3GD3A

Crystal structure of a naturally folded murine apoptosis inducing factor
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
483
structure length
463
Chain Sequence
PSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLQFRQWNGKERSIYFQPPSFYVSAQDLPNIENGGVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRALEKISREVKSITVIGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKILPQYLSNWTMEKVKREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEADYGKGVIFYLRDKVVVGIVLWNVFNRMPIARKIIKDGEQHEDLNEVAKLFNIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redox-linked conformational dynamics in apoptosis-inducing factor
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords Apoptosis-inducing factor 1, mitochondrial
total genus 138
structure length 463
sequence length 483
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3gd3A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3gd3A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3gd3A01
2DKIA 3GSIA 2WP6A 3AYJA 4BK3A 3L8KA 2YLZA 4YSZA 1N4VA 4A99A 4U8KA 2R45A 2C3DA 2WP9A 2V3AA 1VRQB 3NN0X 4U8OA 3LZXA 2X8CA 4U8JA 2CDUA 2C65A 2A8XA 3DK8A 1OJDA 4Z44A 3COXA 2X99A 1Y56B 3AE1A 3AWIA 3KVEA 1B37A 1FOHA 4ADWA 1CJ2A 2BA9A 4U2SA 4Z2UA 1ZK7A 2Q7VA 1E1NA 2OLNA 1RSGA 4JY2A 2C73A 1H83A 4E0VA 3P9UA 3AEFA 3VRDB 1FL2A 4OPLA 2B9WA 2OALA 2IIDA 2YG4A 3URHA 5HXIA 1NHRA 4Z26A 4GUVA 2JB2A 4J34A 1EBDA 5U63A 2OA1A 2C72A 4EQSA 3BHFA 3K7QX 4U8MA 2C64A 2VQ7A 1E1KA 3EAOA 2V3BA 3AYLA 4WCTA 3GRSA 1KSSA 1BGNA 1NENA 5FS7A 2Z5YA 3NNEA 1LQUA 1S2QA 3NHOX 3GD4A 1Z6LA 1XDIA 2YLWA 3GDPA 4USQA 1FEAA 1BKWA 3F8PA 3GMBA 4Z2TA 3FPZA 1CHUA 1IUUA 3NRNA 5FS8A 1GALA 4A6NB 3FG2P 1Y0PA 3UTHA 1JRXA 4B1BA 4XXGA 3SFEA 3G5RA 2WOVA 1YQ3A 2VRLA 1GEUA 4CRTA 2FJDA 2BCPA 3GMCA 3I3LA 4TM4A 3BHKA 4A9WA 4GCMA 1VDCA 2XFUA 1EL7A 2XLTA 3AE5A 1D5TA 2BYBA 3BNUA 4GDPA 4GF7A 1PBCA 1JOAA 2R46A 3AEDA 3IHMA 4EIQA 2GR1A 1M6IA 3LJPA 4U8PA 1E6EA 3NN6X 3LZWA 5JCKA 4FDCB 4BURA 1VQWA 1PXCA 2Q0LA 1K0LA 2R4JA 3DA1A 3H4KA 3GWDA 3I6DA 4UDPA 4A7AA 1H86A 3K7TA 4OPGA 5EB5A 1K4QA 3M13A 1MOKA 4DSGA 1PHHA 3BI4A 3EANA 3M12A 1DXLA 3NTAA 4TLZA 1TYPA 1ZX9A 1H7WA 5LV9A 3UTGA 1D4DA 1ZY8A 2EQ7A 3QFBA 4EM4A 1IJHA 1IUXA 3CGBA 2YLTA 2YM2A 3BNMA 5CKUA 2WPCA 1DNCA 5JCIA 3AE6A 1D4CA 1BF3A 3AE8A 3K30A 1TYTA 2O9ZA 2JKCA 4DGKA 1PBDA 2BXSA 4NTDA 4CBQA 4BJYA 3E1TA 1F8SA 1KF6A 4YKFA 1D7YA 1GTEA 2PHHA 1QO8A 4AT0A 1NAAA 4H50A 5GRTA 1FECA 4B65A 4AP3A 4C3XA 1CJ3A 4C5OA 1GRBA 4J2WA 2GMJA 3LXDA 3CTYA 2GR0A 2TPRA 1P2EA 4Z25A 2C70A 4Y4MA 2E4GA 3GWFA 1IUSA 4RG3A 1BGJA 1L9DA 2GR3A 4Z2RA 4H2PA 1GT8A 4USRA 1RP0A 4C74A 1TDNA 3NTDA 3S61A 3CGCA 5BRTA 1F3PA 2GQWA 3DH9A 4YTPA 4H4TA 4H4VA 1PS9A 3IHGA 4OPIA 4HB9A 1TDKA 2WPEA 4J56A 1X31B 2JBVA 1V59A 2WEUA 2WDRA 3QVRA 4FK1C 5M0ZA 4B66A 3UKKA 5J60A 1MO9A 1PXBA 5M10A 2R9ZA 4NEVA 2XVEA 3ADAB 3BI2A 3UOXA 4B64A 2C3CA 3DMEA 3M0OA 4I58A 1P2HA 3QVPA 4UDQA 1CC6A 2ACZA 2QA1A 1ELIA 1MXTA 5KVHA 2WQYA 2YG3A 3VRBA 3AEBA 3H8IA 4Z43A 2BS3A 4ECHA 3OZ2A 4TM1A 2R0PA 4U8LA 4CNKA 3CNDA 4J31A 1GERA 4YKGA 3AEEA 1GETA 3F8RA 2V5ZA 4O5UA 2B7SA 2VOUA 3LB8A 2YG5A 2YWLA 3ALLA 3NGCX 2V61A 1OJTA 3G5QA 4OPTA 3DJJA 3IC9A 1E39A 3AXBA 4K5RA 1LPFA 4A79A 2X50A 3KKJA 5KXJA 4IA5A 4X9NA 1REOA 4OVIA 3P4SA 1PXAA 2C75A 1Q1RA 1NHSA 3PVCA 4DSHA 3WE0A 1SEZA 2R0CA 3GYJA 5KRQA 2X8HA 4H4YA 2W0HA 2JB1A 1KNRA 4EQRA 2RGHA 2WOWA 3ITJA 4JNQA 1UKVG 4K7ZA 4J57A 2WETA 3NYCA 5U25A 1LTXR 5KWFA 2BXRA 2WPFA 3UOVA 3DJGX 1E7PA 1NEKA 3ATRA 4A6NA 3H8LA 3SFDA 3NYEA 3ZYXA 1OJ9A 2H89A 5EBKA 3P4PA 2V6OA 2XLUA 2NPXA 4N9XA 5KOWA 5KOXA 4H4ZA 4XWRA 4YTMA 2Q6UA 1GSNA 1GRTA 1H7XA 5C3JA 2WP5A 1LJ1A 2H88A 3REDA 4CCQA 3DK4A 1EL8A 1B5QA 4K8DA 2XFOA 2WHDA 5HHFA 3FIMB 4NTCA 2RGJA 3V3OA 2BC0A 1L9CA 4B67A 4UP3A 3B6DA 1NPXA 4H4XA 5GSNA 2Z5XA 4B68A 1L9EA 3UKAA 2WS3A 4X4JA 3CNPA 3AECA 1O95A 5BUKA 4WX1A 2B7RA 2B76A 3SQPA 2GR2A 1BWCA 2XFQA 1GESA 3QSMA 2ZZBA 2ZBWA 1GPEA 5C2TA 1IUVA 2B9YA 3D8XA 4AOXA 3F8DA 4RG4A 5KVIA 4A5LA 1AOGA 1CJ4A 3QSSA 1TDOA 4K22A 3ZDNA 1GXFA 1B4VA 1PDHA 2QCUA 1TDFA 5JCLA 1CJCA 2ZZCA 1GRGA 4LA1A 2VVMA 3QSEA 2YVFA 3AE2A 2APGA 5BULA 2VVLG 1ZDLA 1OJCA 3RP7A 1F8RA 2JK6A 2WESA 3NK2X 2GVCA 3JSKA 3ATQA 4CCRA 2YVJA 1NHPA 2XVJA 1H81A 3K7MX 4IV9A 4H2QA 4CY8A 1ZOVA 1ZKQA 1L0VA 4C3YA 3ICSA 2V60A 4J33A 5JCNA 1D7LA 1GV4A 2C76A 1QJDA 4JNAA 3AE7A 3SM8A 4TM3A 4YSXA 3NK1X 1QLBA 2B9XA 2CFYA 5TR3A 2YLSA 2GEWA 2VRMA 1ZMDA 4IVOB 5EOWA 3GD3A 1COYA 1NG4A 1YY5A 3AD8B 4K5SA 3SGLA 2XFPA 2WU2A 4UDRA 2BABA 1GTHA 3GYIA 3UKFA 2WU5A 2XLPA 3LOVA 1K0IA 4NTEA 1K0JA 4PAAA 1ZMCA 5FS6A 3C96A 4TM0A 5U1OA 3GDNA 2A89A 3GRTA 2UZZA 1S2YA 1TDEA 1VG9A 3CNSA 4H4QA 4JY3A 3CGEA 3ALMA 3UTEA 2BS2A 1YQZA 1CL0A 3AD9B 4APNA 1Q9IA 1Q1WA 3NKSA 5FMHA 2YG7A 4EMWA 5JCMA 3KPFA 3QJ4A 3UKQA 4H7UA 4ICYA 1N4UA 1DJNA 2GF3A 1FCDA 4LU6A 2AQJA 4YT0A 3KD9A 1GNDA 4NEWA 2AAQA 4Y4NA 2YQUA 4BK1A 4JQ9A 3NT6A 2BCGG 5IQ1A 2E5VA 2BS4A 3UCLA 3DGHA 2EQ8A 4B69A 4Z24A 4NZHA 3CPIG 1XHCA 2YLXA 5HYMA 1GOSA 1LVLA 4IA6A 2GMHA 4BK2A 1YKJA 3Q9TA 4ZCDA 4AT2A 4YWOA 3UKLA 3BI5A 2GB0A 2C66A 2EQ9A 2YR5A 3R9UA 1BZLA 4EM3A 3RP6A 3PO7A 1PBEA 3NLCA 4GDEA 3FMWA 4H2RA 1NDAA 2WDQA 4Y4LA 4OPDA 1KNPA 3UP5A 3EF6A 3KLJA 4M52A 1RYIA 3V76A 4D04A 3ALJA 3RNMA 1KFYA 1O94A 1PJ7A 2XFNA 5CQFA 3IWAA 4CY6A 2GV8A 2GH5A 1PJ5A 2IVDA 4LIIA 1TRBA 4H4WA 1S3EA 1ONFA 1CBOA 1GRAA 2C7GA 1FEBA 4U8NA 3S5WA 3O0HA 2AR8A 1B8SA 2GAHB 3CNTA 4RSLA 1PBFA 1PBBA 1CC2A 2YVGA 4P9SA 1LV0A 4U2TA 4BJZA 4YXDA 4KPRA 2QAEA 2IVEA 3AEGA 3CGDA 4EQXA 2R4EA 4K2XA 2J3NA 2Q0KA 1OJAA 2Y6QA 2CULA 2WBAA 2R0GA 2YR4A 3OC4A 4OPUA 3P1WA 3NIXA 2EQ6A 4JDRA 3DJEA 2OAMA 1KSUA 3AE9A 1XANA 4OPCA 4C77A 1CF3A 1DODA 3ABVA 5DBJA 2I0ZA 1PN0A 2HQMA 3II4A 4PABA 4A65A 4TLXA 4B63A 2F5ZA 2FJEA 2YG6A 4X9MA 4MJWA 2WOIA 1D4EA 1IUWA 5IQ4A 4JN9A 4EQWA 2GAGB 1E1LA 1JNRA 3UOZA 3V3NA 3L1RA 4EIPA 3VRAA 2YLRA 4J36A 1YQ4A 3DJDA 1H82A 4H2NA 1NHQA 2FJBA 3QFAA 1GREA 1H84A 1KDGA 3AYIA 4YSHA 2E1MA 1GRFA 3AEAA 4H4SA 3RHAA 3CPJG 3VR8A 2XVIA 3CIRA 3C4AA 1DJQA 2BK5A 1ZP0A 1IUTA 3UKHA 4DNAA 3VQRA 1JRZA 3AE3A 3P4QA 4U8IA 2XLRA 1CC4A 4EMJA 3KU9A 4AP1A 2NVKX 2GRTA 4H4RA 1EL5A 2ZZ0A 4OCGA 3CN8A 3DK9A 2X3NA 1LQTA 3ICTA 4D03A 3VR9A 1DOBA 3FBSA 3T37A 2YM1A 4EMIA 2RABA 3DGZA 1Y56A 3CPHG 1W4XA 2CVJA 2XCGA 1JU2A 1JEHA 2A87A 4O5QA 3NG7X 4REKA 2XVHA 3G5SA 3CNJA 4XWZA 3UTFA 4YTNA 3D1CA 3LADA 1ZOYA 1S3BA 2TMDA 5ER0A 3KA7A 2C67A 4H4PA 2DKHA 2XLSA 4GR1A 2XDOA 3ISHA 1JNZA 2QA2A 3ICRA 3UKPA 3AE4A 4IVMB 2BK4A 1N4WA 1NG3A 2GQFA 1F6MA 2WDVA 5IPYA 3HZLA 4ZN0A 5BVAA 3NH3X 5EB4A 3UP4A 4CNJA 2VQBA 2OLOA 2RGOA 2ARDA 4YSYA 4KX6A 3Q6JA 3C4NA 2X8GA 5HY5A 4I59A 1PJ6A 3B3RA 1VG0A 5J7XA 1JRYA 2XYOA 4HA6A 3AD7B 3NYFA 1M64A 5FS9A 1HYUA 1O5WA 4GRTA 4U2LA 1EL9A 1GRHA 1E1MA 3AB1A 3RP8A 3UOYA 4FX9A 2FBWA 4ZCCA 1H6VA 1F8WA 2BACA 2YR6A 3PS9A 4BV6A 2FJAA 2VVLA 2JB3A 3EPTA 2Y6RA 3P4RA 2YAUA 1XPQA 2BC1A 4AOSA 2BK3A 2JAEA 2PYXA 3NK0X 2XVFA 5L46A 3IF9A 2VZ2A 1N1PA 4H4UA 1DOEA 1DOCA 4FK1A
