3GD3A

Crystal structure of a naturally folded murine apoptosis inducing factor
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
483
structure length
463
Chain Sequence
b'PSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLQFRQWNGKERSIYFQPPSFYVSAQDLPNIENGGVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRALEKISREVKSITVIGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKILPQYLSNWTMEKVKREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEADYGKGVIFYLRDKVVVGIVLWNVFNRMPIARKIIKDGEQHEDLNEVAKLFNIH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apoptosis-inducing factor 1, mitochondrial
publication title Redox-linked conformational dynamics in apoptosis-inducing factor
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 138
structure length 463
sequence length 483
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3gd3A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3gd3A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3gd3A01
4X4JA 4TM1A 4H4RA 2OAMA 2GB0A 4DGKA 5EB5A 3PS9A 4B67A 5KRQA 4D03A 1ZOVA 3UKAA 4U8OA 1IUWA 2V3BA 3NIXA 1GESA 1V59A 3NNEA 3CNTA 4A79A 2CVJA 2RGHA 4C77A 3E1TA 3DJGX 4XWRA 2C76A 1K0IA 3KPFA 2XCGA 1E6EA 2DKIA 1M64A 1H86A 1TDFA 3KKJA 1PJ7A 1DJQA 1QJDA 4BJZA 4Z2UA 2JAEA 4EM3A 4H50A 1KSUA 2R0PA 1D4CA 1Y56A 2WHDA 3F8DA 2WDRA 4H2PA 4J2WA 4OPLA 3UKFA 4A7AA 2TPRA 4H4SA 1F6MA 4OVIA 4EIPA 2X8GA 2WOIA 2DKHA 3RNMA 4H2QA 2FJDA 4U8JA 2WU5A 2XVJA 1F3PA 3KU9A 2E5VA 4TLZA 1RP0A 4A65A 3AEEA 2BCGG 4GR1A 1BGJA 3DGZA 3AEAA 2V60A 3KVEA 5ER0A 1TYPA 3GDPA 4B66A 3AB1A 5KXJA 1DJNA 2ARDA 3DK9A 1TDNA 2YVJA 4NTDA 4A5LA 2JB2A 3NK0X 2XLRA 2A8XA 1ZP0A 3RP6A 4USQA 3M13A 2WDVA 2C3CA 5EB4A 1TDKA 3T37A 3DK4A 1VDCA 1PBCA 3P4PA 3NLCA 4H2RA 1H6VA 3GRTA 3V3OA 1LQTA 1IUXA 1EL9A 1F8RA 3G5QA 3QVRA 2NVKX 3NYFA 1OJTA 2BK3A 1SEZA 2OLOA 5FS8A 5JCKA 4XXGA 4EIQA 3S61A 4CY6A 3ALJA 1IUTA 1N4VA 1QLBA 4H2NA 1L9CA 2YG6A 4O5QA 1GRTA 3VRAA 5GSNA 5BUKA 2GH5A 3AYLA 3I6DA 2XVEA 4REKA 2JB3A 2BXSA 4Z44A 1NG4A 3H4KA 4IA5A 1P2HA 2VRMA 3UOYA 2YVFA 3UTFA 2GR2A 3V76A 3B6DA 2VVMA 3FG2P 1YQ4A 1B37A 2VVLA 3FPZA 5EOWA 3JSKA 4FX9A 4LIIA 1D4DA 1KDGA 4AT0A 3IF9A 1GRGA 3NN0X 2B9WA 3P4RA 1GSNA 4B68A 4J56A 3EAOA 1PJ6A 2YG5A 4UDQA 2Y6RA 2OALA 3FBSA 2XVFA 4BK1A 4C3XA 1VG9A 4CNJA 2GAGB 4C74A 2GR1A 2C75A 2EQ9A 2Q0LA 3SQPA 1JRXA 4FK1C 4OPCA 2AQJA 2EQ6A 3ZDNA 2IVEA 2XLUA 1JOAA 3BHKA 1N1PA 3GWFA 2YM2A 4GDPA 4WX1A 5JCIA 2JB1A 3GWDA 3ICTA 3P9UA 3P4QA 1H84A 4E0VA 1NAAA 3NTDA 2CFYA 3DK8A 1B4VA 3AE6A 1MOKA 2Y6QA 4X9NA 3QJ4A 3IC9A 4A99A 4ICYA 4Z2TA 2VZ2A 2YG7A 4APNA 1GREA 4UP3A 3B3RA 4H4XA 4LA1A 4H4PA 1CJ3A 3AXBA 1PXAA 1FEAA 1XANA 5JCMA 1GNDA 2ZBWA 5BVAA 3RP7A 1H83A 3QVPA 4PAAA 4AOXA 5C3JA 1L9EA 3K7TA 2YG4A 3NGCX 5JCLA 1EL7A 3AWIA 3REDA 2V5ZA 3ITJA 1TDOA 2BS3A 2WU2A 4YSXA 2JK6A 3UOXA 3PVCA 3EANA 2C64A 1KNRA 3AEFA 3QSEA 3CN8A 3LXDA 4DNAA 2AAQA 5BRTA 3ZYXA 1PJ5A 2B7RA 1F8SA 1JRYA 3ICRA 4IV9A 4A9WA 2YAUA 5HY5A 4GUVA 5U1OA 2GF3A 1DOCA 4OCGA 4U2SA 5L46A 3CNSA 2VQBA 2BYBA 3QFBA 5U63A 4OPTA 1LJ1A 1OJAA 1RYIA 2R9ZA 3UCLA 4BK3A 2YR5A 1ZK7A 1K4QA 4BJYA 3LADA 4JDRA 3QSMA 1TDEA 3LZXA 3H8LA 3AECA 1GERA 1BWCA 4J34A 1OJ9A 4H4YA 3NH3X 5KOXA 2R46A 1UKVG 3VRBA 3CNPA 3UTEA 3DJJA 1M6IA 1N4UA 2YR6A 3FIMB 3NYCA 4K5SA 4P9SA 1GRAA 3AEDA 3OC4A 1CC4A 3NG7X 1GXFA 3AD7B 3F8PA 2WQYA 4YSYA 3VR9A 2YLZA 4BK2A 1QO8A 4B1BA 4H4TA 1GTHA 2H89A 5C2TA 4U8LA 4PABA 4TM4A 2QCUA 4K7ZA 4H4UA 4EQRA 1IUSA 3AE3A 4U8PA 2FJBA 5FS9A 4YKGA 4O5UA 4C3YA 3I3LA 3M12A 2PHHA 2YVGA 3SM8A 2XVIA 1CJCA 5IQ4A 1D7YA 1GRBA 5FS6A 4U8NA 4ZCCA 1H82A 2WPEA 4J57A 3O0HA 2WESA 2IVDA 4B63A 2WPCA 2CDUA 2WETA 2GQFA 4H7UA 3AEGA 1ZX9A 3AE1A 5BULA 4USRA 1ZY8A 1GOSA 2YM1A 3NN6X 1GETA 1GRFA 2F5ZA 3EF6A 2B76A 1HYUA 2GV8A 1S2YA 4J36A 2C66A 3NKSA 2UZZA 2WS3A 4HA6A 1LTXR 3PO7A 4NTEA 1LVLA 5M10A 2VQ7A 3KD9A 4K22A 1FOHA 3UKQA 3GD3A 3ATQA 4GDEA 1VQWA 3M0OA 1FCDA 4Z25A 5HHFA 3II4A 3P4SA 4HB9A 2RGJA 2VRLA 3D1CA 1OJDA 1NEKA 3AE4A 3SFEA 4K5RA 2YG3A 3VRDB 1H7XA 1MXTA 3URHA 1Q9IA 4OPGA 1CC6A 2XLPA 2GRTA 3ALLA 1NHRA 4IVOB 4J33A 4RG3A 4OPUA 3CTYA 4UDRA 2C70A 2WDQA 4TLXA 1X31B 1IUUA 1D7LA 2XLSA 1CL0A 2A89A 3BHFA 4K2XA 5M0ZA 1PBBA 3BNMA 3SFDA 1TRBA 3WE0A 4RG4A 1D5TA 2WEUA 2YLTA 3ISHA 4CRTA 4H4ZA 4OPDA 2BS4A 1GALA 1GPEA 3IWAA 1W4XA 3L1RA 1ZDLA 4YWOA 2YWLA 3QSSA 3ABVA 3NK2X 2XFQA 3K30A 1TYTA 3UKLA 2FJAA 4GRTA 5TR3A 1JRZA 3AE8A 3AE2A 3GMCA 2BA9A 3DMEA 4XWZA 4NEVA 4GF7A 4AT2A 2RGOA 3C96A 3UTHA 3CPHG 4Y4MA 1H7WA 3CIRA 3DJEA 1FL2A 1S3EA 3BI2A 3UP4A 2OLNA 5CKUA 3Q9TA 4ECHA 1KNPA 2APGA 4K8DA 1B8SA 2QAEA 4BV6A 2XVHA 2R4EA 1DNCA 3NHOX 5IQ1A 3CGEA 2B9YA 1E1KA 1B5QA 1FEBA 2TMDA 3QFAA 1ZKQA 3OZ2A 1BF3A 1MO9A 2OA1A 2Z5XA 1GTEA 1O5WA 4JY2A 1PDHA 1EL5A 5HXIA 2YLXA 4Y4NA 1KFYA 2Q0KA 2XLTA 2BC1A 1E7PA 4YT0A 2E4GA 4Z24A 3UKPA 1N4WA 2WPFA 2VVLG 1PBDA 5FS7A 4CCQA 3NK1X 2XDOA 3CGDA 1XHCA 2A87A 4X9MA 2FJEA 4YTMA 2GR3A 5DBJA 1Q1WA 3K7MX 3BI4A 1DOEA 5J60A 3AE5A 2WOWA 2XFPA 2WP9A 3CNDA 2GEWA 3UKKA 4AP1A 3CPJG 4AP3A 4KX6A 3UP5A 2C7GA 4D04A 3NT6A 3V3NA 4Z2RA 2YLWA 2NPXA 2C67A 4B64A 5KWFA 3P1WA 1OJCA 3GDNA 3DH9A 3UTGA 2V6OA 2XFUA 4CY8A 2EQ7A 1XDIA 4YTPA 3SGLA 2RABA 1Y0PA 4WCTA 2GVCA 2YR4A 4JNAA 4A6NB 1EL8A 4EQXA 2R45A 4DSHA 2Q6UA 3C4NA 3IHMA 3LZWA 2QA1A 4NZHA 2B7SA 4CBQA 1NHSA 4I59A 5U25A 2X99A 4Z26A 1KF6A 3CPIG 1CF3A 1E1MA 4LU6A 2J3NA 3ICSA 2WP6A 3RHAA 1O94A 1NPXA 1YY5A 3LJPA 4CNKA 3FMWA 1PHHA 2C3DA 4FDCB 1L0VA 5KOWA 4M52A 2O9ZA 2VOUA 2CULA 3G5SA 4IVMB 4RSLA 1F8WA 4FK1A 4CCRA 3KLJA 4YSHA 1YQ3A 1AOGA 4EMJA 2GAHB 2PYXA 5HYMA 1FECA 1RSGA 2Q7VA 3K7QX 2XYOA 2BK5A 2X50A 4H4VA 4NEWA 2B9XA 4B65A 3AE9A 3AEBA 3BNUA 1NDAA 2ZZBA 4KPRA 3GRSA 2H88A 1CHUA 3CNJA 3UKHA 4C5OA 1S3BA 3C4AA 3G5RA 4ZN0A 2GR0A 1BGNA 3AD9B 2I0ZA 3AYIA 4JN9A 1CC2A 2XFOA 2BXRA 1DXLA 1JNRA 2ZZCA 1E39A 4ZCDA 3ADAB 3GYIA 2V3AA 4U8KA 4UDPA 3DGHA 4Y4LA 3AYJA 1GT8A 2W0HA 4I58A 1ZMDA 1CJ4A 1IJHA 1XPQA 2R0CA 1BZLA 3GSIA 5GRTA 4YXDA 1PS9A 4U8MA 3D8XA 5EBKA 2GMHA 1GRHA 3UOVA 3VR8A 3F8RA 4B69A 4JQ9A 1VRQB 4J31A 1BKWA 5JCNA 3ALMA 1CBOA 1ZOYA 4U2LA 1JU2A 4H4QA 5FMHA 1VG0A 3RP8A 5IPYA 1LPFA 3L8KA 1P2EA 1S2QA 3H8IA 4N9XA 3CGBA 2YLRA 3GMBA 4ADWA 2WP5A 2V61A 4JNQA 4A6NA 5KVIA 2GQWA 2C65A 3HZLA 2R4JA 3COXA 4EMIA 1PXBA 4BURA 3NYEA 2EQ8A 1COYA 1ELIA 4YSZA 1GEUA 4H4WA 1Y56B 1EBDA 1K0JA 1JNZA 3KA7A 1E1NA 1KSSA 2IIDA 1DODA 4MJWA 4U8IA 3NRNA 2BK4A 4IA6A 3DJDA 1REOA 1NG3A 1PBFA 4GCMA 2YLSA 4EQWA 2C72A 2HQMA 1ZMCA 1D4EA 2JKCA 4DSGA 3BI5A 2X8CA 2ACZA 2X3NA 4NTCA 1K0LA 2WBAA 2Z5YA 2WOVA 2C73A 3LOVA 3LB8A 3R9UA 3EPTA 2BABA 1NENA 4Z43A 2YQUA 4JY3A 2ZZ0A 4AOSA 3GYJA 4TM0A 3S5WA 3VQRA 3GD4A 2BACA 1IUVA 1LV0A 2BS2A 2BC0A 1ONFA 4EM4A 1L9DA 1YKJA 4OPIA 2R0GA 2GMJA 5J7XA 1PXCA 4YTNA 1PN0A 3CGCA 1H81A 2AR8A 3AE7A 3Q6JA 1NHPA 1YQZA 3DA1A 1DOBA 2JBVA 5LV9A 4EQSA 4TM3A 4YKFA 2BCPA 1LQUA 5KVHA 1Z6LA 5CQFA 3ATRA 1NHQA 4U2TA 2XFNA 1JEHA 1GV4A 1O95A 2FBWA 2E1MA 1E1LA 3UOZA 3AD8B 2X8HA 4EMWA 1CJ2A 1PBEA 2QA2A 3IHGA 1Q1RA 3NTAA
