4OCGA 4O5UA 4J57A 3P9UA 4WX1A 2YG6A 3AYLA 2WEUA 3QSEA 4GAPA 5KWFA 3NK1X 1BF3A 4EIPA 1O5WA 2RABA 2X99A 1GREA 1GT8A 3UKHA 1F6MA 2H88A 2JB3A 2XFOA 4FK1A 4NTDA 1DOBA 4YKGA 4OPGA 2BCPA 2FJAA 3SZFA 1VG0A 4JQ9A 3ALLA 2WP9A 1JNRA 1H7WA 3AEEA 3KVEA 3ADAB 1Z6LA 4UDRA 1N4WA 5KMSA 2YG7A 5C2TA 2RGHA 4CY6A 3UKAA 4U2TA 1ZP0A 1BKWA 3ZDNA 2WP5A 1D4DA 2IIDA 3SZCA 3P4PA 1S7MA 1PXAA 2R0GA 1P2EA 2B7RA 3DJEA 3UP4A 3GSIA 3H8IA 4OPCA 1KDGA 1GTEA 3E1TA 3NIXA 3DK8A 3VQRA 1KFYA 1Y0PA 3UTHA 2BACA 1S3BA 2C72A 5ER0A 1IUVA 3AWIA 1EL8A 5U63A 3KPFA 1Q1RA 2X8HA 4IA5A 4H4YA 2WDVA 4B65A 4CCQA 5BULA 4G9KA 3G5QA 4Y4LA 4YTNA 4REKA 3AYJA 2EQ8A 3OC4A 5KMRA 2GVCA 2GF3A 2OAMA 1NHPA 1DJNA 2XVEA 3CGBA 3UKFA 3BI2A 3C96A 4Z43A 1TDOA 2YLZA 4GRTA 1F8WA 2FJDA 2EQ6A 4B66A 1ONFA 2XVIA 2V3BA 1NAAA 1LPFA 4RSLA 2XVHA 1OJCA 3GRSA 4FDCB 1CC4A 1EL9A 2VQBA 2WOWA 2YR5A 3AE5A 3GYIA 4D03A 1NG4A 1PDHA 1JOAA 5KVIA 1D5TA 1VDCA 3BHKA 4BJYA 4YTPA 2XLRA 2JAEA 4Y4NA 5J60A 4G73A 3BHFA 3C4NA 1BGNA 2APGA 2R4EA 1YQ4A 4U8NA 3HYXA 1JRXA 3SX6A 4OPTA 4ADWA 1OJTA 3DJGX 4BURA 1GERA 2Y6RA 3EPTA 1TDNA 4YXDA 1E1LA 2VOUA 1PJ7A 2AQJA 1TYTA 3ICRA 5HYMA 1ZK7A 4U2SA 1REOA 1JRYA 4Z2TA 3C4AA 4Y4MA 1LJ1A 5KMPA 5J7XA 3V3NA 3WE0A 4CRTA 1N4UA 1NEKA 2BC1A 4II3A 2WOVA 3AE1A 3FPZA 1PBEA 4GCMA 4EQXA 2OALA 3F8PA 1NHRA 2WOIA 1L0VA 2YG5A 4A7AA 3CMMA 4BJZA 3NTDA 3EF6A 5C3JA 3O0HA 1CC2A 1TRBA 2YR4A 4J56A 4C74A 3AEGA 3T14A 4D04A 2W0HA 1B37A 2B9XA 2C3CA 1JNZA 2OLOA 3ALMA 5KOXA 1O95A 2A89A 3HZLA 2C66A 3QFBA 3NTAA 4AT0A 1BZLA 5EB4A 2C73A 1MOKA 4H4UA 3VR9A 1GSNA 1K0JA 1MXTA 2BK4A 2WS3A 2BXSA 5GSNA 4EMJA 4K5RA 4A6NA 1GPEA 4JY3A 4H2RA 3EAOA 1GESA 2VVLG 3AE7A 3M12A 3UKQA 3IC9A 4C3XA 3LOVA 5FS6A 3S5WA 1YQZA 2YAUA 2GR3A 3IHMA 2GB0A 1KSSA 1NHQA 1YKJA 4ZCDA 5KOWA 4TM1A 1GTHA 3NHOX 1ZX9A 5BRTA 1LV0A 2JK6A 5BUKA 3URHA 4C77A 4H4XA 4KX6A 4KPRA 1PXCA 1S3EA 1P2HA 2O9ZA 4B69A 1GV4A 1F3PA 1ZOVA 2C7GA 2B76A 2GAGB 3V3OA 1LVLA 4RG4A 3AEBA 3LZWA 3GRTA 4B64A 3CNTA 3D8XA 2WQYA 1M6IA 1RP0A 5U1OA 1FEAA 3CNPA 5M0ZA 2YLWA 4EIQA 5JCIA 3NK0X 4MJWA 1M64A 3SFDA 3UTEA 2CFYA 3UKPA 2QA1A 2BXRA 2EQ7A 1OJ9A 4H7UA 1E1MA 3AEAA 1KNRA 3R9UA 2JBVA 2IVDA 3BNUA 4GF7A 4H2NA 4O5QA 4YSHA 1QO8A 1GRTA 2WPEA 5JCLA 1LTXR 3GDNA 2E4GA 4DNAA 4IVOB 2BRAA 1D7YA 4IVMB 1BGJA 4HB9A 4J34A 4USRA 3UKLA 4A79A 1JU2A 1OJDA 4EMIA 2DKIA 2OA1A 3CN8A 3NH3X 4X4JA 2B7SA 5EOWA 3AD8B 1O94A 2Q6UA 4II2A 3H8LA 3ATRA 1NENA 3SXIA 4N9XA 1IJHA 1B8SA 4CY8A 4OPLA 3B3RA 1H84A 4M52A 5EBKA 2V3AA 1B4VA 2V5ZA 3FIMB 4A99A 4I58A 3CPJG 2XFUA 1PXBA 2FJBA 3L8KA 3Q6JA 1F8SA 3CNJA 2ZZBA 3G5RA 1TDKA 2R45A 1D4EA 1E1NA 1QJDA 4JY2A 3SM8A 3DH9A 4H4VA 1S2YA 3F8DA 2BCGG 4K5SA 4BK1A 3PG6A 3UCLA 2EQ9A 1DXLA 1H6VA 4IA6A 2VVLA 1NPXA 4NWZA 3Q9TA 4Z24A 3D9XA 3D1CA 1PHHA 3M13A 5FS7A 4B63A 3NYEA 2YVGA 1IUXA 2GRTA 3QVRA 4ICYA 3KU9A 1UKVG 4AP3A 2GAHB 4YSYA 2AR8A 5DBJA 3FBSA 2WP6A 1KSUA 4J33A 1NHSA 1H82A 2FJEA 1V59A 3BNMA 3PO7A 1IUWA 1E39A 4UP3A 4TLXA 5FMHA 1L9DA 4G6GA 3NG7X 2BABA 2Z5XA 4H4TA 4U8PA 1JRZA 3RP7A 3T2KA 3CTYA 4EMWA 1XPQA 4K8DA 2CVJA 2XVJA 4DSGA 1PJ6A 1OJAA 3NYCA 3SFEA 2YLXA 5KNLA 1DJQA 2B9WA 1K0LA 4J31A 1H2IA 1XDIA 1GRHA 2GMJA 2WDQA 3AB1A 1FL2A 3GMBA 3NGCX 1KN0A 1E6EA 1XANA 3VRBA 2JB1A 1FCDA 4APNA 2BYBA 4H2PA 4I59A 3SZWA 3UOYA 5CKUA 3AD9B 5HY5A 3ZYXA 2JKCA 3HYWA 3AXBA 3NYFA 4GR1A 3LADA 1X31B 2XFQA 3KLJA 1Q1WA 4LU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JCK A;  3AED A;  3UTF A;  1EL5 A;  1Y56 B;  4CBQ A;  2VQ7 A;  1YY5 A;  4XWZ A;  2WPC A;  4U8I A;  3AYI A;  3G5S A;  2WU5 A;  4USQ A;  1CF3 A;  3RP6 A;  4H4S A;  3ATQ A;  3P4S A;  2QA2 A;  2WHD A;  4YTM A;  4RG3 A;  2B9Y A;  1KNP A;  5L46 A;  1FEB A;  1YQ3 A;  3NN0 X;  5IQ1 A;  2R46 A;  2NVK X;  3JSK A;  2A87 A;  2YLS A;  1ZMC A;  3AE6 A;  3UP5 A;  2BS4 A;  1LQU A;  4U8O A;  3DK4 A;  2FBW A;  4NEW A;  2V6O A;  3BI4 A;  3T37 A;  1ELI A;  2YG4 A;  2XDO A;  3CGE A;  3ISH A;  4Z2R A;  4YWO A;  4WCT A;  1JEH A;  1FEC A;  2HQM A;  1DOD A;  5HXI A;  3QJ4 A;  1XHC A;  4AOS A;  3GD3 A;  1AOG A;  1W4X A;  4B67 A;  2VZ2 A;  3M0O A;  1E7P A;  2R4J A;  1EL7 A;  3NNE A;  2VVM A;  5HHF A;  4EQW A;  3LB8 A;  2GR2 A;  4A9W A;  4Z25 A;  2X8C A;  3H4K A;  4CCR A;  5EB5 A;  3RHA A;  4FX9 A;  2YQU A;  5U25 A;  4BK3 A;  4X9M A;  3ICS A;  1GXF A;  4GDE A;  4JN9 A;  2C67 A;  4ZCC A;  4AOX A;  2YLR A;  1ZDL A;  5KVH A;  2V61 A;  4PAB A;  2TMD A;  3UTG A;  1DOE A;  