chains in the Genus database with same CATH superfamily
3A7AA 2C3DA 2WP9A 1SJAA 2V3AA 3DFHA 3DK8A 1YEYA 4Z44A 3DESA 3KVEA 1CJ2A 4U2SA 2W3RA 3SZCA 1E1NA 2GGEA 1RSGA 4JY2A 3P9UA 3TOYA 1FL2A 2B9WA 1JPDX 3URHA 3OZYA 2GL5A 2OA1A 5KMQA 4U8MA 4WCTA 3NNEA 4YWSA 3GDPA 3CK5A 1H2IA 1FEAA 1BKWA 4Z2TA 3FPZA 4Z1YA 1CHUA 1IUUA 1Y0PA 3UTHA 2WOVA 2VRLA 2DW6A 1JCTA 2OQHA 1VDCA 2P8BA 2XFUA 1D5TA 3TW9A 3BNUA 4GF7A 1JOAA 3LJPA 4HN8A 3UJRA 1E6EA 3NN6X 3LZWA 4FDCB 2Q0LA 1K0LA 3GWDA 2PCEA 2POZA 3M13A 1PHHA 3BI4A 3EANA 3NTAA 1H7WA 5LV9A 3N4FA 3UTGA 2EQ7A 1FIQB 1MUCA 3PWGA 2YM2A 5CKUA 3AE6A 3A7UA 3AE8A 3K30A 2OPJA 4NTDA 4BJYA 1QO8A 4H50A 3VC6A 1FECA 4B65A 4AP3A 2XSXA 3UJFA 1VDVA 3LXDA 4Z25A 4GISA 1P48A 2E4GA 1X2GA 3GO2A 1EC7A 1BGJA 3ZVHB 4H2PA 4USRA 1F3PA 2PSNA 3STPA 3HPFA 4J56A 2WEUA 2P8CA 5M10A 1R6WA 2XVEA 3UOXA 4B64A 1WYGA 4A3RA 4UDQA 1CC6A 2QA1A 1MXTA 2BRAA 3H8IA 2BS3A 4ECHA 1GERA 3AEEA 4O5UA 1TE6A 3G5QA 3P3BA 4OPTA 3DJJA 3IC9A 1BQGA 4K5RA 1LPFA 1ONEA 3P4SA 4DSHA 3WE0A 2X8HA 1WUFA 4H4YA 2JB1A 4HPNA 5U25A 5KWFA 1KN0A 3ATRA 1NEKA 3OW1A 3NZGA 3H8LA 2H89A 2V6OA 2ZADA 3KPKA 1GSNA 3VA8A 1H7XA 2GDQA 4NTCA 1T3QC 3U9IA 3V3OA 4B67A 1L9CA 3B6DA 4DXKA 4H4XA 3UKAA 4X4JA 4JN8A 5BUKA 2B7RA 3V4BA 3QSMA 2ZBWA 3DGBA 3I6EA 4K22A 3ZDNA 3NFUA 1PDHA 2QCUA 2HZGA 1CJCA 4LA1A 2YVFA 2APGA 2VVLG 1ZDLA 3UXKA 3UCDA 4GAPA 1N63C 5KMSA 3NK2X 2QGYA 2YVJA 4IV9A 2XVJA 3K7MX 4G9KA 1ZOVA 1D7LA 4TM3A 4H2HA 3NRZB 1N62C 5EOWA 4K5SA 3I4KA 4UDRA 1GTHA 3GYIA 3EEZA 2WU5A 2XLPA 4NTEA 1K0JA 4PAAA 1ELSA 5U1OA 2A89A 2UZZA 3RGTA 2MNRA 3CGEA 2DW7A 2BS2A 1YQZA 3AD9B 1Q9IA 2ONEA 3P0WA 3UKQA 4H7UA 4YT0A 3SN1A 2AAQA 4JN7A 2HXUA 2YQUA 1OEPA 4JQ9A 3FVDA 3CPIG 1XHCA 3Q9TA 3R1ZA 2EQ9A 3JVAA 3R9UA 2AKZA 4H2RA 2WDQA 3S5SA 4Y4LA 3KLJA 5CQFA 2GV8A 2AR8A 3UJ2A 3CNTA 1FFVC 2GAHB 1VQZA 2E5AA 1E9IA 3JZUA 1S7MA 4KPRA 3CGDA 4EQXA 4E8GA 2Q0KA 1OJAA 2YR4A 3OC4A 4OPUA 3P1WA 3NIXA 1X2HA 1KSUA 1XANA 1CF3A 1DODA 5DBJA 3SR6B 3II4A 4B63A 3EKGA 3Q4DA 1IUWA 1E1LA 4EIPA 3VRAA 4J36A 1YQ4A 4H2NA 2CHRA 1H84A 4YSHA 3AEAA 4H4SA 3VR8A 2XVIA 3CIRA 2BK5A 1SB3B 3A7RA 4EMJA 4AP1A 3TWBA 3VR9A 2PPGA 3SN0A 2CVJA 1JEHA 3NG7X 3G5SA 5ER0A 3CXOA 2C67A 3ISHA 2XDOA 2PGEA 1JNZA 3UKPA 4II3A 1NG3A 3D47A 5IPYA 4ZN0A 3DIPA 5BVAA 2VQBA 3MY9A 2RGOA 3FYYA 4KX6A 3Q6JA 3IK4A 3B3RA 1VG0A 4K2SA 1N5WC 1JRYA 4HA6A 3NVWB 1HYUA 1GRHA 1F8WA 3PS9A 4GYPA 2BC1A 2BK3A 5L46A 2XVFA 4H4UA 3TJ4A 2PTWA 2WP6A 3AYJA 4BK3A 2YLZA 1N4VA 5BOEA 4U8JA 3GD6A 2C65A 4G7FA 1KKOA 3AE1A 3AWIA 1FOHA 4IHCA 4ADWA 4Z2UA 3SZWA 4E0VA 1H83A 4HNLA 2OALA 2OQYA 4FI4A 2PA6A 1EBDA 2C72A 2C64A 2VQ7A 1E1KA 3GRSA 1LQUA 3NHOX 1XDIA 1XPYA 3F8PA 3NRNA 1MNSA 1GALA 3TTEA 4A6NB 3NVZB 1JRXA 3G5RA 1YQ3A 1GEUA 3R07C 2BCPA 3I3LA 2PP0A 4TM4A 3BHKA 4A9WA 1EL7A 3T0KA 2BYBA 4EIQA 2R4JA 3DA1A 3K7TA 5EB5A 4DSGA 1DXLA 1D4DA 1ZY8A 2PTXA 1IUXA 2YLTA 5JCIA 2HXTA 1BF3A 4DN1A 2O9ZA 2BXSA 1F8SA 1KF6A 1GTEA 1NAAA 3T9PA 4C5OA 1GRBA 2GMJA 2GR0A 4J1OA 4RG3A 1L9DA 2GR3A 1GT8A 1TDNA 4GIRA 2W54A 5BRTA 2GQWA 3DH9A 1PS9A 2E3TA 4HCHA 3NO1A 3Q45A 4A35A 2QQ6A 1X31B 1V59A 3QVRA 5M0ZA 5J60A 3UKKA 1MO9A 1PXBA 4ZCWA 4MMWA 3DMEA 3M0OA 4I58A 4IZGA 1P2HA 1BKHA 4GGBA 1ELIA 3UXLA 2YG3A 3OZ2A 4CNKA 4J31A 3DG6A 1GETA 3F8RA 2V5ZA 2B7SA 3MQTA 3NVYB 3DDMA 2YG5A 3ES7A 3ALLA 4DYEA 2V61A 1OJTA 4H1ZA 4A79A 1PXAA 2R0CA 3GYJA 5KRQA 2W0HA 2RGHA 1UKVG 2WETA 4HNCA 1LTXR 2BXRA 2WPFA 4A6NA 3ZYXA 1OJ9A 5EBKA 4N9XA 3UCCA 3SYIA 1GRTA 2WP5A 3REDA 4CCQA 1EL8A 2XFOA 4K8DA 4UP3A 1L9EA 5G5HB 3VFCA 1O95A 4IT1A 2B76A 2GR2A 4HCLA 1BWCA 3SQPA 2ZZBA 1GPEA 1IUVA 3SY4A 3D46A 1TDOA 4GGHA 3RR1A 2ZZCA 3QSEA 3PK7A 3AE2A 5BULA 1OJCA 3RP7A 1F8RA 3JSKA 3ATQA 1NHPA 1ZKQA 4C3YA 5JCNA 2C76A 4JNAA 3AE7A 3SM8A 4YSXA 1QLBA 2B9XA 2CFYA 3ETRB 2VRMA 1ZMDA 1COYA 2XFPA 2PODA 3SXIA 3UKFA 1ZMCA 2MUCA 3GRTA 1KD0A 3U4FA 1CL0A 4G73A 3NKSA 5FMHA 3FJ4A 3QJ4A 3SX6A 1DJNA 2AQJA 4NEWA 2BCGG 2E5VA 2EQ8A 4Z24A 1YKJA 3UKLA 3BI5A 2GB0A 3QPEA 4G6GA 5J04A 4EM3A 1PBEA 3NLCA 4GDEA 4OPDA 1KNPA 4D04A 3ALJA 1O94A 3IWAA 1PJ5A 2IVDA 1S3EA 1CBOA 4TVYA 4RSLA 2OZTA 1PBBA 4P9SA 3FCPA 4BJZA 4KPLA 3AEGA 3HYVA 2R4EA 4K2XA 4JHMA 4JDRA 1PN0A 4PABA 4A65A 4TLXA 2GGIA 2WOIA 1D4EA 3TCSA 4EQWA 3UOZA 1JNRA 3V3NA 3L1RA 2HNEA 3V5FA 4ZOHB 3AN1A 7ENLA 3RHAA 4GYPC 3CPJG 3SQSA 3IJIA 1JRZA 3P4QA 2XLRA 3T2KA 2NVKX 2GRTA 4H4RA 4OCGA 1FHUA 3ICTA 4D03A 1DOBA 3FBSA 3R10A 4FP1A 3I6TA 1JU2A 4IP4A 2A87A 3NXLA 4REKA 3CNJA 1S3BA 2TMDA 3SJNA 4GR1A 3N6JA 4IVMB 2BK4A 3H8AA 3UP4A 3K1GA 3GYXA 4YSYA 3C4NA 4I59A 1PJ6A 5J7XA 1M64A 3SBFA 1EL9A 4ZCCA 2FJAA 3EPTA 3P4RA 2PYXA 1DOCA 4NWZA 2DKIA 2BRYA 2PP1A 3GSIA 3L8KA 3MZNA 4U8KA 3T6CA 1VRQB 1EBGA 2A8XA 2X99A 1Y56B 1B37A 3CXBA 2OLNA 2C73A 3OPSA 1JRPA 3AEFA 3VRDB 4OPLA 2IIDA 2YG4A 1NHRA 2JB2A 4J34A 5U63A 2OFJA 3K7QX 3BHFA 2V3BA 3AYLA 3HW2A 3V5CA 1NENA 3TQPA 1S2QA 1Z6LA 4DWDA 1SJBA 4USQA 3GMBA 4B1BA 3N6HA 2FJDA 3GMCA 5BOFA 1SJCA 2XLTA 2QJNA 4GDPA 1PBCA 3IHMA 2GR1A 1M6IA 5JCKA 3RP6A 1VQWA 4UDPA 3H4KA 3H7VA 4A7AA 1H86A 4OPGA 3EUB3 1MOKA 3T31A 3M12A 1ZX9A 4TVWA 3AM9A 2PU1A 1IJHA 3BNMA 1DNCA 4DGKA 2ZC8A 1PBDA 3R0KA 4CBQA 3E1TA 3HYWA 1D7YA 5GRTA 4C3XA 4J2WA 3CTYA 1P2EA 2TPRA 3SZ0A 3VC5A 4Y4MA 1IUSA 5KMPA 4DX3A 4C74A 3NTDA 4YTPA 1STZA 3IHGA 3B97A 2W55A 4HB9A 3BSMA 1RVKA 1TDKA 2WPEA 3NS1B 2JBVA 4GAVA 1EBHA 4FK1C 2OKTA 4B66A 2GGHA 2R9ZA 3ADAB 3BI2A 2C3CA 3BJSA 2ACZA 5KVHA 2WQYA 1XS2A 3VRBA 4Z43A 2R0PA 3CNDA 3D9XA 2VOUA 3LB8A 2YWLA 1W6TA 3T4WA 4IL0A 4ENLA 4E5TA 2X50A 3RRAA 3KKJA 5KXJA 4X9NA 4OVIA 2C75A 1Q1RA 1SEZA 4G6HA 4EQRA 3ITJA 2WOWA 4JNQA 4K7ZA 3NYCA 3PWIA 3DJGX 1E7PA 3NVVB 2FYMA 4HCDA 2XLUA 5KOXA 5KOWA 4XWRA 1LJ1A 3DK4A 1B5QA 3N4EA 2BC0A 5GSNA 2Z5XA 4NNJA 3CNPA 1PDYA 2XFQA 3RITA 3F8DA 4A5LA 3OZMA 1AOGA 3QSSA 1B4VA 5JRBA 2XH4A 5JCLA 1GRGA 2VVMA 3HYXA 4E6MA 1R0MA 2JK6A 2GVCA 4MKSA 4CCRA 4H2QA 1MDLA 3ICSA 2V60A 4K8GA 1GV4A 1QJDA 2GEWA 4IVOB 3GD3A 1YY5A 3AD8B 3SGLA 2BABA 5FJTA 3LOVA 3CMMA 1K0IA 3C96A 4TM0A 3GDNA 3QTPA 1TDEA 3CNSA 4H4QA 1N60C 4JY3A 3FXGA 5G5GB 5FJOA 1Q1WA 5IDZA 5JCMA 2I5QA 2W3SA 2AL2B 4ICYA 1FCDA 3DEQA 3KD9A 2P88A 4BK1A 3NT6A 5IQ1A 2BS4A 3UCLA 4DHGA 3DGHA 4B69A 2GMHA 4BK2A 3HRDC 4AT2A 3OP2A 4YWOA 3KUMA 4J3ZA 3ENLA 1BZLA 3PO7A 3FMWA 1NDAA 4M52A 1ECQA 1PJ7A 2PTZA 4LIIA 1TRBA 1ONFA 2C7GA 4U8NA 1FEBA 1B8SA 1MRAA 1PBFA 1CC2A 4ROPA 2YVGA 1LV0A 4U2TA 2IVEA 1N61C 1JDFA 2R0GA 3MSYA 2EQ6A 3DJEA 2OAMA 4OPCA 1PDZA 4C77A 3R25A 3ABVA 3VCCA 2I0ZA 2GSHA 3VDGA 5KMRA 3QLDA 2C4CA 2YG6A 4X9MA 5IQ4A 4JN9A 2GAGB 2YLRA 1NHQA 2QJMA 2RDXA 3SZFA 3AYIA 1GRFA 1DJQA 1ZP0A 4DNAA 1IYXA 2PS2A 4U8IA 3OTRA 4ZA0A 3H70A 1DTNA 