chains in the Genus database with same CATH superfamily
2QJJA 3R11A 4H4RA 3T14A 5EB5A 4U8OA 3CNTA 4A79A 2CVJA 2RGHA 4C77A 3KPFA 1K0IA 3SN1A 1DTNA 4BJZA 2JAEA 4H50A 1D4CA 1Y56A 1N61C 4OPLA 4H4SA 3NVWB 2XVJA 1F3PA 4TLZA 1YEYA 4B66A 3ZVIA 5ER0A 3GDPA 2ARDA 3JZUA 4IP5A 4A5LA 3BOXA 3NK0X 2XLRA 4USQA 5EB4A 3DK4A 1BKHA 1VDCA 3NLCA 4H2RA 1EL9A 3CB3A 2NVKX 1NELA 3AN1A 1SEZA 1QLBA 3K1GA 1N62C 3VRAA 2GH5A 2JB3A 2BXSA 4Z44A 1NG4A 3OPSA 1P2HA 3P3BA 3V76A 3T4WA 4FX9A 3T2ZA 2B9WA 4J56A 1PJ6A 2YG5A 2Y6RA 4BK1A 1E9IA 3MSYA 2GAGB 2GR1A 3SQPA 2IVEA 4GDPA 3P4QA 3NTDA 4HN8A 3MQTA 1ZXIC 3DK8A 1MOKA 2Y6QA 3GY1A 1EC8A 4E4UA 4UP3A 4NWZA 4GAVA 2ZBWA 5BVAA 4E6MA 1MRAA 1EL7A 3AWIA 3ITJA 2XSXA 4YSXA 3PVCA 3AEFA 3LXDA 3P0WA 4GGHA 2B7RA 2PP3A 3SYIA 4IV9A 4A9WA 1F9CA 1MUCA 3CNSA 2BYBA 3QFBA 3QTPA 1OJAA 3RR1A 2YR5A 1ZK7A 3SR6B 3A7AA 5FJRA 1BWCA 1OJ9A 3UXLA 1UKVG 1M6IA 3FIMB 3DG7A 4K5SA 4P9SA 3ZVHA 3T6CA 1CC4A 3NG7X 2WQYA 4YSYA 4BK2A 4YWSA 1QO8A 4H4TA 5C2TA 4U8LA 4TM4A 2GL5A 4H4UA 5FS9A 3I3LA 3SZWA 1V97A 2PHHA 4U8NA 3S5SA 1H82A 3TOYA 1KKRA 2GQFA 3R1ZA 3EUB3 1ZX9A 5BULA 4USRA 3NN6X 1XS2A 5IDZA 3EF6A 3TQPA 1HYUA 1S2YA 3NKSA 4DWDA 4HA6A 1LTXR 1LVLA 3DG6A 1FOHA 3UKQA 3IJIA 1FCDA 4HB9A 2RGJA 2VRLA 1W6TA 1OJDA 3PK7A 4K5RA 3HYVA 3VRDB 3ZLGA 4UDRA 2WDQA 1X31B 1CL0A 3SFDA 1TRBA 3WE0A 3QPEA 4ROPA 1MNSA 3QN3A 3B9JB 3CK5A 1GPEA 3IWAA 1TYTA 4GRTA 5TR3A 3I6TA 3VDGA 3AE8A 4XWZA 4GF7A 2RGOA 1S3EA 3UP4A 4ECHA 4K8DA 3VC5A 5IQ1A 2GGGA 1NU5A 3GYXA 2Z5XA 1FIQB 2DW6A 3N6HA 5HXIA 1KFYA 2BC1A 2E4GA 4M6UA 3UKPA 1N4WA 2WPFA 2VVLG 5FJTA 3ES8A 4YTMA 3K7MX 4HNLA 4AP1A 5KWFA 3UTGA 2XFUA 1MDLA 2RABA 2GVCA 4JNAA 1EL8A 2Q6UA 1NHSA 2P88A 5U25A 1KF6A 3CPIG 1CF3A 1JROA 2WP6A 3RHAA 3D46A 4GYPC 4FDCB 4M52A 2O9ZA 4IVMB 3ETRB 4CCRA 4G6GA 5HYMA 3UGVA 2Q7VA 3Q4DA 2OZ8A 1R0MA 1SJCA 4Z1YA 2GGIA 3RGTA 3UKHA 3DEQA 3CNJA 2MNRA 4JN7A 1BGNA 1JNRA 2ZZCA 1E39A 3ADAB 3QLDA 3AYJA 1GT8A 1ZMDA 1CJ4A 2AKMA 4YXDA 4U8MA 1GRHA 4IL0A 2C4CA 5FMHA 3RP8A 5IPYA 1LPFA 1P2EA 5KMRA 2YLRA 2V61A 4A6NA 2C65A 3HZLA 4BURA 3NYEA 4A6GA 3FCPA 1COYA 1GEUA 4IT1A 1KSSA 2IIDA 2XH4A 1ELSA 1PBFA 2YLSA 2C72A 3OTRA 1ZMCA 4DSGA 3KPKA 1K0LA 2HXTA 2WOVA 3LOVA 3VCNA 3LB8A 3R9UA 2QQ6A 3EPTA 3GYJA 4TM0A 3CXOA 1ONFA 3H70A 2E5AA 2GMJA 4YTNA 3AE7A 1NHPA 1DOBA 4TM3A 4YKFA 1SB3B 2X8HA 4X4JA 2OAMA 2GB0A 4DGKA 4D03A 1ZOVA 1GESA 3NNEA 3E1TA 2C76A 4GGBA 4ZA0A 1DJQA 1EBHA 4Z2UA 4EM3A 2R0PA 2OPJA 2RDXA 3P93A 3MUCA 2X8GA 2WOIA 4H2QA 4U8JA 1TYPA 2PTXA 4NTDA 3R10A 3BSMA 2A8XA 1ZP0A 3RP6A 2WDVA 2C3CA 3T37A 1PBCA 3P4PA 4A3RA 1H6VA 3V3OA 1F8RA 2BK3A 2OLOA 4O5QA 1GRTA 5BUKA 5G5HB 3L5OA 4REKA 2BRAA 4GMEA 3UTFA 4DYEA 4LIIA 4AT0A 3NN0X 4B68A 2OALA 4C3XA 2OKTA 2Q0LA 4ZOHB 3GWFA 3BHKA 1N1PA 3A7RA 3HYXA 3GWDA 3P9UA 2PSNA 1H84A 4E0VA 1H2IA 4FI4A 1B4VA 3H8AA 3HRDC 3QJ4A 3IC9A 3T31A 4Z2TA 2FYMA 1SJBA 2YG7A 4APNA 1GREA 4LA1A 5JCMA 3RP7A 1OEPA 4AOXA 2QJNA 1L9EA 3NGCX 4GISA 5JCLA 3T9PA 3FYYA 4H2HA 2JK6A 1N60C 1KCZA 3UOXA 4G7FA 3CN8A 4DNAA 2AAQA 5BRTA 1PJ5A 3H12A 1JRYA 5HY5A 3ICRA 4TVWA 4GUVA 1DOCA 2PP0A 4OCGA 5L46A 4GYPA 2VQBA 2R9ZA 4BJYA 3LZXA 3H8LA 2R46A 1EC9A 3CNPA 4K2SA 3VRBA 3UTEA 3DJJA 3JW7A 1N4UA 2YR6A 1GRAA 1KD0A 4HCDA 4K7ZA 4EQRA 4U8PA 4O5UA 1FHUA 3M12A 2XVIA 3DFHA 3UJSA 1CJCA 5IQ4A 1GRBA 4B63A 2WPCA 2CDUA 4DHGA 2YM1A 1GETA 1EC7A 4G6HA 2UZZA 3FVDA 3PO7A 3KD9A 4K22A 3V3WA 1VQWA 4ENLA 3SFEA 2YG3A 1H7XA 2GRTA 4IVOB 3CTYA 3OZYA 2C70A 3SY4A 1D7LA 2XLSA 2A89A 3BHFA 5M0ZA 1PBBA 3TWBA 4RG4A 1D5TA 4CRTA 4H4ZA 4OPDA 4YWOA 2XFQA 2ZC8A 1RM6B 4H1ZA 3AE2A 3UTHA 3CPHG 4Y4MA 1TKKA 2OLNA 2QAEA 4BV6A 2R4EA 1DNCA 2B9YA 1E1KA 1FEBA 3D47A 1X2HA 3QFAA 3OZ2A 1GTEA 4DX3A 4JN8A 1P43A 3DESA 1L8PA 5FS7A 4CCQA 3CGDA 2A87A 4X9MA 2PGWA 2P0IA 3PWIA 6ENLA 3BI4A 3V5FA 2WOWA 4IZGA 2WP9A 2XFPA 3AE5A 3UKKA 4AP3A 5KMQA 5BOFA 4Z2RA 2YLWA 3GDNA 3QKEA 2V6OA 1XDIA 4WCTA 2YR4A 4EQXA 2R45A 3LZWA 2B7SA 4CBQA 4I59A 3SZFA 2ONEA 4LU6A 2J3NA 1WUEA 4ZCWA 3FMWA 4II2A 3G5SA 3T8QA 4YSHA 1AOGA 2PYXA 2BK5A 2X50A 3AEBA 4KPRA 2H88A 1CHUA 4C5OA 3G5RA 1VDVA 3RCYA 4KWSA 3ES7A 1CC2A 2BXRA 2PTWA 4ZCDA 3HYWA 4C74A 2W0HA 1IJHA 1XPQA 2R0CA 2OFJA 2PS2A 2GMHA 4JQ9A 4J31A 5JCNA 3ALMA 3L8KA 3NZGA 1S2QA 4N9XA 3GMBA 2WP5A 2R4JA 1PXBA 2EQ8A 1ELIA 1FFVC 4H4WA 3KUMA 3KA7A 1E1NA 2GDQA 1FFUC 4IA6A 1NG3A 2JKCA 2X8CA 3GC2A 2WBAA 4Z43A 4JY3A 2NQLA 3S5WA 3SBFA 2OQYA 3VQRA 1JRPA 1IUVA 1LV0A 2BS2A 3MKCA 1N5WC 1PN0A 2AR8A 1H81A 3Q6JA 3PWGA 2JBVA 4EQSA 3ATRA 2XFNA 3JVAA 1KN0A 2ZADA 1E1LA 3UOZA 4TM1A 3UKAA 2V3BA 3NIXA 5G5GB 3TW9A 3DJGX 4XWRA 4K1WA 2XCGA 1E6EA 2DKIA 1M64A 2P3ZA 4H2PA 3F8DA 2WHDA 2WDRA 4A7AA 3UKFA 2TPRA 4EIPA 3UJFA 2WU5A 3KU9A 2E5VA 1RP0A 3AEEA 4GR1A 2W3RA 1BGJA 3DGZA 1DJNA 3DK9A 1TDNA 2YVJA 4K8GA 3M13A 1TDKA 3GRTA 3TJ4A 1LQTA 3G5QA 3NYFA 5FS8A 1IUTA 1N4VA 4M0XA 1L9CA 2OO6A 5GSNA 4DN1A 1FO4A 3AYLA 4IA5A 2E3TA 2PGEA 1JCTA 2YVFA 2GR2A 3B6DA 2VVMA 3FG2P 1YQ4A 2VVLA 5EOWA 3FPZA 3U4FA 3IF9A 1GSNA 3BJSA 5KNLA 3CAWA 3EAOA 5ENLA 2XVFA 4CNJA 3CT2A 1VG9A 1JRXA 4FK1C 2AQJA 5JRBA 2XLUA 4WX1A 5JCIA 2JB1A 2W55A 4E8GA 3R25A 1IYXA 3AE6A 4X9NA 3SSZA 4A99A 2VZ2A 5KMPA 4H4PA 3UJEA 1WUFA 1XANA 3OZMA 1H83A 4PAAA 5C3JA 3DDMA 3K7TA 2YG4A 3REDA 1XPYA 2V5ZA 1TDOA 2WU2A 4KT2A 2C64A 3D9XA 3SXIA 3ZYXA 4FP1A 4EWJA 3A7UA 3STPA 2GF3A 3ENLA 4U2SA 5U63A 4OPTA 1LJ1A 4BK3A 3FXGA 3N4FA 3CXBA 4JDRA 3QSMA 1TDEA 1GERA 4J34A 4MGGA 2W3SA 3GD6A 3V5CA 2W54A 4HNCA 3AD7B 1GTHA 2H89A 2QCUA 3AE3A 4C3YA 2YVGA 3SM8A 2P8CA 2AL2B 3SZCA 3FJ4A 4ZCCA 4J57A 3O0HA 2IVDA 2WETA 3GO2A 1ZY8A 2AL1A 1GOSA 1GRFA 2F5ZA 4J36A 2B76A 2GV8A 2C66A 3SN0A 2OX4A 4DXKA 3TCSA 2WS3A 4J1OA 4NTEA 2VQ7A 3GD3A 2DW7A 4GDEA 2OG9A 3AE4A 3URHA 4OPGA 1NHRA 3DFYA 4RG3A 2XH0A 4TLXA 1IUUA 4GFIA 2O56A 3BNMA 4KEMA 3SZ0A 4IP4A 2WEUA 3ISHA 4JHMA 2BS4A 1GALA 1W4XA 1ZDLA 5EU9A 2YWLA 3QSSA 3NK2X 3K30A 3UKLA 2FJAA 1JRZA 3PG6A 3GMCA 2BA9A 3DMEA 4NEVA 4AT2A 3C96A 3NVVB 3DJEA 3BI2A 3EKGA 1R6WA 3Q9TA 1JPMA 1B8SA 2XVHA 3CGEA 1B5QA 3EEZA 4HCLA 2FKPA 4JY2A 2YLXA 2MUCA 2Q0KA 2XDOA 1XHCA 2FJEA 5DBJA 1Q1WA 3UJRA 1DOEA 5J60A 3CNDA 3SN4A 2GEWA 1S7MA 3CPJG 4KX6A 4D04A 3NT6A 2PODA 2NPXA 2C67A 3UJ2A 3P1WA 4CY8A 4GAPA 4YTPA 1Y0PA 2P8BA 4G8TA 3IK4A 3R0KA 4HCHA 2QA1A 4NZHA 1TE6A 1BQGA 4Z26A 1E1MA 3ICSA 3LJPA 2BRYA 2C3DA 5KOWA 3AM9A 2VOUA 1F8WA 4FK1A 3KLJA 1PDYA 1YQ3A 4EMJA 3K7QX 2XYOA 4H4VA 2B9XA 3AE9A 3BNUA 1NDAA 2ZZBA 1S3BA 4NNJA 2I0ZA 4H83A 4IHCA 4G73A 3IJLA 1DXLA 3GYIA 2V3AA 3DGHA 4Y4LA 2QDDA 2XGZA 1BZLA 3GSIA 5GRTA 3D8XA 1RVKA 5BOEA 3VCCA 3UOVA 3VR8A 3F8RA 4B69A 2PTZA 3UCDA 4U2LA 3CGBA 4X2PA 5KVIA 4EMIA 4YSZA 1Y56B 1K0JA 1JNZA 1TZZA 