5BVA A;  3BI5 A;  2WES A;  5KRQ A;  4U8M A;  2CUL A;  4YSX A;  3VRA A;  2BA9 A;  4OVI A;  3RNM A;  3NT6 A;  3DJD A;  2XYO A;  2GH5 A;  4H4Q A;  4B1B A;  3LZX A;  4C3Y A;  1QLB A;  4JNA A;  2J3N A;  4H4P A;  5CQF A;  1B5Q A;  2XLU A;  3P4Q A;  1LQT A;  4JNQ A;  1DNC A;  4BK2 A;  4C5O A;  1RYI A;  4NZH A;  3QFA A;  1GND A;  2XLP A;  3GMC A;  2Q0L A;  2YG3 A;  3AE2 A;  2C3D A;  1PN0 A;  2DKH A;  1GRF A;  3AE4 A;  2C64 A;  2JB2 A;  3K7T A;  4YT0 A;  4AT2 A;  1ZY8 A;  4NEV A;  2QCU A;  3RP8 A;  2ZZ0 A;  2YLT A;  4E0V A;  1VQW A;  4FK1 C;  3QSM A;  4B68 A;  2XFP A;  2GR0 A;  4HA6 A;  4XWR A;  3NK2 X;  1CJ4 A;  4XXG A;  3GWD A;  4BV6 A;  2GMH A;  2XLT A;  3ICT A;  4U2L A;  2R0C A;  3UOX A;  2C70 A;  1VG9 A;  2GR1 A;  3IWA A;  1NG3 A;  3K7M X;  4NTE A;  1MO9 A;  3UOZ A;  2R9Z A;  1K0I A;  4P9S A;  1CC6 A;  2X3N A;  3KKJ A;  4K2X A;  2QAE A;  4J36 A;  2VRL A;  1CHU A;  2R0P A;  1COY A;  4LA1 A;  2RGO A;  3P4R A;  3S61 A;  4AP1 A;  4Z26 A;  2YVJ A;  3NLC A;  2ARD A;  2IVE A;  3IF9 A;  1HYU A;  2Q0K A;  2UZZ A;  2YWL A;  1H83 A;  4U8K A;  3NN6 X;  3NRN A;  4CNJ A;  2WU2 A;  3AD7 B;  2F5Z A;  1TYP A;  1N1P A;  4JDR A;  2I0Z A;  2XCG A;  3I6D A;  3AE8 A;  1PBF A;  2YR6 A;  1E1K A;  1TDE A;  2YVF A;  1IUT A;  2PYX A;  2VRM A;  1H81 A;  3I3L A;  3CGC A;  2E1M A;  1CJ3 A;  3CND A;  3NKS A;  1PBB A;  3PS9 A;  4X9N A;  4OPD A;  3AEC A;  3DGH A;  5JCN A;  1DOC A;  2GV8 A;  3CPI G;  5M10 A;  1N4V A;  3QSS A;  4CNK A;  4EQS A;  2V60 A;  2TPR A;  1GRB A;  1S2Q A;  4J2W A;  2GQW A;  3ITJ A;  3GD4 A;  3CPH G;  4TM0 A;  5KXJ A;  1K4Q A;  4IV9 A;  3K7Q X;  3K30 A;  2GEW A;  3GWF A;  1ZKQ A;  2RGJ A;  3UKK A;  1H86 A;  3EAN A;  5IQ4 A;  3AE9 A;  4GUV A;  4EM3 A;  1CL0 A;  2A8X A;  1CJC A;  3COX A;  4A5L A;  3AE3 A;  3AEF A;  3DA1 A;  4A6N B;  2E5V A;  3V76 A;  5TR3 A;  2C75 A;  4YKF A;  3FG2 P;  2OLN A;  4GDP A;  1VRQ B;  3SQP A;  2BC0 A;  3CIR A;  4PAA A;  1D4C A;  3P1W A;  4H4W A;  1Q9I A;  2ZZC A;  3ABV A;  3II4 A;  3CNS A;  2BK3 A;  2PHH A;  5LV9 A;  1IUS A;  3IHG A;  1D7L A;  1IUU A;  4ECH A;  1EBD A;  5FS9 A;  1L9E A;  1BWC A;  1GAL A;  5GRT A;  1RSG A;  4LII A;  2AAQ A;  3DGZ A;  1TDF A;  2YM2 A;  3ALJ A;  3LJP A;  1CBO A;  1Y56 A;  2WET A;  4YSZ A;  2WPF A;  2ZBW A;  4UDQ A;  2Z5Y A;  1PBC A;  3VR8 A;  2XLS A;  3SGL A;  3B6D A;  4OPI A;  4K22 A;  1KF6 A;  2WDR A;  3KA7 A;  3PVC A;  3GYJ A;  4Z2U A;  2BS2 A;  2BS3 A;  3UOV A;  2ACZ A;  1PJ5 A;  4NTC A;  4TM3 A;  2XVF A;  4A65 A;  3KD9 A;  3CGD A;  2X8G A;  3DK9 A;  4TLZ A;  4EM4 A;  2C76 A;  3VRD B;  2Y6Q A;  1PBD A;  1H7X A;  1SEZ A;  3F8R A;  1PS9 A;  1ZOY A;  3L1R A;  1GRG A;  1CJ2 A;  3DJJ A;  2XFN A;  2YM1 A;  4U8J A;  4DSH A;  5FS8 A;  1F8R A;  1GRA A;  1GET A;  2Q7V A;  3FMW A;  4OPU A;  1GEU A;  1NDA A;  4Z44 A;  3RED A;  3OZ2 A;  4TM4 A;  2NPX A;  4K7Z A;  2BK5 A;  4U8L A;  4H4Z A;  4H50 A;  1L9C A;  4DGK A;  4EQR A;  5JCM A;  2H89 A;  2X50 A;  4H2Q A;  4ZN0 A;  5IPY A;  2C65 A;  3QVP A;  2GQF A;  2CDU A;  4H4R A;  4UDP A;  1GOS A;  1FOH A;  1ZMD A;  3LXD A;  3GDP A;  2WBA A;  3DME A;  4OCG A;  4O5U A;  4J57 A;  3P9U A;  4WX1 A;  2YG6 A;  3AYL A;  2WEU A;  3QSE A;  5KWF A;  3NK1 X;  1BF3 A;  4EIP A;  1O5W A;  2RAB A;  2X99 A;  1GRE A;  1GT8 A;  3UKH A;  1F6M A;  2H88 A;  2JB3 A;  2XFO A;  4FK1 A;  4NTD A;  1DOB A;  4YKG A;  4OPG A;  2BCP A;  2FJA A;  1VG0 A;  4JQ9 A;  3ALL A;  2WP9 A;  1JNR A;  1H7W A;  3AEE A;  3KVE A;  3ADA B;  1Z6L A;  4UDR A;  1N4W A;  2YG7 A;  5C2T A;  2RGH A;  4CY6 A;  3UKA A;  4U2T A;  1ZP0 A;  1BKW A;  3ZDN A;  2WP5 A;  1D4D A;  2IID A;  3P4P A;  1PXA A;  2R0G A;  1P2E A;  2B7R A;  3DJE A;  3UP4 A;  3GSI A;  3H8I A;  4OPC A;  1KDG A;  1GTE A;  3E1T A;  3NIX A;  3DK8 A;  3VQR A;  1KFY A;  1Y0P A;  3UTH A;  2BAC A;  1S3B A;  2C72 A;  5ER0 A;  1IUV A;  3AWI A;  1EL8 A;  5U63 A;  3KPF A;  1Q1R A;  2X8H A;  4IA5 A;  4H4Y A;  2WDV A;  4B65 A;  4CCQ A;  5BUL A;  3G5Q A;  4Y4L A;  4YTN A;  4REK A;  3AYJ A;  2EQ8 A;  3OC4 A;  2GVC A;  2GF3 A;  2OAM A;  1NHP A;  1DJN A;  2XVE A;  3CGB A;  3UKF A;  3BI2 A;  3C96 A;  1TDO A;  2YLZ A;  4GRT A;  1F8W A;  2FJD A;  2EQ6 A;  4B66 A;  1ONF A;  2XVI A;  2V3B A;  1NAA A;  1LPF A;  4RSL A;  2XVH A;  1OJC A;  3GRS A;  4FDC B;  1CC4 A;  1EL9 A;  2VQB A;  2WOW A;  2YR5 A;  3AE5 A;  3GYI A;  4D03 A;  1NG4 A;  1PDH