2ZZ0A 4E4FA 3L5OA 4EMIA 2RABA 3DGZA 1Y56A 3CPHG 1W4XA 3TWAA 2XVHA 4XWZA 4G74A 4YTNA 4KEMA 3D1CA 3LADA 1ZOYA 3CT2A 5FJRA 3KA7A 4H4PA 2XLSA 3ICRA 1TKKA 1F6MA 2WDVA 5EB4A 4CNJA 4GMEA 2ARDA 2X8GA 3AD7B 3NYFA 2QDDA 5FS9A 4GRTA 3RCYA 4U2LA 1E1MA 3UOYA 4FX9A 2FBWA 2BACA 2YR6A 3PG6A 4BV6A 2VVLA 2JB3A 1XPQA 3TJIA 3T2ZA 1EC9A 1N1PA 4FK1A 3JW7A 3ZLGA 2P3ZA 4YSZA 4A99A 2R45A 4EWJA 3NN0X 4U8OA 3LZXA 2X8CA 1P43A 2CDUA 1OJDA 3COXA 2BA9A 1ZK7A 2Q7VA 1EC8A 3GY1A 1MDRA 1TZZA 5HXIA 2QDEA 4H83A 4Z26A 4GUVA 1KKRA 4EQSA 3DFYA 3PFRA 3EAOA 1KSSA 1BGNA 5FS7A 2Z5YA 2OZ3A 3GD4A 3GC2A 2PP3A 2YLWA 3B9JB 5FS8A 3UJEA 3FG2P 5EU9A 4XXGA 3SFEA 4CRTA 4GCMA 2AKMA 3AE5A 3THUA 2R46A 3AEDA 2OLAA 2OG9A 4U8PA 1FHVA 4BURA 1PXCA 3I6DA 4X2PA 1K4QA 4TLZA 1TYPA 1RM6B 3QFBA 4EM4A 3CGBA 2WPCA 1D4CA 1TYTA 3RO6A 2JKCA 3R0UA 4YKFA 2PHHA 1JROA 2AL1A 4AT0A 1N5XA 1CJ3A 4KWSA 4A6GA 1FO4A 2C70A 3CB3A 3GWFA 4Z2RA 1RP0A 3S61A 3CGCA 3H12A 4H4TA 4H4VA 4OPIA 3P93A 2XH0A 2WDRA 4IL2A 4NEVA 3QVPA 4Z17A 2GGGA 3UJSA 3AEBA 4TM1A 4U8LA 4YKGA 3DERA 3NGCX 5FJUA 1E39A 3AXBA 4IA5A 3FV9A 1REOA 3PVCA 1JPMA 1NHSA 3IJLA 3SSZA 3CAWA 1KNRA 3S47A 4II2A 2XH2A 4J57A 3UOVA 1NU5A 3SFDA 3NYEA 1WUEA 4G8TA 3P4PA 2NPXA 4H4ZA 4YTMA 2Q6UA 4HYRA 5C3JA 2H88A 4K1WA 4IP5A 2WHDA 5HHFA 3FIMB 2RGJA 3DG7A 3CYJA 1NPXA 3T2YA 4B68A 2WS3A 3AECA 3SN4A 4WX1A 3T14A 1GESA 2AL2A 5C2TA 2B9YA 3D8XA 4AOXA 4RG4A 5KVIA 1CJ4A 1V97A 1GXFA 2OX4A 1TDFA 1FFUC 2WESA 2QVHA 4CY8A 1H81A 1SJDA 1L0VA 4J33A 2PMQA 3ZVHA 3NK1X 5TR3A 2YLSA 2PTYA 1NG4A 2WU2A 5FJPA 2GGJA 3VCNA 4MGGA 5FS6A 3V3WA 3R11A 1S2YA 1VG9A 2OVLA 3ALMA 3UTEA 3ZLFA 4APNA 2YG7A 4EMWA 3KPFA 1N4UA 2GF3A 4LU6A 2PU0A 1GNDA 4Y4NA 3QN3A 3ZLHA 4NZHA 2YLXA 4KT2A 1GOSA 1LVLA 4IA6A 4ZCDA 2C66A 1KCZA 2YR5A 4GFIA 3UP5A 3EF6A 1RYIA 3V76A 5HYMA 3RNMA 1KFYA 2XFNA 2GH5A 4E4UA 3T8QA 4H4WA 1GRAA 3S5WA 2OZ8A 3O0HA 2OO6A 4M0XA 4YXDA 2QAEA 2J3NA 5ENLA 2Y6QA 2CULA 2WBAA 3AE9A 2HQMA 2F5ZA 2FJEA 3DG3A 4MJWA 1ZXIC 2QJJA 3DJDA 1H82A 2FJBA 3QFAA 1GREA 2FKPA 3MKCA 2XGZA 1KDGA 2E1MA 1L8PA 3UGVA 3C4AA 3UKHA 1IUTA 3VQRA 3AE3A 1CC4A 2PGWA 3ZVIA 3KU9A 1NELA 4F4RA 1EL5A 3CN8A 3DK9A 2X3NA 1LQTA 3MUCA 4H19A 3T37A 2YM1A 3MWCA 2XCGA 4O5QA 3QKEA 2O56A 3UTFA 1F9CA 2DKHA 4CY6A 2QA2A 3AE4A 1N4WA 2GQFA 3AMZA 2XH7A 3HZLA 3NH3X 2OLOA 2P0IA 5HY5A 2NQLA 2XYOA 5KNLA 6ENLA 1O5WA 3ES8A 3BOXA 3AB1A 3RP8A 1H6VA 2Y6RA 4M6UA 2YAUA 4AOSA 3IJQA 2JAEA 3NK0X 3IF9A 2VZ2A 1DOEA
chains in the Genus database with same CATH topology
2DKIA 2BRYA 3GSIA 2WP6A 3AYJA 4BK3A 3L8KA 2YLZA 4YSZA 1N4VA 4A99A 4U8KA 2R45A 2C3DA 2WP9A 2V3AA 1VRQB 3NN0X 4U8OA 3LZXA 2X8CA 4U8JA 2CDUA 2C65A 2A8XA 3DK8A 1OJDA 4Z44A 3COXA 2X99A 1Y56B 3AE1A 3AWIA 3KVEA 1B37A 1FOHA 4ADWA 1CJ2A 2BA9A 4U2SA 4Z2UA 3SZCA 1ZK7A 2Q7VA 3SZWA 1E1NA 2OLNA 4NWZA 1RSGA 4JY2A 2C73A 1H83A 4E0VA 3P9UA 3AEFA 3VRDB 1FL2A 4OPLA 2B9WA 2OALA 2IIDA 2YG4A 3URHA 5HXIA 1NHRA 4Z26A 4GUVA 2JB2A 4J34A 1EBDA 5U63A 2OA1A 5KMQA 2C72A 4EQSA 3BHFA 3K7QX 4U8MA 2C64A 2VQ7A 1E1KA 2V3BA 3EAOA 3AYLA 4WCTA 3GRSA 1KSSA 1BGNA 1NENA 5FS7A 2Z5YA 3NNEA 1LQUA 1S2QA 3NHOX 3GD4A 1Z6LA 1XDIA 2YLWA 3GDPA 4USQA 1H2IA 1FEAA 1BKWA 3F8PA 3GMBA 4Z2TA 3FPZA 1CHUA 1IUUA 3NRNA 5FS8A 1GALA 4A6NB 3FG2P 1Y0PA 3UTHA 1JRXA 4B1BA 4XXGA 3SFEA 3G5RA 2WOVA 1YQ3A 2VRLA 1GEUA 4CRTA 2FJDA 2BCPA 3GMCA 3I3LA 4TM4A 3BHKA 4A9WA 4GCMA 1VDCA 2XFUA 1EL7A 3T0KA 2XLTA 3AE5A 1D5TA 2BYBA 3BNUA 4GDPA 4GF7A 1PBCA 1JOAA 2R46A 3AEDA 3IHMA 4EIQA 2GR1A 1M6IA 3LJPA 4U8PA 1E6EA 3NN6X 3LZWA 5JCKA 4FDCB 4BURA 1VQWA 1PXCA 2Q0LA 1K0LA 2R4JA 3DA1A 3H4KA 3GWDA 3I6DA 4UDPA 4A7AA 1H86A 3K7TA 4OPGA 5EB5A 1K4QA 3M13A 1MOKA 4DSGA 1PHHA 3T31A 3BI4A 3EANA 3M12A 1DXLA 3NTAA 4TLZA 1TYPA 1ZX9A 1H7WA 5LV9A 3UTGA 1D4DA 1ZY8A 2EQ7A 3QFBA 4EM4A 1IJHA 1IUXA 3CGBA 2YLTA 2YM2A 3BNMA 5CKUA 2WPCA 1DNCA 5JCIA 3AE6A 1D4CA 1BF3A 3AE8A 3K30A 1TYTA 2O9ZA 2JKCA 4DGKA 1PBDA 2BXSA 4NTDA 4CBQA 4BJYA 3E1TA 1F8SA 1KF6A 4YKFA 3HYWA 1D7YA 1GTEA 2PHHA 1QO8A 4AT0A 1NAAA 4H50A 5GRTA 1FECA 4B65A 4AP3A 4C3XA 1CJ3A 4C5OA 1GRBA 4J2WA 2GMJA 3LXDA 3CTYA 2GR0A 2TPRA 1P2EA 3SZ0A 4Z25A 2C70A 4Y4MA 2E4GA 3GWFA 1IUSA 5KMPA 4RG3A 1BGJA 1L9DA 2GR3A 4Z2RA 4H2PA 1GT8A 4USRA 1RP0A 4C74A 1TDNA 3NTDA 3S61A 3CGCA 5BRTA 1F3PA 2GQWA 3DH9A 4YTPA 4H4TA 4H4VA 1PS9A 3IHGA 4OPIA 4HB9A 1TDKA 2WPEA 4J56A 1X31B 4GAVA 2JBVA 1V59A 2WEUA 2WDRA 3QVRA 4FK1C 5M0ZA 4B66A 3UKKA 5J60A 1MO9A 1PXBA 5M10A 2R9ZA 4NEVA 2XVEA 3ADAB 3BI2A 3UOXA 4B64A 2C3CA 3DMEA 3M0OA 4I58A 1P2HA 3QVPA 4UDQA 1CC6A 2ACZA 2QA1A 1ELIA 1MXTA 5KVHA 2WQYA 2YG3A 3VRBA 2BRAA 3AEBA 3H8IA 4Z43A 2BS3A 4ECHA 3OZ2A 4TM1A 2R0PA 4U8LA 4CNKA 3CNDA 4J31A 1GERA 4YKGA 3AEEA 1GETA 3F8RA 2V5ZA 4O5UA 2B7SA 3D9XA 2VOUA 3LB8A 2YG5A 2YWLA 3ALLA 3NGCX 2V61A 1OJTA 3G5QA 4OPTA 3DJJA 3IC9A 1E39A 3AXBA 4K5RA 1LPFA 4A79A 2X50A 3KKJA 5KXJA 4IA5A 4X9NA 1REOA 4OVIA 3P4SA 1PXAA 2C75A 1Q1RA 1NHSA 3PVCA 4DSHA 3WE0A 1SEZA 2R0CA 3GYJA 4G6HA 5KRQA 2X8HA 4H4YA 2W0HA 2JB1A 1KNRA 4EQRA 2RGHA 2WOWA 3ITJA 4JNQA 4II2A 1UKVG 4K7ZA 4J57A 2WETA 3NYCA 5U25A 1LTXR 5KWFA 2BXRA 2WPFA 1KN0A 3DJGX 1E7PA 1NEKA 3ATRA 3UOVA 4A6NA 3H8LA 3SFDA 3NYEA 3ZYXA 1OJ9A 2H89A 5EBKA 3P4PA 2V6OA 2XLUA 2NPXA 4N9XA 5KOWA 5KOXA 4H4ZA 4XWRA 4YTMA 2Q6UA 1GSNA 1GRTA 1H7XA 3KPKA 3SYIA 2WP5A 5C3JA 1LJ1A 2H88A 3REDA 4CCQA 3DK4A 1EL8A 1B5QA 4K8DA 2XFOA 2WHDA 5HHFA 3FIMB 4NTCA 2RGJA 3V3OA 2BC0A 1L9CA 4B67A 4UP3A 3B6DA 1NPXA 4H4XA 5GSNA 3T2YA 2Z5XA 4B68A 1L9EA 3UKAA 2WS3A 4NNJA 4X4JA 3CNPA 3AECA 1O95A 5BUKA 4WX1A 2B7RA 2B76A 3SQPA 2GR2A 1BWCA 2XFQA 3T14A 1GESA 3QSMA 2ZZBA 2ZBWA 1GPEA 5C2TA 1IUVA 2B9YA 3D8XA 4AOXA 3F8DA 4RG4A 5KVIA 3SY4A 1AOGA 1CJ4A 3QSSA 1TDOA 4K22A 3ZDNA 1GXFA 4A5LA 1B4VA 1PDHA 2QCUA 5JRBA 1TDFA 5JCLA 1CJCA 2ZZCA 1GRGA 4LA1A 2VVMA 3QSEA 2YVFA 3HYXA 3AE2A 2APGA 5BULA 2VVLG 1ZDLA 1OJCA 4GAPA 3RP7A 1F8RA 5KMSA 2JK6A 2WESA 3NK2X 2GVCA 3JSKA 3ATQA 4CCRA 2YVJA 1NHPA 2XVJA 1H81A 3K7MX 4IV9A 4H2QA 4CY8A 4G9KA 1ZOVA 1ZKQA 1L0VA 4C3YA 3ICSA 2V60A 4J33A 5JCNA 1D7LA 1GV4A 2C76A 1QJDA 4JNAA 3AE7A 3SM8A 4TM3A 4YSXA 3NK1X 1QLBA 2B9XA 2CFYA 5TR3A 2YLSA 2GEWA 2VRMA 1ZMDA 4IVOB 5EOWA 3GD3A 1COYA 1NG4A 1YY5A 3AD8B 4K5SA 3SGLA 2XFPA 2WU2A 4UDRA 2BABA 1GTHA 3GYIA 3SXIA 2WU5A 2XLPA 3LOVA 3CMMA 3UKFA 1K0IA 4NTEA 1K0JA 4PAAA 1ZMCA 5FS6A 3C96A 4TM0A 5U1OA 3GDNA 2A89A 3GRTA 2UZZA 1S2YA 1TDEA 1VG9A 3CNSA 4H4QA 4JY3A 3CGEA 3ALMA 3UTEA 2BS2A 1YQZA 1CL0A 3AD9B 4APNA 1Q9IA 1Q1WA 4G73A 3NKSA 5FMHA 2YG7A 4EMWA 5JCMA 3KPFA 3QJ4A 3SX6A 3UKQA 4H7UA 4ICYA 1N4UA 1DJNA 2GF3A 1FCDA 4LU6A 2AQJA 4YT0A 3KD9A 1GNDA 4NEWA 2AAQA 4Y4NA 2YQUA 4BK1A 4JQ9A 3NT6A 2BCGG 5IQ1A 2E5VA 2BS4A 3UCLA 3DGHA 2EQ8A 4B69A 4Z24A 4NZHA 3CPIG 1XHCA 2YLXA 5HYMA 1GOSA 1LVLA 4IA6A 2GMHA 4BK2A 1YKJA 3Q9TA 4ZCDA 4AT2A 4YWOA 3UKLA 3BI5A 2GB0A 4G6GA 2C66A 2EQ9A 2YR5A 3R9UA 