3GD4A

Crystal structure of the reduced, nad-bound form of murine apoptosis inducing factor
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
483
structure length
445
Chain Sequence
PSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLQFRQWNGKERSIYFQPPSFYVSAQDLPNIENGGVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRALEKISREVKSITVIGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKILPQYLSNWTMEKVKREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKAEASEITIPEDYGKGVIFYLRDKVVVGIVLWNVFNRMPIARKIIKDGEQHEDLNEVAKLFNIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apoptosis-inducing factor 1, mitochondrial
publication title Redox-linked conformational dynamics in apoptosis-inducing factor
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 142
structure length 445
sequence length 483
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3gd4A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3gd4A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3gd4A01
1KNPA 1OJCA 1E39A 3LADA 2WU2A 2XFQA 1VQWA 4TM0A 2EQ8A 5HY5A 4B66A 1H82A 3P4SA 4JN9A 2BK5A 1H83A 3NTAA 5HXIA 1CJCA 1NHQA 4H4SA 1S3EA 4D04A 1JU2A 1K0JA 3REDA 4EM4A 2YM1A 4U8JA 4XXGA 3UKQA 2YM2A 1QO8A 3GRSA 3CPIG 3VRDB 2HQMA 2XCGA 2YQUA 3FIMB 2XVIA 3QJ4A 1Y0PA 2BS4A 2E1MA 5EOWA 1B8SA 2IIDA 3RHAA 1UKVG 2C7GA 2X99A 4IA6A 1JEHA 1QLBA 3KVEA 3KU9A 5KWFA 1L9EA 3BI5A 2BCPA 3QFAA 4FDCB 2AAQA 1YY5A 2C3CA 3DGHA 3I3LA 3QSSA 3GDPA 2R46A 1N4WA 3CGDA 1E1LA 4GUVA 4AT2A 3B3RA 1IUUA 3ALJA 2BXSA 1O5WA 2GV8A 3GMBA 5LV9A 1F8RA 1RSGA 1LV0A 5IQ1A 2TMDA 4U2LA 3HZLA 1GESA 1CHUA 3RP7A 1GTHA 3UKAA 2Y6QA 3UKLA 2DKHA 2R0CA 2R4EA 4B68A 3BNUA 3EF6A 3KD9A 3G5QA 3CNTA 3KLJA 4TM3A 4H4TA 1EL7A 3NTDA 2BC0A 3CN8A 2XVJA 1P2HA 3GSIA 3AYJA 1YQ3A 3OZ2A 2NPXA 2YVJA 1XPQA 3ADAB 1COYA 3H8LA 3DA1A 1GTEA 3I6DA 1CC2A 2APGA 3UP4A 2BYBA 4FK1C 2YG4A 5BRTA 4FX9A 2PYXA 4A6NA 3S61A 1B37A 1LQUA 3FMWA 2X3NA 3UOXA 3AECA 5KOWA 5M10A 1CL0A 3AD7B 2BACA 1NHPA 1XDIA 1NDAA 1ZDLA 3GRTA 2Y6RA 5KRQA 2JB1A 2EQ6A 1D7YA 3Q6JA 2Q0KA 2C64A 2R45A 4K5SA 2VVLA 4K7ZA 3G5SA 1TDEA 1JRZA 4H2RA 3V3NA 1JRYA 4J57A 2VVLG 4K5RA 5BULA 4CBQA 1QJDA 2YG5A 2CDUA 4YWOA 1N1PA 1MXTA 2C70A 5EB5A 1FECA 2WOIA 1M6IA 2RGHA 2XFUA 4JY2A 4U8PA 4B69A 4YSXA 5KVIA 4AOXA 2B9WA 2B9XA 4FK1A 3L8KA 4APNA 3EANA 1Q1RA 2WU5A 3GWFA 4XWRA 2GEWA 2ZZCA 2H88A 3ALMA 1OJ9A 3IF9A 1GXFA 5L46A 3QSEA 2WDQA 2Z5YA 1IUTA 1JRXA 3NK0X 3AE5A 2A87A 4BV6A 2XFPA 2XVEA 3L1RA 4NTCA 4YKFA 3SFEA 2JB2A 1LQTA 2WDRA 1OJDA 2E4GA 3NKSA 4HB9A 2C67A 2C75A 1PHHA 1EL8A 2V60A 1FOHA 1OJTA 1KF6A 2XLPA 3AEFA 4REKA 1PBFA 4UDPA 2DKIA 4AOSA 2ACZA 4JQ9A 2XDOA 3BI2A 3NN0X 4H7UA 4NTEA 2A8XA 1GRFA 3QVPA 1M64A 3BHFA 3NNEA 4Z2TA 1KNRA 1YQ4A 5FS6A 3LZXA 3GYJA 3O0HA 3ALLA 3CNDA 1D4CA 1O94A 2OLNA 1DJQA 2GAHB 2V3AA 4CY6A 3K7TA 2PHHA 4AP3A 3LJPA 1K4QA 2J3NA 3SFDA 4PABA 3P4QA 2YLSA 3M0OA 3DK4A 1CF3A 3AE1A 5KOXA 1F8SA 4YTNA 4H50A 3DJDA 4H2QA 2R9ZA 4H4QA 3K7MX 1KFYA 1PBBA 1B5QA 2NVKX 3WE0A 4GDEA 3AEDA 1E1MA 3NLCA 1PJ7A 4U8KA 4ZCDA 2GF3A 3AEGA 1E1KA 3NK2X 2BXRA 3H4KA 4Z25A 2FJBA 4KX6A 1Q1WA 2BS2A 4H4PA 1L0VA 1NHRA 2V3BA 1PBEA 2X8HA 4O5UA 4OPCA 3UTHA 2XFOA 4ECHA 2XLSA 2YLWA 1GRBA 4RG3A 2FJDA 1GETA 4Z44A 4DSGA 3NN6X 4EQXA 3AYLA 2YR5A 1TYTA 1FCDA 2QA2A 3CGCA 4U8IA 2GR2A 3E1TA 1D4EA 1NG4A 3NHOX 4U2SA 2B76A 3PO7A 1E1NA 3S5WA 2WOVA 1GOSA 3UP5A 2ZZBA 2YR6A 4CCRA 2C3DA 4CRTA 1IUXA 1BGJA 3LOVA 1OJAA 1NHSA 2XLUA 3JSKA 1PBCA 2JK6A 2WQYA 3NIXA 1K0LA 4P9SA 1BF3A 1ZMCA 2WP9A 5ER0A 2CVJA 4Z2RA 2XLRA 3CPHG 2GQWA 3DK8A 1CJ3A 3GWDA 3Q9TA 4GRTA 3ICRA 4U8NA 4A65A 4BURA 3FBSA 1LPFA 4EMWA 4NTDA 2E5VA 3BNMA 3IWAA 4Y4LA 4BJZA 3NG7X 3FG2P 1D5TA 2JBVA 5BUKA 1CC4A 2AR8A 3GDNA 1N4VA 3LB8A 4CNJA 1NEKA 4K2XA 2VQ7A 2WPEA 1H84A 4EQSA 1H7XA 5HHFA 5U25A 3P1WA 1NAAA 4YSZA 5HYMA 2QA1A 1FEBA 2GB0A 4UDRA 3NRNA 3VR8A 2GAGB 2JB3A 4YSHA 4I59A 5JCKA 1TDNA 3RP8A 1ELIA 4OVIA 1AOGA 1GV4A 4HA6A 4JNQA 4PAAA 4YSYA 3C96A 5FS7A 2YLRA 5CQFA 4YTMA 3RNMA 1DOBA 1PXBA 3C4NA 1LJ1A 3V76A 4CNKA 4C3YA 1S2YA 3IC9A 3CGEA 4TM4A 4UP3A 2AQJA 1H86A 1VG9A 2JKCA 1ZX9A 3BI4A 1EL5A 4IVMB 1IUVA 4OPIA 3AD9B 2WS3A 1D7LA 4E0VA 1KSSA 4DSHA 3AXBA 4CY8A 3AB1A 1GPEA 2YG3A 2YLXA 4H4RA 4OPGA 2WOWA 4GF7A 4X4JA 1CBOA 5DBJA 4B1BA 5JCIA 2BA9A 1TYPA 1PXAA 1NG3A 2OLOA 3NH3X 4H4ZA 3OC4A 3IHMA 1S3BA 3LZWA 2XLTA 2WDVA 3VRAA 4B65A 3KPFA 4A6NB 1CJ4A 4X9NA 1ZP0A 2XVFA 4K8DA 1DJNA 5GSNA 4A7AA 1YQZA 2C66A 2YLZA 3NYCA 3G5RA 4J34A 1VRQB 3NYEA 3QSMA 1CJ2A 1GT8A 1S2QA 3KA7A 4OPUA 2A89A 2V5ZA 2XVHA 3KKJA 3PS9A 3D1CA 3UKFA 1NPXA 3ICSA 4NZHA 4EMIA 3EAOA 3IHGA 3SQPA 1REOA 4H4YA 4UDQA 1L9DA 3CTYA 4N9XA 1DOEA 2YLTA 4A99A 2C72A 1GNDA 4YKGA 1BWCA 2X8GA 4C77A 1W4XA 2R0PA 3VR9A 1GRAA 3F8DA 2R4JA 4DNAA 1HYUA 4BK1A 4BK2A 4U2TA 1BKWA 1VG0A 4IVOB 4U8LA 3AE9A 3UOYA 4D03A 4OPDA 2WP6A 1ZOYA 1N4UA 1TDKA 3K7QX 4M52A 2QCUA 2YWLA 3SGLA 2VVMA 5TR3A 3AD8B 5M0ZA 3CIRA 1CC6A 1MOKA 2Z5XA 3AE6A 2RGOA 1ONFA 1VDCA 1FL2A 2O9ZA 3AE8A 4U8MA 4H4WA 2Q7VA 3AEAA 2VQBA 2EQ7A 3M12A 2TPRA 2WP5A 1B4VA 1EL9A 1BZLA 3NK1X 4H2PA 4Z26A 1XHCA 3CGBA 1RP0A 3DGZA 1TDOA 2R0GA 3ATRA 3UOZA 2BABA 3P9UA 1PS9A 3P4PA 5FS9A 3UKPA 1GRTA 4ADWA 1LTXR 4J36A 1PDHA 4TLZA 1PXCA 2WESA 1NENA 2EQ9A 4TLXA 5JCMA 3RP6A 2YVFA 2GRTA 5EBKA 4J56A 1F3PA 4YXDA 2GR3A 3H8IA 1H6VA 2BC1A 4MJWA 1Y56A 3AYIA 1DXLA 4A79A 4USRA 5J60A 3SM8A 2IVDA 3V3OA 2GH5A 4YTPA 2YAUA 2B7SA 2WHDA 4Z24A 1KDGA 2JAEA 2XFNA 1GALA 4WX1A 1XANA 4EMJA 1E7PA 2CULA 4J2WA 2XYOA 4GCMA 1FEAA 5IQ4A 4BK3A 3F8RA 1E6EA 3CNPA 2GQFA 1GERA 2X8CA 3PVCA 3II4A 5FS8A 4ICYA 3UTEA 4WCTA 1PN0A 4EM3A 4J31A 2C65A 3VRBA 4H4UA 4K22A 3M13A 1BGNA 1IUWA 4RSLA 3UKKA 4BJYA 2X50A 3AE7A 3ZDNA 3C4AA 3URHA 2WPFA 3AE2A 4B63A 5C3JA 1GEUA 5J7XA 2VOUA 4Y4NA 4IA5A 1MO9A 4RG4A 3CPJG 3VQRA 2BCGG 5C2TA 1D4DA 3CNJA 4JDRA 3GD3A 1H7WA 2FJAA 2V61A 3ABVA 3DJJA 4A9WA 3P4RA 4LIIA 1V59A 1JNRA 1RYIA 2Q0LA 2GMJA 3D8XA 1Q9IA 2BK4A 5KVHA 3AE3A 1F8WA 3BHKA 5EB4A 1SEZA 1GRHA 2YVGA 3DJEA 4U8OA 3ICTA 1IJHA 3NYFA 4LA1A 1JNZA 1ZOVA 4B64A 2F5ZA 1H81A 2OAMA 2I0ZA 5CKUA 5JCLA 2BK3A 4NEVA 2OALA 4ZCCA 3DK9A 5JCNA 1Y56B 4H2NA 2V6OA 2W0HA 1ZY8A 3T37A 1P2EA 3FPZA 3COXA 4OCGA 1GRGA 4OPTA 3UOVA 1KSUA 3F8PA 2OA1A 3AEEA 4JNAA 4Y4MA 4C5OA 2B7RA 3K30A 1PJ5A 3NT6A 4DGKA 3ZYXA 2GR1A 3LXDA 1DOCA 1PBDA 3CNSA 2YG7A 4C3XA 4YT0A 2FJEA 4AT0A 2BS3A 2QAEA 3QVRA 4H4VA 2VRMA 2B9YA 3AWIA 2YR4A 2RABA 2ZZ0A 4ZN0A 3GMCA 3DJGX 5KXJA 2GR0A 4AP1A 1X31B 2WEUA 3DH9A 1YKJA 1K0IA 3AEBA 4Z43A 4X9MA 1DNCA 4EQRA 4J33A 2YG6A 4JY3A 3GD4A 4OPLA 4H4XA 4I58A 1TDFA 5U63A 3DMEA 4IV9A 4USQA 1ZK7A 4A5LA 4C74A 4KPRA 1EBDA 3EPTA 5BVAA 4O5QA 4NEWA 3GYIA 2ZBWA 1O95A 2H89A 1DODA 2Q6UA 1GSNA 4TM1A 1LVLA 4B67A 4CCQA 2FBWA 3R9UA 1PJ6A 1Z6LA 1TRBA 1F6MA 1ZMDA 2VZ2A 1ZKQA 3ITJA 4EIPA 3ATQA 5IPYA 2WPCA 5GRTA 2ARDA 3UTFA 1L9CA 2CFYA 4GR1A 4EQWA 3AE4A 4LU6A 4XWZA 2C76A 2GMHA 1IUSA 4GDPA 4EIQA 2VRLA 2WBAA 3B6DA 1JOAA 3ISHA 4Z2UA 1GREA 5FMHA 3QFBA 3UKHA 2C73A 2UZZA 5U1OA 3UTGA 3NGCX 2WETA 2IVEA 2RGJA 3UCLA 2GVCA