A;  1JOA A;  5KVI A;  1D5T A;  1VDC A;  3BHK A;  4BJY A;  4YTP A;  2XLR A;  2JAE A;  4Y4N A;  5J60 A;  3BHF A;  3C4N A;  1BGN A;  2APG A;  2R4E A;  1YQ4 A;  4U8N A;  1JRX A;  4OPT A;  4ADW A;  1OJT A;  3DJG X;  4BUR A;  1GER A;  2Y6R A;  3EPT A;  1TDN A;  4YXD A;  1E1L A;  2VOU A;  1PJ7 A;  2AQJ A;  1TYT A;  3ICR A;  5HYM A;  1ZK7 A;  4U2S A;  1REO A;  1JRY A;  4Z2T A;  3C4A A;  4Y4M A;  1LJ1 A;  5J7X A;  3V3N A;  3WE0 A;  4CRT A;  1N4U A;  1NEK A;  2BC1 A;  2WOV A;  3AE1 A;  3FPZ A;  1PBE A;  4GCM A;  4EQX A;  2OAL A;  3F8P A;  1NHR A;  2WOI A;  1L0V A;  2YG5 A;  4A7A A;  4BJZ A;  3NTD A;  3EF6 A;  5C3J A;  3O0H A;  1CC2 A;  1TRB A;  2YR4 A;  4J56 A;  4C74 A;  3AEG A;  4D04 A;  2W0H A;  1B37 A;  2B9X A;  2C3C A;  1JNZ A;  2OLO A;  3ALM A;  5KOX A;  1O95 A;  2A89 A;  3HZL A;  2C66 A;  3QFB A;  3NTA A;  4AT0 A;  1BZL A;  5EB4 A;  2C73 A;  1MOK A;  4H4U A;  3VR9 A;  1GSN A;  1K0J A;  1MXT A;  2BK4 A;  2WS3 A;  2BXS A;  5GSN A;  4EMJ A;  4K5R A;  4A6N A;  1GPE A;  4JY3 A;  4H2R A;  3EAO A;  1GES A;  2VVL G;  3AE7 A;  3M12 A;  3UKQ A;  3IC9 A;  4C3X A;  3LOV A;  5FS6 A;  3S5W A;  1YQZ A;  2YAU A;  2GR3 A;  3IHM A;  2GB0 A;  1KSS A;  1NHQ A;  1YKJ A;  4ZCD A;  5KOW A;  4TM1 A;  1GTH A;  3NHO X;  1ZX9 A;  5BRT A;  1LV0 A;  2JK6 A;  5BUK A;  3URH A;  4C77 A;  4H4X A;  4KX6 A;  4KPR A;  1PXC A;  1S3E A;  1P2H A;  2O9Z A;  4B69 A;  1GV4 A;  1F3P A;  1ZOV A;  2C7G A;  2B76 A;  2GAG B;  3V3O A;  1LVL A;  4RG4 A;  3AEB A;  3LZW A;  3GRT A;  4B64 A;  3CNT A;  3D8X A;  2WQY A;  1M6I A;  1RP0 A;  5U1O A;  1FEA A;  3CNP A;  5M0Z A;  2YLW A;  4EIQ A;  5JCI A;  3NK0 X;  4MJW A;  1M64 A;  3SFD A;  3UTE A;  2CFY A;  3UKP A;  2QA1 A;  2BXR A;  2EQ7 A;  1OJ9 A;  4H7U A;  1E1M A;  3AEA A;  1KNR A;  3R9U A;  2JBV A;  2IVD A;  3BNU A;  4GF7 A;  4H2N A;  4O5Q A;  4YSH A;  1QO8 A;  1GRT A;  2WPE A;  5JCL A;  1LTX R;  3GDN A;  2E4G A;  4DNA A;  4IVO B;  4IVM B;  1D7Y A;  4A79 A;  1BGJ A;  4HB9 A;  4J34 A;  4USR A;  3UKL A;  1JU2 A;  1OJD A;  4EMI A;  2DKI A;  2OA1 A;  3CN8 A;  3NH3 X;  4X4J A;  2B7S A;  5EOW A;  3AD8 B;  1O94 A;  2Q6U A;  3H8L A;  3ATR A;  1NEN A;  4CY8 A;  4N9X A;  1IJH A;  1B8S A;  4OPL A;  3B3R A;  1H84 A;  4M52 A;  5EBK A;  1B4V A;  2V3A A;  2V5Z A;  3FIM B;  4A99 A;  4I58 A;  3CPJ G;  2XFU A;  1PXB A;  2FJB A;  3L8K A;  3Q6J A;  1F8S A;  3CNJ A;  2ZZB A;  3G5R A;  1TDK A;  2R45 A;  1D4E A;  1E1N A;  1QJD A;  4JY2 A;  3SM8 A;  3DH9 A;  4H4V A;  1S2Y A;  3F8D A;  2BCG G;  4K5S A;  4BK1 A;  3UCL A;  2EQ9 A;  1DXL A;  1H6V A;  4IA6 A;  2VVL A;  1NPX A;  3Q9T A;  4Z24 A;  3D1C A;  1PHH A;  3M13 A;  5FS7 A;  4B63 A;  3NYE A;  2YVG A;  1IUX A;  2GRT A;  3QVR A;  4ICY A;  3KU9 A;  1UKV G;  4AP3 A;  2GAH B;  4YSY A;  2AR8 A;  5DBJ A;  3FBS A;  2WP6 A;  1KSU A;  4J33 A;  1NHS A;  1H82 A;  2FJE A;  1V59 A;  3BNM A;  3PO7 A;  1IUW A;  1E39 A;  4UP3 A;  4TLX A;  5FMH A;  1L9D A;  3NG7 X;  2BAB A;  2Z5X A;  4H4T A;  4U8P A;  1JRZ A;  3RP7 A;  3CTY A;  4EMW A;  1XPQ A;  4K8D A;  2CVJ A;  2XVJ A;  4DSG A;  1PJ6 A;  1OJA A;  3NYC A;  3SFE A;  2YLX A;  1DJQ A;  2B9W A;  1K0L A;  4J31 A;  1XDI A;  2GMJ A;  1GRH A;  2WDQ A;  3GMB A;  3AB1 A;  1FL2 A;  3NGC X;  4Z43 A;  1E6E A;  1XAN A;  3VRB A;  2JB1 A;  1FCD A;  4APN A;  2BYB A;  4H2P A;  4I59 A;  3UOY A;  5CKU A;  3AD9 B;  5HY5 A;  3ZYX A;  2JKC A;  3AXB A;  3NYF A;  4GR1 A;  3LAD A;  1X31 B;  2XFQ A;  3KLJ A;  1Q1W A;  4LU6 A; 
#chains in the Genus database with same CATH topology
 3SJN A;  5JCK A;  4CBQ A;  3DG7 A;  1Y56 B;  1YY5 A;  2WPC A;  3AYI A;  2WHD A;  2B9Y A;  3I6E A;  1FEB A;  1YQ3 A;  3R07 C;  2NVK X;  4GGH A;  4H1Z A;  1LQU A;  2FBW A;  1JDF A;  2V6O A;  3T37 A;  3RR1 A;  1ELI A;  3DDM A;  4YWO A;  4WCT A;  2HQM A;  3NNE A;  4EQW A;  2GR2 A;  2X8C A;  3RGT A;  5EB5 A;  4F4R A;  3NVZ B;  1GXF A;  2PGE A;  1KCZ A;  4ZCC A;  4AOX A;  1ZDL A;  2TMD A;  3BI5 A;  3UJE A;  4U8M A;  4H4Q A;  2J3N A;  3OZY A;  1B5Q A;  3P4Q A;  4BK2 A;  3UXK A;  3S47 A;  3QFA A;  2XH4 A;  3GMC A;  3AE2 A;  2DKH A;  1GRF A;  2C64 A;  2ZZ0 A;  2YLT A;  4E0V A;  3QSM A;  2QVH A;  4HA6 A;  4XWR A;  2OVL A;  3TTE A;  2POZ A;  3GWD A;  3NVV B;  3ICT A;  2GR1 A;  3MSY A;  3UOZ A;  3EEZ A;  1W6T A;  4P9S A;  2MUC A;  4J36 A;  4LA1 A;  2RGO A;  2ARD A;  3IF9 A;  3NRN A;  3AM9 A;  4IP5 A;  1X2H