1BZLA 4EM3A 3RP6A 3PO7A 1PBEA 3NLCA 4GDEA 3FMWA 4H2RA 1NDAA 2WDQA 4Y4LA 4OPDA 1KNPA 3UP5A 3EF6A 3KLJA 4M52A 1RYIA 3V76A 4D04A 3ALJA 3RNMA 1KFYA 1O94A 1PJ7A 2XFNA 5CQFA 3IWAA 4CY6A 2GV8A 2GH5A 1PJ5A 2IVDA 4LIIA 1TRBA 4H4WA 1S3EA 1ONFA 1CBOA 1GRAA 2C7GA 1FEBA 4U8NA 3S5WA 3O0HA 2AR8A 1B8SA 2GAHB 3CNTA 4RSLA 1PBFA 1PBBA 1CC2A 2YVGA 4P9SA 1LV0A 4U2TA 4BJZA 1S7MA 4YXDA 4KPRA 2QAEA 2IVEA 3AEGA 3CGDA 4EQXA 3HYVA 2R4EA 4K2XA 2J3NA 2Q0KA 1OJAA 2Y6QA 2CULA 2WBAA 2R0GA 2YR4A 3OC4A 4OPUA 3P1WA 3NIXA 2EQ6A 4JDRA 3DJEA 2OAMA 1KSUA 3AE9A 1XANA 4OPCA 4C77A 1CF3A 1DODA 3ABVA 5DBJA 2I0ZA 1PN0A 2HQMA 3II4A 4PABA 4A65A 5KMRA 4TLXA 4B63A 2F5ZA 2FJEA 2C4CA 2YG6A 4X9MA 4MJWA 2WOIA 1D4EA 1IUWA 5IQ4A 4JN9A 4EQWA 2GAGB 1E1LA 1JNRA 3UOZA 3V3NA 3L1RA 4EIPA 3VRAA 2YLRA 4J36A 1YQ4A 3DJDA 1H82A 4H2NA 1NHQA 2FJBA 3QFAA 1GREA 3SZFA 1H84A 1KDGA 3AYIA 4YSHA 2E1MA 1GRFA 3AEAA 4H4SA 3RHAA 3CPJG 3VR8A 2XVIA 3CIRA 3C4AA 1DJQA 2BK5A 1ZP0A 1IUTA 3UKHA 4DNAA 3VQRA 1JRZA 3AE3A 3P4QA 4U8IA 2XLRA 3T2KA 1CC4A 4EMJA 3KU9A 4AP1A 2NVKX 2GRTA 4H4RA 1EL5A 2ZZ0A 4OCGA 3CN8A 3DK9A 2X3NA 1LQTA 3ICTA 3L5OA 4D03A 3VR9A 1DOBA 3FBSA 3T37A 2YM1A 4EMIA 2RABA 3DGZA 1Y56A 3CPHG 1W4XA 2CVJA 2XCGA 1JU2A 1JEHA 2A87A 4O5QA 3NG7X 4REKA 2XVHA 3G5SA 3CNJA 4XWZA 3UTFA 4G74A 4YTNA 3D1CA 3LADA 1ZOYA 1S3BA 2TMDA 5ER0A 3KA7A 2C67A 4H4PA 2DKHA 2XLSA 4GR1A 2XDOA 3ISHA 1JNZA 2QA2A 3ICRA 3UKPA 3AE4A 4IVMB 4II3A 2BK4A 1N4WA 1NG3A 2GQFA 1F6MA 2WDVA 5IPYA 3HZLA 4ZN0A 5BVAA 3NH3X 5EB4A 3UP4A 4CNJA 2VQBA 2OLOA 2RGOA 3GYXA 2ARDA 4YSYA 4KX6A 3Q6JA 3C4NA 2X8GA 5HY5A 4I59A 1PJ6A 3B3RA 1VG0A 5J7XA 1JRYA 2XYOA 4HA6A 3AD7B 3NYFA 1M64A 5KNLA 5FS9A 1HYUA 1O5WA 4GRTA 4U2LA 1EL9A 1GRHA 1E1MA 3AB1A 3RP8A 3UOYA 4FX9A 2FBWA 4ZCCA 1H6VA 1F8WA 2BACA 2YR6A 3PG6A 3PS9A 4BV6A 2FJAA 2VVLA 2JB3A 3EPTA 2Y6RA 3P4RA 2YAUA 1XPQA 2BC1A 4AOSA 2BK3A 2JAEA 2PYXA 3NK0X 2XVFA 3T2ZA 5L46A 3IF9A 2VZ2A 1N1PA 4H4UA 1DOEA 1DOCA 4FK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DKI A;  3GSI A;  2WP6 A;  3AYJ A;  4BK3 A;  3L8K A;  2YLZ A;  4YSZ A;  1N4V A;  4A99 A;  4U8K A;  2R45 A;  2C3D A;  2WP9 A;  2V3A A;  1VRQ B;  3NN0 X;  4U8O A;  3LZX A;  2X8C A;  4U8J A;  2CDU A;  2C65 A;  2A8X A;  3DK8 A;  1OJD A;  4Z44 A;  3COX A;  2X99 A;  1Y56 B;  3AE1 A;  3AWI A;  3KVE A;  1B37 A;  1FOH A;  4ADW A;  1CJ2 A;  2BA9 A;  4U2S A;  4Z2U A;  1ZK7 A;  2Q7V A;  1E1N A;  2OLN A;  1RSG A;  4JY2 A;  2C73 A;  1H83 A;  4E0V A;  3P9U A;  3AEF A;  3VRD B;  1FL2 A;  4OPL A;  2B9W A;  2OAL A;  2IID A;  2YG4 A;  3URH A;  5HXI A;  1NHR A;  4Z26 A;  4GUV A;  2JB2 A;  4J34 A;  1EBD A;  5U63 A;  2OA1 A;  2C72 A;  4EQS A;  3BHF A;  3K7Q X;  4U8M A;  2C64 A;  2VQ7 A;  1E1K A;  3EAO A;  2V3B A;  3AYL A;  4WCT A;  3GRS A;  1KSS A;  1BGN A;  1NEN A;  5FS7 A;  2Z5Y A;  3NNE A;  1LQU A;  1S2Q A;  3NHO X;  3GD4 A;  1Z6L A;  1XDI A;  2YLW A;  3GDP A;  4USQ A;  1FEA A;  1BKW A;  3F8P A;  3GMB A;  4Z2T A;  3FPZ A;  1CHU A;  1IUU A;  3NRN A;  5FS8 A;  1GAL A;  4A6N B;  3FG2 P;  1Y0P A;  3UTH A;  1JRX A;  4B1B A;  4XXG A;  3SFE A;  3G5R A;  2WOV A;  1YQ3 A;  2VRL A;  1GEU A;  4CRT A;  2FJD A;  2BCP A;  3GMC A;  3I3L A;  4TM4 A;  3BHK A;  4A9W A;  4GCM A;  1VDC A;  2XFU A;  1EL7 A;  2XLT A;  3AE5 A;  1D5T A;  2BYB A;  3BNU A;  4GDP A;  4GF7 A;  1PBC A;  1JOA A;  2R46 A;  3AED A;  3IHM A;  4EIQ A;  2GR1 A;  1M6I A;  3LJP A;  4U8P A;  1E6E A;  3NN6 X;  3LZW A;  5JCK A;  4FDC B;  4BUR A;  1VQW A;  1PXC A;  2Q0L A;  1K0L A;  2R4J A;  3DA1 A;  3H4K A;  3GWD A;  3I6D A;  4UDP A;  4A7A A;  1H86 A;  3K7T A;  4OPG A;  5EB5 A;  1K4Q A;  3M13 A;  1MOK A;  4DSG A;  1PHH A;  3BI4 A;  3EAN A;  3M12 A;  1DXL A;  3NTA A;  4TLZ A;  1TYP A;  1ZX9 A;  1H7W A;  5LV9 A;  3UTG A;  1D4D A;  1ZY8 A;  2EQ7 A;  3QFB A;  4EM4 A;  1IJH A;  1IUX A;  3CGB A;  2YLT A;  2YM2 A;  3BNM A;  5CKU A;  2WPC A;  1DNC A;  5JCI A;  3AE6 A;  1D4C A;  1BF3 A;  3AE8 A;  3K30 A;  1TYT A;  2O9Z A;  2JKC A;  4DGK A;  1PBD A;  2BXS A;  4NTD A;  4CBQ A;  4BJY A;  3E1T A;  1F8S A;  1KF6 A;  4YKF A;  1D7Y A;  1GTE A;  2PHH A;  1QO8 A;  4AT0 A;  1NAA A;  4H50 A;  5GRT A;  1FEC A;  4B65 A;  4AP3 A;  4C3X A;  1CJ3 A;  4C5O A;  1GRB A;  4J2W A;  2GMJ A;  3LXD A;  3CTY A;  2GR0 A;  2TPR A;  1P2E A;  4Z25 A;  2C70 A;  4Y4M A;  2E4G A;  3GWF A;  1IUS A;  4RG3 A;  1BGJ A;  1L9D A;  2GR3 A;  4Z2R A;  4H2P A;  1GT8 A;  4USR A;  1RP0 A;  4C74 A;  1TDN A;  3NTD A;  3S61 A;  3CGC A;  5BRT A;  1F3P A;  2GQW A;  3DH9 A;  4YTP A;  4H4T A;  4H4V A;  1PS9 A;  3IHG A;  4OPI A;  4HB9 A;  1TDK A;  2WPE A;  4J56 A;  1X31 B;  2JBV A;  1V59 A;  2WEU A;  2WDR A;  3QVR A;  4FK1 C;  5M0Z A;  4B66 A;  3UKK A;  5J60 A;  1MO9 A;  1PXB A;  5M10 A;  2R9Z A;  4NEV A;  2XVE A;  3ADA B;  3BI2 A;  3UOX A;  4B64 A;  2C3C A;  3DME A;  3M0O A;  4I58 A;  1P2H A;  3QVP A;  4UDQ A;  1CC6 A;  2ACZ A;  2QA1 A;  1ELI A;  1MXT A;  5KVH A;  2WQY A;  2YG3 A;  3VRB A;  3AEB A;  3H8I A;  4Z43 A;  2BS3 A;  4ECH A;  3OZ2 A;  4TM1 A;  2R0P A;  4U8L A;  4CNK A;  3CND A;  4J31 A;  1GER A;  4YKG A;  3AEE A;  1GET A;  3F8R A;  2V5Z A;  4O5U A;  2B7S A;  2VOU A;  3LB8 A;  2YG5 A;  2YWL A;  3ALL A;  3NGC X;  2V61 A;  1OJT A;  3G5Q A;  4OPT A;  3DJJ A;  3IC9 A;  1E39 A;  3AXB A;  4K5R A;  1LPF A;  4A79 A;  2X50 A;  3KKJ A;  5KXJ A;  4IA5 A;  4X9N A;  1REO A;  4OVI A;  3P4S A;  1PXA A;  2C75 A;  1Q1R A;  1NHS A;  3PVC A;  4DSH A;  3WE0 A;  1SEZ A;  2R0C A;  3GYJ A;  5KRQ A;  2X8H A;  4H4Y A;  2W0H A;  2JB1 A;  1KNR A;  4EQR A;  2RGH A;  2WOW A;  3ITJ A;  4JNQ A;  1UKV G;  4K7Z A;  4J57 A;  2WET A;  3NYC A;  5U25 A;  1LTX R;  5KWF A;  2BXR A;  2WPF A;  3UOV A;  3DJG X;  1E7P A;  1NEK A;  3ATR A;  4A6N A;  3H8L A;  3SFD A;  3NYE A;  3ZYX A;  1OJ9 A;  2H89 A;  5EBK A;  3P4P A;  2V6O A;  2XLU A;  2NPX A;  4N9X A;  5KOW A;  5KOX A;  4H4Z A;  4XWR A;  4YTM A;  2Q6U A;  1GSN A;  1GRT A;  1H7X A;  5C3J A;  2WP5 A;  1LJ1 A;  2H88 A;  3RED A;  4CCQ A;  3DK4 A;  1EL8 A;  1B5Q A;  4K8D A;  2XFO A;  2WHD A;  5HHF A;  3FIM B;  4NTC A;  2RGJ A;  3V3O A;  2BC0 A;  1L9C A;  4B67 A;  4UP3 A;  3B6D A;  1NPX A;  4H4X A;  5GSN A;  2Z5X A;  4B68 A;  1L9E A;  3UKA A;  2WS3 A;  4X4J A;  3CNP A;  3AEC A;  1O95 A;  5BUK A;  4WX1 A;  2B7R A;  2B76 A;  3SQP A;  2GR2 A;  1BWC A;  2XFQ A;  1GES A;  3QSM A;  2ZZB A;  2ZBW A;  1GPE A;  5C2T A;  1IUV A;  2B9Y A;  3D8X A;  4AOX A;  3F8D A;  4RG4 A;  5KVI A;  4A5L A;  1AOG A;  1CJ4 A;  3QSS A;  1TDO A;  4K22 A;  3ZDN A;  1GXF A;  1B4V A;  1PDH A;  2QCU A;  1TDF A;  5JCL A;  1CJC A;  2ZZC A;  1GRG A;  4LA1 A;  2VVM A;  3QSE A;  2YVF A;  3AE2 A;  2APG A;  5BUL A;  2VVL G;  1ZDL A;  1OJC A;  3RP7 A;  1F8R A;  2JK6 A;  2WES A;  3NK2 X;  2GVC A;  3JSK