chains in the Genus database with same CATH superfamily
3LADA 3AM9A 1VQWA 3MY9A 3OPSA 4B66A 3TW9A 3UXKA 4D04A 4Z1YA 1K0JA 1JPMA 2YM1A 4U8JA 3CPIG 3VRDB 2QDEA 2PP3A 3QJ4A 3HW2A 1B8SA 3TWBA 3KVEA 5KWFA 4FDCB 1N4WA 3OP2A 3CXBA 1F8RA 3GD6A 3HZLA 1GESA 3UKAA 4B68A 1V97A 3KLJA 3NTDA 1P2HA 3GSIA 3AYJA 3ADAB 2XH4A 3H8LA 3S5SA 1CC2A 4IP5A 4FX9A 1LQUA 4M6UA 3FCPA 2BACA 1NDAA 4KWSA 2R45A 4K7ZA 1JRZA 4K5RA 5BULA 4CBQA 4DN1A 1QJDA 1FECA 2OO6A 2WOIA 3T2KA 4AOXA 2B9WA 4FK1A 1L8PA 3L8KA 4HCHA 2WU5A 4XWRA 1OJ9A 3TCSA 3NK0X 1MNSA 2A87A 3NRZB 4YKFA 3L1RA 1OJDA 2E4GA 4HB9A 2BRAA 2OPJA 1EL8A 2V60A 3T31A 3SJNA 3AEFA 2DKIA 2C4CA 4AOSA 1H2IA 4NTEA 2A8XA 3MQTA 4Z17A 4Z2TA 1KNRA 3CNDA 3SY4A 3THUA 4X2PA 3LJPA 3P4QA 3M0OA 1X2GA 4H2QA 2R9ZA 3HRDC 1SJCA 1KFYA 2NVKX 1IYXA 3R07C 3AEDA 4ZCDA 3DERA 3AEGA 3H4KA 2BS2A 4GAVA 2XFOA 4HN8A 1GRBA 4Z44A 3HYXA 2YR5A 1NG4A 3NHOX 1FFVC 3S5WA 2ZZBA 4CCRA 1IUXA 5FJOA 3LOVA 3DESA 4IL2A 3JSKA 2JK6A 2WQYA 4P9SA 2QQ6A 1BF3A 1ZMCA 2WP9A 3P93A 3CPHG 2GQWA 1CJ3A 3GWDA 3SZWA 1N4VA 3LB8A 4CNJA 3T9PA 2E3TA 3QKEA 4E5TA 5HHFA 2DW7A 3P1WA 1NAAA 3DFYA 4UDRA 2GAGB 2ONEA 4G9KA 4PAAA 4HA6A 5FS7A 3KPKA 3SZ0A 1TE6A 1PXBA 1LJ1A 3C4NA 3IC9A 1H86A 1EL5A 2AL2B 2WS3A 2OVLA 3AXBA 4H4RA 2WOWA 4X4JA 5DBJA 4YWSA 4B1BA 3TWAA 1TYPA 1NG3A 4DYEA 4H4ZA 3OC4A 2WDVA 4K8DA 5G5HB 1YQZA 3NYCA 4J34A 3NYEA 2PSNA 3SXIA 3PFRA 3PS9A 4NZHA 3ICSA 4UDQA 4N9XA 1ZXIC 2X8GA 2R0PA 1GRAA 2OG9A 3F8DA 1BKWA 3UOYA 1W6TA 2PODA 3AE6A 1ONFA 1VDCA 1FL2A 3AE8A 4U8MA 3UJEA 2Q7VA 3SX6A 3AEAA 2MUCA 2EQ7A 2TPRA 1RM6B 3GO2A 2OZ8A 1STZA 4GFIA 4H2PA 1TDOA 2HXTA 3N6JA 1PDHA 4TLZA 1N62C 2HNEA 3IJIA 4FP1A 3IJLA 4J56A 4YXDA 1DXLA 2XH2A 3SM8A 5JRBA 4YTPA 2JAEA 1GALA 1MUCA 5IQ4A 4BK3A 3SBFA 1GERA 5BOEA 5FS8A 4EM3A 2CHRA 4H4UA 1IUWA 2W3SA 3AE7A 1GEUA 3H12A 3CPJG 3R25A 1H7WA 2V61A 4A9WA 1JNRA 2Q0LA 5KVHA 4GMEA 1SEZA 1GRHA 3VC5A 3ICTA 3NYFA 3PWGA 4LA1A 1H81A 3SZFA 2I0ZA 5CKUA 2OALA 3DK9A 4H2NA 2W0HA 2ZC8A 3A7UA 4JNAA 4C5OA 2XGZA 1PJ5A 3T0KA 2GR1A 1DOCA 4YT0A 3NS1B 2YG7A 1N61C 3NVWB 3QVRA 2B9YA 2RABA 3GMCA 3DJGX 5KXJA 2GR0A 2WEUA 2PMQA 1RVKA 4JY3A 3GD4A 1TDFA 3DMEA 3B9JB 4USQA 3H7VA 2ZBWA 4CCQA 3R9UA 3JVAA 4IL0A 2VZ2A 1ZKQA 3SYIA 3ATQA 4GR1A 3SQSA 2O56A 3R11A 2VRLA 4EIQA 2WBAA 2GGHA 3QFBA 4H83A 3UKHA 2C73A 3JW7A 3NGCX 3UCLA 3C4AA 1X2HA 1E39A 4HPNA 2WU2A 1N60C 1H82A 3P4SA 5HXIA 1NHQA 1JU2A 4EM4A 2E1MA 5EOWA 3RHAA 1EBGA 1L9EA 4GIRA 1XPYA 3QFAA 2C3CA 3I3LA 3ETRB 3SN1A 3HYVA 2R46A 3B3RA 1IUUA 2BXSA 1O5WA 4ZA0A 4U2LA 3FVDA 3RP7A 1GTHA 3BNUA 3OTRA 3KD9A 3MSYA 2OFJA 4E8GA 3OZ2A 3FXGA 1XPQA 1COYA 4JN7A 3UP4A 5BRTA 2PYXA 3UOXA 2X3NA 3AECA 5KOWA 5M10A 2PTYA 1NHPA 4GYPC 2JB1A 2Q0KA 3Q6JA 4K5SA 4H2RA 1JRYA 4J57A 3V5FA 2YG5A 2CDUA 3D47A 4YSXA 2XFUA 4K2SA 4DX3A 2B9XA 1F9CA 3D9XA 4H1ZA 1N5WC 1R6WA 2Z5YA 1JRXA 3SFEA 3DFHA 3PK7A 2WDRA 3NKSA 3I6TA 2C75A 2QGYA 1KF6A 4REKA 1PBFA 4UDPA 4JQ9A 4H7UA 1M64A 5FS6A 3LZXA 3GYJA 1O94A 2V3AA 2GAHB 3TQPA 3SFDA 4PABA 3TOYA 1BKHA 2YLSA 4MKSA 5KOXA 1F8SA 2OX4A 1B5QA 4G8TA 4GDEA 1E1MA 1PDZA 1PJ7A 3ES8A 3NK2X 2FJBA 4KX6A 1Q1WA 1L0VA 4ECHA 3PWIA 2FJDA 4K8GA 1GETA 4EQXA 3AYLA 2QVHA 1TYTA 1FCDA 1EC8A 3S47A 4U2SA 2FYMA 3PO7A 3A7RA 1GOSA 5ENLA 1OJAA 3T2ZA 1KCZA 3NIXA 3EEZA 1K0LA 4IHCA 2CVJA 4Z2RA 2XLRA 3EUB3 4GRTA 1NELA 4BURA 1LPFA 3IWAA 4BJZA 4ROPA 1D5TA 2JBVA 2AR8A 3ZLHA 4NWZA 2WPEA 3KUMA 4HYRA 4EQSA 5U25A 4J1OA 4I59A 1TDNA 3R10A 4JNQA 1N5XA 3RNMA 1MDLA 1PDYA 4CNKA 2HZGA 2JKCA 3GY1A 1IUVA 1D7LA 4DSHA 4OPGA 1CBOA 5JCIA 3N4FA 3RRAA 3IHMA 3SZCA 2XVFA 2PGEA 3VDGA 4A7AA 2C66A 1CJ2A 1MDRA 4JHMA 3UKFA 2PU1A 1L9DA 3CTYA 1GNDA 2GGIA 4G6HA 4YKGA 4C77A 3N4EA 3FYYA 2OKTA 4EWJA 4D03A 4OPDA 1FO4A 1N4UA 1TDKA 3RO6A 4NNJA 2QCUA 2YWLA 2BRYA 5TR3A 3UXLA 3CIRA 2Z5XA 2RGOA 2POZA 1WYGA 4H4WA 3SSZA 3EKGA 2GGEA 3M12A 1B4VA 3H8AA 2DW6A 3NFUA 1RP0A 3I4KA 3UKPA 5FS9A 3SN0A 1GRTA 3K1GA 3RGTA 4J36A 2GR3A 1H6VA 1Y56A 2HXUA 3AYIA 5J60A 2IVDA 2B7SA 2WHDA 1KDGA 1KD0A 4GCMA 1FEAA 1E6EA 3CNPA 2X8CA 4WCTA 3FV9A 2C65A 4K22A 4KEMA 4E6MA 3ZDNA 5C3JA 3RITA 5J7XA 4Y4NA 4IA5A 1MO9A 5C2TA 1D4DA 1FHVA 3GD3A 3ABVA 3DJJA 3VFCA 2GMJA 3BHKA 1ONEA 3UGVA 4KT2A 1ZOVA 2OAMA 2BK3A 5JCNA 1Y56B 1ZY8A 3TJIA 3FPZA 3COXA 1GRGA 4OPTA 3F8PA 2OA1A 3AEEA 1N63C 3NT6A 3RR1A 3N6HA 4DGKA 3ZYXA 3LXDA 4C3XA 2BS3A 2QAEA 4H4VA 3AWIA 5FJPA 3B97A 3ZVHA 1X31B 3DG3A 3DH9A 4Z43A 4J33A 2W55A 4GYPA 3T4WA 1ZK7A 3EPTA 3GYIA 2MNRA 2H89A 3IK4A 2Q6UA 3UJSA 1GSNA 3FJ4A 4B67A 4HCDA 3Q4DA 2FBWA 1F6MA 4G6GA 3ITJA 3CYJA 3JZUA 2ARDA 1L9CA 2CFYA 3AE4A 2C76A 4GDPA 3L5OA 3B6DA 1JOAA 3NZGA 5U1OA 3V3WA 3ZVHB 2PA6A 2OQYA 2WETA 2IVEA 4DHGA 2GVCA 1KNPA 1OJCA 4TM0A 2EQ8A 4JN9A 1H83A 3NTAA 1CJCA 4H4SA 3UKQA 4XXGA 1QO8A 3GRSA 2HQMA 3FIMB 2XVIA 1Y0PA 2BS4A 1JEHA 3KU9A 4GAPA 3BI5A 2BCPA 1YY5A 2OQHA 3DGHA 3QSSA 3CB3A 4HNLA 2GV8A 3GMBA 1RSGA 2TMDA 1ELSA 1CHUA 1YEYA 1WUEA 2Y6QA 2R0CA 2R4EA 2P3ZA 3G5QA 1JRPA 2I5QA 1EL7A 2BC0A 3CN8A 2XVJA 1YQ3A 2YVJA 3UJFA 2APGA 3V5CA 3DDMA 4FK1C 2OLAA 3VC6A 4A6NA 3S61A 3AMZA 3VA8A 3GRTA 5KRQA 1SJAA 1D7YA 3G5SA 3V3NA 4YWOA 5EB5A 1M6IA 4JY2A 4U8PA 4B69A 4APNA 3EANA 4HNCA 4II3A 2ZZCA 3ALMA 4G73A 3IF9A 1GXFA 3OW1A 5L46A 2WDQA 3NVYB 2XFPA 1LQTA 2QJJA 1PHHA 2P8CA 1FOHA 3GYXA 1OJTA 4GGHA 2ACZA 1T3QC 3BI2A 1GRFA 2PTXA 3QVPA 4MGGA 4F4RA 1YQ4A 3ALLA 2PTZA 1D4CA 1FHUA 3K7TA 2P88A 2J3NA 4YTNA 4H50A 3DJDA 3K7MX 3H70A 1PBBA 3WE0A 4U8KA 2GF3A 4H4PA 1NHRA 4OPCA 3T8QA 3UTHA 2XLSA 5KMRA 2GSHA 4DSGA 2XH7A 2QA2A 3CGCA 4U8IA 3E1TA 1E1NA 2WOVA 5G5GB 3UP5A 2PS2A 2C3DA 2AKZA 1NHSA 2XLUA 3DK8A 2E5AA 4J3ZA 3ICRA 3PG6A 4U8NA 5KMQA 