4MJWA 4U8IA 3NRNA 1REOA 2QGYA 2OVLA 3IJQA 4EQWA 3DGBA 4H19A 2OQHA 3N4EA 2ACZA 3ZLFA 4NTCA 3RRAA 1NENA 2YQUA 2ZZ0A 4AOSA 3GD4A 2BACA 1N63C 2BC0A 4EM4A 4OPIA 1PXCA 5FJPA 2CHRA 4E5TA 3DA1A 1LQUA 3RITA 5CQFA 1PDZA 4U2TA 1JEHA 1GV4A 1N5XA 2E1MA 4EMWA 1ECQA 2QA2A 1Q1RA 1X2GA 3S47A 5KRQA 3PS9A 3CYJA 4B67A 3THUA 1IUWA 1V59A 1T3QC 4G74A 2GGHA 4KPLA 1H86A 1TDFA 3KKJA 1PJ7A 1QJDA 1KSUA 4J2WA 1WYGA 1MDRA 1F6MA 4OVIA 2DKHA 3RNMA 2FJDA 4A65A 3RO6A 2BCGG 2HZGA 3AEAA 3KVEA 2V60A 3AB1A 5KXJA 3T2YA 2JB2A 3NFUA 3N6JA 2PCEA 1IUXA 3QVRA 1OJTA 4XXGA 5JCKA 4EIQA 3S61A 4CY6A 3ALJA 3T2KA 4H2NA 4HPNA 2YG6A 1P48A 3I6DA 3T0KA 2XVEA 3H4KA 2VRMA 3UOYA 3SJNA 4F4RA 1B37A 3JSKA 1D4DA 1KDGA 3NO1A 1GRGA 3HW2A 3P4RA 4UDQA 4HYRA 3FBSA 2C75A 2EQ9A 3ZVHB 4OPCA 3ZDNA 2EQ6A 7ENLA 1JOAA 2PTYA 2YM2A 3ICTA 1NAAA 2CFYA 3MWCA 4ICYA 3B3RA 4H4XA 1CJ3A 3AXBA 1PXAA 1FEAA 1GNDA 3V4BA 3QVPA 3TWAA 2PU0A 2BS3A 3NS1B 5FJOA 2PU1A 3EANA 3QSEA 1KNRA 1F8SA 2YAUA 5U1OA 4G9KA 3UCLA 1RYIA 3DERA 5FJUA 1K4QA 3LADA 3AECA 5KOXA 4H4YA 3NH3X 3NVYB 2OZTA 2XH2A 3NYCA 3AEDA 3NVZB 3OC4A 1GXFA 3F8PA 3VFCA 3VR9A 2YLZA 4B1BA 1JDFA 3AMZA 4PABA 3TJIA 1IUSA 2GGEA 2FJBA 4YKGA 3UXKA 1D7YA 5FS6A 2WPEA 2WESA 2HNEA 4H7UA 3AEGA 3AE1A 3R07C 3MY9A 3H7VA 5M10A 3PFRA 4MMWA 3CMMA 3ATQA 3M0OA 1EBGA 4Z25A 5HHFA 3II4A 3P4SA 3D1CA 1NEKA 1MXTA 2PMQA 1Q9IA 1CC6A 2XLPA 3ALLA 4J33A 4OPUA 3B97A 3MZNA 4K2XA 3VA8A 2PP1A 2YLTA 1SJAA 3L1RA 3Q45A 3ABVA 5KMSA 2AL2A 2AKZA 2QVHA 1H7WA 3CIRA 4II3A 1FL2A 4IL2A 5CKUA 1KNPA 2APGA 3NHOX 3SX6A 3DIPA 2TMDA 2QJMA 1ZKQA 1BF3A 1MO9A 2OA1A 1O5WA 1PDHA 1EL5A 3TTEA 4Y4NA 1SJDA 2XLTA 1E7PA 3DG3A 4YT0A 4Z24A 2GGJA 1PBDA 3NK1X 2GR3A 1JPDX 3ZLHA 1ONEA 3UP5A 2C7GA 3V3NA 4B64A 1OJCA 3DH9A 2EQ7A 2PA6A 3FV9A 3SGLA 4A6NB 4DSHA 3NRZB 3C4NA 3IHMA 3SQSA 3OW1A 2X99A 1KKOA 1O94A 1NPXA 1YY5A 4CNKA 1PHHA 3U9IA 3I6EA 3NXLA 1L0VA 2CULA 4RSLA 2OZ3A 3HPFA 2GAHB 1FECA 1RSGA 4TVYA 5J04A 3R0UA 4Z17A 2HXUA 4NEWA 4B65A 3GRSA 3C4AA 4ZN0A 2GR0A 3AD9B 3AYIA 4JN9A 2XFOA 3VC6A 2GSHA 3OP2A 4U8KA 4UDPA 4I58A 4GIRA 4J3ZA 2POZA 1PS9A 5EBKA 1VRQB 1BKWA 1CBOA 1ZOYA 4H4QA 1JU2A 3H8IA 1FHVA 2I5QA 4ADWA 4JNQA 2GQWA 3COXA 1EBDA 3UCCA 1DODA 2BK4A 3DJDA 4GCMA 2HQMA 2QDEA 1D4EA 3I4KA 2OLAA 2PPGA 3BI5A 2X3NA 2Z5YA 2C73A 2BABA 1L9DA 1YKJA 2R0GA 5J7XA 3CGCA 1STZA 1VQZA 5LV9A 1YQZA 4MKSA 2BCPA 2XH7A 5KVHA 4E4FA 1Z6LA 1NHQA 1O95A 4A35A 2FBWA 3AD8B 1CJ2A 1PBEA 3IHGA 1VG0A 3NTAA
chains in the Genus database with same CATH topology
4X4JA 4TM1A 4H4RA 2OAMA 2GB0A 3T14A 4DGKA 5EB5A 3PS9A 4B67A 5KRQA 4D03A 1ZOVA 3UKAA 4U8OA 1IUWA 2V3BA 3NIXA 1GESA 1V59A 3NNEA 4G74A 3CNTA 4A79A 2CVJA 2RGHA 4C77A 3E1TA 3DJGX 4XWRA 2C76A 1K0IA 3KPFA 2XCGA 1E6EA 2DKIA 1H86A 1M64A 1TDFA 3KKJA 1PJ7A 1DJQA 1QJDA 4BJZA 4Z2UA 2JAEA 4EM3A 4H50A 1KSUA 2R0PA 1D4CA 1Y56A 2WHDA 3F8DA 2WDRA 4H2PA 4J2WA 4OPLA 3UKFA 4A7AA 2TPRA 4H4SA 1F6MA 4OVIA 4EIPA 2X8GA 2WOIA 2DKHA 3RNMA 4H2QA 2FJDA 4U8JA 2WU5A 2XVJA 1F3PA 3KU9A 2E5VA 4TLZA 1RP0A 4A65A 3AEEA 2BCGG 4GR1A 1BGJA 3DGZA 3AEAA 2V60A 3KVEA 5ER0A 1TYPA 3GDPA 4B66A 3AB1A 5KXJA 1DJNA 2ARDA 3DK9A 1TDNA 2YVJA 4NTDA 4A5LA 3T2YA 2JB2A 3NK0X 2XLRA 2A8XA 1ZP0A 3RP6A 4USQA 3M13A 2WDVA 2C3CA 5EB4A 1TDKA 3T37A 3DK4A 1VDCA 1PBCA 3P4PA 3NLCA 4H2RA 1H6VA 3GRTA 3V3OA 1IUXA 1EL9A 1F8RA 1LQTA 3G5QA 3QVRA 2NVKX 3NYFA 1OJTA 2BK3A 1SEZA 2OLOA 5FS8A 5JCKA 4XXGA 4EIQA 3S61A 4CY6A 3ALJA 1IUTA 1N4VA 3T2KA 1QLBA 4H2NA 1L9CA 2YG6A 4O5QA 1GRTA 3VRAA 5GSNA 5BUKA 2GH5A 3AYLA 3I6DA 3T0KA 2XVEA 3L5OA 4REKA 2JB3A 2BXSA 4Z44A 1NG4A 2BRAA 3H4KA 4IA5A 1P2HA 2VRMA 3UOYA 2YVFA 3UTFA 2GR2A 3V76A 3B6DA 2VVMA 3FG2P 1YQ4A 1B37A 2VVLA 3FPZA 5EOWA 3JSKA 4FX9A 4LIIA 1D4DA 1KDGA 4AT0A 3IF9A 1GRGA 3T2ZA 3NN0X 2B9WA 3P4RA 1GSNA 4B68A 5KNLA 4J56A 3EAOA 1PJ6A 2YG5A 4UDQA 2Y6RA 2OALA 3FBSA 2XVFA 4BK1A 4C3XA 1VG9A 4CNJA 2GAGB 4C74A 2GR1A 2C75A 2EQ9A 2Q0LA 3SQPA 1JRXA 4FK1C 4OPCA 2AQJA 2EQ6A 3ZDNA 2IVEA 5JRBA 2XLUA 1JOAA 3BHKA 1N1PA 3GWFA 2YM2A 4GDPA 4WX1A 5JCIA 2JB1A 3GWDA 3HYXA 3ICTA 3P9UA 3P4QA 1H84A 4E0VA 1NAAA 3NTDA 2CFYA 1H2IA 3DK8A 1B4VA 3AE6A 1MOKA 2Y6QA 4X9NA 3QJ4A 3IC9A 4A99A 4ICYA 3T31A 4Z2TA 2VZ2A 2YG7A 4APNA 5KMPA 1GREA 4UP3A 3B3RA 4H4XA 4LA1A 4NWZA 4H4PA 1CJ3A 3AXBA 4GAVA 1PXAA 1FEAA 1XANA 5JCMA 1GNDA 2ZBWA 5BVAA 3RP7A 1H83A 3QVPA 4PAAA 4AOXA 5C3JA 1L9EA 3K7TA 2YG4A 3NGCX 5JCLA 1EL7A 3AWIA 3REDA 2V5ZA 3ITJA 1TDOA 2BS3A 2WU2A 4YSXA 2JK6A 3UOXA 3PVCA 3EANA 2C64A 1KNRA 3AEFA 3QSEA 3CN8A 3LXDA 3D9XA 2AAQA 4DNAA 5BRTA 3SXIA 3ZYXA 1PJ5A 2B7RA 3SYIA 1F8SA 1JRYA 3ICRA 4IV9A 4A9WA 2YAUA 5HY5A 4GUVA 5U1OA 4G9KA 2GF3A 1DOCA 4OCGA 4U2SA 5L46A 3CNSA 2VQBA 2BYBA 3QFBA 5U63A 4OPTA 1LJ1A 1OJAA 1RYIA 2R9ZA 3UCLA 4BK3A 2YR5A 1ZK7A 1K4QA 4BJYA 3LADA 4JDRA 3QSMA 1TDEA 3LZXA 3H8LA 3AECA 1GERA 1BWCA 4J34A 1OJ9A 4H4YA 3NH3X 5KOXA 2R46A 1UKVG 3VRBA 3CNPA 3UTEA 3DJJA 1M6IA 1N4UA 2YR6A 3FIMB 3NYCA 4K5SA 4P9SA 1GRAA 3AEDA 3OC4A 1CC4A 3NG7X 1GXFA 3AD7B 3F8PA 2WQYA 4YSYA 3VR9A 2YLZA 4BK2A 1QO8A 4B1BA 4H4TA 1GTHA 2H89A 5C2TA 4U8LA 4PABA 4TM4A 2QCUA 4K7ZA 4H4UA 4EQRA 1IUSA 3AE3A 4U8PA 2FJBA 5FS9A 4YKGA 4O5UA 4C3YA 3I3LA 3M12A 3SZWA 2PHHA 2YVGA 3SM8A 2XVIA 3SZCA 1CJCA 5IQ4A 1D7YA 1GRBA 5FS6A 4U8NA 4ZCCA 1H82A 2WPEA 4J57A 3O0HA 2WESA 2IVDA 4B63A 2WPCA 2CDUA 2WETA 2GQFA 4H7UA 3AEGA 1ZX9A 3AE1A 5BULA 4USRA 1ZY8A 1GOSA 2YM1A 3NN6X 1GETA 1GRFA 2F5ZA 3EF6A 2B76A 1HYUA 2GV8A 1S2YA 4J36A 2C66A 4G6HA 3NKSA 2UZZA 2WS3A 4HA6A 1LTXR 3PO7A 4NTEA 1LVLA 5M10A 2VQ7A 3KD9A 4K22A 1FOHA 3UKQA 3GD3A 3CMMA 3ATQA 4GDEA 1VQWA 3M0OA 1FCDA 4Z25A 5HHFA 3II4A 3P4SA 4HB9A 2RGJA 2VRLA 3D1CA 1OJDA 1NEKA 3AE4A 3SFEA 4K5RA 2YG3A 3HYVA 3VRDB 1H7XA 1MXTA 3URHA 1Q9IA 4OPGA 1CC6A 2XLPA 2GRTA 3ALLA 1NHRA 4IVOB 4J33A 4RG3A 4OPUA 3CTYA 4UDRA 2C70A 3SY4A 2WDQA 4TLXA 1X31B 1IUUA 1D7LA 2XLSA 1CL0A 2A89A 3BHFA 4K2XA 5M0ZA 1PBBA 3BNMA 3SFDA 1TRBA 3WE0A 3SZ0A 4RG4A 1D5TA 2WEUA 2YLTA 3ISHA 4CRTA 4H4ZA 4OPDA 2BS4A 1GALA 1GPEA 3IWAA 1W4XA 3L1RA 1ZDLA 4YWOA 2YWLA 3QSSA 3ABVA 3NK2X 2XFQA 3K30A 1TYTA 3UKLA 2FJAA 5KMSA 4GRTA 5TR3A 1JRZA 3AE8A 3AE2A 3PG6A 3GMCA 2BA9A 3DMEA 4XWZA 4NEVA 4GF7A 4AT2A 2RGOA 3C96A 3UTHA 3CPHG 4Y4MA 1H7WA 3CIRA 3DJEA 1FL2A 4II3A 1S3EA 3BI2A 3UP4A 2OLNA 5CKUA 3Q9TA 4ECHA 1KNPA 2APGA 4K8DA 1B8SA 2QAEA 4BV6A 2XVHA 2R4EA 1DNCA 3NHOX 5IQ1A 3SX6A 3CGEA 2B9YA 1E1KA 1B5QA 1FEBA 2TMDA 3GYXA 3QFAA 1ZKQA 3OZ2A 1BF3A 1MO9A 2OA1A 2Z5XA 1GTEA 1O5WA 4JY2A 1PDHA 1EL5A 5HXIA 2YLXA 4Y4NA 1KFYA 2Q0KA 2XLTA 2BC1A 1E7PA 4YT0A 2E4GA 4Z24A 3UKPA 1N4WA 2WPFA 2VVLG 1PBDA 5FS7A 4CCQA 3NK1X 2XDOA 3CGDA 1XHCA 2A87A 4X9MA 2FJEA 4YTMA 2GR3A 5DBJA 1Q1WA 3K7MX 3BI4A 1DOEA 5J60A 3AE5A 2WOWA 2XFPA 2WP9A 3CNDA 2GEWA 3UKKA 1S7MA 4AP1A 3CPJG 4AP3A 4KX6A 5KMQA 2C7GA 3UP5A 4D04A 3NT6A 3V3NA 4Z2RA 2YLWA 2NPXA 2C67A 4B64A 5KWFA 3P1WA 1OJCA 