A;  3ATQ A;  4CCR A;  2YVJ A;  1NHP A;  2XVJ A;  1H81 A;  3K7M X;  4IV9 A;  4H2Q A;  4CY8 A;  1ZOV A;  1ZKQ A;  1L0V A;  4C3Y A;  3ICS A;  2V60 A;  4J33 A;  5JCN A;  1D7L A;  1GV4 A;  2C76 A;  1QJD A;  4JNA A;  3AE7 A;  3SM8 A;  4TM3 A;  4YSX A;  3NK1 X;  1QLB A;  2B9X A;  2CFY A;  5TR3 A;  2YLS A;  2GEW A;  2VRM A;  1ZMD A;  4IVO B;  5EOW A;  3GD3 A;  1COY A;  1NG4 A;  1YY5 A;  3AD8 B;  4K5S A;  3SGL A;  2XFP A;  2WU2 A;  4UDR A;  2BAB A;  1GTH A;  3GYI A;  3UKF A;  2WU5 A;  2XLP A;  3LOV A;  1K0I A;  4NTE A;  1K0J A;  4PAA A;  1ZMC A;  5FS6 A;  3C96 A;  4TM0 A;  5U1O A;  3GDN A;  2A89 A;  3GRT A;  2UZZ A;  1S2Y A;  1TDE A;  1VG9 A;  3CNS A;  4H4Q A;  4JY3 A;  3CGE A;  3ALM A;  3UTE A;  2BS2 A;  1YQZ A;  1CL0 A;  3AD9 B;  4APN A;  1Q9I A;  1Q1W A;  3NKS A;  5FMH A;  2YG7 A;  4EMW A;  5JCM A;  3KPF A;  3QJ4 A;  3UKQ A;  4H7U A;  4ICY A;  1N4U A;  1DJN A;  2GF3 A;  1FCD A;  4LU6 A;  2AQJ A;  4YT0 A;  3KD9 A;  1GND A;  4NEW A;  2AAQ A;  4Y4N A;  2YQU A;  4BK1 A;  4JQ9 A;  3NT6 A;  2BCG G;  5IQ1 A;  2E5V A;  2BS4 A;  3UCL A;  3DGH A;  2EQ8 A;  4B69 A;  4Z24 A;  4NZH A;  3CPI G;  1XHC A;  2YLX A;  5HYM A;  1GOS A;  1LVL A;  4IA6 A;  2GMH A;  4BK2 A;  1YKJ A;  3Q9T A;  4ZCD A;  4AT2 A;  4YWO A;  3UKL A;  3BI5 A;  2GB0 A;  2C66 A;  2EQ9 A;  2YR5 A;  3R9U A;  1BZL A;  4EM3 A;  3RP6 A;  3PO7 A;  1PBE A;  3NLC A;  4GDE A;  3FMW A;  4H2R A;  1NDA A;  2WDQ A;  4Y4L A;  4OPD A;  1KNP A;  3UP5 A;  3EF6 A;  3KLJ A;  4M52 A;  1RYI A;  3V76 A;  4D04 A;  3ALJ A;  3RNM A;  1KFY A;  1O94 A;  1PJ7 A;  2XFN A;  5CQF A;  3IWA A;  4CY6 A;  2GV8 A;  2GH5 A;  1PJ5 A;  2IVD A;  4LII A;  1TRB A;  4H4W A;  1S3E A;  1ONF A;  1CBO A;  1GRA A;  2C7G A;  1FEB A;  4U8N A;  3S5W A;  3O0H A;  2AR8 A;  1B8S A;  2GAH B;  3CNT A;  4RSL A;  1PBF A;  1PBB A;  1CC2 A;  2YVG A;  4P9S A;  1LV0 A;  4U2T A;  4BJZ A;  4YXD A;  4KPR A;  2QAE A;  2IVE A;  3AEG A;  3CGD A;  4EQX A;  2R4E A;  4K2X A;  2J3N A;  2Q0K A;  1OJA A;  2Y6Q A;  2CUL A;  2WBA A;  2R0G A;  2YR4 A;  3OC4 A;  4OPU A;  3P1W A;  3NIX A;  2EQ6 A;  4JDR A;  3DJE A;  2OAM A;  1KSU A;  3AE9 A;  1XAN A;  4OPC A;  4C77 A;  1CF3 A;  1DOD A;  3ABV A;  5DBJ A;  2I0Z A;  1PN0 A;  2HQM A;  3II4 A;  4PAB A;  4A65 A;  4TLX A;  4B63 A;  2F5Z A;  2FJE A;  2YG6 A;  4X9M A;  4MJW A;  2WOI A;  1D4E A;  1IUW A;  5IQ4 A;  4JN9 A;  4EQW A;  2GAG B;  1E1L A;  1JNR A;  3UOZ A;  3V3N A;  3L1R A;  4EIP A;  3VRA A;  2YLR A;  4J36 A;  1YQ4 A;  3DJD A;  1H82 A;  4H2N A;  1NHQ A;  2FJB A;  3QFA A;  1GRE A;  1H84 A;  1KDG A;  3AYI A;  4YSH A;  2E1M A;  1GRF A;  3AEA A;  4H4S A;  3RHA A;  3CPJ G;  3VR8 A;  2XVI A;  3CIR A;  3C4A A;  1DJQ A;  2BK5 A;  1ZP0 A;  1IUT A;  3UKH A;  4DNA A;  3VQR A;  1JRZ A;  3AE3 A;  3P4Q A;  4U8I A;  2XLR A;  1CC4 A;  4EMJ A;  3KU9 A;  4AP1 A;  2NVK X;  2GRT A;  4H4R A;  1EL5 A;  2ZZ0 A;  4OCG A;  3CN8 A;  3DK9 A;  2X3N A;  1LQT A;  3ICT A;  4D03 A;  3VR9 A;  1DOB A;  3FBS A;  3T37 A;  2YM1 A;  4EMI A;  2RAB A;  3DGZ A;  1Y56 A;  3CPH G;  1W4X A;  2CVJ A;  2XCG A;  1JU2 A;  1JEH A;  2A87 A;  4O5Q A;  3NG7 X;  4REK A;  2XVH A;  3G5S A;  3CNJ A;  4XWZ A;  3UTF A;  4YTN A;  3D1C A;  3LAD A;  1ZOY A;  1S3B A;  2TMD A;  5ER0 A;  3KA7 A;  2C67 A;  4H4P A;  2DKH A;  2XLS A;  4GR1 A;  2XDO A;  3ISH A;  1JNZ A;  2QA2 A;  3ICR A;  3UKP A;  3AE4 A;  4IVM B;  2BK4 A;  1N4W A;  1NG3 A;  2GQF A;  1F6M A;  2WDV A;  5IPY A;  3HZL A;  4ZN0 A;  5BVA A;  3NH3 X;  5EB4 A;  3UP4 A;  4CNJ A;  2VQB A;  2OLO A;  2RGO A;  2ARD A;  4YSY A;  4KX6 A;  3Q6J A;  3C4N A;  2X8G A;  5HY5 A;  4I59 A;  1PJ6 A;  3B3R A;  1VG0 A;  5J7X A;  1JRY A;  2XYO A;  4HA6 A;  3AD7 B;  3NYF A;  1M64 A;  5FS9 A;  1HYU A;  1O5W A;  4GRT A;  4U2L A;  1EL9 A;  1GRH A;  1E1M A;  3AB1 A;  3RP8 A;  3UOY A;  4FX9 A;  2FBW A;  4ZCC A;  1H6V A;  1F8W A;  2BAC A;  2YR6 A;  3PS9 A;  4BV6 A;  2FJA A;  2VVL A;  2JB3 A;  3EPT A;  2Y6R A;  3P4R A;  2YAU A;  1XPQ A;  2BC1 A;  4AOS A;  2BK3 A;  2JAE A;  2PYX A;  3NK0 X;  2XVF A;  5L46 A;  3IF9 A;  2VZ2 A;  1N1P A;  4H4U A;  1DOE A;  1DOC A;  4FK1 A; 
#chains in the Genus database with same CATH topology
 3A7A A;  2C3D A;  2WP9 A;  1SJA A;  2V3A A;  3DFH A;  3DK8 A;  1YEY A;  4Z44 A;  3DES A;  3KVE A;  1CJ2 A;  4U2S A;  2W3R A;  3SZC A;  1E1N A;  2GGE A;  1RSG A;  4JY2 A;  3P9U A;  3TOY A;  1FL2 A;  2B9W A;  1JPD X;  3URH A;  3OZY A;  2GL5 A;  2OA1 A;  5KMQ A;  4U8M A;  4WCT A;  3NNE A;  4YWS A;  3GDP A;  3CK5 A;  1H2I A;  1FEA A;  1BKW A;  4Z2T A;  3FPZ A;  4Z1Y A;  1CHU A;  1IUU A;  1Y0P A;  3UTH A;  2WOV A;  2VRL A;  2DW6 A;  1JCT A;  2OQH A;  1VDC A;  2P8B A;  2XFU A;  1D5T A;  3TW9 A;  3BNU A;  4GF7 A;  1JOA A;  3LJP A;  4HN8 A;  3UJR A;  1E6E A;  3NN6 X;  3LZW A;  4FDC B;  2Q0L A;  1K0L A;  3GWD A;  2PCE A;  2POZ A;  3M13 A;  1PHH A;  3BI4 A;  3EAN A;  3NTA A;  1H7W A;  5LV9 A;  3N4F A;  3UTG A;  2EQ7 A;  1FIQ B;  1MUC A;  3PWG A;  2YM2 A;  5CKU A;  3AE6 A;  3A7U A;  3AE8 A;  3K30 A;  2OPJ A;  4NTD A;  4BJY A;  1QO8 A;  4H50 A;  3VC6 A;  1FEC A;  4B65 A;  4AP3 A;  2XSX A;  3UJF A;  1VDV A;  3LXD A;  4Z25 A;  4GIS A;  1P48 A;  2E4G A;  1X2G A;  3GO2 A;  1EC7 A;  1BGJ A;  3ZVH B;  4H2P A;  4USR A;  1F3P A;  2PSN A;  3STP A;  3HPF A;  4J56 A;  2WEU A;  2P8C A;  5M10 A;  1R6W A;  2XVE A;  3UOX A;  4B64 A;  1WYG A;  4A3R A;  4UDQ A;  1CC6 A;  2QA1 A;  1MXT A;  2BRA A;  3H8I A;  2BS3 A;  4ECH A;  1GER A;  3AEE A;  4O5U A;  1TE6 A;  3G5Q A;  3P3B A;  4OPT A;  3DJJ A;  3IC9 A;  1BQG A;  4K5R A;  1LPF A;  1ONE A;  3P4S A;  4DSH A;  3WE0 A;  2X8H A;  1WUF A;  4H4Y A;  2JB1 A;  4HPN A;  5U25 A;  5KWF A;  1KN0 A;  3ATR A;  1NEK A;  3OW1 A;  3NZG A;  3H8L A;  2H89 A;  2V6O A;  2ZAD A;  3KPK A;  1GSN A;  3VA8 A;  1H7X A;  2GDQ A;  4NTC A;  1T3Q C;  3U9I A;  3V3O A;  4B67 A;  1L9C A;  3B6D A;  4DXK A;  4H4X A;  3UKA A;  4X4J A;  4JN8 A;  5BUK A;  2B7R A;  3V4B A;  3QSM A;  2ZBW A;  3DGB A;  3I6E A;  4K22 A;  3ZDN A;  3NFU A;  1PDH A;  2QCU A;  2HZG A;  1CJC A;  4LA1 A;  2YVF A;  2APG A;  2VVL G;  1ZDL A;  3UXK A;  3UCD A;  4GAP A;  1N63 C;  5KMS A;  3NK2 X;  2QGY A;  2YVJ A;  4IV9 A;  2XVJ A;  3K7M X;  4G9K A;  1ZOV A;  1D7L A;  4TM3 A;  4H2H A;  3NRZ B;  1N62 C;  5EOW A;  4K5S A;  3I4K A;  4UDR A;  1GTH A;  3GYI A;  3EEZ A;  2WU5 A;  2XLP A;  4NTE A;  1K0J A;  4PAA A;  1ELS A;  5U1O A;  2A89 A;  2UZZ A;  3RGT A;  2MNR A;  3CGE A;  2DW7 A;  2BS2 A;  1YQZ A;  3AD9 B;  1Q9I A;  2ONE A;  3P0W A;  3UKQ A;  4H7U A;  4YT0 A;  3SN1 A;  2AAQ A;  4JN7 A;  2HXU A;  2YQU A;  1OEP A;  4JQ9 A;  3FVD A;  3CPI G;  1XHC A;  3Q9T A;  3R1Z A;  2EQ9 A;  3JVA A;  3R9U A;  2AKZ A;  4H2R A;  2WDQ A;  3S5S A;  4Y4L A;  3KLJ A;  