4A65A 3FBSA 1OEPA 4EMWA 2E5VA 3BNMA 3NG7X 3FG2P 5BUKA 1CC4A 5KNLA 3GDNA 4K2XA 1H7XA 5HYMA 2QA1A 4DWDA 3NRNA 2JB3A 5JCKA 1ELIA 1AOGA 3C96A 5CQFA 1EC9A 3V76A 4C3YA 1SJBA 5FJUA 3CGEA 4TM4A 4UP3A 3BI4A 4IVMB 2OZ3A 5IDZA 3AB1A 3ENLA 2YG3A 2YLXA 4KPLA 2BA9A 2OLOA 3NH3X 1FFUC 4B65A 3KPFA 4A3RA 1CJ4A 3NVVB 5GSNA 1VRQB 3QSMA 1GT8A 3D1CA 3BSMA 3VCNA 1DOEA 2YLTA 4A99A 2C72A 1BWCA 2NQLA 2AKMA 2R4JA 2W3RA 4U2TA 4IVOB 3QN3A 4M52A 2VVMA 3UCCA 1NU5A 2P8BA 2O9ZA 4GGBA 2WP5A 1EL9A 3ZLGA 1BZLA 5BOFA 3BOXA 4Z26A 1XHCA 2R0GA 3DGZA 3ATRA 2BABA 3P9UA 1PS9A 1LTXR 2GGJA 1PXCA 1NENA 4TLXA 2AL1A 5JCMA 3RP6A 2YVFA 2GRTA 5EBKA 1F3PA 1SB3B 4MJWA 2BC1A 3P3BA 4A79A 4USRA 2PP0A 3V3OA 2GH5A 3SN4A 2YAUA 4EMJA 1E7PA 2CULA 4J2WA 4ICYA 3UTEA 4J31A 1S7MA 4RSLA 3M13A 1P43A 2X50A 4B63A 2WPFA 3AE2A 4GISA 2PP1A 4RG4A 2RDXA 3CNJA 4JDRA 3R0UA 4LIIA 1V59A 1RYIA 3D8XA 4ZOHB 2BK4A 3AN1A 1F8WA 5EB4A 2YVGA 1IJHA 2F5ZA 3D46A 3QLDA 1E9IA 2V6OA 1P2EA 4OCGA 1KSUA 4H2HA 4Y4MA 3MKCA 1PBDA 2FJEA 4AT0A 2VRMA 2ZZ0A 4AP1A 3VCCA 1YKJA 1K0IA 4X9MA 1DNCA 2YG6A 2GL5A 4H4XA 3HPFA 2QJMA 3UCDA 1DODA 4TM1A 1LVLA 3HYWA 1ZMDA 4EIPA 2WPCA 3UTFA 4EQWA 4LU6A 3U4FA 4MMWA 3ISHA 4Z2UA 4G7FA 1GREA 5FMHA 2UZZA 2XFQA 3UJ2A 5HY5A 2BK5A 3CMMA 1S3EA 3REDA 2YM2A 2XCGA 2YQUA 2IIDA 1UKVG 2C7GA 2X99A 4IA6A 1QLBA 2AAQA 1R0MA 3GDPA 3T14A 3CGDA 1E1LA 4GUVA 4AT2A 3ALJA 1SJDA 3V4BA 4A35A 5LV9A 3ES7A 1LV0A 5IQ1A 2AL2A 3UKLA 2DKHA 3EF6A 2W54A 3CNTA 4TM3A 1DTNA 4H4TA 2NPXA 3SR6B 3DA1A 7ENLA 1GTEA 3I6DA 2BYBA 2YG4A 1VQZA 4JN8A 1B37A 3CK5A 3FMWA 1CL0A 5KMPA 3AD7B 1XDIA 1ZDLA 2Y6RA 3CXOA 4TVYA 2EQ6A 2C64A 2VVLA 1TDEA 6ENLA 2VVLG 1N1PA 1MXTA 2C70A 2RGHA 5KVIA 4G74A 1Q1RA 3GWFA 2GEWA 3STPA 2H88A 3QSEA 3U9IA 1BQGA 3I6EA 1IUTA 3AE5A 4BV6A 2XVEA 4NTCA 2JB2A 3UJRA 2C67A 1KN0A 3QPEA 2XLPA 2XDOA 3NN0X 2PU0A 1KKOA 3BHFA 3NNEA 3O0HA 4E4UA 2OLNA 1DJQA 4CY6A 4AP3A 2PHHA 1K4QA 3DK4A 1CF3A 3AE1A 4H4QA 3P0WA 3R1ZA 3NLCA 3A7AA 1E1KA 2BXRA 4Z25A 2V3BA 1PBEA 2X8HA 4O5UA 3ZLFA 2YLWA 4RG3A 1FIQB 5FJRA 3OZYA 3NN6X 2QJNA 1TZZA 2GR2A 1D4EA 2FKPA 2B76A 3CT2A 3NO1A 2YR6A 4CRTA 1BGJA 2PCEA 1PBCA 4M0XA 5ER0A 3Q9TA 1XS2A 4NTDA 2XH0A 3NVZB 4Y4LA 2ZADA 3DGBA 4E4FA 1NEKA 2VQ7A 1VDVA 1H84A 3T2YA 4YSZA 1FEBA 2GB0A 3VR8A 4YSHA 3RP8A 4OVIA 1ECQA 1GV4A 4YSYA 3DIPA 2YLRA 4YTMA 1DOBA 3MZNA 1S2YA 2AQJA 1VG9A 1ZX9A 4OPIA 3AD9B 4E0VA 1KSSA 3Q45A 4CY8A 1GPEA 4GF7A 1PXAA 3DEQA 4A6GA 1S3BA 2XLTA 3LZWA 3VRAA 4ENLA 4A6NB 4X9NA 1ZP0A 3NXLA 3TTEA 5KMSA 1JDFA 1DJNA 2YLZA 3G5RA 1S2QA 3KA7A 4OPUA 2A89A 2V5ZA 2XVHA 3KKJA 3DG7A 3R0KA 1NPXA 2PGWA 4EMIA 3EAOA 3IHGA 3SQPA 1REOA 4H4YA 5FJTA 1WUFA 3MUCA 1W4XA 3VR9A 3QTPA 4DNAA 1HYUA 4BK1A 4BK2A 1VG0A 4U8LA 3AE9A 2WP6A 1ZOYA 3K7QX 1KKRA 3SGLA 1TKKA 3AD8B 5M0ZA 2QDDA 1CC6A 1MOKA 4ZCWA 3CAWA 2XSXA 2VQBA 2P0IA 3NK1X 3CGBA 3GC2A 3UOZA 3P4PA 4ADWA 4TVWA 2WESA 2EQ9A 4DXKA 4II2A 1EBHA 3H8IA 4Z24A 2XFNA 2PPGA 4WX1A 1XANA 2XYOA 3F8RA 2GQFA 3PVCA 3II4A 2PTWA 1PN0A 3VRBA 4BJYA 1BGNA 3UKKA 3URHA 2VOUA 3VQRA 2BCGG 3IJQA 3ZVIA 2FJAA 1EC7A 3MWCA 3P4RA 1Q9IA 3AE3A 3DJEA 4U8OA 5EU9A 1JNZA 4B64A 1MRAA 5JCLA 4NEVA 4ZCCA 2OZTA 1JCTA 1P48A 3T37A 3UOVA 2B7RA 3K30A 4IP4A 3CNSA 3BJSA 4H19A 2YR4A 4ZN0A 3AEBA 4EQRA 4IT1A 4HCLA 4OPLA 4I58A 5U63A 4K1WA 2GGGA 4IV9A 4FI4A 4A5LA 4C74A 4KPRA 1EBDA 5BVAA 4O5QA 4NEWA 1O95A 3OZMA 1PJ6A 1Z6LA 1TRBA 5IPYA 4IZGA 5GRTA 5J04A 2GDQA 4XWZA 2GMHA 1IUSA 3T6CA 1JPDX 1JROA 3TJ4A 3UTGA 3RCYA 2RGJA 3DG6A
chains in the Genus database with same CATH topology
1KNPA 1OJCA 1E39A 3LADA 2WU2A 2XFQA 1VQWA 4TM0A 2EQ8A 5HY5A 4B66A 1H82A 3P4SA 4JN9A 2BK5A 1H83A 3CMMA 3NTAA 1CJCA 5HXIA 1NHQA 4H4SA 1S3EA 4D04A 1JU2A 1K0JA 3REDA 4EM4A 2YM1A 4U8JA 4XXGA 3UKQA 2YM2A 1QO8A 3GRSA 3CPIG 3VRDB 2HQMA 2XCGA 2YQUA 3FIMB 2XVIA 3QJ4A 1Y0PA 2BS4A 2E1MA 5EOWA 1B8SA 2IIDA 3RHAA 1UKVG 2C7GA 2X99A 4IA6A 1JEHA 1QLBA 3KVEA 3KU9A 4GAPA 1L9EA 3BI5A 5KWFA 2BCPA 3QFAA 4FDCB 2AAQA 1YY5A 2C3CA 3DGHA 3I3LA 3QSSA 3GDPA 3T14A 3HYVA 2R46A 1N4WA 3CGDA 1E1LA 4GUVA 4AT2A 3B3RA 1IUUA 3ALJA 2BXSA 1O5WA 2GV8A 3GMBA 5LV9A 1F8RA 1RSGA 1LV0A 5IQ1A 4YSXA 2TMDA 4U2LA 3HZLA 1GESA 1CHUA 3RP7A 1GTHA 3UKAA 2Y6QA 3UKLA 2DKHA 2R0CA 2R4EA 4B68A 3BNUA 3EF6A 3KD9A 3G5QA 3CNTA 3KLJA 4TM3A 4H4TA 1EL7A 3NTDA 2BC0A 3CN8A 2XVJA 1P2HA 3GSIA 3AYJA 1YQ3A 3OZ2A 2NPXA 2YVJA 1XPQA 3ADAB 1COYA 3H8LA 3DA1A 1GTEA 3I6DA 1CC2A 2APGA 3UP4A 2BYBA 4FK1C 2YG4A 5BRTA 4FX9A 2PYXA 4A6NA 3S61A 1B37A 1LQUA 3FMWA 2X3NA 3UOXA 3AECA 5KOWA 5M10A 1CL0A 5KMPA 3AD7B 2BACA 1NHPA 1XDIA 1NDAA 1ZDLA 3GRTA 2Y6RA 5KRQA 2JB1A 2EQ6A 1D7YA 3Q6JA 2Q0KA 2C64A 2R45A 4K5SA 2VVLA 4K7ZA 3G5SA 1TDEA 1JRZA 4H2RA 3V3NA 1JRYA 4J57A 2VVLG 4K5RA 5BULA 4CBQA 1QJDA 2YG5A 2CDUA 4YWOA 1N1PA 1MXTA 2C70A 5EB5A 1FECA 2WOIA 1M6IA 2RGHA 2XFUA 4JY2A 4U8PA 3T2KA 4B69A 5KVIA 4AOXA 2B9WA 2B9XA 4FK1A 3D9XA 3L8KA 4APNA 4G74A 3EANA 1Q1RA 2WU5A 3GWFA 4XWRA 2GEWA 4II3A 2ZZCA 2H88A 3ALMA 4G73A 1OJ9A 3IF9A 1GXFA 5L46A 3QSEA 2WDQA 2Z5YA 1IUTA 1JRXA 3NK0X 3AE5A 2A87A 4BV6A 2XFPA 2XVEA 3L1RA 4NTCA 4YKFA 3SFEA 2JB2A 1LQTA 2WDRA 1OJDA 2E4GA 3NKSA 4HB9A 2BRAA 2C67A 2C75A 1PHHA 1EL8A 1KN0A 2V60A 1FOHA 3GYXA 3T31A 1OJTA 1KF6A 2XLPA 3AEFA 4REKA 1PBFA 4UDPA 2DKIA 2C4CA 4AOSA 2ACZA 4JQ9A 2XDOA 3BI2A 3NN0X 1H2IA 4H7UA 4NTEA 2A8XA 1GRFA 3QVPA 1M64A 3BHFA 3NNEA 4Z2TA 1KNRA 1YQ4A 5FS6A 3LZXA 3GYJA 3O0HA 3ALLA 3CNDA 1D4CA 1O94A 2V3AA 1DJQA 2GAHB 2OLNA 3SY4A 3K7TA 2PHHA 4AP3A 3LJPA 1K4QA 2J3NA 3SFDA 4PABA 3P4QA 2YLSA 3M0OA 3DK4A 1CF3A 3AE1A 5KOXA 1F8SA 4YTNA 4H50A 3DJDA 4H2QA 2R9ZA 4H4QA 3K7MX 1KFYA 1PBBA 1B5QA 2NVKX 3WE0A 4GDEA 3AEDA 1E1MA 3NLCA 1PJ7A 4U8KA 4ZCDA 2GF3A 3AEGA 1E1KA 3NK2X 2BXRA 3H4KA 4Z25A 2FJBA 4KX6A 1Q1WA 2BS2A 4H4PA 1L0VA 1NHRA 2V3BA 1PBEA 2X8HA 4O5UA 4GAVA 4OPCA 3UTHA 2XFOA 4ECHA 2XLSA 5KMRA 2YLWA 1GRBA 4RG3A 2FJDA 1GETA 4Z44A 4DSGA 3HYXA 3NN6X 4EQXA 3AYLA 2YR5A 1TYTA 1FCDA 2QA2A 3CGCA 4U8IA 2GR2A 3E1TA 1D4EA 1NG4A 3NHOX 4U2SA 2B76A 3PO7A 1E1NA 3S5WA 2WOVA 1GOSA 3UP5A 2ZZBA 2YR6A 4CCRA 2C3DA 4CRTA 1IUXA 1BGJA 3LOVA 1OJAA 3T2ZA 1NHSA 2XLUA 3JSKA 1PBCA 2JK6A 2WQYA 3NIXA 1K0LA 4P9SA 1BF3A 1ZMCA 2WP9A 5ER0A 2CVJA 4Z2RA 2XLRA 3CPHG 2GQWA 3DK8A 1CJ3A 3GWDA 3Q9TA 4GRTA 3ICRA 3PG6A 4U8NA 5KMQA 4A65A 4BURA 3FBSA 1LPFA 4EMWA 4NTDA 2E5VA 3BNMA 3IWAA 4Y4LA 4BJZA 3NG7X 3FG2P 1D5TA 