3GDNA 3DH9A 3UTGA 2V6OA 2XFUA 4GAPA 2EQ7A 1XDIA 4CY8A 4YTPA 3SGLA 2RABA 1Y0PA 4WCTA 2GVCA 2YR4A 4JNAA 4A6NB 1EL8A 4EQXA 2R45A 4DSHA 2Q6UA 3C4NA 3IHMA 3LZWA 2QA1A 4NZHA 2B7SA 4CBQA 1NHSA 4I59A 5U25A 2X99A 3SZFA 4Z26A 1KF6A 3CPIG 1CF3A 1E1MA 4LU6A 2J3NA 3ICSA 2WP6A 3RHAA 1O94A 1NPXA 1YY5A 3LJPA 2BRYA 4CNKA 3FMWA 4II2A 1PHHA 2C3DA 4FDCB 1L0VA 5KOWA 4M52A 2O9ZA 2VOUA 2CULA 3G5SA 4IVMB 4RSLA 1F8WA 4FK1A 4CCRA 3KLJA 4YSHA 1YQ3A 1AOGA 4EMJA 2GAHB 2PYXA 4G6GA 5HYMA 1FECA 1RSGA 2Q7VA 3K7QX 2XYOA 2BK5A 2X50A 4H4VA 4NEWA 2B9XA 4B65A 3AE9A 3AEBA 3BNUA 1NDAA 2ZZBA 4KPRA 3GRSA 2H88A 1CHUA 3CNJA 3UKHA 4C5OA 1S3BA 3C4AA 3G5RA 4ZN0A 4NNJA 2GR0A 1BGNA 3AD9B 2I0ZA 3AYIA 4JN9A 1CC2A 2XFOA 2BXRA 1DXLA 4G73A 1JNRA 2ZZCA 1E39A 4ZCDA 3ADAB 3HYWA 3GYIA 2V3AA 4U8KA 4UDPA 3DGHA 4Y4LA 3AYJA 1GT8A 2W0HA 4I58A 1ZMDA 1CJ4A 1IJHA 1XPQA 2R0CA 1BZLA 3GSIA 5GRTA 4YXDA 1PS9A 4U8MA 3D8XA 5EBKA 2GMHA 1GRHA 3UOVA 3VR8A 3F8RA 4B69A 4JQ9A 1VRQB 4J31A 2C4CA 1BKWA 5JCNA 3ALMA 1CBOA 1ZOYA 4U2LA 1JU2A 4H4QA 5FMHA 1VG0A 3RP8A 5IPYA 1LPFA 3L8KA 1P2EA 5KMRA 1S2QA 3H8IA 4N9XA 3CGBA 2YLRA 3GMBA 4ADWA 2WP5A 2V61A 4JNQA 4A6NA 5KVIA 2GQWA 2C65A 3HZLA 2R4JA 3COXA 4EMIA 1PXBA 4BURA 3NYEA 2EQ8A 1COYA 1ELIA 4YSZA 1GEUA 4H4WA 1Y56B 1EBDA 1K0JA 1JNZA 3KA7A 1E1NA 1KSSA 2IIDA 1DODA 4MJWA 4U8IA 3NRNA 2BK4A 4IA6A 3DJDA 1REOA 1NG3A 1PBFA 4GCMA 2YLSA 4EQWA 2C72A 2HQMA 1ZMCA 1D4EA 2JKCA 4DSGA 3BI5A 2X8CA 2ACZA 2X3NA 3KPKA 4NTCA 1K0LA 2WBAA 2Z5YA 2WOVA 2C73A 3LOVA 3LB8A 3R9UA 3EPTA 2BABA 1NENA 4Z43A 2YQUA 4JY3A 2ZZ0A 4AOSA 3GYJA 4TM0A 3S5WA 3VQRA 3GD4A 2BACA 1IUVA 1LV0A 2BS2A 2BC0A 1ONFA 4EM4A 1L9DA 1YKJA 4OPIA 2R0GA 2GMJA 5J7XA 1PXCA 4YTNA 1PN0A 3CGCA 1H81A 2AR8A 3AE7A 3Q6JA 1NHPA 1YQZA 3DA1A 1DOBA 2JBVA 5LV9A 4EQSA 4TM3A 4YKFA 2BCPA 1LQUA 5KVHA 1Z6LA 5CQFA 3ATRA 1NHQA 4U2TA 2XFNA 1JEHA 1GV4A 1O95A 1KN0A 2FBWA 2E1MA 1E1LA 3UOZA 3AD8B 2X8HA 4EMWA 1CJ2A 1PBEA 2QA2A 3IHGA 1Q1RA 3NTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X4J A;  4TM1 A;  4H4R A;  2OAM A;  2GB0 A;  4DGK A;  5EB5 A;  3PS9 A;  4B67 A;  5KRQ A;  4D03 A;  1ZOV A;  3UKA A;  4U8O A;  1IUW A;  2V3B A;  3NIX A;  1GES A;  1V59 A;  3NNE A;  3CNT A;  4A79 A;  2CVJ A;  2RGH A;  4C77 A;  3E1T A;  3DJG X;  4XWR A;  2C76 A;  1K0I A;  3KPF A;  2XCG A;  1E6E A;  2DKI A;  1M64 A;  1H86 A;  1TDF A;  3KKJ A;  1PJ7 A;  1DJQ A;  1QJD A;  4BJZ A;  4Z2U A;  2JAE A;  4EM3 A;  4H50 A;  1KSU A;  2R0P A;  1D4C A;  1Y56 A;  2WHD A;  3F8D A;  2WDR A;  4H2P A;  4J2W A;  4OPL A;  3UKF A;  4A7A A;  2TPR A;  4H4S A;  1F6M A;  4OVI A;  4EIP A;  2X8G A;  2WOI A;  2DKH A;  3RNM A;  4H2Q A;  2FJD A;  4U8J A;  2WU5 A;  2XVJ A;  1F3P A;  3KU9 A;  2E5V A;  4TLZ A;  1RP0 A;  4A65 A;  3AEE A;  2BCG G;  4GR1 A;  1BGJ A;  3DGZ A;  3AEA A;  2V60 A;  3KVE A;  5ER0 A;  1TYP A;  3GDP A;  4B66 A;  3AB1 A;  5KXJ A;  1DJN A;  2ARD A;  3DK9 A;  1TDN A;  2YVJ A;  4NTD A;  4A5L A;  2JB2 A;  3NK0 X;  2XLR A;  2A8X A;  1ZP0 A;  3RP6 A;  4USQ A;  3M13 A;  2WDV A;  2C3C A;  5EB4 A;  1TDK A;  3T37 A;  3DK4 A;  1VDC A;  1PBC A;  3P4P A;  3NLC A;  4H2R A;  1H6V A;  3GRT A;  3V3O A;  1LQT A;  1IUX A;  1EL9 A;  1F8R A;  3G5Q A;  3QVR A;  2NVK X;  3NYF A;  1OJT A;  2BK3 A;  1SEZ A;  2OLO A;  5FS8 A;  5JCK A;  4XXG A;  4EIQ A;  3S61 A;  4CY6 A;  3ALJ A;  1IUT A;  1N4V A;  1QLB A;  4H2N A;  1L9C A;  2YG6 A;  4O5Q A;  1GRT A;  3VRA A;  5GSN A;  5BUK A;  2GH5 A;  3AYL A;  3I6D A;  2XVE A;  4REK A;  2JB3 A;  2BXS A;  4Z44 A;  1NG4 A;  3H4K A;  4IA5 A;  1P2H A;  2VRM A;  3UOY A;  2YVF A;  3UTF A;  2GR2 A;  3V76 A;  3B6D A;  2VVM A;  3FG2 P;  1YQ4 A;  1B37 A;  2VVL A;  3FPZ A;  5EOW A;  3JSK A;  4FX9 A;  4LII A;  1D4D A;  1KDG A;  4AT0 A;  3IF9 A;  1GRG A;  3NN0 X;  2B9W A;  3P4R A;  1GSN A;  4B68 A;  4J56 A;  3EAO A;  1PJ6 A;  2YG5 A;  4UDQ A;  2Y6R A;  2OAL A;  3FBS A;  2XVF A;  4BK1 A;  4C3X A;  1VG9 A;  4CNJ A;  2GAG B;  4C74 A;  2GR1 A;  2C75 A;  2EQ9 A;  2Q0L A;  3SQP A;  1JRX A;  4FK1 C;  4OPC A;  2AQJ A;  2EQ6 A;  3ZDN A;  2IVE A;  2XLU A;  1JOA A;  3BHK A;  1N1P A;  3GWF A;  2YM2 A;  4GDP A;  4WX1 A;  5JCI A;  2JB1 A;  3GWD A;  3ICT A;  3P9U A;  3P4Q A;  1H84 A;  4E0V A;  1NAA A;  3NTD A;  2CFY A;  3DK8 A;  1B4V A;  3AE6 A;  1MOK A;  2Y6Q A;  4X9N A;  3QJ4 A;  3IC9 A;  4A99 A;  4ICY A;  4Z2T A;  2VZ2 A;  2YG7 A;  4APN A;  1GRE A;  4UP3 A;  3B3R A;  4H4X A;  4LA1 A;  4H4P A;  1CJ3 A;  3AXB A;  1PXA A;  1FEA A;  1XAN A;  5JCM A;  1GND A;  2ZBW A;  5BVA A;  3RP7 A;  1H83 A;  3QVP A;  4PAA A;  4AOX A;  5C3J A;  1L9E A;  3K7T A;  2YG4 A;  3NGC X;  5JCL A;  1EL7 A;  3AWI A;  3RED A;  2V5Z A;  3ITJ A;  1TDO A;  2BS3 A;  2WU2 A;  4YSX A;  2JK6 A;  3UOX A;  3PVC A;  3EAN A;  2C64 A;  1KNR A;  3AEF A;  3QSE A;  3CN8 A;  3LXD A;  4DNA A;  2AAQ A;  5BRT A;  3ZYX A;  1PJ5 A;  2B7R A;  1F8S A;  1JRY A;  3ICR A;  4IV9 A;  4A9W A;  2YAU A;  5HY5 A;  4GUV A;  5U1O A;  2GF3 A;  1DOC A;  4OCG A;  4U2S A;  5L46 A;  3CNS A;  2VQB A;  2BYB A;  3QFB A;  5U63 A;  4OPT A;  1LJ1 A;  1OJA A;  1RYI A;  2R9Z A;  3UCL A;  4BK3 A;  2YR5 A;  1ZK7 A;  1K4Q A;  4BJY A;  3LAD A;  4JDR A;  3QSM A;  1TDE A;  3LZX A;  3H8L A;  3AEC A;  1GER A;  1BWC A;  4J34 A;  1OJ9 A;  4H4Y A;  3NH3 X;  5KOX A;  2R46 A;  1UKV G;  3VRB A;  3CNP A;  3UTE A;  3DJJ A;  1M6I A;  1N4U A;  2YR6 A;  3FIM B;  3NYC A;  4K5S A;  4P9S A;  1GRA A;  3AED A;  3OC4 A;  1CC4 A;  3NG7 X;  1GXF A;  3AD7 B;  3F8P A;  2WQY A;  4YSY A;  3VR9 A;  2YLZ A;  4BK2 A;  1QO8 A;  4B1B A;  4H4T A;  1GTH A;  2H89 A;  5C2T A;  4U8L A;  4PAB A;  4TM4 A;  2QCU A;  4K7Z A;  4H4U A;  4EQR A;  1IUS A;  3AE3 A;  4U8P A;  2FJB A;  5FS9 A;  4YKG A;  4O5U A;  4C3Y A;  3I3L A;  3M12 A;  2PHH A;  2YVG A;  3SM8 A;  2XVI A;  1CJC A;  5IQ4 A;  1D7Y A;  1GRB A;  5FS6 A;  4U8N A;  4ZCC A;  1H82 A;  2WPE A;  4J57 A;  3O0H A;  2WES A;  2IVD A;  4B63 A;  2WPC A;  2CDU A;  2WET A;  2GQF A;  4H7U A;  3AEG A;  1ZX9 A;  3AE1 A;  5BUL A;  4USR A;  1ZY8 A;  1GOS A;  2YM1 A;  3NN6 X;  1GET A;  1GRF A;  2F5Z A;  3EF6 A;  2B76 A;  1HYU A;  2GV8 A;  1S2Y A;  4J36 A;  2C66 A;  3NKS A;  2UZZ A;  2WS3 A;  4HA6 A;  1LTX R;  3PO7 A;  4NTE A;  1LVL A;  5M10 A;  2VQ7 A;  3KD9 A;  4K22 A;  1FOH A;  3UKQ A;  3GD3 A;  3ATQ A;  4GDE A;  1VQW A;  3M0O A;  1FCD A;  4Z25 A;  5HHF A;  3II4 A;  3P4S A;  4HB9 A;  2RGJ A;  2VRL A;  3D1C A;  1OJD A;  1NEK A;  3AE4 A;  3SFE A;  4K5R A;  2YG3 A;  3VRD B;  1H7X A;  1MXT A;  3URH A;  1Q9I A;  4OPG A;  1CC6 A;  2XLP A;  2GRT A;  3ALL A;  1NHR A;  4IVO B;  4J33 A;  4RG3 A;  4OPU A;  3CTY A;  4UDR A;  2C70 A;  2WDQ A;  4TLX A;  1X31 B;  1IUU A;  1D7L A;  2XLS A;  1CL0 A;  2A89 A;  3BHF A;  4K2X A;  5M0Z A;  1PBB A;  3BNM A;  3SFD A;  1TRB