A;  3KUM A;  3TQP A;  3DG3 A;  2YR6 A;  1TDE A;  2PYX A;  1H81 A;  4X9N A;  1TE6 A;  3CPI G;  4CNK A;  4J2W A;  4IL2 A;  4GAV A;  7ENL A;  3T4W A;  1WYG A;  3GD4 A;  5KXJ A;  4IV9 A;  3K7Q X;  2GEW A;  4NNJ A;  1ZKQ A;  2QDD A;  4HPN A;  4X2P A;  5IQ4 A;  4GFI A;  1CJC A;  4G74 A;  4A6N B;  2GGH A;  4YKF A;  3FG2 P;  3SQP A;  1Q9I A;  4IT1 A;  3II4 A;  3IJQ A;  2BK3 A;  5LV9 A;  1IUU A;  5FS9 A;  4G7F A;  4LII A;  3H70 A;  1TDF A;  1Y56 A;  2XLS A;  3B6D A;  4OPI A;  1KF6 A;  3ENL A;  3KA7 A;  3PVC A;  2ACZ A;  1PJ5 A;  4NTC A;  3MQT A;  3VRD B;  1PBD A;  1H7X A;  1SEZ A;  2P8B A;  3DJJ A;  4DSH A;  1TZZ A;  2P88 A;  1F8R A;  1GRA A;  1FHV A;  3OZ2 A;  2NPX A;  1EC9 A;  2BK5 A;  2BRY A;  4H4Z A;  4H50 A;  3NFU A;  4EQR A;  5JCM A;  3QVP A;  1RVK A;  1ZMD A;  4KPL A;  3DME A;  1N61 C;  4GAP A;  2RAB A;  1DOB A;  4YKG A;  4E4U A;  3S5S A;  2FJA A;  3SZF A;  1H7W A;  5KMS A;  5C2T A;  4CY6 A;  2W55 A;  2WP5 A;  4A6G A;  1D4D A;  2IID A;  3P4P A;  3OTR A;  3CYJ A;  3H8I A;  2PMQ A;  1GTE A;  3VQR A;  3DK8 A;  3UTH A;  4FI4 A;  2C72 A;  1EL8 A;  1Q1R A;  4E5T A;  3G5Q A;  3OC4 A;  2GF3 A;  3UKF A;  1XS2 A;  3UGV A;  3C96 A;  1TDO A;  4H2H A;  1F8W A;  3UJF A;  2FJD A;  5J04 A;  4B66 A;  1ONF A;  2XVI A;  3ZVH B;  5FJP A;  3GRS A;  1EL9 A;  2VQB A;  3GYI A;  4D03 A;  1PDH A;  5KVI A;  1D5T A;  4Y4N A;  4G73 A;  2XSX A;  1JRX A;  4OPT A;  4ROP A;  4HCH A;  2AQJ A;  4U2S A;  2W3S A;  1LJ1 A;  3V3N A;  4CRT A;  1NEK A;  1L8P A;  4II3 A;  3FPZ A;  3P0W A;  1PBE A;  4GCM A;  4A7A A;  3TWB A;  3CXO A;  4D04 A;  1E9I A;  1B37 A;  2A89 A;  1BZL A;  3VR9 A;  4GIR A;  4ENL A;  2BXS A;  4A6N A;  4JY3 A;  4H2R A;  3S5W A;  1YQZ A;  2GSH A;  2GB0 A;  5KOW A;  1GTH A;  1LV0 A;  2JK6 A;  4ZA0 A;  4H4X A;  1PXC A;  1ZOV A;  2B76 A;  3NXL A;  3LZW A;  4B64 A;  1JPD X;  3ZLH A;  4DXK A;  1X2G A;  4MJW A;  2PA6 A;  3UKP A;  2IVD A;  4H2N A;  2GGI A;  3SN0 A;  1EC7 A;  4IVO B;  4USR A;  3UKL A;  1OJD A;  2OA1 A;  3NH3 X;  5EOW A;  3V3W A;  1O94 A;  2Q6U A;  3H8L A;  4CY8 A;  4N9X A;  1IJH A;  4DN1 A;  2OQY A;  3CPJ G;  2ZZB A;  1TDK A;  1D4E A;  4JY2 A;  1PDZ A;  2DW7 A;  4GIS A;  3IJL A;  4K5S A;  1SJB A;  1H6V A;  3IK4 A;  3M13 A;  2YVG A;  2PPG A;  3KU9 A;  1UKV G;  4AP3 A;  2WP6 A;  4J33 A;  3DGB A;  3R25 A;  3CTY A;  4EMW A;  2CVJ A;  5KNL A;  1OJA A;  3NYC A;  1DJQ A;  4J31 A;  1XDI A;  4Z43 A;  1GRH A;  1FL2 A;  1KN0 A;  5G5H B;  2JB1 A;  4I59 A;  3SZW A;  3UOY A;  3AD9 B;  2JKC A;  4KT2 A;  3ZVH A;  2PTW A;  3N6H A;  3OW1 A;  3KLJ A;  1MRA A;  4U8I A;  4USQ A;  3RP6 A;  3ATQ A;  2GL5 A;  4YTM A;  1KNP A;  5JRB A;  2R46 A;  1IYX A;  2A87 A;  3UP5 A;  1ZMC A;  4U8O A;  3PWG A;  2PSN A;  2XDO A;  3NZG A;  3ISH A;  1FEC A;  3L5O A;  2PTY A;  4AOS A;  3GD3 A;  1W4X A;  4B67 A;  3M0O A;  1E7P A;  5HHF A;  3LB8 A;  4A9W A;  1JRO A;  1SJA A;  4CCR A;  5U25 A;  4X9M A;  4GDE A;  2C67 A;  2V61 A;  3UTG A;  4MMW A;  1N5X A;  2CUL A;  4YSX A;  3RNM A;  2OPJ A;  3DJD A;  3NT6 A;  3LZX A;  4C3Y A;  3R1Z A;  1LQT A;  3CB3 A;  1DNC A;  2YG3 A;  3K7T A;  1T3Q C;  2JB2 A;  4AT2 A;  4FK1 C;  2MNR A;  4GYP C;  4GYP A;  1N5W C;  1MUC A;  2R0C A;  2C70 A;  2RDX A;  3BOX A;  4K2X A;  2VRL A;  4E8G A;  3IJI A;  4Z26 A;  4AP1 A;  2Q0K A;  1H83 A;  4U8K A;  1STZ A;  3NN6 X;  5KMQ A;  4CNJ A;  4Z1Y A;  3AD7 B;  5G5G B;  2I0Z A;  4H83 A;  1IUT A;  3TJI A;  3I3L A;  1CJ3 A;  3NKS A;  4OPD A;  2GV8 A;  1N4V A;  3QSS A;  1S2Q A;  4DWD A;  1WUE A;  2PCE A;  4GUV A;  4EM3 A;  1CL0 A;  4A5L A;  3DA1 A;  1PDY A;  2E5V A;  2OKT A;  3V76 A;  3SZ0 A;  1VRQ B;  3CIR A;  3A7A A;  1EC8 A;  2ZZC A;  4FP1 A;  2E5A A;  1D7L A;  3GC2 A;  4ECH A;  1GAL A;  2YM2 A;  2WET A;  4YSZ A;  3BJS A;  2Z5Y A;  3SGL A;  2OZT A;  3MUC A;  2WDR A;  3GYJ A;  2BS2 A;  3GYX A;  3T31 A;  3UOV A;  4A65 A;  2X8G A;  4TLZ A;  1VQZ A;  1PS9 A;  5FS8 A;  3FMW A;  3SYI A;  3ETR B;  2XH2 A;  3PWI A;  1KKO A;  2AKM A;  1JPM A;  2X50 A;  4ZN0 A;  2C65 A;  4J1O A;  3HYV A;  3QLD A;  1R6W A;  1FOH A;  3LXD A;  3GDP A;  2WBA A;  4OCG A;  4O5U A;  4J57 A;  3P9U A;  4WX1 A;  2WEU A;  1BF3 A;  1O5W A;  1GT8 A;  3UKH A;  1F6M A;  4OPG A;  4JQ9 A;  2WP9 A;  3DFY A;  1Z6L A;  2YG7 A;  3Q4D A;  3UKA A;  5ENL A;  4G8T A;  1PXA A;  3UJR A;  2R0G A;  3DJE A;  1Y0P A;  2BAC A;  1S3B A;  5ER0 A;  3AWI