2JBVA 5BUKA 1CC4A 2AR8A 5KNLA 3SZWA 3GDNA 1N4VA 3LB8A 4CNJA 1NEKA 4K2XA 2VQ7A 4NWZA 2WPEA 1H84A 4EQSA 1H7XA 5HHFA 5U25A 3T2YA 3P1WA 1NAAA 4YSZA 5HYMA 2QA1A 1FEBA 2GB0A 4UDRA 3NRNA 3VR8A 2GAGB 2JB3A 4YSHA 4I59A 5JCKA 1TDNA 4G9KA 1ELIA 3RP8A 4OVIA 1AOGA 1GV4A 4HA6A 4JNQA 4PAAA 4YSYA 3C96A 5FS7A 2YLRA 5CQFA 4YTMA 3RNMA 3KPKA 1DOBA 3SZ0A 1PXBA 3C4NA 1LJ1A 3V76A 4CNKA 4C3YA 1S2YA 3IC9A 3CGEA 4TM4A 4UP3A 2AQJA 1H86A 1VG9A 2JKCA 1ZX9A 3BI4A 1EL5A 4IVMB 1IUVA 4OPIA 3AD9B 2WS3A 1D7LA 4E0VA 1KSSA 4DSHA 3AXBA 4CY8A 3AB1A 1GPEA 2YG3A 2YLXA 4CY6A 4H4RA 4OPGA 2WOWA 4GF7A 4X4JA 1CBOA 5DBJA 4B1BA 5JCIA 2BA9A 1TYPA 1PXAA 1NG3A 2OLOA 3NH3X 4H4ZA 3OC4A 3IHMA 1S3BA 3LZWA 2XLTA 2WDVA 3SZCA 3VRAA 4B65A 3KPFA 4A6NB 1CJ4A 4X9NA 1ZP0A 2XVFA 4K8DA 5KMSA 1DJNA 5GSNA 4A7AA 1YQZA 2C66A 2YLZA 3NYCA 3G5RA 4J34A 1VRQB 3NYEA 3QSMA 1CJ2A 1GT8A 1S2QA 3SXIA 3KA7A 4OPUA 2A89A 2V5ZA 2XVHA 3KKJA 3PS9A 3D1CA 3UKFA 1NPXA 3ICSA 4NZHA 4EMIA 3EAOA 3IHGA 3SQPA 1REOA 4H4YA 4UDQA 1L9DA 3CTYA 4N9XA 1DOEA 2YLTA 4A99A 2C72A 1GNDA 4G6HA 4YKGA 1BWCA 2X8GA 4C77A 1W4XA 2R0PA 3VR9A 1GRAA 3F8DA 2R4JA 4DNAA 1HYUA 4BK1A 4BK2A 4U2TA 1BKWA 1VG0A 4IVOB 4U8LA 3AE9A 3UOYA 4D03A 4OPDA 2WP6A 1ZOYA 1N4UA 1TDKA 3K7QX 4M52A 4NNJA 2QCUA 2YWLA 2BRYA 3SGLA 2VVMA 5TR3A 3AD8B 5M0ZA 3CIRA 1CC6A 1MOKA 2Z5XA 3AE6A 2RGOA 1ONFA 1VDCA 1FL2A 2O9ZA 3AE8A 4U8MA 4H4WA 2Q7VA 3SX6A 3AEAA 2VQBA 2EQ7A 3M12A 2TPRA 2WP5A 1B4VA 1EL9A 1BZLA 3NK1X 4H2PA 4Z26A 1XHCA 3CGBA 1RP0A 3DGZA 1TDOA 2R0GA 3ATRA 3UOZA 2BABA 3P9UA 1PS9A 3P4PA 5FS9A 3UKPA 1GRTA 4ADWA 1LTXR 4J36A 1PDHA 4TLZA 1PXCA 2WESA 1NENA 2EQ9A 4TLXA 5JCMA 3RP6A 4II2A 2YVFA 2GRTA 5EBKA 4J56A 1F3PA 4YXDA 2GR3A 3H8IA 1H6VA 2BC1A 4MJWA 1Y56A 3AYIA 1DXLA 4A79A 4USRA 5J60A 3SM8A 5JRBA 2IVDA 3V3OA 2GH5A 4YTPA 2YAUA 2B7SA 2WHDA 4Z24A 1KDGA 2JAEA 2XFNA 1GALA 4WX1A 1XANA 4EMJA 1E7PA 2CULA 4J2WA 2XYOA 4GCMA 1FEAA 5IQ4A 4BK3A 3F8RA 1E6EA 3CNPA 2GQFA 1GERA 2X8CA 3PVCA 3II4A 5FS8A 4ICYA 3UTEA 4WCTA 1PN0A 4EM3A 4J31A 2C65A 1S7MA 3VRBA 4H4UA 4K22A 3M13A 1BGNA 1IUWA 4RSLA 3UKKA 4BJYA 2X50A 3AE7A 3ZDNA 3C4AA 3URHA 2WPFA 3AE2A 4B63A 5C3JA 1GEUA 5J7XA 2VOUA 4Y4NA 4IA5A 1MO9A 4RG4A 3CPJG 3VQRA 2BCGG 5C2TA 1D4DA 3CNJA 4JDRA 3GD3A 1H7WA 2FJAA 2V61A 3ABVA 3DJJA 4A9WA 3P4RA 4LIIA 1V59A 1JNRA 1RYIA 2Q0LA 2GMJA 3D8XA 1Q9IA 2BK4A 5KVHA 3AE3A 1F8WA 3BHKA 5EB4A 1SEZA 1GRHA 2YVGA 3DJEA 4U8OA 3ICTA 1IJHA 3NYFA 4LA1A 1JNZA 1ZOVA 4B64A 2F5ZA 1H81A 2OAMA 3SZFA 2I0ZA 5CKUA 5JCLA 2BK3A 4NEVA 2OALA 4ZCCA 3DK9A 5JCNA 1Y56B 4H2NA 2V6OA 2W0HA 1ZY8A 3T37A 1P2EA 3FPZA 3COXA 4OCGA 1GRGA 4OPTA 3UOVA 1KSUA 3F8PA 2OA1A 3AEEA 4JNAA 4Y4MA 4C5OA 2B7RA 3K30A 1PJ5A 3NT6A 4DGKA 3T0KA 2GR1A 3ZYXA 3LXDA 1DOCA 1PBDA 3CNSA 2YG7A 4C3XA 4YT0A 2FJEA 4AT0A 2BS3A 2QAEA 3QVRA 4H4VA 2VRMA 2B9YA 3AWIA 2YR4A 2RABA 2ZZ0A 4ZN0A 3GMCA 3DJGX 5KXJA 2GR0A 4AP1A 1X31B 2WEUA 3DH9A 1YKJA 1K0IA 3AEBA 4Z43A 4X9MA 1DNCA 4EQRA 4J33A 2YG6A 4JY3A 3GD4A 4OPLA 4H4XA 4I58A 1TDFA 5U63A 3DMEA 4IV9A 4USQA 1ZK7A 4A5LA 4C74A 4KPRA 1EBDA 3EPTA 5BVAA 4O5QA 4NEWA 3GYIA 2ZBWA 1O95A 2H89A 1DODA 2Q6UA 1GSNA 4TM1A 1LVLA 4B67A 4CCQA 2FBWA 3R9UA 1PJ6A 1Z6LA 3HYWA 1TRBA 1F6MA 4G6GA 1ZMDA 2VZ2A 1ZKQA 3SYIA 3ITJA 4EIPA 3ATQA 5IPYA 2WPCA 5GRTA 2ARDA 3UTFA 1L9CA 2CFYA 4GR1A 4EQWA 3AE4A 4LU6A 4XWZA 2C76A 2GMHA 1IUSA 4GDPA 4EIQA 2VRLA 2WBAA 3L5OA 1JOAA 3B6DA 3ISHA 4Z2UA 1GREA 5FMHA 3QFBA 3UKHA 2C73A 2UZZA 5U1OA 3UTGA 3NGCX 2WETA 2IVEA 2RGJA 3UCLA 2GVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KNP A;  1OJC A;  1E39 A;  3LAD A;  2WU2 A;  2XFQ A;  1VQW A;  4TM0 A;  2EQ8 A;  5HY5 A;  4B66 A;  1H82 A;  3P4S A;  4JN9 A;  2BK5 A;  1H83 A;  3NTA A;  5HXI A;  1CJC A;  1NHQ A;  4H4S A;  1S3E A;  4D04 A;  1JU2 A;  1K0J A;  3RED A;  4EM4 A;  2YM1 A;  4U8J A;  4XXG A;  3UKQ A;  2YM2 A;  1QO8 A;  3GRS A;  3CPI G;  3VRD B;  2HQM A;  2XCG A;  2YQU A;  3FIM B;  2XVI A;  3QJ4 A;  1Y0P A;  2BS4 A;  2E1M A;  5EOW A;  1B8S A;  2IID A;  3RHA A;  1UKV G;  2C7G A;  2X99 A;  4IA6 A;  1JEH A;  1QLB A;  3KVE A;  3KU9 A;  5KWF A;  1L9E A;  3BI5 A;  2BCP A;  3QFA A;  4FDC B;  2AAQ A;  1YY5 A;  2C3C A;  3DGH A;  3I3L A;  3QSS A;  3GDP A;  2R46 A;  1N4W A;  3CGD A;  1E1L A;  4GUV A;  4AT2 A;  3B3R A;  1IUU A;  3ALJ A;  2BXS A;  1O5W A;  2GV8 A;  3GMB A;  5LV9 A;  1F8R A;  1RSG A;  1LV0 A;  5IQ1 A;  2TMD A;  4U2L A;  3HZL A;  1GES A;  1CHU A;  3RP7 A;  1GTH A;  3UKA A;  2Y6Q A;  3UKL A;  2DKH A;  2R0C A;  2R4E A;  4B68 A;  3BNU A;  3EF6 A;  3KD9 A;  3G5Q A;  3CNT A;  3KLJ A;  4TM3 A;  4H4T A;  1EL7 A;  3NTD A;  2BC0 A;  3CN8 A;  2XVJ A;  1P2H A;  3GSI A;  3AYJ A;  1YQ3 A;  3OZ2 A;  2NPX A;  2YVJ A;  1XPQ A;  3ADA B;  1COY A;  3H8L A;  3DA1 A;  1GTE A;  3I6D A;  1CC2 A;  2APG A;  3UP4 A;  2BYB A;  4FK1 C;  2YG4 A;  5BRT A;  4FX9 A;  2PYX A;  4A6N A;  3S61 A;  1B37 A;  1LQU A;  3FMW A;  2X3N A;  3UOX A;  3AEC A;  5KOW A;  5M10 A;  1CL0 A;  3AD7 B;  2BAC A;  1NHP A;  1XDI A;  1NDA A;  1ZDL A;  3GRT A;  2Y6R A;  5KRQ A;  2JB1 A;  2EQ6 A;  1D7Y A;  3Q6J A;  2Q0K A;  2C64 A;  2R45 A;  4K5S A;  2VVL A;  4K7Z A;  3G5S A;  1TDE A;  1JRZ A;  4H2R A;  3V3N A;  1JRY A;  4J57 A;  2VVL G;  4K5R A;  5BUL A;  4CBQ A;  1QJD A;  2YG5 A;  2CDU A;  4YWO A;  1N1P A;  1MXT A;  2C70 A;  5EB5 A;  1FEC A;  2WOI A;  1M6I A;  2RGH A;  2XFU A;  4JY2 A;  4U8P A;  4B69 A;  4YSX A;  5KVI A;  4AOX A;  2B9W A;  2B9X A;  4FK1 A;  3L8K A;  4APN A;  3EAN A;  1Q1R A;  2WU5 A;  3GWF A;  4XWR A;  2GEW A;  2ZZC A;  2H88 A;  3ALM A;  1OJ9 A;  3IF9 A;  1GXF A;  5L46 A;  3QSE A;  2WDQ A;  2Z5Y A;  1IUT A;  1JRX A;  3NK0 X;  3AE5 A;  2A87 A;  4BV6 A;  2XFP A;  2XVE A;  3L1R A;  4NTC A;  4YKF A;  3SFE A;  2JB2 A;  1LQT A;  2WDR A;  1OJD A;  2E4G A;  3NKS A;  4HB9 A;  2C67 A;  2C75 A;  1PHH A;  1EL8 A;  2V60 A;  1FOH A;  1OJT A;  1KF6 A;  2XLP A;  3AEF A;  4REK A;  1PBF A;  4UDP A;  2DKI A;  4AOS A;  2ACZ A;  4JQ9 A;  2XDO A;  3BI2 A;  3NN0 X;  4H7U A;  4NTE A;  2A8X A;  1GRF A;  3QVP A;  1M64 A;  3BHF A;  3NNE A;  4Z2T A;  1KNR A;  1YQ4 A;  5FS6 A;  3LZX A;  3GYJ A;  3O0H A;  3ALL A;  3CND A;  1D4C A;  1O94 A;  2OLN A;  1DJQ A;  2GAH B;  2V3A A;  4CY6 A;  3K7T A;  2PHH A;  4AP3 A;  3LJP A;  1K4Q A;  2J3N A;  3SFD A;  4PAB A;  3P4Q A;  2YLS