A;  3WE0 A;  4RG4 A;  1D5T A;  2WEU A;  2YLT A;  3ISH A;  4CRT A;  4H4Z A;  4OPD A;  2BS4 A;  1GAL A;  1GPE A;  3IWA A;  1W4X A;  3L1R A;  1ZDL A;  4YWO A;  2YWL A;  3QSS A;  3ABV A;  3NK2 X;  2XFQ A;  3K30 A;  1TYT A;  3UKL A;  2FJA A;  4GRT A;  5TR3 A;  1JRZ A;  3AE8 A;  3AE2 A;  3GMC A;  2BA9 A;  3DME A;  4XWZ A;  4NEV A;  4GF7 A;  4AT2 A;  2RGO A;  3C96 A;  3UTH A;  3CPH G;  4Y4M A;  1H7W A;  3CIR A;  3DJE A;  1FL2 A;  1S3E A;  3BI2 A;  3UP4 A;  2OLN A;  5CKU A;  3Q9T A;  4ECH A;  1KNP A;  2APG A;  4K8D A;  1B8S A;  2QAE A;  4BV6 A;  2XVH A;  2R4E A;  1DNC A;  3NHO X;  5IQ1 A;  3CGE A;  2B9Y A;  1E1K A;  1B5Q A;  1FEB A;  2TMD A;  3QFA A;  1ZKQ A;  3OZ2 A;  1BF3 A;  1MO9 A;  2OA1 A;  2Z5X A;  1GTE A;  1O5W A;  4JY2 A;  1PDH A;  1EL5 A;  5HXI A;  2YLX A;  4Y4N A;  1KFY A;  2Q0K A;  2XLT A;  2BC1 A;  1E7P A;  4YT0 A;  2E4G A;  4Z24 A;  3UKP A;  1N4W A;  2WPF A;  2VVL G;  1PBD A;  5FS7 A;  4CCQ A;  3NK1 X;  2XDO A;  3CGD A;  1XHC A;  2A87 A;  4X9M A;  2FJE A;  4YTM A;  2GR3 A;  5DBJ A;  1Q1W A;  3K7M X;  3BI4 A;  1DOE A;  5J60 A;  3AE5 A;  2WOW A;  2XFP A;  2WP9 A;  3CND A;  2GEW A;  3UKK A;  4AP1 A;  3CPJ G;  4AP3 A;  4KX6 A;  3UP5 A;  2C7G A;  4D04 A;  3NT6 A;  3V3N A;  4Z2R A;  2YLW A;  2NPX A;  2C67 A;  4B64 A;  5KWF A;  3P1W A;  1OJC A;  3GDN A;  3DH9 A;  3UTG A;  2V6O A;  2XFU A;  4CY8 A;  2EQ7 A;  1XDI A;  4YTP A;  3SGL A;  2RAB A;  1Y0P A;  4WCT A;  2GVC A;  2YR4 A;  4JNA A;  4A6N B;  1EL8 A;  4EQX A;  2R45 A;  4DSH A;  2Q6U A;  3C4N A;  3IHM A;  3LZW A;  2QA1 A;  4NZH A;  2B7S A;  4CBQ A;  1NHS A;  4I59 A;  5U25 A;  2X99 A;  4Z26 A;  1KF6 A;  3CPI G;  1CF3 A;  1E1M A;  4LU6 A;  2J3N A;  3ICS A;  2WP6 A;  3RHA A;  1O94 A;  1NPX A;  1YY5 A;  3LJP A;  4CNK A;  3FMW A;  1PHH A;  2C3D A;  4FDC B;  1L0V A;  5KOW A;  4M52 A;  2O9Z A;  2VOU A;  2CUL A;  3G5S A;  4IVM B;  4RSL A;  1F8W A;  4FK1 A;  4CCR A;  3KLJ A;  4YSH A;  1YQ3 A;  1AOG A;  4EMJ A;  2GAH B;  2PYX A;  5HYM A;  1FEC A;  1RSG A;  2Q7V A;  3K7Q X;  2XYO A;  2BK5 A;  2X50 A;  4H4V A;  4NEW A;  2B9X A;  4B65 A;  3AE9 A;  3AEB A;  3BNU A;  1NDA A;  2ZZB A;  4KPR A;  3GRS A;  2H88 A;  1CHU A;  3CNJ A;  3UKH A;  4C5O A;  1S3B A;  3C4A A;  3G5R A;  4ZN0 A;  2GR0 A;  1BGN A;  3AD9 B;  2I0Z A;  3AYI A;  4JN9 A;  1CC2 A;  2XFO A;  2BXR A;  1DXL A;  1JNR A;  2ZZC A;  1E39 A;  4ZCD A;  3ADA B;  3GYI A;  2V3A A;  4U8K A;  4UDP A;  3DGH A;  4Y4L A;  3AYJ A;  1GT8 A;  2W0H A;  4I58 A;  1ZMD A;  1CJ4 A;  1IJH A;  1XPQ A;  2R0C A;  1BZL A;  3GSI A;  5GRT A;  4YXD A;  1PS9 A;  4U8M A;  3D8X A;  5EBK A;  2GMH A;  1GRH A;  3UOV A;  3VR8 A;  3F8R A;  4B69 A;  4JQ9 A;  1VRQ B;  4J31 A;  1BKW A;  5JCN A;  3ALM A;  1CBO A;  1ZOY A;  4U2L A;  1JU2 A;  4H4Q A;  5FMH A;  1VG0 A;  3RP8 A;  5IPY A;  1LPF A;  3L8K A;  1P2E A;  1S2Q A;  3H8I A;  4N9X A;  3CGB A;  2YLR A;  3GMB A;  4ADW A;  2WP5 A;  2V61 A;  4JNQ A;  4A6N A;  5KVI A;  2GQW A;  2C65 A;  3HZL A;  2R4J A;  3COX A;  4EMI A;  1PXB A;  4BUR A;  3NYE A;  2EQ8 A;  1COY A;  1ELI A;  4YSZ A;  1GEU A;  4H4W A;  1Y56 B;  1EBD A;  1K0J A;  1JNZ A;  3KA7 A;  1E1N A;  1KSS A;  2IID A;  1DOD A;  4MJW A;  4U8I A;  3NRN A;  2BK4 A;  4IA6 A;  3DJD A;  1REO A;  1NG3 A;  1PBF A;  4GCM A;  2YLS A;  4EQW A;  2C72 A;  2HQM A;  1ZMC A;  1D4E A;  2JKC A;  4DSG A;  3BI5 A;  2X8C A;  2ACZ A;  2X3N A;  4NTC A;  1K0L A;  2WBA A;  2Z5Y A;  2WOV A;  2C73 A;  3LOV A;  3LB8 A;  3R9U A;  3EPT A;  2BAB A;  1NEN A;  4Z43 A;  2YQU A;  4JY3 A;  2ZZ0 A;  4AOS A;  3GYJ A;  4TM0 A;  3S5W A;  3VQR A;  3GD4 A;  2BAC A;  1IUV A;  1LV0 A;  2BS2 A;  2BC0 A;  1ONF A;  4EM4 A;  1L9D A;  1YKJ A;  4OPI A;  2R0G A;  2GMJ A;  5J7X A;  1PXC A;  4YTN A;  1PN0 A;  3CGC A;  1H81 A;  2AR8 A;  3AE7 A;  3Q6J A;  1NHP A;  1YQZ A;  3DA1 A;  1DOB A;  2JBV A;  5LV9 A;  4EQS A;  4TM3 A;  4YKF A;  2BCP A;  1LQU A;  5KVH A;  1Z6L A;  5CQF A;  3ATR A;  1NHQ A;  4U2T A;  2XFN A;  1JEH A;  1GV4 A;  1O95 A;  2FBW A;  2E1M A;  1E1L A;  3UOZ A;  3AD8 B;  2X8H A;  4EMW A;  1CJ2 A;  1PBE A;  2QA2 A;  3IHG A;  1Q1R A;  3NTA A; 
#chains in the Genus database with same CATH topology
 2QJJ A;  3R11 A;  4H4R A;  3T14 A;  5EB5 A;  4U8O A;  3CNT A;  4A79 A;  2CVJ A;  2RGH A;  4C77 A;  3KPF A;  1K0I A;  3SN1 A;  1DTN A;  4BJZ A;  2JAE A;  4H50 A;  1D4C A;  1Y56 A;  1N61 C;  4OPL A;  4H4S A;  3NVW B;  2XVJ A;  1F3P A;  4TLZ A;  1YEY A;  4B66 A;  3ZVI A;  5ER0 A;  3GDP A;  2ARD A;  3JZU A;  4IP5 A;  4A5L A;  3BOX A;  3NK0 X;  2XLR A;  4USQ A;  5EB4 A;  3DK4 A;  1BKH A;  1VDC A;  3NLC A;  4H2R A;  1EL9 A;  3CB3 A;  2NVK X;  1NEL A;  3AN1 A;  1SEZ A;  1QLB A;  3K1G A;  1N62 C;  3VRA A;  2GH5 A;  2JB3 A;  2BXS A;  4Z44 A;  1NG4 A;  3OPS A;  1P2H A;  3P3B A;  3V76 A;  3T4W A;  4FX9 A;  3T2Z A;  2B9W A;  4J56 A;  1PJ6 A;  2YG5 A;  2Y6R A;  4BK1 A;  1E9I A;  3MSY A;  2GAG B;  2GR1 A;  3SQP A;  2IVE A;  4GDP A;  3P4Q A;  3NTD A;  4HN8 A;  3MQT A;  1ZXI C;  3DK8 A;  1MOK A;  2Y6Q A;  3GY1 A;  1EC8 A;  4E4U A;  4UP3 A;  4NWZ A;  4GAV A;  2ZBW A;  5BVA A;  4E6M A;  1MRA A;  1EL7 A;  3AWI A;  3ITJ A;  2XSX A;  4YSX A;  3PVC A;  3AEF A;  3LXD A;  3P0W A;  4GGH A;  2B7R A;  2PP3 A;  3SYI A;  4IV9 A;  4A9W A;  1F9C A;  1MUC A;  3CNS A;  2BYB A;  3QFB A;  3QTP A;  1OJA A;  3RR1 A;  2YR5 A;  1ZK7 A;  3SR6 B;  3A7A A;  5FJR A;  1BWC A;  1OJ9 A;  3UXL A;  1UKV G;  1M6I A;  3FIM B;  3DG7 A;  4K5S A;  4P9S A;  3ZVH A;  3T6C A;  1CC4 A;  3NG7 X;  2WQY A;  4YSY A;  4BK2 A;  4YWS A;  1QO8 A;  4H4T A;  5C2T A;  4U8L A;  4TM4 A;  2GL5 A;  4H4U A;  5FS9 A;  3I3L A;  3SZW A;  1V97 A;  2PHH A;  4U8N A;  3S5S A;  1H82 A;  3TOY A;  1KKR A;  2GQF A;  3R1Z A;  3EUB 3;  1ZX9 A;  5BUL A;  4USR A;  3NN6 X;  1XS2 A;  5IDZ A;  3EF6 A;  3TQP A;  1HYU A;  1S2Y A;  3NKS A;  4DWD A;  4HA6 A;  1LTX R;  1LVL A;  3DG6 A;  1FOH A;  3UKQ A;  3IJI A;  1FCD A;  4HB9 A;  2RGJ A;  2VRL A;  1W6T A;  1OJD A;  3PK7 A;  4K5R A;  3HYV A;  3VRD B;  3ZLG A;  4UDR A;  2WDQ A;  1X31 B;  1CL0 A;  3SFD A;  1TRB A;  3WE0 A;  3QPE A;  4ROP A;  1MNS A;  3QN3 A;  3B9J B;  3CK5 A;  1GPE A;  3IWA A;  1TYT A;  4GRT A;  5TR3 A;  3I6T A;  3VDG A;  3AE8 A;  4XWZ A;  4GF7 A;  2RGO A;  1S3E A;  3UP4 A;  4ECH A;  4K8D A;  3VC5 A;  5IQ1 A;  2GGG A;  1NU5 A;  3GYX A;  2Z5X A;  1FIQ B;  2DW6 A;  3N6H A;  5HXI A;  1KFY A;  2BC1 A;  2E4G A;  4M6U A;  3UKP A;  1N4W A;  2WPF A;  2VVL G;  5FJT A;  3ES8 A;  4YTM A;  3K7M X;  4HNL A;  4AP1 A;  5KWF A;  3UTG A;  2XFU A;  1MDL A;  2RAB A;  2GVC A;  4JNA A;  1EL8 A;  2Q6U A;  1NHS A;  2P88 A;  5U25 A;  1KF6 A;  3CPI G;  1CF3 A;  1JRO A;  2WP6 A;  3RHA A;  3D46 A;  4GYP C;  4FDC B;  4M52 A;  2O9Z A;  4IVM B;  3ETR