A;  4IA5 A;  4B65 A;  1NU5 A;  3AYJ A;  2PP1 A;  2OAM A;  2OZ8 A;  2YLZ A;  4GRT A;  3MZN A;  1FHU A;  3GD6 A;  1NAA A;  4RSL A;  2XVH A;  1ZXI C;  3AE5 A;  5J60 A;  4IP4 A;  2JAE A;  3C4N A;  3OP2 A;  2R4E A;  4U8N A;  1YQ4 A;  2AKZ A;  2Y6R A;  1VDV A;  3N4F A;  1REO A;  1JRY A;  3C4A A;  3WE0 A;  1N4U A;  3UXL A;  5FJT A;  2WOV A;  2YG5 A;  3NTD A;  2PU1 A;  1SJD A;  4J56 A;  2W0H A;  2OLO A;  2C3C A;  3ALM A;  5KOX A;  1O95 A;  3HZL A;  3DG6 A;  2C66 A;  1ELS A;  6ENL A;  5EB4 A;  2C73 A;  1MOK A;  2CHR A;  2PP0 A;  1K0J A;  2WS3 A;  4EMJ A;  4K5R A;  1GPE A;  1GES A;  2VVL G;  4C3X A;  4Z17 A;  5FS6 A;  2YAU A;  2GR3 A;  1KSS A;  1NHQ A;  4ZCD A;  3NHO X;  1ZX9 A;  4KPR A;  1S3E A;  1P2H A;  3N4E A;  2O9Z A;  2C7G A;  3V3O A;  4RG4 A;  3GRT A;  5U1O A;  1FEA A;  3CNP A;  5M0Z A;  4EIQ A;  3FV9 A;  3FJ4 A;  3SFD A;  2QA1 A;  2BXR A;  2JBV A;  1QO8 A;  5JCL A;  3PK7 A;  2BRA A;  4HB9 A;  4J34 A;  1MDL A;  3PFR A;  4EMI A;  2B7S A;  2QJN A;  3B9J B;  1NEN A;  1B4V A;  3SBF A;  3FIM B;  4I58 A;  2FJB A;  3DH9 A;  3F8D A;  1DXL A;  4GME A;  4B63 A;  3H7V A;  2PU0 A;  3NYE A;  2GRT A;  2GAH B;  4YSY A;  1KSU A;  1NHS A;  4MGG A;  1H82 A;  3BNM A;  1IUW A;  4UP3 A;  4JN7 A;  2BAB A;  4H4T A;  3RP7 A;  3R11 A;  1XPQ A;  2XVJ A;  1PJ6 A;  3SFE A;  2YLX A;  1EBG A;  2FKP A;  4APN A;  4H2P A;  3HRD C;  5CKU A;  5HY5 A;  1WUF A;  3NYF A;  2XFQ A;  1Q1W A;  3AED A;  3UTF A;  3ZVI A;  2VQ7 A;  2PTX A;  4H4S A;  3T9P A;  5L46 A;  3NN0 X;  2W3R A;  3JSK A;  4G6H A;  3DK4 A;  4NEW A;  3VFC A;  2YG4 A;  4Z2R A;  4IZG A;  1JEH A;  1DOD A;  3QJ4 A;  1AOG A;  4K1W A;  2R4J A;  1EL7 A;  2VVM A;  2HXT A;  2I5Q A;  3RHA A;  3ICS A;  4JN9 A;  1N63 C;  3VDG A;  5BVA A;  2QGY A;  2WES A;  5KRQ A;  3VRA A;  2BA9 A;  4OVI A;  4B1B A;  2PTZ A;  1QLB A;  3DFH A;  4H4P A;  5CQF A;  2OO6 A;  4JNQ A;  3VCN A;  1RYI A;  2HXU A;  4NZH A;  2XLP A;  2C3D A;  1PN0 A;  3AE4 A;  1JRP A;  4YT0 A;  2PS2 A;  4B68 A;  4DX3 A;  2GR0 A;  3MWC A;  4KWS A;  3NK2 X;  4XXG A;  3FVD A;  4BV6 A;  2XLT A;  3UOX A;  1VG9 A;  3IWA A;  1NG3 A;  3K7M X;  1MO9 A;  3P93 A;  3THU A;  2R9Z A;  1CC6 A;  3KKJ A;  3I4K A;  1XPY A;  3UJS A;  2QAE A;  1CHU A;  2R0P A;  1COY A;  1BKH A;  3P4R A;  3S61 A;  2UZZ A;  2YWL A;  3K1G A;  2F5Z A;  1TYP A;  1N1P A;  3V5F A;  2XCG A;  2P0I A;  3AE8 A;  1PBF A;  1E1K A;  2YVF A;  5FJO A;  3PS9 A;  1P43 A;  3GO2 A;  5JCN A;  1DOC A;  5M10 A;  4EQS A;  3A7U A;  3FYY A;  3ITJ A;  3KPK A;  3CAW A;  3CPH G;  3NVW B;  1K4Q A;  1NEL A;  2RGJ A;  1H86 A;  3AE9 A;  4ZOH B;  2HNE A;  3COX A;  3AE3 A;  2QJM A;  2C75 A;  2OLN A;  1DTN A;  4H4W A;  3ABV A;  1ONE A;  3CNS A;  3T2Z A;  2PHH A;  3JW7 A;  2ZAD A;  3RIT A;  1IUS A;  3IHG A;  1BWC A;  3ALJ A;  3LJP A;  2ZBW A;  3VR8 A;  4K22 A;  4K8G A;  3TWA A;  2ONE A;  3KD9 A;  3CGD A;  3DK9 A;  3JZU A;  4EM4 A;  2C76 A;  3F8R A;  1ZOY A;  1GRG A;  1CJ2 A;  2XFN A;  4U8J A;  2AL2 B;  3RED A;  4Z44 A;  1GEU A;  4TM4 A;  4K7Z A;  1L9C A;  2GQF A;  1OEP A;  4UDP A;  1GOS A;  2OX4 A;  2YG6 A;  3QSE A;  2OLA A;  5KWF A;  3NS1 B;  3CT2 A;  3NK1 X;  3VCC A;  2XFO A;  4FK1 A;  4NTD A;  2XH0 A;  2BCP A;  1VG0 A;  4A3R A;  3ALL A;  1JNR A;  1MNS A;  4UDR A;  2RGH A;  3SZC A;  1S7M A;  2ZC8 A;  4OPC A;  2PGW A;  1KDG A;  3RRA A;  1IUV A;  5U63 A;  3KPF A;  4H4Y A;  4CCQ A;  4G9K A;  4Y4L A;  4REK A;  2EQ8 A;  3NRZ B;  3T6C A;  1DJN A;  3CGB A;  3FCP A;  3DIP A;  2EQ6 A;  2V3B A;  1LPF A;  4FDC B;  3R0U A;  1CC4 A;  3BHK A;  1VDC A;  4BJY A;  1BGN A;  3QN3 A;  3SX6 A;  1OJT A;  3DJG X;  4BUR A;  1GER A;  3EPT A;  1TDN A;  2OFJ A;  4YXD A;  1E1L A;  3P3B A;  1PJ7 A;  3ICR A;  1ZK7 A;  4Z2T A;  4Y4M A;  5KMP A;  5J7X A;  3R10 A;  3F8P A;  3CMM A;  4BJZ A;  5C3J A;  1TRB A;  4C74 A;  3T14 A;  1JNZ A;  4AT0 A;  5GSN A;  3EAO A;  5BOE A;  3M12 A;  3RCY A;  1FFV C;  4M0X A;  2OZ3 A;  1YKJ A;  3H8A A;  3U9I A;  4C77 A;  3UJ2 A;  4KX6 A;  4HN8 A;  1F3P A;  2QQ6 A;  3BSM A;  1LVL A;  3V4B A;  3AEB A;  3CNT A;  3D8X A;  2WQY A;  3DER A;  3UCC A;  1KD0 A;  2YLW A;  5JCI A;  3NK0 X;  3UTE A;  2CFY A;  1OJ9 A;  4ZCW A;  4H7U A;  3D46 A;  3AEA A;  3R9U A;  4GF7 A;  4YSH A;  2WPE A;  3GDN A;  1LTX R;  4YWS A;  1JU2 A;  3CN8 A;  2AL2 A;  3AD8 B;  3DES A;  3ATR A;  1B8S A;  3DEQ A;  1H84 A;  3B3R A;  5EBK A;  2V3A A;  