A;  3M0O A;  3DK4 A;  1CF3 A;  3AE1 A;  5KOX A;  1F8S A;  4YTN A;  4H50 A;  3DJD A;  4H2Q A;  2R9Z A;  4H4Q A;  3K7M X;  1KFY A;  1PBB A;  1B5Q A;  2NVK X;  3WE0 A;  4GDE A;  3AED A;  1E1M A;  3NLC A;  1PJ7 A;  4U8K A;  4ZCD A;  2GF3 A;  3AEG A;  1E1K A;  3NK2 X;  2BXR A;  3H4K A;  4Z25 A;  2FJB A;  4KX6 A;  1Q1W A;  2BS2 A;  4H4P A;  1L0V A;  1NHR A;  2V3B A;  1PBE A;  2X8H A;  4O5U A;  4OPC A;  3UTH A;  2XFO A;  4ECH A;  2XLS A;  2YLW A;  1GRB A;  4RG3 A;  2FJD A;  1GET A;  4Z44 A;  4DSG A;  3NN6 X;  4EQX A;  3AYL A;  2YR5 A;  1TYT A;  1FCD A;  2QA2 A;  3CGC A;  4U8I A;  2GR2 A;  3E1T A;  1D4E A;  1NG4 A;  3NHO X;  4U2S A;  2B76 A;  3PO7 A;  1E1N A;  3S5W A;  2WOV A;  1GOS A;  3UP5 A;  2ZZB A;  2YR6 A;  4CCR A;  2C3D A;  4CRT A;  1IUX A;  1BGJ A;  3LOV A;  1OJA A;  1NHS A;  2XLU A;  3JSK A;  1PBC A;  2JK6 A;  2WQY A;  3NIX A;  1K0L A;  4P9S A;  1BF3 A;  1ZMC A;  2WP9 A;  5ER0 A;  2CVJ A;  4Z2R A;  2XLR A;  3CPH G;  2GQW A;  3DK8 A;  1CJ3 A;  3GWD A;  3Q9T A;  4GRT A;  3ICR A;  4U8N A;  4A65 A;  4BUR A;  3FBS A;  1LPF A;  4EMW A;  4NTD A;  2E5V A;  3BNM A;  3IWA A;  4Y4L A;  4BJZ A;  3NG7 X;  3FG2 P;  1D5T A;  2JBV A;  5BUK A;  1CC4 A;  2AR8 A;  3GDN A;  1N4V A;  3LB8 A;  4CNJ A;  1NEK A;  4K2X A;  2VQ7 A;  2WPE A;  1H84 A;  4EQS A;  1H7X A;  5HHF A;  5U25 A;  3P1W A;  1NAA A;  4YSZ A;  5HYM A;  2QA1 A;  1FEB A;  2GB0 A;  4UDR A;  3NRN A;  3VR8 A;  2GAG B;  2JB3 A;  4YSH A;  4I59 A;  5JCK A;  1TDN A;  3RP8 A;  1ELI A;  4OVI A;  1AOG A;  1GV4 A;  4HA6 A;  4JNQ A;  4PAA A;  4YSY A;  3C96 A;  5FS7 A;  2YLR A;  5CQF A;  4YTM A;  3RNM A;  1DOB A;  1PXB A;  3C4N A;  1LJ1 A;  3V76 A;  4CNK A;  4C3Y A;  1S2Y A;  3IC9 A;  3CGE A;  4TM4 A;  4UP3 A;  2AQJ A;  1H86 A;  1VG9 A;  2JKC A;  1ZX9 A;  3BI4 A;  1EL5 A;  4IVM B;  1IUV A;  4OPI A;  3AD9 B;  2WS3 A;  1D7L A;  4E0V A;  1KSS A;  4DSH A;  3AXB A;  4CY8 A;  3AB1 A;  1GPE A;  2YG3 A;  2YLX A;  4H4R A;  4OPG A;  2WOW A;  4GF7 A;  4X4J A;  1CBO A;  5DBJ A;  4B1B A;  5JCI A;  2BA9 A;  1TYP A;  1PXA A;  1NG3 A;  2OLO A;  3NH3 X;  4H4Z A;  3OC4 A;  3IHM A;  1S3B A;  3LZW A;  2XLT A;  2WDV A;  3VRA A;  4B65 A;  3KPF A;  4A6N B;  1CJ4 A;  4X9N A;  1ZP0 A;  2XVF A;  4K8D A;  1DJN A;  5GSN A;  4A7A A;  1YQZ A;  2C66 A;  2YLZ A;  3NYC A;  3G5R A;  4J34 A;  1VRQ B;  3NYE A;  3QSM A;  1CJ2 A;  1GT8 A;  1S2Q A;  3KA7 A;  4OPU A;  2A89 A;  2V5Z A;  2XVH A;  3KKJ A;  3PS9 A;  3D1C A;  3UKF A;  1NPX A;  3ICS A;  4NZH A;  4EMI A;  3EAO A;  3IHG A;  3SQP A;  1REO A;  4H4Y A;  4UDQ A;  1L9D A;  3CTY A;  4N9X A;  1DOE A;  2YLT A;  4A99 A;  2C72 A;  1GND A;  4YKG A;  1BWC A;  2X8G A;  4C77 A;  1W4X A;  2R0P A;  3VR9 A;  1GRA A;  3F8D A;  2R4J A;  4DNA A;  1HYU A;  4BK1 A;  4BK2 A;  4U2T A;  1BKW A;  1VG0 A;  4IVO B;  4U8L A;  3AE9 A;  3UOY A;  4D03 A;  4OPD A;  2WP6 A;  1ZOY A;  1N4U A;  1TDK A;  3K7Q X;  4M52 A;  2QCU A;  2YWL A;  3SGL A;  2VVM A;  5TR3 A;  3AD8 B;  5M0Z A;  3CIR A;  1CC6 A;  1MOK A;  2Z5X A;  3AE6 A;  2RGO A;  1ONF A;  1VDC A;  1FL2 A;  2O9Z A;  3AE8 A;  4U8M A;  4H4W A;  2Q7V A;  3AEA A;  2VQB A;  2EQ7 A;  3M12 A;  2TPR A;  2WP5 A;  1B4V A;  1EL9 A;  1BZL A;  3NK1 X;  4H2P A;  4Z26 A;  1XHC A;  3CGB A;  1RP0 A;  3DGZ A;  1TDO A;  2R0G A;  3ATR A;  3UOZ A;  2BAB A;  3P9U A;  1PS9 A;  3P4P A;  5FS9 A;  3UKP A;  1GRT A;  4ADW A;  1LTX R;  4J36 A;  1PDH A;  4TLZ A;  1PXC A;  2WES A;  1NEN A;  2EQ9 A;  4TLX A;  5JCM A;  3RP6 A;  2YVF A;  2GRT A;  5EBK A;  4J56 A;  1F3P A;  4YXD A;  2GR3 A;  3H8I A;  1H6V A;  2BC1 A;  4MJW A;  1Y56 A;  3AYI A;  1DXL A;  4A79 A;  4USR A;  5J60 A;  3SM8 A;  2IVD A;  3V3O A;  2GH5 A;  4YTP A;  2YAU A;  2B7S A;  2WHD A;  4Z24 A;  1KDG A;  2JAE A;  2XFN A;  1GAL A;  4WX1 A;  1XAN A;  4EMJ A;  1E7P A;  2CUL A;  4J2W A;  2XYO A;  4GCM A;  1FEA A;  5IQ4 A;  4BK3 A;  3F8R A;  1E6E A;  3CNP A;  2GQF A;  1GER A;  2X8C A;  3PVC A;  3II4 A;  5FS8 A;  4ICY A;  3UTE A;  4WCT A;  1PN0 A;  4EM3 A;  4J31 A;  2C65 A;  3VRB A;  4H4U A;  4K22 A;  3M13 A;  1BGN A;  1IUW A;  4RSL A;  3UKK A;  4BJY A;  2X50 A;  3AE7 A;  3ZDN A;  3C4A A;  3URH A;  2WPF A;  3AE2 A;  4B63 A;  5C3J A;  1GEU A;  5J7X A;  2VOU A;  4Y4N A;  4IA5 A;  1MO9 A;  4RG4 A;  3CPJ G;  3VQR A;  2BCG G;  5C2T A;  1D4D A;  3CNJ A;  4JDR A;  3GD3 A;  1H7W A;  2FJA A;  2V61 A;  3ABV A;  3DJJ A;  4A9W A;  3P4R A;  4LII A;  1V59 A;  1JNR A;  1RYI A;  2Q0L A;  2GMJ A;  3D8X A;  1Q9I A;  2BK4 A;  5KVH A;  3AE3 A;  1F8W A;  3BHK A;  5EB4 A;  1SEZ A;  1GRH A;  2YVG A;  3DJE A;  4U8O A;  3ICT A;  1IJH A;  3NYF A;  4LA1 A;  1JNZ A;  1ZOV A;  4B64 A;  2F5Z A;  1H81 A;  2OAM A;  2I0Z A;  5CKU A;  5JCL A;  2BK3 A;  4NEV A;  2OAL A;  4ZCC A;  3DK9 A;  5JCN A;  1Y56 B;  4H2N A;  2V6O A;  2W0H A;  1ZY8 A;  3T37 A;  1P2E A;  3FPZ A;  3COX A;  4OCG A;  1GRG A;  4OPT A;  3UOV A;  1KSU A;  3F8P A;  2OA1 A;  3AEE A;  4JNA A;  4Y4M A;  4C5O A;  2B7R A;  3K30 A;  1PJ5 A;  3NT6 A;  4DGK A;  3ZYX A;  2GR1 A;  3LXD A;  1DOC A;  1PBD A;  3CNS A;  2YG7 A;  4C3X A;  4YT0 A;  2FJE A;  4AT0 A;  2BS3 A;  2QAE A;  3QVR A;  4H4V A;  2VRM A;  2B9Y A;  3AWI A;  2YR4 A;  2RAB A;  2ZZ0 A;  4ZN0 A;  3GMC A;  3DJG X;  5KXJ A;  2GR0 A;  4AP1 A;  1X31 B;  2WEU A;  3DH9 A;  1YKJ A;  1K0I A;  3AEB A;  4Z43 A;  4X9M A;  1DNC A;  4EQR A;  4J33 A;  2YG6 A;  4JY3 A;  3GD4 A;  4OPL A;  4H4X A;  4I58 A;  1TDF A;  5U63 A;  3DME A;  4IV9 A;  4USQ A;  1ZK7 A;  4A5L A;  4C74 A;  4KPR A;  1EBD A;  3EPT A;  5BVA A;  4O5Q A;  4NEW A;  3GYI A;  2ZBW A;  1O95 A;  2H89 A;  1DOD A;  2Q6U A;  1GSN A;  4TM1 A;  1LVL A;  4B67 A;  4CCQ A;  2FBW A;  3R9U A;  1PJ6 A;  1Z6L A;  1TRB A;  1F6M A;  1ZMD A;  2VZ2 A;  1ZKQ A;  3ITJ A;  4EIP A;  3ATQ A;  5IPY A;  2WPC A;  5GRT A;  2ARD A;  3UTF A;  1L9C A;  2CFY A;  4GR1 A;  4EQW A;  3AE4 A;  4LU6 A;  4XWZ A;  2C76 A;  2GMH A;  1IUS A;  4GDP A;  4EIQ A;  2VRL A;  2WBA A;  3B6D A;  1JOA A;  3ISH A;  4Z2U A;  1GRE A;  5FMH A;  3QFB A;  3UKH A;  2C73 A;  2UZZ A;  5U1O A;  3UTG A;  3NGC X;  2WET A;  2IVE A;  2RGJ A;  3UCL A;  2GVC A; 
#chains in the Genus database with same CATH topology