B;  4CCR A;  4G6G A;  5HYM A;  3UGV A;  2Q7V A;  3Q4D A;  2OZ8 A;  1R0M A;  1SJC A;  4Z1Y A;  2GGI A;  3RGT A;  3UKH A;  3DEQ A;  3CNJ A;  2MNR A;  4JN7 A;  1BGN A;  1JNR A;  2ZZC A;  1E39 A;  3ADA B;  3QLD A;  3AYJ A;  1GT8 A;  1ZMD A;  1CJ4 A;  2AKM A;  4YXD A;  4U8M A;  1GRH A;  4IL0 A;  2C4C A;  5FMH A;  3RP8 A;  5IPY A;  1LPF A;  1P2E A;  5KMR A;  2YLR A;  2V61 A;  4A6N A;  2C65 A;  3HZL A;  4BUR A;  3NYE A;  4A6G A;  3FCP A;  1COY A;  1GEU A;  4IT1 A;  1KSS A;  2IID A;  2XH4 A;  1ELS A;  1PBF A;  2YLS A;  2C72 A;  3OTR A;  1ZMC A;  4DSG A;  3KPK A;  1K0L A;  2HXT A;  2WOV A;  3LOV A;  3VCN A;  3LB8 A;  3R9U A;  2QQ6 A;  3EPT A;  3GYJ A;  4TM0 A;  3CXO A;  1ONF A;  3H70 A;  2E5A A;  2GMJ A;  4YTN A;  3AE7 A;  1NHP A;  1DOB A;  4TM3 A;  4YKF A;  1SB3 B;  2X8H A;  4X4J A;  2OAM A;  2GB0 A;  4DGK A;  4D03 A;  1ZOV A;  1GES A;  3NNE A;  3E1T A;  2C76 A;  4GGB A;  4ZA0 A;  1DJQ A;  1EBH A;  4Z2U A;  4EM3 A;  2R0P A;  2OPJ A;  2RDX A;  3P93 A;  3MUC A;  2X8G A;  2WOI A;  4H2Q A;  4U8J A;  1TYP A;  2PTX A;  4NTD A;  3R10 A;  3BSM A;  2A8X A;  1ZP0 A;  3RP6 A;  2WDV A;  2C3C A;  3T37 A;  1PBC A;  3P4P A;  4A3R A;  1H6V A;  3V3O A;  1F8R A;  2BK3 A;  2OLO A;  4O5Q A;  1GRT A;  5BUK A;  5G5H B;  3L5O A;  4REK A;  2BRA A;  4GME A;  3UTF A;  4DYE A;  4LII A;  4AT0 A;  3NN0 X;  4B68 A;  2OAL A;  4C3X A;  2OKT A;  2Q0L A;  4ZOH B;  3GWF A;  3BHK A;  1N1P A;  3A7R A;  3HYX A;  3GWD A;  3P9U A;  2PSN A;  1H84 A;  4E0V A;  1H2I A;  4FI4 A;  1B4V A;  3H8A A;  3HRD C;  3QJ4 A;  3IC9 A;  3T31 A;  4Z2T A;  2FYM A;  1SJB A;  2YG7 A;  4APN A;  1GRE A;  4LA1 A;  5JCM A;  3RP7 A;  1OEP A;  4AOX A;  2QJN A;  1L9E A;  3NGC X;  4GIS A;  5JCL A;  3T9P A;  3FYY A;  4H2H A;  2JK6 A;  1N60 C;  1KCZ A;  3UOX A;  4G7F A;  3CN8 A;  4DNA A;  2AAQ A;  5BRT A;  1PJ5 A;  3H12 A;  1JRY A;  5HY5 A;  3ICR A;  4TVW A;  4GUV A;  1DOC A;  2PP0 A;  4OCG A;  5L46 A;  4GYP A;  2VQB A;  2R9Z A;  4BJY A;  3LZX A;  3H8L A;  2R46 A;  1EC9 A;  3CNP A;  4K2S A;  3VRB A;  3UTE A;  3DJJ A;  3JW7 A;  1N4U A;  2YR6 A;  1GRA A;  1KD0 A;  4HCD A;  4K7Z A;  4EQR A;  4U8P A;  4O5U A;  1FHU A;  3M12 A;  2XVI A;  3DFH A;  3UJS A;  1CJC A;  5IQ4 A;  1GRB A;  4B63 A;  2WPC A;  2CDU A;  4DHG A;  2YM1 A;  1GET A;  1EC7 A;  4G6H A;  2UZZ A;  3FVD A;  3PO7 A;  3KD9 A;  4K22 A;  3V3W A;  1VQW A;  4ENL A;  3SFE A;  2YG3 A;  1H7X A;  2GRT A;  4IVO B;  3CTY A;  3OZY A;  2C70 A;  3SY4 A;  1D7L A;  2XLS A;  2A89 A;  3BHF A;  5M0Z A;  1PBB A;  3TWB A;  4RG4 A;  1D5T A;  4CRT A;  4H4Z A;  4OPD A;  4YWO A;  2XFQ A;  2ZC8 A;  1RM6 B;  4H1Z A;  3AE2 A;  3UTH A;  3CPH G;  4Y4M A;  1TKK A;  2OLN A;  2QAE A;  4BV6 A;  2R4E A;  1DNC A;  2B9Y A;  1E1K A;  1FEB A;  3D47 A;  1X2H A;  3QFA A;  3OZ2 A;  1GTE A;  4DX3 A;  4JN8 A;  1P43 A;  3DES A;  1L8P A;  5FS7 A;  4CCQ A;  3CGD A;  2A87 A;  4X9M A;  2PGW A;  2P0I A;  3PWI A;  6ENL A;  3BI4 A;  3V5F A;  2WOW A;  4IZG A;  2WP9 A;  2XFP A;  3AE5 A;  3UKK A;  4AP3 A;  5KMQ A;  5BOF A;  4Z2R A;  2YLW A;  3GDN A;  3QKE A;  2V6O A;  1XDI A;  4WCT A;  2YR4 A;  4EQX A;  2R45 A;  3LZW A;  2B7S A;  4CBQ A;  4I59 A;  3SZF A;  2ONE A;  4LU6 A;  2J3N A;  1WUE A;  4ZCW A;  3FMW A;  4II2 A;  3G5S A;  3T8Q A;  4YSH A;  1AOG A;  2PYX A;  2BK5 A;  2X50 A;  3AEB A;  4KPR A;  2H88 A;  1CHU A;  4C5O A;  3G5R A;  1VDV A;  3RCY A;  4KWS A;  3ES7 A;  1CC2 A;  2BXR A;  2PTW A;  4ZCD A;  3HYW A;  4C74 A;  2W0H A;  1IJH A;  1XPQ A;  2R0C A;  2OFJ A;  2PS2 A;  2GMH A;  4JQ9 A;  4J31 A;  5JCN A;  3ALM A;  3L8K A;  3NZG A;  1S2Q A;  4N9X A;  3GMB A;  2WP5 A;  2R4J A;  1PXB A;  2EQ8 A;  1ELI A;  1FFV C;  4H4W A;  3KUM A;  3KA7 A;  1E1N A;  2GDQ A;  1FFU C;  4IA6 A;  1NG3 A;  2JKC A;  2X8C A;  3GC2 A;  2WBA A;  4Z43 A;  4JY3 A;  2NQL A;  3S5W A;  3SBF A;  2OQY A;  3VQR A;  1JRP A;  1IUV A;  1LV0 A;  2BS2 A;  3MKC A;  1N5W C;  1PN0 A;  2AR8 A;  1H81 A;  3Q6J A;  3PWG A;  2JBV A;  4EQS A;  3ATR A;  2XFN A;  3JVA A;  1KN0 A;  2ZAD A;  1E1L A;  3UOZ A;  4TM1 A;  3UKA A;  2V3B A;  3NIX A;  5G5G B;  3TW9 A;  3DJG X;  4XWR A;  4K1W A;  2XCG A;  1E6E A;  2DKI A;  1M64 A;  2P3Z A;  4H2P A;  3F8D A;  2WHD A;  2WDR A;  4A7A A;  3UKF A;  2TPR A;  4EIP A;  3UJF A;  2WU5 A;  3KU9 A;  2E5V A;  1RP0 A;  3AEE A;  4GR1 A;  2W3R A;  1BGJ A;  3DGZ A;  1DJN A;  3DK9 A;  1TDN A;  2YVJ A;  4K8G A;  3M13 A;  1TDK A;  3GRT A;  3TJ4 A;  1LQT A;  3G5Q A;  3NYF A;  5FS8 A;  1IUT A;  1N4V A;  4M0X A;  1L9C A;  2OO6 A;  5GSN A;  4DN1 A;  1FO4 A;  3AYL A;  4IA5 A;  2E3T A;  2PGE A;  1JCT A;  2YVF A;  2GR2 A;  3B6D A;  2VVM A;  3FG2 P;  1YQ4 A;  2VVL A;  5EOW A;  3FPZ A;  3U4F A;  3IF9 A;  1GSN A;  3BJS A;  5KNL A;  3CAW A;  3EAO A;  5ENL A;  2XVF A;  4CNJ A;  3CT2 A;  1VG9 A;  1JRX A;  4FK1 C;  2AQJ A;  5JRB A;  2XLU A;  4WX1 A;  5JCI A;  2JB1 A;  2W55 A;  4E8G A;  3R25 A;  1IYX A;  3AE6 A;  4X9N A;  3SSZ A;  4A99 A;  2VZ2 A;  5KMP A;  4H4P A;  3UJE A;  1WUF A;  1XAN A;  3OZM A;  1H83 A;  4PAA A;  5C3J A;  3DDM A;  3K7T A;  2YG4 A;  3RED A;  1XPY A;  2V5Z A;  1TDO A;  2WU2 A;  4KT2 A;  2C64 A;  3D9X A;  3SXI A;  3ZYX A;  4FP1 A;  4EWJ A;  3A7U A;  3STP A;  2GF3 A;  3ENL A;  4U2S A;  5U63 A;  4OPT A;  1LJ1 A;  4BK3 A;  3FXG A;  3N4F A;  3CXB A;  4JDR A;  3QSM A;  1TDE A;  1GER A;  4J34 A;  4MGG A;  2W3S A;  3GD6 A;  3V5C A;  2W54 A;  4HNC A;  3AD7 B;  1GTH A;  2H89 A;  2QCU A;  3AE3 A;  4C3Y A;  2YVG A;  3SM8 A;  2P8C A;  2AL2 B;  3SZC A;  3FJ4 A;  4ZCC A;  4J57 A;  3O0H A;  2IVD A;  2WET A;  3GO2 A;  1ZY8 A;  2AL1 A;  1GOS A;  1GRF A;  2F5Z A;  4J36 A;  2B76 A;  2GV8 A;  2C66 A;  3SN0 A;  2OX4 A;  4DXK A;  3TCS A;  2WS3 A;  4J1O A;  4NTE A;  2VQ7 A;  3GD3 A;  2DW7 A;  4GDE A;  2OG9 A;  3AE4 A;  3URH A;  4OPG A;  1NHR A;  3DFY A;  4RG3 A;  2XH0 A;  4TLX A;  1IUU A;  4GFI A;  2O56 A;  3BNM A;  4KEM A;  3SZ0 A;  4IP4 A;  2WEU A;  3ISH A;  4JHM A;  2BS4 A;  1GAL A;  1W4X A;  1ZDL A;  5EU9 A;  2YWL A;  3QSS A;  3NK2 X;  3K30 A;  3UKL A;  2FJA A;  1JRZ A;  3PG6 A;  3GMC A;  2BA9 A;  3DME A;  4NEV A;  4AT2 A;  3C96 A;  3NVV B;  3DJE A;  3BI2 A;  3EKG A;  1R6W A;  3Q9T A;  1JPM A;  1B8S A;  2XVH A;  3CGE A;  1B5Q A;  3EEZ A;  4HCL A;  2FKP A;  4JY2 A;  2YLX A;  2MUC A;  2Q0K A;  2XDO A;  1XHC A;  2FJE A;  5DBJ A;  1Q1W A;  3UJR A;  1DOE A;  5J60 A;  3CND A;  3SN4 A;  2GEW A;  1S7M A;  3CPJ G;  4KX6 A;  4D04 A;  3NT6 A;  2POD A;  2NPX A;  2C67 A;  3UJ2 A;  3P1W A;  4CY8 A;  4GAP A;  4YTP A;  1Y0P A;  2P8B A;  4G8T A;  3IK4 A;  3R0K A;  4HCH A;  2QA1 A;  4NZH A;  1TE6 A;  1BQG A;  4Z26 A;  1E1M A;  3ICS A;  3LJP A;  2BRY A;  2C3D A;  5KOW A;  3AM9 A;  2VOU A;  1F8W A;  4FK1 A;  3KLJ A;  1PDY A;  1YQ3 A;  