5BOF A;  2V5Z A;  2HZG A;  3U4F A;  3L8K A;  2R45 A;  3SM8 A;  1E1N A;  1QJD A;  4H4V A;  2FYM A;  3TW9 A;  3UCL A;  3NO1 A;  2EQ9 A;  4IA6 A;  2VVL A;  4Z24 A;  3D9X A;  1PHH A;  5FS7 A;  1IUX A;  4ICY A;  2FJE A;  3PO7 A;  1E39 A;  3QTP A;  4TLX A;  4IHC A;  4G6G A;  3NG7 X;  2Z5X A;  4U8P A;  1KKR A;  1JRZ A;  3T2K A;  4K8D A;  3B97 A;  3RO6 A;  3R0K A;  2B9W A;  3GMB A;  1H2I A;  3NGC X;  3AB1 A;  1F9C A;  2OG9 A;  1E6E A;  1XAN A;  3VRB A;  1FCD A;  3ZLG A;  4IL0 A;  3HYW A;  3AXB A;  4GR1 A;  2GGG A;  3SR6 B;  2P3Z A;  4K2S A;  4LU6 A;  3MY9 A;  1EL5 A;  4XWZ A;  1BQG A;  2P8C A;  3G5S A;  2WU5 A;  4GGB A;  4TVY A;  1CF3 A;  3P4S A;  2QA2 A;  4RG3 A;  5IQ1 A;  3AE6 A;  2YLS A;  2E3T A;  2BS4 A;  3HPF A;  3BI4 A;  3CGE A;  5HXI A;  1XHC A;  3SY4 A;  3STP A;  2VZ2 A;  2O56 A;  3ES7 A;  4Z25 A;  1P48 A;  3H4K A;  3H12 A;  4EWJ A;  4FX9 A;  2YQU A;  3MKC A;  4BK3 A;  3T0K A;  4HCL A;  2YLR A;  4PAB A;  5KVH A;  4HNL A;  1DOE A;  3NVY B;  2XYO A;  2GH5 A;  5EU9 A;  4JNA A;  2XLU A;  4C5O A;  3UCD A;  1GND A;  2Q0L A;  1ZY8 A;  4NEV A;  2QCU A;  3RP8 A;  1VQW A;  2XFP A;  1CJ4 A;  3EUB 3;  3ES8 A;  2GMH A;  2W54 A;  4U2L A;  4NTE A;  1K0I A;  3FXG A;  2X3N A;  3AN1 A;  3N6J A;  2YVJ A;  3NLC A;  2IVE A;  1HYU A;  3SN1 A;  2WU2 A;  4JDR A;  3AMZ A;  3I6D A;  2VRM A;  3CGC A;  2E1M A;  3CND A;  1PBB A;  1SB3 B;  3AEC A;  3DGH A;  2V60 A;  2TPR A;  1GRB A;  3Q45 A;  1MDR A;  4KEM A;  2GQW A;  4TM0 A;  3K30 A;  3GWF A;  3UKK A;  4HNC A;  3EAN A;  3A7R A;  3JVA A;  4A35 A;  2A8X A;  3AEF A;  4TVW A;  2GGJ A;  3HW2 A;  5TR3 A;  3VA8 A;  3T2Y A;  4GDP A;  4PAA A;  2BC0 A;  1D4C A;  3P1W A;  4MKS A;  3ZLF A;  1EBD A;  4E6M A;  1L9E A;  5GRT A;  1RSG A;  4DHG A;  2AAQ A;  3DGZ A;  4HYR A;  1CBO A;  2WPF A;  4UDQ A;  1PBC A;  2OQH A;  2XGZ A;  3TOY A;  4Z2U A;  4HCD A;  2BS3 A;  4TM3 A;  2XVF A;  4JN8 A;  2Y6Q A;  3L1R A;  2YM1 A;  2C4C A;  1GET A;  2Q7V A;  4OPU A;  1NDA A;  3VC5 A;  4U8L A;  3TJ4 A;  4DGK A;  2H89 A;  4H2Q A;  5IPY A;  2CDU A;  4H4R A;  3AYL A;  4EIP A;  2X99 A;  1GRE A;  5IDZ A;  2H88 A;  2JB3 A;  3VC6 A;  1V97 A;  3AEE A;  3KVE A;  3ADA B;  1N4W A;  2AL1 A;  4U2T A;  1ZP0 A;  1BKW A;  1RM6 B;  3SQS A;  3ZDN A;  1P2E A;  2B7R A;  3UP4 A;  3GSI A;  3SN4 A;  3E1T A;  3NIX A;  1KFY A;  2X8H A;  5BUL A;  2WDV A;  4YTN A;  5KMR A;  2GVC A;  3I6T A;  1NHP A;  3TCS A;  2XVE A;  3BI2 A;  1N60 C;  1FFU C;  1OJC A;  2YR5 A;  2WOW A;  1NG4 A;  4YTP A;  1JOA A;  2XLR A;  3BHF A;  2APG A;  3HYX A;  4ADW A;  4E4F A;  2VOU A;  1TYT A;  1EBH A;  5HYM A;  3SSZ A;  2BC1 A;  3AE1 A;  2QJJ A;  1L0V A;  4EQX A;  2OAL A;  1NHR A;  2WOI A;  4J3Z A;  3EF6 A;  3O0H A;  1CC2 A;  2YR4 A;  4H19 A;  3AEG A;  2XH7 A;  2B9X A;  1FO4 A;  1TKK A;  3OPS A;  3QFB A;  3NTA A;  4H4U A;  3T8Q A;  1GSN A;  1MXT A;  2BK4 A;  3AE7 A;  3UKQ A;  3IC9 A;  3LOV A;  1FIQ B;  4M6U A;  3IHM A;  3QPE A;  4TM1 A;  5BRT A;  5BUK A;  3URH A;  1N62 C;  4B69 A;  1GV4 A;  2GAG B;  3GY1 A;  2NQL A;  1M6I A;  2GDQ A;  1RP0 A;  1M64 A;  1YEY A;  2EQ7 A;  1E1M A;  1KNR A;  3BNU A;  4O5Q A;  1GRT A;  4IVM B;  2E4G A;  4DNA A;  4A79 A;  1D7Y A;  5FJR A;  1BGJ A;  2DKI A;  3EKG A;  4X4J A;  4DYE A;  4II2 A;  3SXI A;  1SJC A;  4OPL A;  4M52 A;  2POD A;  4A99 A;  2XFU A;  1PXB A;  3CNJ A;  3Q6J A;  1F8S A;  3G5R A;  3QKE A;  1S2Y A;  3V5C A;  2BCG G;  4BK1 A;  3PG6 A;  3OZM A;  4NWZ A;  1NPX A;  3Q9T A;  3D1C A;  1R0M A;  1ECQ A;  5FJU A;  3CK5 A;  3QVR A;  2AR8 A;  5DBJ A;  3FBS A;  2GGE A;  1V59 A;  2DW6 A;  5FMH A;  1L9D A;  3D47 A;  2QDE A;  4DSG A;  1K0L A;  4JHM A;  2GMJ A;  2WDQ A;  2BYB A;  1JCT A;  3CXB A;  2PP3 A;  3ZYX A;  3LAD A;  1X31 B; 
#chains in the Genus database with same CATH homology