 3LAD A;  3AM9 A;  1VQW A;  3MY9 A;  3OPS A;  4B66 A;  3TW9 A;  3UXK A;  4D04 A;  4Z1Y A;  1K0J A;  1JPM A;  2YM1 A;  4U8J A;  3CPI G;  3VRD B;  2QDE A;  2PP3 A;  3QJ4 A;  3HW2 A;  1B8S A;  3TWB A;  3KVE A;  5KWF A;  4FDC B;  1N4W A;  3OP2 A;  3CXB A;  1F8R A;  3GD6 A;  3HZL A;  1GES A;  3UKA A;  4B68 A;  1V97 A;  3KLJ A;  3NTD A;  1P2H A;  3GSI A;  3AYJ A;  3ADA B;  2XH4 A;  3H8L A;  3S5S A;  1CC2 A;  4IP5 A;  4FX9 A;  1LQU A;  4M6U A;  3FCP A;  2BAC A;  1NDA A;  4KWS A;  2R45 A;  4K7Z A;  1JRZ A;  4K5R A;  5BUL A;  4CBQ A;  4DN1 A;  1QJD A;  1FEC A;  2OO6 A;  2WOI A;  3T2K A;  4AOX A;  2B9W A;  4FK1 A;  1L8P A;  3L8K A;  4HCH A;  2WU5 A;  4XWR A;  1OJ9 A;  3TCS A;  3NK0 X;  1MNS A;  2A87 A;  3NRZ B;  4YKF A;  3L1R A;  1OJD A;  2E4G A;  4HB9 A;  2BRA A;  2OPJ A;  1EL8 A;  2V60 A;  3T31 A;  3SJN A;  3AEF A;  2DKI A;  2C4C A;  4AOS A;  1H2I A;  4NTE A;  2A8X A;  3MQT A;  4Z17 A;  4Z2T A;  1KNR A;  3CND A;  3SY4 A;  3THU A;  4X2P A;  3LJP A;  3P4Q A;  3M0O A;  1X2G A;  4H2Q A;  2R9Z A;  3HRD C;  1SJC A;  1KFY A;  2NVK X;  1IYX A;  3R07 C;  3AED A;  4ZCD A;  3DER A;  3AEG A;  3H4K A;  2BS2 A;  4GAV A;  2XFO A;  4HN8 A;  1GRB A;  4Z44 A;  3HYX A;  2YR5 A;  1NG4 A;  3NHO X;  1FFV C;  3S5W A;  2ZZB A;  4CCR A;  1IUX A;  5FJO A;  3LOV A;  3DES A;  4IL2 A;  3JSK A;  2JK6 A;  2WQY A;  4P9S A;  2QQ6 A;  1BF3 A;  1ZMC A;  2WP9 A;  3P93 A;  3CPH G;  2GQW A;  1CJ3 A;  3GWD A;  3SZW A;  1N4V A;  3LB8 A;  4CNJ A;  3T9P A;  2E3T A;  3QKE A;  4E5T A;  5HHF A;  2DW7 A;  3P1W A;  1NAA A;  3DFY A;  4UDR A;  2GAG B;  2ONE A;  4G9K A;  4PAA A;  4HA6 A;  5FS7 A;  3KPK A;  3SZ0 A;  1TE6 A;  1PXB A;  1LJ1 A;  3C4N A;  3IC9 A;  1H86 A;  1EL5 A;  2AL2 B;  2WS3 A;  2OVL A;  3AXB A;  4H4R A;  2WOW A;  4X4J A;  5DBJ A;  4YWS A;  4B1B A;  3TWA A;  1TYP A;  1NG3 A;  4DYE A;  4H4Z A;  3OC4 A;  2WDV A;  4K8D A;  5G5H B;  1YQZ A;  3NYC A;  4J34 A;  3NYE A;  2PSN A;  3SXI A;  3PFR A;  3PS9 A;  4NZH A;  3ICS A;  4UDQ A;  4N9X A;  1ZXI C;  2X8G A;  2R0P A;  1GRA A;  2OG9 A;  3F8D A;  1BKW A;  3UOY A;  1W6T A;  2POD A;  3AE6 A;  1ONF A;  1VDC A;  1FL2 A;  3AE8 A;  4U8M A;  3UJE A;  2Q7V A;  3SX6 A;  3AEA A;  2MUC A;  2EQ7 A;  2TPR A;  1RM6 B;  3GO2 A;  2OZ8 A;  1STZ A;  4GFI A;  4H2P A;  1TDO A;  2HXT A;  3N6J A;  1PDH A;  4TLZ A;  1N62 C;  2HNE A;  3IJI A;  4FP1 A;  3IJL A;  4J56 A;  4YXD A;  1DXL A;  2XH2 A;  3SM8 A;  5JRB A;  4YTP A;  2JAE A;  1GAL A;  1MUC A;  5IQ4 A;  4BK3 A;  3SBF A;  1GER A;  5BOE A;  5FS8 A;  4EM3 A;  2CHR A;  4H4U A;  1IUW A;  2W3S A;  3AE7 A;  1GEU A;  3H12 A;  3CPJ G;  3R25 A;  1H7W A;  2V61 A;  4A9W A;  1JNR A;  2Q0L A;  5KVH A;  4GME A;  1SEZ A;  1GRH A;  3VC5 A;  3ICT A;  3NYF A;  3PWG A;  4LA1 A;  1H81 A;  3SZF A;  2I0Z A;  5CKU A;  2OAL A;  3DK9 A;  4H2N A;  2W0H A;  2ZC8 A;  3A7U A;  4JNA A;  4C5O A;  2XGZ A;  1PJ5 A;  3T0K A;  2GR1 A;  1DOC A;  4YT0 A;  3NS1 B;  2YG7 A;  1N61 C;  3NVW B;  3QVR A;  2B9Y A;  2RAB A;  3GMC A;  3DJG X;  5KXJ A;  2GR0 A;  2WEU A;  2PMQ A;  1RVK A;  4JY3 A;  3GD4 A;  1TDF A;  3DME A;  3B9J B;  4USQ A;  3H7V A;  2ZBW A;  4CCQ A;  3R9U A;  3JVA A;  4IL0 A;  2VZ2 A;  1ZKQ A;  3SYI A;  3ATQ A;  4GR1 A;  3SQS A;  2O56 A;  3R11 A;  2VRL A;  4EIQ A;  2WBA A;  2GGH A;  3QFB A;  4H83 A;  3UKH A;  2C73 A;  3JW7 A;  3NGC X;  3UCL A;  3C4A A;  1X2H A;  1E39 A;  4HPN A;  2WU2 A;  1N60 C;  1H82 A;  3P4S A;  5HXI A;  1NHQ A;  1JU2 A;  4EM4 A;  2E1M A;  5EOW A;  3RHA A;  1EBG A;  1L9E A;  4GIR A;  1XPY A;  3QFA A;  2C3C A;  3I3L A;  3ETR B;  3SN1 A;  3HYV A;  2R46 A;  3B3R A;  1IUU A;  2BXS A;  1O5W A;  4ZA0 A;  4U2L A;  3FVD A;  3RP7 A;  1GTH A;  3BNU A;  3OTR A;  3KD9 A;  3MSY A;  2OFJ A;  4E8G A;  3OZ2 A;  3FXG A;  1XPQ A;  1COY A;  4JN7 A;  3UP4 A;  5BRT A;  2PYX A;  3UOX A;  2X3N A;  3AEC A;  5KOW A;  5M10 A;  2PTY A;  1NHP A;  4GYP C;  2JB1 A;  2Q0K A;  3Q6J A;  4K5S A;  4H2R A;  1JRY A;  4J57 A;  3V5F A;  2YG5 A;  2CDU A;  3D47 A;  4YSX A;  2XFU A;  4K2S A;  4DX3 A;  2B9X A;  1F9C A;  3D9X A;  4H1Z A;  1N5W C;  1R6W A;  2Z5Y A;  1JRX A;  3SFE A;  3DFH A;  3PK7 A;  2WDR A;  3NKS A;  3I6T A;  2C75 A;  2QGY A;  1KF6 A;  4REK A;  1PBF A;  4UDP A;  4JQ9 A;  4H7U A;  1M64 A;  5FS6 A;  3LZX A;  3GYJ A;  1O94 A;  2V3A A;  2GAH B;  3TQP A;  3SFD A;  4PAB A;  3TOY A;  1BKH A;  2YLS A;  4MKS A;  5KOX A;  1F8S A;  2OX4 A;  1B5Q A;  4G8T A;  4GDE A;  1E1M A;  1PDZ A;  1PJ7 A;  3ES8 A;  3NK2 X;  2FJB A;  4KX6 A;  1Q1W A;  1L0V A;  4ECH A;  3PWI A;  2FJD A;  4K8G A;  1GET A;  4EQX A;  3AYL A;  2QVH A;  1TYT A;  1FCD A;  1EC8 A;  3S47 A;  4U2S A;  2FYM A;  3PO7 A;  3A7R A;  1GOS A;  5ENL A;  1OJA A;  3T2Z A;  1KCZ A;  3NIX A;  3EEZ A;  1K0L A;  4IHC A;  2CVJ A;  4Z2R A;  2XLR A;  3EUB 3;  4GRT A;  1NEL A;  4BUR A;  1LPF A;  3IWA A;  4BJZ A;  4ROP A;  1D5T A;  2JBV A;  2AR8 A;  3ZLH A;  4NWZ A;  2WPE A;  3KUM A;  4HYR A;  4EQS A;  5U25 A;  4J1O A;  4I59 A;  1TDN A;  3R10 A;  4JNQ A;  1N5X A;  3RNM A;  1MDL A;  1PDY A;  4CNK A;  2HZG A;  2JKC A;  3GY1 A;  1IUV A;  1D7L A;  4DSH A;  4OPG A;  1CBO A;  5JCI A;  3N4F A;  3RRA A;  3IHM A;  3SZC A;  2XVF A;  2PGE A;  3VDG A;  4A7A A;  2C66 A;  1CJ2 A;  1MDR A;  4JHM A;  3UKF A;  2PU1 A;  1L9D A;  3CTY A;  1GND A;  2GGI A;  4G6H A;  4YKG A;  4C77 A;  3N4E A;  3FYY A;  2OKT A;  4EWJ A;  4D03 A;  4OPD A;  1FO4 A;  1N4U A;  1TDK A;  3RO6 A;  4NNJ A;  2QCU A;  2YWL A;  2BRY A;  5TR3 A;  3UXL A;  3CIR A;  2Z5X A;  2RGO A;  2POZ A;  1WYG A;  4H4W A;  3SSZ A;  3EKG A;  2GGE A;  3M12 A;  1B4V A;  3H8A A;  2DW6 A;  3NFU A;  1RP0 A;  3I4K A;  3UKP A;  5FS9 A;  3SN0 A;  1GRT A;  3K1G A;  3RGT A;  4J36 A;  2GR3 A;  1H6V A;  1Y56 A;  2HXU A;  3AYI A;  5J60 A;  2IVD A;  2B7S A;  2WHD A;  1KDG A;  1KD0 A;  4GCM A;  1FEA A;  1E6E A;  3CNP A;  2X8C A;  4WCT A;  3FV9 A;  2C65 A;  4K22 A;  4KEM A;  4E6M A;  3ZDN A;  5C3J A;  3RIT A;  5J7X A;  4Y4N A;  4IA5 A;  1MO9 A;  5C2T A;  1D4D A;  1FHV A;  3GD3 A;  3ABV A;  3DJJ A;  3VFC A;  2GMJ A;  3BHK A;  1ONE A;  3UGV A;  4KT2 A;  1ZOV A;  2OAM A;  2BK3 A;  5JCN A;  1Y56 B;  1ZY8 A;  3TJI A;  3FPZ A;  3COX A;  1GRG A;  4OPT A;  3F8P A;  2OA1 A;  3AEE A;  1N63 C;  3NT6 A;  3RR1 A;  3N6H A;  4DGK A;  3ZYX A;  3LXD A;  4C3X A;  2BS3 A;  2QAE