4EMJ A;  3K7Q X;  2XYO A;  4H4V A;  2B9X A;  3AE9 A;  3BNU A;  1NDA A;  2ZZB A;  1S3B A;  4NNJ A;  2I0Z A;  4H83 A;  4IHC A;  4G73 A;  3IJL A;  1DXL A;  3GYI A;  2V3A A;  3DGH A;  4Y4L A;  2QDD A;  2XGZ A;  1BZL A;  3GSI A;  5GRT A;  3D8X A;  1RVK A;  5BOE A;  3VCC A;  3UOV A;  3VR8 A;  3F8R A;  4B69 A;  2PTZ A;  3UCD A;  4U2L A;  3CGB A;  4X2P A;  5KVI A;  4EMI A;  4YSZ A;  1Y56 B;  1K0J A;  1JNZ A;  1TZZ A;  4MJW A;  4U8I A;  3NRN A;  1REO A;  2QGY A;  2OVL A;  3IJQ A;  4EQW A;  3DGB A;  4H19 A;  2OQH A;  3N4E A;  2ACZ A;  3ZLF A;  4NTC A;  3RRA A;  1NEN A;  2YQU A;  2ZZ0 A;  4AOS A;  3GD4 A;  2BAC A;  1N63 C;  2BC0 A;  4EM4 A;  4OPI A;  1PXC A;  5FJP A;  2CHR A;  4E5T A;  3DA1 A;  1LQU A;  3RIT A;  5CQF A;  1PDZ A;  4U2T A;  1JEH A;  1GV4 A;  1N5X A;  2E1M A;  4EMW A;  1ECQ A;  2QA2 A;  1Q1R A;  1X2G A;  3S47 A;  5KRQ A;  3PS9 A;  3CYJ A;  4B67 A;  3THU A;  1IUW A;  1V59 A;  1T3Q C;  4G74 A;  2GGH A;  4KPL A;  1H86 A;  1TDF A;  3KKJ A;  1PJ7 A;  1QJD A;  1KSU A;  4J2W A;  1WYG A;  1MDR A;  1F6M A;  4OVI A;  2DKH A;  3RNM A;  2FJD A;  4A65 A;  3RO6 A;  2BCG G;  2HZG A;  3AEA A;  3KVE A;  2V60 A;  3AB1 A;  5KXJ A;  3T2Y A;  2JB2 A;  3NFU A;  3N6J A;  2PCE A;  1IUX A;  3QVR A;  1OJT A;  4XXG A;  5JCK A;  4EIQ A;  3S61 A;  4CY6 A;  3ALJ A;  3T2K A;  4H2N A;  4HPN A;  2YG6 A;  1P48 A;  3I6D A;  3T0K A;  2XVE A;  3H4K A;  2VRM A;  3UOY A;  3SJN A;  4F4R A;  1B37 A;  3JSK A;  1D4D A;  1KDG A;  3NO1 A;  1GRG A;  3HW2 A;  3P4R A;  4UDQ A;  4HYR A;  3FBS A;  2C75 A;  2EQ9 A;  3ZVH B;  4OPC A;  3ZDN A;  2EQ6 A;  7ENL A;  1JOA A;  2PTY A;  2YM2 A;  3ICT A;  1NAA A;  2CFY A;  3MWC A;  4ICY A;  3B3R A;  4H4X A;  1CJ3 A;  3AXB A;  1PXA A;  1FEA A;  1GND A;  3V4B A;  3QVP A;  3TWA A;  2PU0 A;  2BS3 A;  3NS1 B;  5FJO A;  2PU1 A;  3EAN A;  3QSE A;  1KNR A;  1F8S A;  2YAU A;  5U1O A;  4G9K A;  3UCL A;  1RYI A;  3DER A;  5FJU A;  1K4Q A;  3LAD A;  3AEC A;  5KOX A;  4H4Y A;  3NH3 X;  3NVY B;  2OZT A;  2XH2 A;  3NYC A;  3AED A;  3NVZ B;  3OC4 A;  1GXF A;  3F8P A;  3VFC A;  3VR9 A;  2YLZ A;  4B1B A;  1JDF A;  3AMZ A;  4PAB A;  3TJI A;  1IUS A;  2GGE A;  2FJB A;  4YKG A;  3UXK A;  1D7Y A;  5FS6 A;  2WPE A;  2WES A;  2HNE A;  4H7U A;  3AEG A;  3AE1 A;  3R07 C;  3MY9 A;  3H7V A;  5M10 A;  3PFR A;  4MMW A;  3CMM A;  3ATQ A;  3M0O A;  1EBG A;  4Z25 A;  5HHF A;  3II4 A;  3P4S A;  3D1C A;  1NEK A;  1MXT A;  2PMQ A;  1Q9I A;  1CC6 A;  2XLP A;  3ALL A;  4J33 A;  4OPU A;  3B97 A;  3MZN A;  4K2X A;  3VA8 A;  2PP1 A;  2YLT A;  1SJA A;  3L1R A;  3Q45 A;  3ABV A;  5KMS A;  2AL2 A;  2AKZ A;  2QVH A;  1H7W A;  3CIR A;  4II3 A;  1FL2 A;  4IL2 A;  5CKU A;  1KNP A;  2APG A;  3NHO X;  3SX6 A;  3DIP A;  2TMD A;  2QJM A;  1ZKQ A;  1BF3 A;  1MO9 A;  2OA1 A;  1O5W A;  1PDH A;  1EL5 A;  3TTE A;  4Y4N A;  1SJD A;  2XLT A;  1E7P A;  3DG3 A;  4YT0 A;  4Z24 A;  2GGJ A;  1PBD A;  3NK1 X;  2GR3 A;  1JPD X;  3ZLH A;  1ONE A;  3UP5 A;  2C7G A;  3V3N A;  4B64 A;  1OJC A;  3DH9 A;  2EQ7 A;  2PA6 A;  3FV9 A;  3SGL A;  4A6N B;  4DSH A;  3NRZ B;  3C4N A;  3IHM A;  3SQS A;  3OW1 A;  2X99 A;  1KKO A;  1O94 A;  1NPX A;  1YY5 A;  4CNK A;  1PHH A;  3U9I A;  3I6E A;  3NXL A;  1L0V A;  2CUL A;  4RSL A;  2OZ3 A;  3HPF A;  2GAH B;  1FEC A;  1RSG A;  4TVY A;  5J04 A;  3R0U A;  4Z17 A;  2HXU A;  4NEW A;  4B65 A;  3GRS A;  3C4A A;  4ZN0 A;  2GR0 A;  3AD9 B;  3AYI A;  4JN9 A;  2XFO A;  3VC6 A;  2GSH A;  3OP2 A;  4U8K A;  4UDP A;  4I58 A;  4GIR A;  4J3Z A;  2POZ A;  1PS9 A;  5EBK A;  1VRQ B;  1BKW A;  1CBO A;  1ZOY A;  4H4Q A;  1JU2 A;  3H8I A;  1FHV A;  2I5Q A;  4ADW A;  4JNQ A;  2GQW A;  3COX A;  1EBD A;  3UCC A;  1DOD A;  2BK4 A;  3DJD A;  4GCM A;  2HQM A;  2QDE A;  1D4E A;  3I4K A;  2OLA A;  2PPG A;  3BI5 A;  2X3N A;  2Z5Y A;  2C73 A;  2BAB A;  1L9D A;  1YKJ A;  2R0G A;  5J7X A;  3CGC A;  1STZ A;  1VQZ A;  5LV9 A;  1YQZ A;  4MKS A;  2BCP A;  2XH7 A;  5KVH A;  4E4F A;  1Z6L A;  1NHQ A;  1O95 A;  4A35 A;  2FBW A;  3AD8 B;  1CJ2 A;  1PBE A;  3IHG A;  1VG0 A;  3NTA A; 
#chains in the Genus database with same CATH homology
 4X4J A;  4TM1 A;  4H4R A;  2OAM A;  2GB0 A;  3T14 A;  4DGK A;  5EB5 A;  3PS9 A;  4B67 A;  5KRQ A;  4D03 A;  1ZOV A;  3UKA A;  4U8O A;  1IUW A;  2V3B A;  3NIX A;  1GES A;  1V59 A;  3NNE A;  4G74 A;  3CNT A;  4A79 A;  2CVJ A;  2RGH A;  4C77 A;  3E1T A;  3DJG X;  4XWR A;  2C76 A;  1K0I A;  3KPF A;  2XCG A;  1E6E A;  2DKI A;  1H86 A;  1M64 A;  1TDF A;  3KKJ A;  1PJ7 A;  1DJQ A;  1QJD A;  4BJZ A;  4Z2U A;  2JAE A;  4EM3 A;  4H50 A;  1KSU A;  2R0P A;  1D4C A;  1Y56 A;  2WHD A;  3F8D A;  2WDR A;  4H2P A;  4J2W A;  4OPL A;  3UKF A;  4A7A A;  2TPR A;  4H4S A;  1F6M A;  4OVI A;  4EIP A;  2X8G A;  2WOI A;  2DKH A;  3RNM A;  4H2Q A;  2FJD A;  4U8J A;  2WU5 A;  2XVJ A;  1F3P A;  3KU9 A;  2E5V A;  4TLZ A;  1RP0 A;  4A65 A;  3AEE A;  2BCG G;  4GR1 A;  1BGJ A;  3DGZ A;  3AEA A;  2V60 A;  3KVE A;  5ER0 A;  1TYP A;  3GDP A;  4B66 A;  3AB1 A;  5KXJ A;  1DJN A;  2ARD A;  3DK9 A;  1TDN A;  2YVJ A;  4NTD A;  4A5L A;  3T2Y A;  2JB2 A;  3NK0 X;  2XLR A;  2A8X A;  1ZP0 A;  3RP6 A;  4USQ A;  3M13 A;  2WDV A;  2C3C A;  5EB4 A;  1TDK A;  3T37 A;  3DK4 A;  1VDC A;  1PBC A;  3P4P A;  3NLC A;  4H2R A;  1H6V A;  3GRT A;  3V3O A;  1IUX A;  1EL9 A;  1F8R A;  1LQT A;  3G5Q A;  3QVR A;  2NVK X;  3NYF A;  1OJT A;  2BK3 A;  1SEZ A;  2OLO A;  5FS8 A;  5JCK A;  4XXG A;  4EIQ A;  3S61 A;  4CY6 A;  3ALJ A;  1IUT A;  1N4V A;  3T2K A;  1QLB A;  4H2N A;  1L9C A;  2YG6 A;  4O5Q A;  1GRT A;  3VRA A;  5GSN A;  5BUK A;  2GH5 A;  3AYL A;  3I6D A;  3T0K A;  2XVE A;  3L5O A;  4REK A;  2JB3 A;  2BXS A;  4Z44 A;  1NG4 A;  2BRA A;  3H4K A;  4IA5 A;  1P2H A;  2VRM A;  3UOY A;  2YVF A;  3UTF A;  2GR2 A;  3V76 A;  3B6D A;  2VVM A;  3FG2 P;  1YQ4 A;  1B37 A;  2VVL A;  3FPZ A;  5EOW A;  3JSK A;  4FX9 A;  4LII A;  1D4D A;  1KDG A;  4AT0 A;  3IF9 A;  1GRG A;  3T2Z A;  3NN0 X;  2B9W A;  3P4R A;  1GSN A;  4B68 A;  5KNL A;  4J56 A;  3EAO A;  1PJ6 A;  2YG5 A;  4UDQ A;  2Y6R A;  2OAL A;  3FBS A;  2XVF A;  4BK1 A;  4C3X A;  1VG9 A;  4CNJ A;  2GAG B;  4C74 A;  2GR1 A;  2C75 A;  2EQ9 A;  2Q0L A;  3SQP A;  1JRX A;  4FK1 C;  4OPC A;  2AQJ A;  2EQ6 A;  3ZDN A;  2IVE A;  5JRB A;  2XLU A;  1JOA A;  3BHK A;  1N1P A;  3GWF A;  2YM2 A;  4GDP A;  4WX1 A;  5JCI A;  2JB1 A;  3GWD A;  3HYX A;  3ICT A;  3P9U A;  3P4Q A;  1H84 A;  4E0V A;  1NAA A;  3NTD A;  2CFY A;  1H2I A;  3DK8 A;  1B4V A;  3AE6 A;  1MOK A;  2Y6Q A;  4X9N A;  3QJ4 A;  3IC9 A;  4A99 A;  4ICY A;  3T31 A;  4Z2T A;  2VZ2 A;  2YG7 A;  4APN A;  5KMP A;  1GRE A;  4UP3 A;  3B3R A;  4H4X A;  4LA1 A;  4NWZ A;  4H4P A;  1CJ3 A;  3AXB A;  4GAV A;  1PXA A;  1FEA A;  1XAN A;  