 5JCK A;  3AED A;  3UTF A;  1EL5 A;  1Y56 B;  4CBQ A;  2VQ7 A;  1YY5 A;  4XWZ A;  2WPC A;  4U8I A;  3AYI A;  3G5S A;  2WU5 A;  4USQ A;  1CF3 A;  3RP6 A;  4H4S A;  3ATQ A;  3P4S A;  2QA2 A;  2WHD A;  4YTM A;  4RG3 A;  2B9Y A;  1KNP A;  5L46 A;  1FEB A;  1YQ3 A;  3NN0 X;  5JRB A;  5IQ1 A;  2R46 A;  2NVK X;  3JSK A;  2A87 A;  2YLS A;  1ZMC A;  3AE6 A;  3UP5 A;  4G6H A;  2BS4 A;  1LQU A;  4U8O A;  3DK4 A;  2FBW A;  4NEW A;  2V6O A;  3BI4 A;  3T37 A;  1ELI A;  2YG4 A;  2XDO A;  3CGE A;  3ISH A;  4Z2R A;  4YWO A;  4WCT A;  1JEH A;  1FEC A;  2HQM A;  3L5O A;  1DOD A;  5HXI A;  3QJ4 A;  1XHC A;  3SY4 A;  3GD3 A;  4AOS A;  1AOG A;  1W4X A;  4B67 A;  2VZ2 A;  3M0O A;  1E7P A;  2R4J A;  1EL7 A;  3NNE A;  2VVM A;  5HHF A;  4EQW A;  3LB8 A;  2GR2 A;  4A9W A;  4Z25 A;  2X8C A;  3H4K A;  4CCR A;  5EB5 A;  3RHA A;  4FX9 A;  2YQU A;  5U25 A;  4BK3 A;  4X9M A;  3T0K A;  3ICS A;  1GXF A;  4GDE A;  4JN9 A;  2C67 A;  4ZCC A;  4AOX A;  2YLR A;  1ZDL A;  5KVH A;  2V61 A;  4PAB A;  2TMD A;  3UTG A;  1DOE A;  5BVA A;  3BI5 A;  2WES A;  5KRQ A;  4U8M A;  2CUL A;  4YSX A;  3VRA A;  2BA9 A;  4OVI A;  3RNM A;  3NT6 A;  3DJD A;  2XYO A;  2GH5 A;  4H4Q A;  4B1B A;  3LZX A;  4C3Y A;  1QLB A;  4JNA A;  2J3N A;  4H4P A;  5CQF A;  1B5Q A;  2XLU A;  3P4Q A;  1LQT A;  4JNQ A;  1DNC A;  4BK2 A;  4C5O A;  1RYI A;  4NZH A;  3QFA A;  1GND A;  2XLP A;  3GMC A;  2Q0L A;  2YG3 A;  3AE2 A;  2C3D A;  1PN0 A;  2DKH A;  1GRF A;  3AE4 A;  2C64 A;  2JB2 A;  3K7T A;  4YT0 A;  4AT2 A;  1ZY8 A;  4NEV A;  2QCU A;  3RP8 A;  2ZZ0 A;  2YLT A;  4E0V A;  1VQW A;  4FK1 C;  3QSM A;  4B68 A;  2XFP A;  2GR0 A;  4HA6 A;  4XWR A;  3NK2 X;  1CJ4 A;  4XXG A;  3GWD A;  4BV6 A;  2GMH A;  2XLT A;  3ICT A;  4U2L A;  2R0C A;  3UOX A;  2C70 A;  1VG9 A;  2GR1 A;  3IWA A;  1NG3 A;  3K7M X;  4NTE A;  1MO9 A;  3UOZ A;  2R9Z A;  1K0I A;  4P9S A;  1CC6 A;  2X3N A;  3KKJ A;  4K2X A;  2QAE A;  4J36 A;  2VRL A;  1CHU A;  2R0P A;  1COY A;  4LA1 A;  2RGO A;  3P4R A;  3S61 A;  4AP1 A;  4Z26 A;  2YVJ A;  3NLC A;  2ARD A;  2IVE A;  3IF9 A;  1HYU A;  2Q0K A;  2UZZ A;  2YWL A;  1H83 A;  4U8K A;  3NN6 X;  3NRN A;  5KMQ A;  4CNJ A;  2WU2 A;  3AD7 B;  2F5Z A;  1TYP A;  4JDR A;  1N1P A;  2I0Z A;  2XCG A;  3I6D A;  3AE8 A;  1PBF A;  2YR6 A;  1E1K A;  1TDE A;  2YVF A;  1IUT A;  2PYX A;  2VRM A;  1H81 A;  3I3L A;  3CGC A;  2E1M A;  1CJ3 A;  3CND A;  3NKS A;  1PBB A;  3PS9 A;  4X9N A;  4OPD A;  3AEC A;  3DGH A;  5JCN A;  1DOC A;  2GV8 A;  3CPI G;  5M10 A;  1N4V A;  3QSS A;  4CNK A;  4EQS A;  2V60 A;  2TPR A;  1GRB A;  1S2Q A;  4J2W A;  2GQW A;  4GAV A;  3ITJ A;  3KPK A;  3GD4 A;  3CPH G;  4TM0 A;  5KXJ A;  1K4Q A;  4IV9 A;  3K7Q X;  3K30 A;  2GEW A;  3GWF A;  4NNJ A;  1ZKQ A;  2RGJ A;  3UKK A;  1H86 A;  3EAN A;  5IQ4 A;  3AE9 A;  4GUV A;  4EM3 A;  1CL0 A;  2A8X A;  1CJC A;  3COX A;  4A5L A;  3AE3 A;  4G74 A;  3AEF A;  3DA1 A;  4A6N B;  2E5V A;  3V76 A;  3SZ0 A;  5TR3 A;  3T2Y A;  2C75 A;  4YKF A;  3FG2 P;  2OLN A;  4GDP A;  1VRQ B;  3SQP A;  2BC0 A;  3CIR A;  4PAA A;  1D4C A;  3P1W A;  4H4W A;  1Q9I A;  2ZZC A;  3ABV A;  3II4 A;  3CNS A;  3T2Z A;  2BK3 A;  2PHH A;  5LV9 A;  1IUS A;  3IHG A;  1D7L A;  1IUU A;  4ECH A;  1EBD A;  5FS9 A;  1L9E A;  1BWC A;  1GAL A;  5GRT A;  1RSG A;  4LII A;  2AAQ A;  3DGZ A;  1TDF A;  2YM2 A;  3ALJ A;  3LJP A;  1CBO A;  1Y56 A;  2WET A;  4YSZ A;  2WPF A;  2ZBW A;  4UDQ A;  2Z5Y A;  1PBC A;  3VR8 A;  2XLS A;  3SGL A;  3B6D A;  4OPI A;  4K22 A;  1KF6 A;  2WDR A;  3KA7 A;  3PVC A;  3GYJ A;  4Z2U A;  2BS2 A;  3GYX A;  2BS3 A;  3T31 A;  3UOV A;  2ACZ A;  1PJ5 A;  4NTC A;  4TM3 A;  2XVF A;  4A65 A;  3KD9 A;  3CGD A;  2X8G A;  3DK9 A;  4TLZ A;  4EM4 A;  2C76 A;  3VRD B;  2Y6Q A;  1PBD A;  1H7X A;  1SEZ A;  3F8R A;  1PS9 A;  1ZOY A;  3L1R A;  1GRG A;  1CJ2 A;  3DJJ A;  2XFN A;  2YM1 A;  2C4C A;  4U8J A;  4DSH A;  5FS8 A;  1F8R A;  1GRA A;  1GET A;  2Q7V A;  3FMW A;  4OPU A;  1GEU A;  1NDA A;  4Z44 A;  3RED A;  3OZ2 A;  4TM4 A;  2NPX A;  4K7Z A;  2BK5 A;  2BRY A;  4U8L A;  4H4Z A;  4H50 A;  1L9C A;  3SYI A;  4DGK A;  4EQR A;  5JCM A;  2H89 A;  2X50 A;  4H2Q A;  4ZN0 A;  5IPY A;  2C65 A;  3QVP A;  2GQF A;  2CDU A;  3HYV A;  4H4R A;  4UDP A;  1GOS A;  1FOH A;  1ZMD A;  3LXD A;  3GDP A;  2WBA A;  3DME A;  4OCG A;  4O5U A;  4J57 A;  3P9U A;  4WX1 A;  2YG6 A;  3AYL A;  2WEU A;  3QSE A;  4GAP A;  5KWF A;  3NK1 X;  1BF3 A;  4EIP A;  1O5W A;  2RAB A;  2X99 A;  1GRE A;  1GT8 A;  3UKH A;  1F6M A;  2H88 A;  2JB3 A;  2XFO A;  4FK1 A;  4NTD A;  1DOB A;  4YKG A;  4OPG A;  2BCP A;  2FJA A;  3SZF A;  1VG0 A;  4JQ9 A;  3ALL A;  2WP9 A;  1JNR A;  1H7W A;  3AEE A;  3KVE A;  3ADA B;  1Z6L A;  4UDR A;  1N4W A;  5KMS A;  2YG7 A;  5C2T A;  2RGH A;  4CY6 A;  3UKA A;  4U2T A;  1ZP0 A;  1BKW A;  3ZDN A;  2WP5 A;  1D4D A;  2IID A;  3SZC A;  3P4P A;  1S7M A;  1PXA A;  2R0G A;  1P2E A;  2B7R A;  3DJE A;  3UP4 A;  3GSI A;  3H8I A;  4OPC A;  1KDG A;  1GTE