A;  4H4V A;  3AWI A;  5FJP A;  3B97 A;  3ZVH A;  1X31 B;  3DG3 A;  3DH9 A;  4Z43 A;  4J33 A;  2W55 A;  4GYP A;  3T4W A;  1ZK7 A;  3EPT A;  3GYI A;  2MNR A;  2H89 A;  3IK4 A;  2Q6U A;  3UJS A;  1GSN A;  3FJ4 A;  4B67 A;  4HCD A;  3Q4D A;  2FBW A;  1F6M A;  4G6G A;  3ITJ A;  3CYJ A;  3JZU A;  2ARD A;  1L9C A;  2CFY A;  3AE4 A;  2C76 A;  4GDP A;  3L5O A;  3B6D A;  1JOA A;  3NZG A;  5U1O A;  3V3W A;  3ZVH B;  2PA6 A;  2OQY A;  2WET A;  2IVE A;  4DHG A;  2GVC A;  1KNP A;  1OJC A;  4TM0 A;  2EQ8 A;  4JN9 A;  1H83 A;  3NTA A;  1CJC A;  4H4S A;  3UKQ A;  4XXG A;  1QO8 A;  3GRS A;  2HQM A;  3FIM B;  2XVI A;  1Y0P A;  2BS4 A;  1JEH A;  3KU9 A;  4GAP A;  3BI5 A;  2BCP A;  1YY5 A;  2OQH A;  3DGH A;  3QSS A;  3CB3 A;  4HNL A;  2GV8 A;  3GMB A;  1RSG A;  2TMD A;  1ELS A;  1CHU A;  1YEY A;  1WUE A;  2Y6Q A;  2R0C A;  2R4E A;  2P3Z A;  3G5Q A;  1JRP A;  2I5Q A;  1EL7 A;  2BC0 A;  3CN8 A;  2XVJ A;  1YQ3 A;  2YVJ A;  3UJF A;  2APG A;  3V5C A;  3DDM A;  4FK1 C;  2OLA A;  3VC6 A;  4A6N A;  3S61 A;  3AMZ A;  3VA8 A;  3GRT A;  5KRQ A;  1SJA A;  1D7Y A;  3G5S A;  3V3N A;  4YWO A;  5EB5 A;  1M6I A;  4JY2 A;  4U8P A;  4B69 A;  4APN A;  3EAN A;  4HNC A;  4II3 A;  2ZZC A;  3ALM A;  4G73 A;  3IF9 A;  1GXF A;  3OW1 A;  5L46 A;  2WDQ A;  3NVY B;  2XFP A;  1LQT A;  2QJJ A;  1PHH A;  2P8C A;  1FOH A;  3GYX A;  1OJT A;  4GGH A;  2ACZ A;  1T3Q C;  3BI2 A;  1GRF A;  2PTX A;  3QVP A;  4MGG A;  4F4R A;  1YQ4 A;  3ALL A;  2PTZ A;  1D4C A;  1FHU A;  3K7T A;  2P88 A;  2J3N A;  4YTN A;  4H50 A;  3DJD A;  3K7M X;  3H70 A;  1PBB A;  3WE0 A;  4U8K A;  2GF3 A;  4H4P A;  1NHR A;  4OPC A;  3T8Q A;  3UTH A;  2XLS A;  5KMR A;  2GSH A;  4DSG A;  2XH7 A;  2QA2 A;  3CGC A;  4U8I A;  3E1T A;  1E1N A;  2WOV A;  5G5G B;  3UP5 A;  2PS2 A;  2C3D A;  2AKZ A;  1NHS A;  2XLU A;  3DK8 A;  2E5A A;  4J3Z A;  3ICR A;  3PG6 A;  4U8N A;  5KMQ A;  4A65 A;  3FBS A;  1OEP A;  4EMW A;  2E5V A;  3BNM A;  3NG7 X;  3FG2 P;  5BUK A;  1CC4 A;  5KNL A;  3GDN A;  4K2X A;  1H7X A;  5HYM A;  2QA1 A;  4DWD A;  3NRN A;  2JB3 A;  5JCK A;  1ELI A;  1AOG A;  3C96 A;  5CQF A;  1EC9 A;  3V76 A;  4C3Y A;  1SJB A;  5FJU A;  3CGE A;  4TM4 A;  4UP3 A;  3BI4 A;  4IVM B;  2OZ3 A;  5IDZ A;  3AB1 A;  3ENL A;  2YG3 A;  2YLX A;  4KPL A;  2BA9 A;  2OLO A;  3NH3 X;  1FFU C;  4B65 A;  3KPF A;  4A3R A;  1CJ4 A;  3NVV B;  5GSN A;  1VRQ B;  3QSM A;  1GT8 A;  3D1C A;  3BSM A;  3VCN A;  1DOE A;  2YLT A;  4A99 A;  2C72 A;  1BWC A;  2NQL A;  2AKM A;  2R4J A;  2W3R A;  4U2T A;  4IVO B;  3QN3 A;  4M52 A;  2VVM A;  3UCC A;  1NU5 A;  2P8B A;  2O9Z A;  4GGB A;  2WP5 A;  1EL9 A;  3ZLG A;  1BZL A;  5BOF A;  3BOX A;  4Z26 A;  1XHC A;  2R0G A;  3DGZ A;  3ATR A;  2BAB A;  3P9U A;  1PS9 A;  1LTX R;  2GGJ A;  1PXC A;  1NEN A;  4TLX A;  2AL1 A;  5JCM A;  3RP6 A;  2YVF A;  2GRT A;  5EBK A;  1F3P A;  1SB3 B;  4MJW A;  2BC1 A;  3P3B A;  4A79 A;  4USR A;  2PP0 A;  3V3O A;  2GH5 A;  3SN4 A;  2YAU A;  4EMJ A;  1E7P A;  2CUL A;  4J2W A;  4ICY A;  3UTE A;  4J31 A;  1S7M A;  4RSL A;  3M13 A;  1P43 A;  2X50 A;  4B63 A;  2WPF A;  3AE2 A;  4GIS A;  2PP1 A;  4RG4 A;  2RDX A;  3CNJ A;  4JDR A;  3R0U A;  4LII A;  1V59 A;  1RYI A;  3D8X A;  4ZOH B;  2BK4 A;  3AN1 A;  1F8W A;  5EB4 A;  2YVG A;  1IJH A;  2F5Z A;  3D46 A;  3QLD A;  1E9I A;  2V6O A;  1P2E A;  4OCG A;  1KSU A;  4H2H A;  4Y4M A;  3MKC A;  1PBD A;  2FJE A;  4AT0 A;  2VRM A;  2ZZ0 A;  4AP1 A;  3VCC A;  1YKJ A;  1K0I A;  4X9M A;  1DNC A;  2YG6 A;  2GL5 A;  4H4X A;  3HPF A;  2QJM A;  3UCD A;  1DOD A;  4TM1 A;  1LVL A;  3HYW A;  1ZMD A;  4EIP A;  2WPC A;  3UTF A;  4EQW A;  4LU6 A;  3U4F A;  4MMW A;  3ISH A;  4Z2U A;  4G7F A;  1GRE A;  5FMH A;  2UZZ A;  2XFQ A;  3UJ2 A;  5HY5 A;  2BK5 A;  3CMM A;  1S3E A;  3RED A;  2YM2 A;  2XCG A;  2YQU A;  2IID A;  1UKV G;  2C7G A;  2X99 A;  4IA6 A;  1QLB A;  2AAQ A;  1R0M A;  3GDP A;  3T14 A;  3CGD A;  1E1L A;  4GUV A;  4AT2 A;  3ALJ A;  1SJD A;  3V4B A;  4A35 A;  5LV9 A;  3ES7 A;  1LV0 A;  5IQ1 A;  2AL2 A;  3UKL A;  2DKH A;  3EF6 A;  2W54 A;  3CNT A;  4TM3 A;  1DTN A;  4H4T A;  2NPX A;  3SR6 B;  3DA1 A;  7ENL A;  1GTE A;  3I6D A;  2BYB A;  2YG4 A;  1VQZ A;  4JN8 A;  1B37 A;  3CK5 A;  3FMW A;  1CL0 A;  5KMP A;  3AD7 B;  1XDI A;  1ZDL A;  2Y6R A;  3CXO A;  4TVY A;  2EQ6 A;  2C64 A;  2VVL A;  1TDE A;  6ENL A;  2VVL G;  1N1P A;  1MXT A;  2C70 A;  2RGH A;  5KVI A;  4G74 A;  1Q1R A;  3GWF A;  2GEW A;  3STP A;  2H88 A;  3QSE A;  3U9I A;  1BQG A;  3I6E A;  1IUT A;  3AE5 A;  4BV6 A;  2XVE A;  4NTC A;  2JB2 A;  3UJR A;  2C67 A;  1KN0 A;  3QPE A;  2XLP A;  2XDO A;  3NN0 X;  2PU0 A;  1KKO A;  3BHF A;  3NNE A;  3O0H A;  4E4U A;  2OLN A;  1DJQ A;  4CY6 A;  4AP3 A;  2PHH A;  1K4Q A;  3DK4 A;  1CF3 A;  3AE1 A;  4H4Q A;  3P0W A;  3R1Z A;  3NLC A;  3A7A A;  1E1K A;  2BXR A;  4Z25 A;  2V3B A;  1PBE A;  2X8H A;  4O5U A;  3ZLF A;  2YLW A;  4RG3 A;  1FIQ B;  5FJR A;  3OZY A;  3NN6 X;  2QJN A;  1TZZ A;  2GR2 A;  1D4E A;  2FKP A;  2B76 A;  3CT2 A;  3NO1 A;  2YR6 A;  4CRT A;  1BGJ A;  2PCE A;  1PBC A;  4M0X A;  5ER0 A;  3Q9T A;  1XS2 A;  4NTD A;  2XH0 A;  3NVZ B;  4Y4L A;  2ZAD A;  3DGB A;  4E4F A;  1NEK A;  2VQ7 A;  1VDV A;  1H84 A;  3T2Y A;  4YSZ A;  1FEB A;  2GB0 A;  3VR8 A;  4YSH A;  3RP8 A;  4OVI A;  1ECQ A;  1GV4 A;  4YSY A;  3DIP A;  2YLR A;  4YTM A;  1DOB A;  3MZN A;  1S2Y A;  2AQJ A;  1VG9 A;  1ZX9 A;  4OPI A;  3AD9 B;  4E0V A;  1KSS A;  3Q45 A;  4CY8 A;  1GPE A;  4GF7 A;  1PXA A;  3DEQ A;  4A6G A;  1S3B A;  2XLT A;  3LZW A;  3VRA A;  4ENL A;  4A6N B;  4X9N A;  1ZP0 A;  3NXL A;  3TTE A;  5KMS A;  1JDF A;  1DJN A;  2YLZ A;  3G5R A;  1S2Q A;  3KA7 A;  4OPU A;  2A89 A;  2V5Z A;  2XVH A;  3KKJ A;  3DG7 A;  3R0K A;  1NPX A;  2PGW A;  4EMI A;  3EAO A;  3IHG A;  3SQP A;  1REO A;  4H4Y A;  5FJT A;  1WUF A;  3MUC A;  1W4X A;  3VR9 A;  3QTP A;  4DNA A;  1HYU A;  4BK1 A;  4BK2 A;  1VG0 A;  4U8L A;  3AE9 A;  2WP6 A;  1ZOY A;  3K7Q X;  1KKR A;  3SGL A;  1TKK A;  3AD8 B;  5M0Z A;  2QDD A;  1CC6 A;  1MOK A;  4ZCW A;  3CAW A;  2XSX A;  2VQB A;  2P0I A;  3NK1 X;  3CGB A;  3GC2 A;  3UOZ A;  3P4P A;  4ADW A;  4TVW A;  2WES A;  2EQ9 A;  4DXK A;  4II2 A;  1EBH A;  3H8I A;  4Z24 A;  2XFN A;  2PPG A;  4WX1 A;  1XAN A;  2XYO A;  3F8R A;  2GQF A;  3PVC A;  3II4 A;  2PTW A;  1PN0 A;  3VRB A;  4BJY A;  1BGN A;  3UKK A;  3URH A;  2VOU A;  3VQR A;  2BCG G;  3IJQ A;  3ZVI A;  2FJA A;  1EC7 A;  3MWC A;  3P4R A;  1Q9I A;  3AE3 A;  3DJE A;  4U8O A;  5EU9 A;  1JNZ A;  4B64 A;  1MRA A;  5JCL A;  4NEV A;  4ZCC A;  2OZT A;  1JCT A;  1P48 A;  3T37 A;  3UOV A;  2B7R A;  3K30 A;  4IP4 A;  3CNS A;  3BJS A;  4H19 A;  2YR4 A;  4ZN0 A;  3AEB A;  4EQR A;  4IT1 A;  4HCL A;  4OPL A;  4I58 A;  5U63 A;  4K1W A;  2GGG A;  4IV9 A;  4FI4 A;  4A5L A;  4C74 A;  4KPR A;  1EBD A;  5BVA A;  4O5Q A;  4NEW A;  1O95 A;  3OZM A;  1PJ6 A;  1Z6L A;  1TRB A;  5IPY A;  4IZG A;  5GRT A;  5J04 A;  2GDQ A;  4XWZ A;  2GMH A;  1IUS A;  3T6C A;  1JPD X;  1JRO A;  3TJ4 A;  3UTG A;  3RCY A;  2RGJ A;  3DG6 A; 