5CQF A;  2GV8 A;  2AR8 A;  3UJ2 A;  3CNT A;  1FFV C;  2GAH B;  1VQZ A;  2E5A A;  1E9I A;  3JZU A;  1S7M A;  4KPR A;  3CGD A;  4EQX A;  4E8G A;  2Q0K A;  1OJA A;  2YR4 A;  3OC4 A;  4OPU A;  3P1W A;  3NIX A;  1X2H A;  1KSU A;  1XAN A;  1CF3 A;  1DOD A;  5DBJ A;  3SR6 B;  3II4 A;  4B63 A;  3EKG A;  3Q4D A;  1IUW A;  1E1L A;  4EIP A;  3VRA A;  4J36 A;  1YQ4 A;  4H2N A;  2CHR A;  1H84 A;  4YSH A;  3AEA A;  4H4S A;  3VR8 A;  2XVI A;  3CIR A;  2BK5 A;  1SB3 B;  3A7R A;  4EMJ A;  4AP1 A;  3TWB A;  3VR9 A;  2PPG A;  3SN0 A;  2CVJ A;  1JEH A;  3NG7 X;  3G5S A;  5ER0 A;  3CXO A;  2C67 A;  3ISH A;  2XDO A;  2PGE A;  1JNZ A;  3UKP A;  4II3 A;  1NG3 A;  3D47 A;  5IPY A;  4ZN0 A;  3DIP A;  5BVA A;  2VQB A;  3MY9 A;  2RGO A;  3FYY A;  4KX6 A;  3Q6J A;  3IK4 A;  3B3R A;  1VG0 A;  4K2S A;  1N5W C;  1JRY A;  4HA6 A;  3NVW B;  1HYU A;  1GRH A;  1F8W A;  3PS9 A;  4GYP A;  2BC1 A;  2BK3 A;  5L46 A;  2XVF A;  4H4U A;  3TJ4 A;  2PTW A;  2WP6 A;  3AYJ A;  4BK3 A;  2YLZ A;  1N4V A;  5BOE A;  4U8J A;  3GD6 A;  2C65 A;  4G7F A;  1KKO A;  3AE1 A;  3AWI A;  1FOH A;  4IHC A;  4ADW A;  4Z2U A;  3SZW A;  4E0V A;  1H83 A;  4HNL A;  2OAL A;  2OQY A;  4FI4 A;  2PA6 A;  1EBD A;  2C72 A;  2C64 A;  2VQ7 A;  1E1K A;  3GRS A;  1LQU A;  3NHO X;  1XDI A;  1XPY A;  3F8P A;  3NRN A;  1MNS A;  1GAL A;  3TTE A;  4A6N B;  3NVZ B;  1JRX A;  3G5R A;  1YQ3 A;  1GEU A;  3R07 C;  2BCP A;  3I3L A;  2PP0 A;  4TM4 A;  3BHK A;  4A9W A;  1EL7 A;  3T0K A;  2BYB A;  4EIQ A;  2R4J A;  3DA1 A;  3K7T A;  5EB5 A;  4DSG A;  1DXL A;  1D4D A;  1ZY8 A;  2PTX A;  1IUX A;  2YLT A;  5JCI A;  2HXT A;  1BF3 A;  4DN1 A;  2O9Z A;  2BXS A;  1F8S A;  1KF6 A;  1GTE A;  1NAA A;  3T9P A;  4C5O A;  1GRB A;  2GMJ A;  2GR0 A;  4J1O A;  4RG3 A;  1L9D A;  2GR3 A;  1GT8 A;  1TDN A;  4GIR A;  2W54 A;  5BRT A;  2GQW A;  3DH9 A;  1PS9 A;  2E3T A;  4HCH A;  3NO1 A;  3Q45 A;  4A35 A;  2QQ6 A;  1X31 B;  1V59 A;  3QVR A;  5M0Z A;  5J60 A;  3UKK A;  1MO9 A;  1PXB A;  4ZCW A;  4MMW A;  3DME A;  3M0O A;  4I58 A;  4IZG A;  1P2H A;  1BKH A;  4GGB A;  1ELI A;  3UXL A;  2YG3 A;  3OZ2 A;  4CNK A;  4J31 A;  3DG6 A;  1GET A;  3F8R A;  2V5Z A;  2B7S A;  3MQT A;  3NVY B;  3DDM A;  2YG5 A;  3ES7 A;  3ALL A;  4DYE A;  2V61 A;  1OJT A;  4H1Z A;  4A79 A;  1PXA A;  2R0C A;  3GYJ A;  5KRQ A;  2W0H A;  2RGH A;  1UKV G;  2WET A;  4HNC A;  1LTX R;  2BXR A;  2WPF A;  4A6N A;  3ZYX A;  1OJ9 A;  5EBK A;  4N9X A;  3UCC A;  3SYI A;  1GRT A;  2WP5 A;  3RED A;  4CCQ A;  1EL8 A;  2XFO A;  4K8D A;  4UP3 A;  1L9E A;  5G5H B;  3VFC A;  1O95 A;  4IT1 A;  2B76 A;  2GR2 A;  4HCL A;  1BWC A;  3SQP A;  2ZZB A;  1GPE A;  1IUV A;  3SY4 A;  3D46 A;  1TDO A;  4GGH A;  3RR1 A;  2ZZC A;  3QSE A;  3PK7 A;  3AE2 A;  5BUL A;  1OJC A;  3RP7 A;  1F8R A;  3JSK A;  3ATQ A;  1NHP A;  1ZKQ A;  4C3Y A;  5JCN A;  2C76 A;  4JNA A;  3AE7 A;  3SM8 A;  4YSX A;  1QLB A;  2B9X A;  2CFY A;  3ETR B;  2VRM A;  1ZMD A;  1COY A;  2XFP A;  2POD A;  3SXI A;  3UKF A;  1ZMC A;  2MUC A;  3GRT A;  1KD0 A;  3U4F A;  1CL0 A;  4G73 A;  3NKS A;  5FMH A;  3FJ4 A;  3QJ4 A;  3SX6 A;  1DJN A;  2AQJ A;  4NEW A;  2BCG G;  2E5V A;  2EQ8 A;  4Z24 A;  1YKJ A;  3UKL A;  3BI5 A;  2GB0 A;  3QPE A;  4G6G A;  5J04 A;  4EM3 A;  1PBE A;  3NLC A;  4GDE A;  4OPD A;  1KNP A;  4D04 A;  3ALJ A;  1O94 A;  3IWA A;  1PJ5 A;  2IVD A;  1S3E A;  1CBO A;  4TVY A;  4RSL A;  2OZT A;  1PBB A;  4P9S A;  3FCP A;  4BJZ A;  4KPL A;  3AEG A;  3HYV A;  2R4E A;  4K2X A;  4JHM A;  4JDR A;  1PN0 A;  4PAB A;  4A65 A;  4TLX A;  2GGI A;  2WOI A;  1D4E A;  3TCS A;  4EQW A;  3UOZ A;  1JNR A;  3V3N A;  3L1R A;  2HNE A;  3V5F A;  4ZOH B;  3AN1 A;  7ENL A;  3RHA A;  4GYP C;  3CPJ G;  3SQS A;  3IJI A;  1JRZ A;  3P4Q A;  2XLR A;  3T2K A;  2NVK X;  2GRT A;  4H4R A;  4OCG A;  1FHU A;  3ICT A;  4D03 A;  1DOB A;  3FBS A;  3R10 A;  4FP1 A;  3I6T A;  1JU2 A;  4IP4 A;  2A87 A;  3NXL A;  4REK A;  3CNJ A;  1S3B A;  2TMD A;  3SJN A;  4GR1 A;  3N6J A;  4IVM B;  2BK4 A;  3H8A A;  3UP4 A;  3K1G A;  3GYX A;  4YSY A;  3C4N A;  4I59 A;  1PJ6 A;  5J7X A;  1M64 A;  3SBF A;  1EL9 A;  4ZCC A;  2FJA A;  3EPT A;  3P4R A;  2PYX A;  1DOC A;  4NWZ A;  2DKI A;  2BRY A;  2PP1 A;  3GSI A;  3L8K A;  3MZN A;  4U8K A;  3T6C A;  1VRQ B;  1EBG A;  2A8X A;  2X99 A;  1Y56 B;  1B37 A;  3CXB A;  2OLN A;  2C73 A;  3OPS A;  1JRP A;  3AEF A;  3VRD B;  4OPL A;  2IID A;  2YG4 A;  1NHR A;  2JB2 A;  4J34 A;  5U63 A;  2OFJ A;  3K7Q X;  3BHF A;  2V3B A;  3AYL A;  3HW2 A;  3V5C A;  1NEN A;  3TQP A;  1S2Q A;  1Z6L A;  4DWD A;  1SJB A;  4USQ A;  3GMB A;  4B1B A;  3N6H A;  2FJD A;  3GMC A;  5BOF A;  1SJC A;  2XLT A;  2QJN A;  4GDP A;  1PBC A;  3IHM A;  2GR1 A;  1M6I A;  5JCK A;  3RP6 A;  1VQW A;  4UDP A;  3H4K A;  3H7V A;  4A7A A;  1H86 A;  4OPG A;  3EUB 3;  1MOK A;  3T31 A;  3M12 A;  1ZX9 A;  4TVW A;  3AM9 A;  2PU1 A;  1IJH A;  3BNM A;  1DNC A;  4DGK A;  2ZC8 A;  1PBD A;  3R0K A;  4CBQ A;  3E1T A;  3HYW A;  1D7Y A;  5GRT A;  4C3X A;  4J2W A;  3CTY A;  1P2E A;  2TPR A;  3SZ0 A;  3VC5 A;  4Y4M A;  1IUS A;  5KMP A;  4DX3 A;  4C74 A;  3NTD A;  4YTP A;  1STZ A;  3IHG A;  3B97 A;  2W55 A;  4HB9 A;  3BSM A;  1RVK A;  1TDK A;  2WPE A;  3NS1 B;  2JBV A;  4GAV A;  1EBH A;  4FK1 C;  2OKT A;  4B66 A;  2GGH A;  2R9Z A;  3ADA B;  3BI2 A;  2C3C A;  3BJS A;  2ACZ A;  5KVH A;  2WQY A;  1XS2 A;  3VRB A;  4Z43 A;  2R0P A;  3CND A;  3D9X A;  2VOU A;  3LB8 A;  2YWL A;  1W6T A;  3T4W A;  4IL0 A;  4ENL A;  4E5T A;  2X50 A;  3RRA A;  3KKJ A;  5KXJ A;  4X9N A;  4OVI A;  2C75 A;  1Q1R A;  1SEZ A;  4G6H A;  4EQR A;  3ITJ A;  2WOW A;  4JNQ A;  4K7Z A;  3NYC A;  3PWI A;  3DJG X;  1E7P A;  3NVV B;  2FYM A;  4HCD A;  2XLU A;  5KOX A;  5KOW A;  4XWR A;  1LJ1 A;  3DK4 A;  1B5Q A;  3N4E A;  2BC0 A;  5GSN A;  2Z5X A;  4NNJ A;  3CNP A;  1PDY A;  2XFQ A;  3RIT A;  3F8D A;  4A5L A;  3OZM A;  1AOG A;  3QSS A;  1B4V A;  5JRB A;  2XH4 A;  5JCL A;  1GRG A;  2VVM A;  3HYX A;  4E6M A;  1R0M A;  2JK6 A;  2GVC A;  4MKS A;  4CCR A;  4H2Q A;  1MDL A;  3ICS A;  2V60 A;  4K8G A;  1GV4 A;  1QJD A;  2GEW A;  4IVO B;  3GD3 A;  1YY5 A;  3AD8 B;  3SGL A;  2BAB A;  5FJT A;  3LOV A;  3CMM A;  1K0I A;  3C96 A;  4TM0 A;  3GDN A;  3QTP A;  1TDE A;  3CNS A;  4H4Q A;  1N60 C;  4JY3 A;  3FXG A;  5G5G B;  5FJO A;  1Q1W A;  5IDZ A;  5JCM A;  2I5Q A;  2W3S A;  2AL2 B;  4ICY A;  1FCD A;  3DEQ A;  3KD9 A;  2P88 A;  4BK1 A;  3NT6 A;  5IQ1 A;  2BS4 A;  3UCL A;  4DHG A;  3DGH A;  4B69 A;  2GMH A;  4BK2 A;  3HRD C;  4AT2 A;  3OP2 A;  4YWO A;  3KUM A;  4J3Z A;  3ENL A;  1BZL A;  3PO7 A;  3FMW A;  1NDA A;  4M52 A;  1ECQ A;  1PJ7 A;  2PTZ A;  4LII A;  1TRB A;  1ONF A;  2C7G A;  4U8N A;  1FEB A;  1B8S A;  1MRA A;  1PBF A;  1CC2 A;  