A;  3E1T A;  3NIX A;  3DK8 A;  3VQR A;  1KFY A;  1Y0P A;  3UTH A;  2BAC A;  1S3B A;  2C72 A;  5ER0 A;  1IUV A;  3AWI A;  1EL8 A;  5U63 A;  3KPF A;  1Q1R A;  2X8H A;  4IA5 A;  4H4Y A;  2WDV A;  4B65 A;  4CCQ A;  5BUL A;  4G9K A;  3G5Q A;  4Y4L A;  4YTN A;  4REK A;  3AYJ A;  2EQ8 A;  3OC4 A;  5KMR A;  2GVC A;  2GF3 A;  2OAM A;  1NHP A;  1DJN A;  2XVE A;  3CGB A;  3UKF A;  3BI2 A;  3C96 A;  4Z43 A;  1TDO A;  2YLZ A;  4GRT A;  1F8W A;  2FJD A;  2EQ6 A;  4B66 A;  1ONF A;  2XVI A;  2V3B A;  1NAA A;  1LPF A;  4RSL A;  2XVH A;  1OJC A;  3GRS A;  4FDC B;  1CC4 A;  1EL9 A;  2VQB A;  2WOW A;  2YR5 A;  3AE5 A;  3GYI A;  4D03 A;  1NG4 A;  1PDH A;  1JOA A;  5KVI A;  1D5T A;  1VDC A;  3BHK A;  4BJY A;  4YTP A;  2XLR A;  2JAE A;  4Y4N A;  5J60 A;  4G73 A;  3BHF A;  3C4N A;  1BGN A;  2APG A;  2R4E A;  1YQ4 A;  4U8N A;  3HYX A;  1JRX A;  3SX6 A;  4OPT A;  4ADW A;  1OJT A;  3DJG X;  4BUR A;  1GER A;  2Y6R A;  3EPT A;  1TDN A;  4YXD A;  1E1L A;  2VOU A;  1PJ7 A;  2AQJ A;  1TYT A;  3ICR A;  5HYM A;  1ZK7 A;  4U2S A;  1REO A;  1JRY A;  4Z2T A;  3C4A A;  4Y4M A;  1LJ1 A;  5KMP A;  5J7X A;  3V3N A;  3WE0 A;  4CRT A;  1N4U A;  1NEK A;  2BC1 A;  4II3 A;  2WOV A;  3AE1 A;  3FPZ A;  1PBE A;  4GCM A;  4EQX A;  2OAL A;  3F8P A;  1NHR A;  2WOI A;  1L0V A;  2YG5 A;  4A7A A;  3CMM A;  4BJZ A;  3NTD A;  3EF6 A;  5C3J A;  3O0H A;  1CC2 A;  1TRB A;  2YR4 A;  4J56 A;  4C74 A;  3AEG A;  3T14 A;  4D04 A;  2W0H A;  1B37 A;  2B9X A;  2C3C A;  1JNZ A;  2OLO A;  3ALM A;  5KOX A;  1O95 A;  2A89 A;  3HZL A;  2C66 A;  3QFB A;  3NTA A;  4AT0 A;  1BZL A;  5EB4 A;  2C73 A;  1MOK A;  4H4U A;  3VR9 A;  1GSN A;  1K0J A;  1MXT A;  2BK4 A;  2WS3 A;  2BXS A;  5GSN A;  4EMJ A;  4K5R A;  4A6N A;  1GPE A;  4JY3 A;  4H2R A;  3EAO A;  1GES A;  2VVL G;  3AE7 A;  3M12 A;  3UKQ A;  3IC9 A;  4C3X A;  3LOV A;  5FS6 A;  3S5W A;  1YQZ A;  2YAU A;  2GR3 A;  3IHM A;  2GB0 A;  1KSS A;  1NHQ A;  1YKJ A;  4ZCD A;  5KOW A;  4TM1 A;  1GTH A;  3NHO X;  1ZX9 A;  5BRT A;  1LV0 A;  2JK6 A;  5BUK A;  3URH A;  4C77 A;  4H4X A;  4KX6 A;  4KPR A;  1PXC A;  1S3E A;  1P2H A;  2O9Z A;  4B69 A;  1GV4 A;  1F3P A;  1ZOV A;  2C7G A;  2B76 A;  2GAG B;  3V3O A;  1LVL A;  4RG4 A;  3AEB A;  3LZW A;  3GRT A;  4B64 A;  3CNT A;  3D8X A;  2WQY A;  1M6I A;  1RP0 A;  5U1O A;  1FEA A;  3CNP A;  5M0Z A;  2YLW A;  4EIQ A;  5JCI A;  3NK0 X;  4MJW A;  1M64 A;  3SFD A;  3UTE A;  2CFY A;  3UKP A;  2QA1 A;  2BXR A;  2EQ7 A;  1OJ9 A;  4H7U A;  1E1M A;  3AEA A;  1KNR A;  3R9U A;  2JBV A;  2IVD A;  3BNU A;  4GF7 A;  4H2N A;  4O5Q A;  4YSH A;  1QO8 A;  1GRT A;  2WPE A;  5JCL A;  1LTX R;  3GDN A;  2E4G A;  4DNA A;  4IVO B;  2BRA A;  1D7Y A;  4IVM B;  1BGJ A;  4HB9 A;  4J34 A;  4USR A;  3UKL A;  4A79 A;  1JU2 A;  1OJD A;  4EMI A;  2DKI A;  2OA1 A;  3CN8 A;  3NH3 X;  4X4J A;  2B7S A;  5EOW A;  3AD8 B;  1O94 A;  2Q6U A;  4II2 A;  3H8L A;  3ATR A;  1NEN A;  3SXI A;  4N9X A;  1IJH A;  1B8S A;  4CY8 A;  4OPL A;  3B3R A;  1H84 A;  4M52 A;  5EBK A;  2V3A A;  1B4V A;  2V5Z A;  3FIM B;  4A99 A;  4I58 A;  3CPJ G;  2XFU A;  1PXB A;  2FJB A;  3L8K A;  3Q6J A;  1F8S A;  3CNJ A;  2ZZB A;  3G5R A;  1TDK A;  2R45 A;  1D4E A;  1E1N A;  1QJD A;  4JY2 A;  3SM8 A;  3DH9 A;  4H4V A;  1S2Y A;  3F8D A;  2BCG G;  4K5S A;  4BK1 A;  3PG6 A;  3UCL A;  2EQ9 A;  1DXL A;  1H6V A;  4IA6 A;  2VVL A;  1NPX A;  4NWZ A;  3Q9T A;  4Z24 A;  3D9X A;  3D1C A;  1PHH A;  3M13 A;  5FS7 A;  4B63 A;  3NYE A;  2YVG A;  1IUX A;  2GRT A;  3QVR A;  4ICY A;  3KU9 A;  1UKV G;  4AP3 A;  2GAH B;  4YSY A;  2AR8 A;  5DBJ A;  3FBS A;  2WP6 A;  1KSU A;  4J33 A;  1NHS A;  1H82 A;  2FJE A;  1V59 A;  3BNM A;  3PO7 A;  1IUW A;  1E39 A;  4UP3 A;  4TLX A;  5FMH A;  1L9D A;  4G6G A;  3NG7 X;  2BAB A;  2Z5X A;  4H4T A;  4U8P A;  1JRZ A;  3RP7 A;  3T2K A;  3CTY A;  4EMW A;  1XPQ A;  4K8D A;  2CVJ A;  2XVJ A;  4DSG A;  1PJ6 A;  1OJA A;  3NYC A;  3SFE A;  2YLX A;  5KNL A;  1DJQ A;  2B9W A;  1K0L A;  4J31 A;  1H2I A;  1XDI A;  1GRH A;  2GMJ A;  2WDQ A;  3AB1 A;  1FL2 A;  3GMB A;  3NGC X;  1KN0 A;  1E6E A;  1XAN A;  3VRB A;  2JB1 A;  1FCD A;  4APN A;  2BYB A;  4H2P A;  4I59 A;  3SZW A;  3UOY A;  5CKU A;  3AD9 B;  5HY5 A;  3ZYX A;  2JKC A;  3HYW A;  3AXB A;  3NYF A;  4GR1 A;  3LAD A;  1X31 B;  2XFQ A;  3KLJ A;  1Q1W A;  4LU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...