5JCM A;  1GND A;  2ZBW A;  5BVA A;  3RP7 A;  1H83 A;  3QVP A;  4PAA A;  4AOX A;  5C3J A;  1L9E A;  3K7T A;  2YG4 A;  3NGC X;  5JCL A;  1EL7 A;  3AWI A;  3RED A;  2V5Z A;  3ITJ A;  1TDO A;  2BS3 A;  2WU2 A;  4YSX A;  2JK6 A;  3UOX A;  3PVC A;  3EAN A;  2C64 A;  1KNR A;  3AEF A;  3QSE A;  3CN8 A;  3LXD A;  3D9X A;  2AAQ A;  4DNA A;  5BRT A;  3SXI A;  3ZYX A;  1PJ5 A;  2B7R A;  3SYI A;  1F8S A;  1JRY A;  3ICR A;  4IV9 A;  4A9W A;  2YAU A;  5HY5 A;  4GUV A;  5U1O A;  4G9K A;  2GF3 A;  1DOC A;  4OCG A;  4U2S A;  5L46 A;  3CNS A;  2VQB A;  2BYB A;  3QFB A;  5U63 A;  4OPT A;  1LJ1 A;  1OJA A;  1RYI A;  2R9Z A;  3UCL A;  4BK3 A;  2YR5 A;  1ZK7 A;  1K4Q A;  4BJY A;  3LAD A;  4JDR A;  3QSM A;  1TDE A;  3LZX A;  3H8L A;  3AEC A;  1GER A;  1BWC A;  4J34 A;  1OJ9 A;  4H4Y A;  3NH3 X;  5KOX A;  2R46 A;  1UKV G;  3VRB A;  3CNP A;  3UTE A;  3DJJ A;  1M6I A;  1N4U A;  2YR6 A;  3FIM B;  3NYC A;  4K5S A;  4P9S A;  1GRA A;  3AED A;  3OC4 A;  1CC4 A;  3NG7 X;  1GXF A;  3AD7 B;  3F8P A;  2WQY A;  4YSY A;  3VR9 A;  2YLZ A;  4BK2 A;  1QO8 A;  4B1B A;  4H4T A;  1GTH A;  2H89 A;  5C2T A;  4U8L A;  4PAB A;  4TM4 A;  2QCU A;  4K7Z A;  4H4U A;  4EQR A;  1IUS A;  3AE3 A;  4U8P A;  2FJB A;  5FS9 A;  4YKG A;  4O5U A;  4C3Y A;  3I3L A;  3M12 A;  3SZW A;  2PHH A;  2YVG A;  3SM8 A;  2XVI A;  3SZC A;  1CJC A;  5IQ4 A;  1D7Y A;  1GRB A;  5FS6 A;  4U8N A;  4ZCC A;  1H82 A;  2WPE A;  4J57 A;  3O0H A;  2WES A;  2IVD A;  4B63 A;  2WPC A;  2CDU A;  2WET A;  2GQF A;  4H7U A;  3AEG A;  1ZX9 A;  3AE1 A;  5BUL A;  4USR A;  1ZY8 A;  1GOS A;  2YM1 A;  3NN6 X;  1GET A;  1GRF A;  2F5Z A;  3EF6 A;  2B76 A;  1HYU A;  2GV8 A;  1S2Y A;  4J36 A;  2C66 A;  4G6H A;  3NKS A;  2UZZ A;  2WS3 A;  4HA6 A;  1LTX R;  3PO7 A;  4NTE A;  1LVL A;  5M10 A;  2VQ7 A;  3KD9 A;  4K22 A;  1FOH A;  3UKQ A;  3GD3 A;  3CMM A;  3ATQ A;  4GDE A;  1VQW A;  3M0O A;  1FCD A;  4Z25 A;  5HHF A;  3II4 A;  3P4S A;  4HB9 A;  2RGJ A;  2VRL A;  3D1C A;  1OJD A;  1NEK A;  3AE4 A;  3SFE A;  4K5R A;  2YG3 A;  3HYV A;  3VRD B;  1H7X A;  1MXT A;  3URH A;  1Q9I A;  4OPG A;  1CC6 A;  2XLP A;  2GRT A;  3ALL A;  1NHR A;  4IVO B;  4J33 A;  4RG3 A;  4OPU A;  3CTY A;  4UDR A;  2C70 A;  3SY4 A;  2WDQ A;  4TLX A;  1X31 B;  1IUU A;  1D7L A;  2XLS A;  1CL0 A;  2A89 A;  3BHF A;  4K2X A;  5M0Z A;  1PBB A;  3BNM A;  3SFD A;  1TRB A;  3WE0 A;  3SZ0 A;  4RG4 A;  1D5T A;  2WEU A;  2YLT A;  3ISH A;  4CRT A;  4H4Z A;  4OPD A;  2BS4 A;  1GAL A;  1GPE A;  3IWA A;  1W4X A;  3L1R A;  1ZDL A;  4YWO A;  2YWL A;  3QSS A;  3ABV A;  3NK2 X;  2XFQ A;  3K30 A;  1TYT A;  3UKL A;  2FJA A;  5KMS A;  4GRT A;  5TR3 A;  1JRZ A;  3AE8 A;  3AE2 A;  3PG6 A;  3GMC A;  2BA9 A;  3DME A;  4XWZ A;  4NEV A;  4GF7 A;  4AT2 A;  2RGO A;  3C96 A;  3UTH A;  3CPH G;  4Y4M A;  1H7W A;  3CIR A;  3DJE A;  1FL2 A;  4II3 A;  1S3E A;  3BI2 A;  3UP4 A;  2OLN A;  5CKU A;  3Q9T A;  4ECH A;  1KNP A;  2APG A;  4K8D A;  1B8S A;  2QAE A;  4BV6 A;  2XVH A;  2R4E A;  1DNC A;  3NHO X;  5IQ1 A;  3SX6 A;  3CGE A;  2B9Y A;  1E1K A;  1B5Q A;  1FEB A;  2TMD A;  3GYX A;  3QFA A;  1ZKQ A;  3OZ2 A;  1BF3 A;  1MO9 A;  2OA1 A;  2Z5X A;  1GTE A;  1O5W A;  4JY2 A;  1PDH A;  1EL5 A;  5HXI A;  2YLX A;  4Y4N A;  1KFY A;  2Q0K A;  2XLT A;  2BC1 A;  1E7P A;  4YT0 A;  2E4G A;  4Z24 A;  3UKP A;  1N4W A;  2WPF A;  2VVL G;  1PBD A;  5FS7 A;  4CCQ A;  3NK1 X;  2XDO A;  3CGD A;  1XHC A;  2A87 A;  4X9M A;  2FJE A;  4YTM A;  2GR3 A;  5DBJ A;  1Q1W A;  3K7M X;  3BI4 A;  1DOE A;  5J60 A;  3AE5 A;  2WOW A;  2XFP A;  2WP9 A;  3CND A;  2GEW A;  3UKK A;  1S7M A;  4AP1 A;  3CPJ G;  4AP3 A;  4KX6 A;  5KMQ A;  2C7G A;  3UP5 A;  4D04 A;  3NT6 A;  3V3N A;  4Z2R A;  2YLW A;  2NPX A;  2C67 A;  4B64 A;  5KWF A;  3P1W A;  1OJC A;  3GDN A;  3DH9 A;  3UTG A;  2V6O A;  2XFU A;  4GAP A;  2EQ7 A;  1XDI A;  4CY8 A;  4YTP A;  3SGL A;  2RAB A;  1Y0P A;  4WCT A;  2GVC A;  2YR4 A;  4JNA A;  4A6N B;  1EL8 A;  4EQX A;  2R45 A;  4DSH A;  2Q6U A;  3C4N A;  3IHM A;  3LZW A;  2QA1 A;  4NZH A;  2B7S A;  4CBQ A;  1NHS A;  4I59 A;  5U25 A;  2X99 A;  3SZF A;  4Z26 A;  1KF6 A;  3CPI G;  1CF3 A;  1E1M A;  4LU6 A;  2J3N A;  3ICS A;  2WP6 A;  3RHA A;  1O94 A;  1NPX A;  1YY5 A;  3LJP A;  2BRY A;  4CNK A;  3FMW A;  4II2 A;  1PHH A;  2C3D A;  4FDC B;  1L0V A;  5KOW A;  4M52 A;  2O9Z A;  2VOU A;  2CUL A;  3G5S A;  4IVM B;  4RSL A;  1F8W A;  4FK1 A;  4CCR A;  3KLJ A;  4YSH A;  1YQ3 A;  1AOG A;  4EMJ A;  2GAH B;  2PYX A;  4G6G A;  5HYM A;  1FEC A;  1RSG A;  2Q7V A;  3K7Q X;  2XYO A;  2BK5 A;  2X50 A;  4H4V A;  4NEW A;  2B9X A;  4B65 A;  3AE9 A;  3AEB A;  3BNU A;  1NDA A;  2ZZB A;  4KPR A;  3GRS A;  2H88 A;  1CHU A;  3CNJ A;  3UKH A;  4C5O A;  1S3B A;  3C4A A;  3G5R A;  4ZN0 A;  4NNJ A;  2GR0 A;  1BGN A;  3AD9 B;  2I0Z A;  3AYI A;  4JN9 A;  1CC2 A;  2XFO A;  2BXR A;  1DXL A;  4G73 A;  1JNR A;  2ZZC A;  1E39 A;  4ZCD A;  3ADA B;  3HYW A;  3GYI A;  2V3A A;  4U8K A;  4UDP A;  3DGH A;  4Y4L A;  3AYJ A;  1GT8 A;  2W0H A;  4I58 A;  1ZMD A;  1CJ4 A;  1IJH A;  1XPQ A;  2R0C A;  1BZL A;  3GSI A;  5GRT A;  4YXD A;  1PS9 A;  4U8M A;  3D8X A;  5EBK A;  2GMH A;  1GRH A;  3UOV A;  3VR8 A;  3F8R A;  4B69 A;  4JQ9 A;  1VRQ B;  4J31 A;  2C4C A;  1BKW A;  5JCN A;  3ALM A;  1CBO A;  1ZOY A;  4U2L A;  1JU2 A;  4H4Q A;  5FMH A;  1VG0 A;  3RP8 A;  5IPY A;  1LPF A;  3L8K A;  1P2E A;  5KMR A;  1S2Q A;  3H8I A;  4N9X A;  3CGB A;  2YLR A;  3GMB A;  4ADW A;  2WP5 A;  2V61 A;  4JNQ A;  4A6N A;  5KVI A;  2GQW A;  2C65 A;  3HZL A;  2R4J A;  3COX A;  4EMI A;  1PXB A;  4BUR A;  3NYE A;  2EQ8 A;  1COY A;  1ELI A;  4YSZ A;  1GEU A;  4H4W A;  1Y56 B;  1EBD A;  1K0J A;  1JNZ A;  3KA7 A;  1E1N A;  1KSS A;  2IID A;  1DOD A;  4MJW A;  4U8I A;  3NRN A;  2BK4 A;  4IA6 A;  3DJD A;  1REO A;  1NG3 A;  1PBF A;  4GCM A;  2YLS A;  4EQW A;  2C72 A;  2HQM A;  1ZMC A;  1D4E A;  2JKC A;  4DSG A;  3BI5 A;  2X8C A;  2ACZ A;  2X3N A;  3KPK A;  4NTC A;  1K0L A;  2WBA A;  2Z5Y A;  2WOV A;  2C73 A;  3LOV A;  3LB8 A;  3R9U A;  3EPT A;  2BAB A;  1NEN A;  4Z43 A;  2YQU A;  4JY3 A;  2ZZ0 A;  4AOS A;  3GYJ A;  4TM0 A;  3S5W A;  3VQR A;  3GD4 A;  2BAC A;  1IUV A;  1LV0 A;  2BS2 A;  2BC0 A;  1ONF A;  4EM4 A;  1L9D A;  1YKJ A;  4OPI A;  2R0G A;  2GMJ A;  5J7X A;  1PXC A;  4YTN A;  1PN0 A;  3CGC A;  1H81 A;  2AR8 A;  3AE7 A;  3Q6J A;  1NHP A;  1YQZ A;  3DA1 A;  1DOB A;  2JBV A;  5LV9 A;  4EQS A;  4TM3 A;  4YKF A;  2BCP A;  1LQU A;  5KVH A;  1Z6L A;  5CQF A;  3ATR A;  1NHQ A;  4U2T A;  2XFN A;  1JEH A;  1GV4 A;  1O95 A;  1KN0 A;  2FBW A;  2E1M A;  1E1L A;  3UOZ A;  3AD8 B;  2X8H A;  4EMW A;  1CJ2 A;  1PBE A;  2QA2 A;  3IHG A;  1Q1R A;  3NTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...