4ROP A;  2YVG A;  1LV0 A;  4U2T A;  2IVE A;  1N61 C;  1JDF A;  2R0G A;  3MSY A;  2EQ6 A;  3DJE A;  2OAM A;  4OPC A;  1PDZ A;  4C77 A;  3R25 A;  3ABV A;  3VCC A;  2I0Z A;  2GSH A;  3VDG A;  5KMR A;  3QLD A;  2C4C A;  2YG6 A;  4X9M A;  5IQ4 A;  4JN9 A;  2GAG B;  2YLR A;  1NHQ A;  2QJM A;  2RDX A;  3SZF A;  3AYI A;  1GRF A;  1DJQ A;  1ZP0 A;  4DNA A;  1IYX A;  2PS2 A;  4U8I A;  3OTR A;  4ZA0 A;  3H70 A;  1DTN A;  2ZZ0 A;  4E4F A;  3L5O A;  4EMI A;  2RAB A;  3DGZ A;  1Y56 A;  3CPH G;  1W4X A;  3TWA A;  2XVH A;  4XWZ A;  4G74 A;  4YTN A;  4KEM A;  3D1C A;  3LAD A;  1ZOY A;  3CT2 A;  5FJR A;  3KA7 A;  4H4P A;  2XLS A;  3ICR A;  1TKK A;  1F6M A;  2WDV A;  5EB4 A;  4CNJ A;  4GME A;  2ARD A;  2X8G A;  3AD7 B;  3NYF A;  2QDD A;  5FS9 A;  4GRT A;  3RCY A;  4U2L A;  1E1M A;  3UOY A;  4FX9 A;  2FBW A;  2BAC A;  2YR6 A;  3PG6 A;  4BV6 A;  2VVL A;  2JB3 A;  1XPQ A;  3TJI A;  3T2Z A;  1EC9 A;  1N1P A;  4FK1 A;  3JW7 A;  3ZLG A;  2P3Z A;  4YSZ A;  4A99 A;  2R45 A;  4EWJ A;  3NN0 X;  4U8O A;  3LZX A;  2X8C A;  1P43 A;  2CDU A;  1OJD A;  3COX A;  2BA9 A;  1ZK7 A;  2Q7V A;  1EC8 A;  3GY1 A;  1MDR A;  1TZZ A;  5HXI A;  2QDE A;  4H83 A;  4Z26 A;  4GUV A;  1KKR A;  4EQS A;  3DFY A;  3PFR A;  3EAO A;  1KSS A;  1BGN A;  5FS7 A;  2Z5Y A;  2OZ3 A;  3GD4 A;  3GC2 A;  2PP3 A;  2YLW A;  3B9J B;  5FS8 A;  3UJE A;  3FG2 P;  5EU9 A;  4XXG A;  3SFE A;  4CRT A;  4GCM A;  2AKM A;  3AE5 A;  3THU A;  2R46 A;  3AED A;  2OLA A;  2OG9 A;  4U8P A;  1FHV A;  4BUR A;  1PXC A;  3I6D A;  4X2P A;  1K4Q A;  4TLZ A;  1TYP A;  1RM6 B;  3QFB A;  4EM4 A;  3CGB A;  2WPC A;  1D4C A;  1TYT A;  3RO6 A;  2JKC A;  3R0U A;  4YKF A;  2PHH A;  1JRO A;  2AL1 A;  4AT0 A;  1N5X A;  1CJ3 A;  4KWS A;  4A6G A;  1FO4 A;  2C70 A;  3CB3 A;  3GWF A;  4Z2R A;  1RP0 A;  3S61 A;  3CGC A;  3H12 A;  4H4T A;  4H4V A;  4OPI A;  3P93 A;  2XH0 A;  2WDR A;  4IL2 A;  4NEV A;  3QVP A;  4Z17 A;  2GGG A;  3UJS A;  3AEB A;  4TM1 A;  4U8L A;  4YKG A;  3DER A;  3NGC X;  5FJU A;  1E39 A;  3AXB A;  4IA5 A;  3FV9 A;  1REO A;  3PVC A;  1JPM A;  1NHS A;  3IJL A;  3SSZ A;  3CAW A;  1KNR A;  3S47 A;  4II2 A;  2XH2 A;  4J57 A;  3UOV A;  1NU5 A;  3SFD A;  3NYE A;  1WUE A;  4G8T A;  3P4P A;  2NPX A;  4H4Z A;  4YTM A;  2Q6U A;  4HYR A;  5C3J A;  2H88 A;  4K1W A;  4IP5 A;  2WHD A;  5HHF A;  3FIM B;  2RGJ A;  3DG7 A;  3CYJ A;  1NPX A;  3T2Y A;  4B68 A;  2WS3 A;  3AEC A;  3SN4 A;  4WX1 A;  3T14 A;  1GES A;  2AL2 A;  5C2T A;  2B9Y A;  3D8X A;  4AOX A;  4RG4 A;  5KVI A;  1CJ4 A;  1V97 A;  1GXF A;  2OX4 A;  1TDF A;  1FFU C;  2WES A;  2QVH A;  4CY8 A;  1H81 A;  1SJD A;  1L0V A;  4J33 A;  2PMQ A;  3ZVH A;  3NK1 X;  5TR3 A;  2YLS A;  2PTY A;  1NG4 A;  2WU2 A;  5FJP A;  2GGJ A;  3VCN A;  4MGG A;  5FS6 A;  3V3W A;  3R11 A;  1S2Y A;  1VG9 A;  2OVL A;  3ALM A;  3UTE A;  3ZLF A;  4APN A;  2YG7 A;  4EMW A;  3KPF A;  1N4U A;  2GF3 A;  4LU6 A;  2PU0 A;  1GND A;  4Y4N A;  3QN3 A;  3ZLH A;  4NZH A;  2YLX A;  4KT2 A;  1GOS A;  1LVL A;  4IA6 A;  4ZCD A;  2C66 A;  1KCZ A;  2YR5 A;  4GFI A;  3UP5 A;  3EF6 A;  1RYI A;  3V76 A;  5HYM A;  3RNM A;  1KFY A;  2XFN A;  2GH5 A;  4E4U A;  3T8Q A;  4H4W A;  1GRA A;  3S5W A;  2OZ8 A;  3O0H A;  2OO6 A;  4M0X A;  4YXD A;  2QAE A;  2J3N A;  5ENL A;  2Y6Q A;  2CUL A;  2WBA A;  3AE9 A;  2HQM A;  2F5Z A;  2FJE A;  3DG3 A;  4MJW A;  1ZXI C;  2QJJ A;  3DJD A;  1H82 A;  2FJB A;  3QFA A;  1GRE A;  2FKP A;  3MKC A;  2XGZ A;  1KDG A;  2E1M A;  1L8P A;  3UGV A;  3C4A A;  3UKH A;  1IUT A;  3VQR A;  3AE3 A;  1CC4 A;  2PGW A;  3ZVI A;  3KU9 A;  1NEL A;  4F4R A;  1EL5 A;  3CN8 A;  3DK9 A;  2X3N A;  1LQT A;  3MUC A;  4H19 A;  3T37 A;  2YM1 A;  3MWC A;  2XCG A;  4O5Q A;  3QKE A;  2O56 A;  3UTF A;  1F9C A;  2DKH A;  4CY6 A;  2QA2 A;  3AE4 A;  1N4W A;  2GQF A;  3AMZ A;  2XH7 A;  3HZL A;  3NH3 X;  2OLO A;  2P0I A;  5HY5 A;  2NQL A;  2XYO A;  5KNL A;  6ENL A;  1O5W A;  3ES8 A;  3BOX A;  3AB1 A;  3RP8 A;  1H6V A;  2Y6R A;  4M6U A;  2YAU A;  4AOS A;  3IJQ A;  2JAE A;  3NK0 X;  3IF9 A;  2VZ2 A;  1DOE A; 
#chains in the Genus database with same CATH homology
 2DKI A;  2BRY A;  3GSI A;  2WP6 A;  3AYJ A;  4BK3 A;  3L8K A;  2YLZ A;  4YSZ A;  1N4V A;  4A99 A;  4U8K A;  2R45 A;  2C3D A;  2WP9 A;  2V3A A;  1VRQ B;  3NN0 X;  4U8O A;  3LZX A;  2X8C A;  4U8J A;  2CDU A;  2C65 A;  2A8X A;  3DK8 A;  1OJD A;  4Z44 A;  3COX A;  2X99 A;  1Y56 B;  3AE1 A;  3AWI A;  3KVE A;  1B37 A;  1FOH A;  4ADW A;  1CJ2 A;  2BA9 A;  4U2S A;  4Z2U A;  3SZC A;  1ZK7 A;  2Q7V A;  3SZW A;  1E1N A;  2OLN A;  4NWZ A;  1RSG A;  4JY2 A;  2C73 A;  1H83 A;  4E0V A;  3P9U A;  3AEF A;  3VRD B;  1FL2 A;  4OPL A;  2B9W A;  2OAL A;  2IID A;  2YG4 A;  3URH A;  5HXI A;  1NHR A;  4Z26 A;  4GUV A;  2JB2 A;  4J34 A;  1EBD A;  5U63 A;  2OA1 A;  5KMQ A;  2C72 A;  4EQS A;  3BHF A;  3K7Q X;  4U8M A;  2C64 A;  2VQ7 A;  1E1K A;  2V3B A;  3EAO A;  3AYL A;  4WCT A;  3GRS A;  1KSS A;  1BGN A;  1NEN A;  5FS7 A;  2Z5Y A;  3NNE A;  1LQU A;  1S2Q A;  3NHO X;  3GD4 A;  1Z6L A;  1XDI A;  2YLW A;  3GDP A;  4USQ A;  1H2I A;  1FEA A;  1BKW A;  3F8P A;  3GMB A;  4Z2T A;  3FPZ A;  1CHU A;  1IUU A;  3NRN A;  5FS8 A;  1GAL A;  4A6N B;  3FG2 P;  1Y0P A;  3UTH A;  1JRX A;  4B1B A;  4XXG A;  3SFE A;  3G5R A;  2WOV A;  1YQ3 A;  2VRL A;  1GEU A;  4CRT A;  2FJD A;  2BCP A;  3GMC A;  3I3L A;  4TM4 A;  3BHK A;  4A9W A;  4GCM A;  1VDC A;  2XFU A;  1EL7 A;  3T0K A;  2XLT A;  3AE5 A;  1D5T A;  2BYB A;  3BNU A;  4GDP A;  4GF7 A;  1PBC A;  1JOA A;  2R46 A;  3AED A;  3IHM A;  4EIQ A;  2GR1 A;  1M6I A;  3LJP A;  4U8P A;  1E6E A;  3NN6 X;  3LZW A;  5JCK A;  4FDC B;  4BUR A;  1VQW A;  1PXC A;  2Q0L A;  1K0L A;  2R4J A;  3DA1 A;  3H4K A;  3GWD A;  3I6D A;  4UDP A;  4A7A A;  1H86 A;  3K7T A;  4OPG A;  5EB5 A;  1K4Q A;  3M13 A;  1MOK A;  4DSG A;  1PHH A;  3T31 A;  3BI4 A;  3EAN A;  3M12 A;  1DXL A;  3NTA A;  4TLZ A;  1TYP A;  1ZX9 A;  1H7W A;  5LV9 A;  3UTG A;  1D4D A;  1ZY8 A;  2EQ7 A;  3QFB A;  4EM4 A;  1IJH A;  1IUX A;  3CGB A;  2YLT A;  2YM2 A;  3BNM A;  5CKU A;  2WPC A;  1DNC A;  5JCI A;  3AE6 A;  1D4C A;  1BF3 A;  3AE8 A;  3K30 A;  1TYT A;  2O9Z A;  2JKC A;  4DGK A;  1PBD A;  2BXS A;  4NTD A;  4CBQ A;  4BJY A;  3E1T A;  1F8S A;  1KF6 A;  4YKF A;  3HYW A;  1D7Y A;  1GTE A;  2PHH A;  1QO8 A;  4AT0 A;  1NAA A;  4H50 A;  5GRT A;  1FEC A;  4B65 A;  4AP3 A;  4C3X A;  1CJ3 A;  4C5O A;  1GRB A;  4J2W A;  2GMJ A;  3LXD A;  3CTY A;  2GR0 A;  2TPR A;  1P2E A;  3SZ0 A;  4Z25 A;  2C70 A;  4Y4M A;  2E4G A;  3GWF A;  1IUS A;  5KMP A;  4RG3 A;  1BGJ A;  1L9D A;  2GR3 A;  4Z2R A;  4H2P A;  1GT8 A;  4USR A;  1RP0 A;  4C74 A;  1TDN A;  3NTD A;  3S61 A;  3CGC A;  5BRT A;  1F3P A;  2GQW A;  3DH9 A;  4YTP A;  4H4T A;  4H4V A;  1PS9 A;  3IHG A;  4OPI A;  4HB9 A;  1TDK A;  2WPE A;  4J56 A;  1X31 B;  4GAV A;  2JBV A;  1V59 A;  2WEU A;  2WDR A;  3QVR A;  4FK1 C;  5M0Z A;  4B66 A;  3UKK A;  5J60 A;  1MO9 A;  1PXB A;  5M10 A;  2R9Z A;  4NEV A;  2XVE A;  3ADA B;  3BI2 A;  3UOX A;  4B64 A;  2C3C A;  3DME A;  3M0O A;  4I58 A;  1P2H A;  3QVP A;  4UDQ A;  1CC6 A;  2ACZ A;  2QA1 A;  1ELI A;  1MXT A;  5KVH A;  2WQY A;  2YG3 A;  3VRB A;  2BRA A;  3AEB A;  3H8I A;  4Z43 A;  2BS3 A;  4ECH A;  3OZ2 A;  4TM1 A;  2R0P A;  4U8L A;  4CNK A;  3CND A;  4J31 A;  1GER A;  4YKG A;  3AEE A;  1GET A;  3F8R A;  2V5Z A;  4O5U A;  2B7S A;  3D9X A;  2VOU A;  3LB8 A;  2YG5 A;  2YWL A;  3ALL A;  3NGC X;  2V61 A;  1OJT A;  3G5Q A;  4OPT A;  3DJJ A;  3IC9 A;  1E39 A;  3AXB A;  4K5R A;  1LPF A;  4A79 A;  2X50 A;  3KKJ A;  5KXJ A;  4IA5 A;  4X9N A;  1REO A;  4OVI A;  3P4S A;  1PXA A;  2C75 A;  1Q1R A;  1NHS A;  3PVC A;  4DSH A;  3WE0 A;  1SEZ A;  2R0C A;  3GYJ A;  4G6H A;  5KRQ A;  2X8H A;  4H4Y A;  2W0H A;  2JB1 A;  1KNR A;  4EQR A;  2RGH A;  2WOW A;  3ITJ A;  4JNQ A;  4II2 A;  1UKV G;  4K7Z A;  4J57 A;  2WET A;  3NYC A;  5U25 A;  1LTX R;  5KWF A;  2BXR A;  2WPF A;  1KN0 A;  3DJG X;  1E7P A;  1NEK A;  3ATR A;  3UOV A;  4A6N A;  3H8L A;  3SFD A;  3NYE A;  3ZYX A;  1OJ9 A;  2H89 A;  5EBK A;  3P4P A;  2V6O A;  2XLU A;  2NPX A;  4N9X A;  5KOW A;  5KOX A;  4H4Z A;  4XWR A;  4YTM A;  2Q6U A;  1GSN A;  1GRT A;  1H7X A;  3KPK A;  3SYI A;  2WP5 A;  5C3J A;  1LJ1 A;  2H88 A;  3RED A;  4CCQ A;  3DK4 A;  1EL8 A;  1B5Q A;  4K8D A;  2XFO A;  2WHD A;  5HHF A;  3FIM B;  4NTC A;  2RGJ A;  3V3O A;  2BC0 A;  1L9C A;  4B67 A;  4UP3 A;  3B6D A;  1NPX A;  4H4X A;  5GSN A;  3T2Y A;  2Z5X A;  4B68 A;  1L9E A;  3UKA A;  2WS3 A;  4NNJ A;  4X4J A;  3CNP A;  3AEC A;  1O95 A;  5BUK A;  4WX1 A;  2B7R A;  2B76 A;  3SQP A;  2GR2 A;  1BWC A;  2XFQ A;  3T14 A;  1GES A;  3QSM A;  2ZZB A;  2ZBW A;  1GPE A;  5C2T A;  1IUV A;  2B9Y A;  3D8X A;  4AOX A;  3F8D A;  4RG4 A;  5KVI A;  3SY4 A;  1AOG A;  1CJ4 A;  3QSS A;  1TDO A;  4K22 A;  3ZDN A;  1GXF A;  4A5L A;  1B4V A;  1PDH A;  2QCU A;  5JRB A;  1TDF A;  5JCL A;  1CJC A;  2ZZC A;  1GRG A;  4LA1 A;  2VVM A;  3QSE A;  2YVF A;  3HYX A;  3AE2 A;  2APG A;  5BUL A;  2VVL G;  1ZDL A;  1OJC A;  4GAP A;  3RP7 A;  1F8R A;  5KMS A;  2JK6 A;  2WES A;  3NK2 X;  2GVC A;  3JSK A;  3ATQ A;  4CCR A;  2YVJ A;  1NHP A;  2XVJ A;  1H81 A;  3K7M X;  4IV9 A;  4H2Q A;  4CY8 A;  4G9K A;  1ZOV A;  1ZKQ A;  1L0V A;  4C3Y A;  3ICS A;  2V60 A;  4J33 A;  5JCN A;  1D7L A;  1GV4 A;  2C76 A;  1QJD A;  4JNA A;  3AE7 A;  3SM8 A;  4TM3 A;  4YSX A;  3NK1 X;  1QLB A;  2B9X A;  2CFY A;  5TR3 A;  2YLS A;  2GEW A;  2VRM A;  1ZMD A;  4IVO B;  5EOW A;  3GD3 A;  1COY A;  1NG4 A;  1YY5 A;  3AD8 B;  4K5S A;  3SGL A;  2XFP A;  2WU2 A;  4UDR A;  2BAB A;  1GTH A;  3GYI A;  3SXI A;  2WU5 A;  2XLP A;  3LOV A;  3CMM A;  3UKF A;  1K0I A;  4NTE A;  1K0J A;  4PAA A;  1ZMC A;  5FS6 A;  3C96 A;  4TM0 A;  5U1O A;  3GDN A;  2A89 A;  3GRT A;  2UZZ A;  1S2Y A;  1TDE A;  1VG9 A;  3CNS A;  4H4Q A;  4JY3 A;  3CGE A;  3ALM A;  3UTE A;  2BS2 A;  1YQZ A;  1CL0 A;  3AD9 B;  4APN A;  1Q9I A;  1Q1W A;  4G73 A;  3NKS A;  5FMH A;  2YG7 A;  4EMW A;  5JCM A;  3KPF A;  3QJ4 A;  3SX6 A;  3UKQ A;  4H7U A;  4ICY A;  1N4U A;  1DJN A;  2GF3 A;  1FCD A;  4LU6 A;  2AQJ A;  4YT0 A;  3KD9 A;  1GND A;  4NEW A;  2AAQ A;  4Y4N A;  2YQU A;  4BK1 A;  4JQ9 A;  3NT6 A;  2BCG G;  5IQ1 A;  2E5V A;  2BS4 A;  3UCL A;  3DGH A;  2EQ8 A;  4B69 A;  4Z24 A;  4NZH A;  3CPI G;  1XHC A;  2YLX A;  5HYM A;  1GOS A;  1LVL A;  4IA6 A;  2GMH A;  4BK2 A;  1YKJ A;  3Q9T A;  4ZCD A;  4AT2 A;  4YWO A;  3UKL A;  3BI5 A;  2GB0 A;  4G6G A;  2C66 A;  2EQ9 A;  2YR5 A;  3R9U A;  1BZL A;  4EM3 A;  3RP6 A;  3PO7 A;  1PBE A;  3NLC A;  4GDE A;  3FMW A;  4H2R A;  1NDA A;  2WDQ A;  4Y4L A;  4OPD A;  1KNP A;  3UP5 A;  3EF6 A;  3KLJ A;  4M52 A;  1RYI A;  3V76 A;  4D04 A;  3ALJ A;  3RNM A;  1KFY A;  1O94 A;  1PJ7 A;  2XFN A;  5CQF A;  3IWA A;  4CY6 A;  2GV8 A;  2GH5 A;  1PJ5 A;  2IVD A;  4LII A;  1TRB A;  4H4W A;  1S3E A;  1ONF A;  1CBO A;  1GRA A;  2C7G A;  1FEB A;  4U8N A;  3S5W A;  3O0H A;  2AR8 A;  1B8S A;  2GAH B;  3CNT A;  4RSL A;  1PBF A;  1PBB A;  1CC2 A;  2YVG A;  4P9S A;  1LV0 A;  4U2T A;  4BJZ A;  1S7M A;  4YXD A;  4KPR A;  2QAE A;  2IVE A;  3AEG A;  3CGD A;  4EQX A;  3HYV A;  2R4E A;  4K2X A;  2J3N A;  2Q0K A;  1OJA A;  2Y6Q A;  2CUL A;  2WBA A;  2R0G A;  2YR4 A;  3OC4 A;  4OPU A;  3P1W A;  3NIX A;  2EQ6 A;  4JDR A;  3DJE A;  2OAM A;  1KSU A;  3AE9 A;  1XAN A;  4OPC A;  4C77 A;  1CF3 A;  1DOD A;  3ABV A;  5DBJ A;  2I0Z A;  1PN0 A;  2HQM A;  3II4 A;  4PAB A;  4A65 A;  5KMR A;  4TLX A;  4B63 A;  2F5Z A;  2FJE A;  2C4C A;  2YG6 A;  4X9M A;  4MJW A;  2WOI A;  1D4E A;  1IUW A;  5IQ4 A;  4JN9 A;  4EQW A;  2GAG B;  1E1L A;  1JNR A;  3UOZ A;  3V3N A;  3L1R A;  4EIP A;  3VRA A;  2YLR A;  4J36 A;  1YQ4 A;  3DJD A;  1H82 A;  4H2N A;  1NHQ A;  2FJB A;  3QFA A;  1GRE A;  3SZF A;  1H84 A;  1KDG A;  3AYI A;  4YSH A;  2E1M A;  1GRF A;  3AEA A;  4H4S A;  3RHA A;  3CPJ G;  3VR8 A;  2XVI A;  3CIR A;  3C4A A;  1DJQ A;  2BK5 A;  1ZP0 A;  1IUT A;  3UKH A;  4DNA A;  3VQR A;  1JRZ A;  3AE3 A;  3P4Q A;  4U8I A;  2XLR A;  3T2K A;  1CC4 A;  4EMJ A;  3KU9 A;  4AP1 A;  2NVK X;  2GRT A;  4H4R A;  1EL5 A;  2ZZ0 A;  4OCG A;  3CN8 A;  3DK9 A;  2X3N A;  1LQT A;  3ICT A;  3L5O A;  4D03 A;  3VR9 A;  1DOB A;  3FBS A;  3T37 A;  2YM1 A;  4EMI A;  2RAB A;  3DGZ A;  1Y56 A;  3CPH G;  1W4X A;  2CVJ A;  2XCG A;  1JU2 A;  1JEH A;  2A87 A;  4O5Q A;  3NG7 X;  4REK A;  2XVH A;  3G5S A;  3CNJ A;  4XWZ A;  3UTF A;  4G74 A;  4YTN A;  3D1C A;  3LAD A;  1ZOY A;  1S3B A;  2TMD A;  5ER0 A;  3KA7 A;  2C67 A;  4H4P A;  2DKH A;  2XLS A;  4GR1 A;  2XDO A;  3ISH A;  1JNZ A;  2QA2 A;  3ICR A;  3UKP A;  3AE4 A;  4IVM B;  4II3 A;  2BK4 A;  1N4W A;  1NG3 A;  2GQF A;  1F6M A;  2WDV A;  5IPY A;  3HZL A;  4ZN0 A;  5BVA A;  3NH3 X;  5EB4 A;  3UP4 A;  4CNJ A;  2VQB A;  2OLO A;  2RGO A;  3GYX A;  2ARD A;  4YSY A;  4KX6 A;  3Q6J A;  3C4N A;  2X8G A;  5HY5 A;  4I59 A;  1PJ6 A;  3B3R A;  1VG0 A;  5J7X A;  1JRY A;  2XYO A;  4HA6 A;  3AD7 B;  3NYF A;  1M64 A;  5KNL A;  5FS9 A;  1HYU A;  1O5W A;  4GRT A;  4U2L A;  1EL9 A;  1GRH A;  1E1M A;  3AB1 A;  3RP8 A;  3UOY A;  4FX9 A;  2FBW A;  4ZCC A;  1H6V A;  1F8W A;  2BAC A;  2YR6 A;  3PG6 A;  3PS9 A;  4BV6 A;  2FJA A;  2VVL A;  2JB3 A;  3EPT A;  2Y6R A;  3P4R A;  2YAU A;  1XPQ A;  2BC1 A;  4AOS A;  2BK3 A;  2JAE A;  2PYX A;  3NK0 X;  2XVF A;  3T2Z A;  5L46 A;  3IF9 A;  2VZ2 A;  1N1P A;  4H4U A;  1DOE A;  1DOC A;  4FK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...