#chains in the Genus database with same CATH homology
 1KNP A;  1OJC A;  1E39 A;  3LAD A;  2WU2 A;  2XFQ A;  1VQW A;  4TM0 A;  2EQ8 A;  5HY5 A;  4B66 A;  1H82 A;  3P4S A;  4JN9 A;  2BK5 A;  1H83 A;  3CMM A;  3NTA A;  1CJC A;  5HXI A;  1NHQ A;  4H4S A;  1S3E A;  4D04 A;  1JU2 A;  1K0J A;  3RED A;  4EM4 A;  2YM1 A;  4U8J A;  4XXG A;  3UKQ A;  2YM2 A;  1QO8 A;  3GRS A;  3CPI G;  3VRD B;  2HQM A;  2XCG A;  2YQU A;  3FIM B;  2XVI A;  3QJ4 A;  1Y0P A;  2BS4 A;  2E1M A;  5EOW A;  1B8S A;  2IID A;  3RHA A;  1UKV G;  2C7G A;  2X99 A;  4IA6 A;  1JEH A;  1QLB A;  3KVE A;  3KU9 A;  4GAP A;  1L9E A;  3BI5 A;  5KWF A;  2BCP A;  3QFA A;  4FDC B;  2AAQ A;  1YY5 A;  2C3C A;  3DGH A;  3I3L A;  3QSS A;  3GDP A;  3T14 A;  3HYV A;  2R46 A;  1N4W A;  3CGD A;  1E1L A;  4GUV A;  4AT2 A;  3B3R A;  1IUU A;  3ALJ A;  2BXS A;  1O5W A;  2GV8 A;  3GMB A;  5LV9 A;  1F8R A;  1RSG A;  1LV0 A;  5IQ1 A;  4YSX A;  2TMD A;  4U2L A;  3HZL A;  1GES A;  1CHU A;  3RP7 A;  1GTH A;  3UKA A;  2Y6Q A;  3UKL A;  2DKH A;  2R0C A;  2R4E A;  4B68 A;  3BNU A;  3EF6 A;  3KD9 A;  3G5Q A;  3CNT A;  3KLJ A;  4TM3 A;  4H4T A;  1EL7 A;  3NTD A;  2BC0 A;  3CN8 A;  2XVJ A;  1P2H A;  3GSI A;  3AYJ A;  1YQ3 A;  3OZ2 A;  2NPX A;  2YVJ A;  1XPQ A;  3ADA B;  1COY A;  3H8L A;  3DA1 A;  1GTE A;  3I6D A;  1CC2 A;  2APG A;  3UP4 A;  2BYB A;  4FK1 C;  2YG4 A;  5BRT A;  4FX9 A;  2PYX A;  4A6N A;  3S61 A;  1B37 A;  1LQU A;  3FMW A;  2X3N A;  3UOX A;  3AEC A;  5KOW A;  5M10 A;  1CL0 A;  5KMP A;  3AD7 B;  2BAC A;  1NHP A;  1XDI A;  1NDA A;  1ZDL A;  3GRT A;  2Y6R A;  5KRQ A;  2JB1 A;  2EQ6 A;  1D7Y A;  3Q6J A;  2Q0K A;  2C64 A;  2R45 A;  4K5S A;  2VVL A;  4K7Z A;  3G5S A;  1TDE A;  1JRZ A;  4H2R A;  3V3N A;  1JRY A;  4J57 A;  2VVL G;  4K5R A;  5BUL A;  4CBQ A;  1QJD A;  2YG5 A;  2CDU A;  4YWO A;  1N1P A;  1MXT A;  2C70 A;  5EB5 A;  1FEC A;  2WOI A;  1M6I A;  2RGH A;  2XFU A;  4JY2 A;  4U8P A;  3T2K A;  4B69 A;  5KVI A;  4AOX A;  2B9W A;  2B9X A;  4FK1 A;  3D9X A;  3L8K A;  4APN A;  4G74 A;  3EAN A;  1Q1R A;  2WU5 A;  3GWF A;  4XWR A;  2GEW A;  4II3 A;  2ZZC A;  2H88 A;  3ALM A;  4G73 A;  1OJ9 A;  3IF9 A;  1GXF A;  5L46 A;  3QSE A;  2WDQ A;  2Z5Y A;  1IUT A;  1JRX A;  3NK0 X;  3AE5 A;  2A87 A;  4BV6 A;  2XFP A;  2XVE A;  3L1R A;  4NTC A;  4YKF A;  3SFE A;  2JB2 A;  1LQT A;  2WDR A;  1OJD A;  2E4G A;  3NKS A;  4HB9 A;  2BRA A;  2C67 A;  2C75 A;  1PHH A;  1EL8 A;  1KN0 A;  2V60 A;  1FOH A;  3GYX A;  3T31 A;  1OJT A;  1KF6 A;  2XLP A;  3AEF A;  4REK A;  1PBF A;  4UDP A;  2DKI A;  2C4C A;  4AOS A;  2ACZ A;  4JQ9 A;  2XDO A;  3BI2 A;  3NN0 X;  1H2I A;  4H7U A;  4NTE A;  2A8X A;  1GRF A;  3QVP A;  1M64 A;  3BHF A;  3NNE A;  4Z2T A;  1KNR A;  1YQ4 A;  5FS6 A;  3LZX A;  3GYJ A;  3O0H A;  3ALL A;  3CND A;  1D4C A;  1O94 A;  2V3A A;  1DJQ A;  2GAH B;  2OLN A;  3SY4 A;  3K7T A;  2PHH A;  4AP3 A;  3LJP A;  1K4Q A;  2J3N A;  3SFD A;  4PAB A;  3P4Q A;  2YLS A;  3M0O A;  3DK4 A;  1CF3 A;  3AE1 A;  5KOX A;  1F8S A;  4YTN A;  4H50 A;  3DJD A;  4H2Q A;  2R9Z A;  4H4Q A;  3K7M X;  1KFY A;  1PBB A;  1B5Q A;  2NVK X;  3WE0 A;  4GDE A;  3AED A;  1E1M A;  3NLC A;  1PJ7 A;  4U8K A;  4ZCD A;  2GF3 A;  3AEG A;  1E1K A;  3NK2 X;  2BXR A;  3H4K A;  4Z25 A;  2FJB A;  4KX6 A;  1Q1W A;  2BS2 A;  4H4P A;  1L0V A;  1NHR A;  2V3B A;  1PBE A;  2X8H A;  4O5U A;  4GAV A;  4OPC A;  3UTH A;  2XFO A;  4ECH A;  2XLS A;  5KMR A;  2YLW A;  1GRB A;  4RG3 A;  2FJD A;  1GET A;  4Z44 A;  4DSG A;  3HYX A;  3NN6 X;  4EQX A;  3AYL A;  2YR5 A;  1TYT A;  1FCD A;  2QA2 A;  3CGC A;  4U8I A;  2GR2 A;  3E1T A;  1D4E A;  1NG4 A;  3NHO X;  4U2S A;  2B76 A;  3PO7 A;  1E1N A;  3S5W A;  2WOV A;  1GOS A;  3UP5 A;  2ZZB A;  2YR6 A;  4CCR A;  2C3D A;  4CRT A;  1IUX A;  1BGJ A;  3LOV A;  1OJA A;  3T2Z A;  1NHS A;  2XLU A;  3JSK A;  1PBC A;  2JK6 A;  2WQY A;  3NIX A;  1K0L A;  4P9S A;  1BF3 A;  1ZMC A;  2WP9 A;  5ER0 A;  2CVJ A;  4Z2R A;  2XLR A;  3CPH G;  2GQW A;  3DK8 A;  1CJ3 A;  3GWD A;  3Q9T A;  4GRT A;  3ICR A;  3PG6 A;  4U8N A;  5KMQ A;  4A65 A;  4BUR A;  3FBS A;  1LPF A;  4EMW A;  4NTD A;  2E5V A;  3BNM A;  3IWA A;  4Y4L A;  4BJZ A;  3NG7 X;  3FG2 P;  1D5T A;  2JBV A;  5BUK A;  1CC4 A;  2AR8 A;  5KNL A;  3SZW A;  3GDN A;  1N4V A;  3LB8 A;  4CNJ A;  1NEK A;  4K2X A;  2VQ7 A;  4NWZ A;  2WPE A;  1H84 A;  4EQS A;  1H7X A;  5HHF A;  5U25 A;  3T2Y A;  3P1W A;  1NAA A;  4YSZ A;  5HYM A;  2QA1 A;  1FEB A;  2GB0 A;  4UDR A;  3NRN A;  3VR8 A;  2GAG B;  2JB3 A;  4YSH A;  4I59 A;  5JCK A;  1TDN A;  4G9K A;  1ELI A;  3RP8 A;  4OVI A;  1AOG A;  1GV4 A;  4HA6 A;  4JNQ A;  4PAA A;  4YSY A;  3C96 A;  5FS7 A;  2YLR A;  5CQF A;  4YTM A;  3RNM A;  3KPK A;  1DOB A;  3SZ0 A;  1PXB A;  3C4N A;  1LJ1 A;  3V76 A;  4CNK A;  4C3Y A;  1S2Y A;  3IC9 A;  3CGE A;  4TM4 A;  4UP3 A;  2AQJ A;  1H86 A;  1VG9 A;  2JKC A;  1ZX9 A;  3BI4 A;  1EL5 A;  4IVM B;  1IUV A;  4OPI A;  3AD9 B;  2WS3 A;  1D7L A;  4E0V A;  1KSS A;  4DSH A;  3AXB A;  4CY8 A;  3AB1 A;  1GPE A;  2YG3 A;  2YLX A;  4CY6 A;  4H4R A;  4OPG A;  2WOW A;  4GF7 A;  4X4J A;  1CBO A;  5DBJ A;  4B1B A;  5JCI A;  2BA9 A;  1TYP A;  1PXA A;  1NG3 A;  2OLO A;  3NH3 X;  4H4Z A;  3OC4 A;  3IHM A;  1S3B A;  3LZW A;  2XLT A;  2WDV A;  3SZC A;  3VRA A;  4B65 A;  3KPF A;  4A6N B;  1CJ4 A;  4X9N A;  1ZP0 A;  2XVF A;  4K8D A;  5KMS A;  1DJN A;  5GSN A;  4A7A A;  1YQZ A;  2C66 A;  2YLZ A;  3NYC A;  3G5R A;  4J34 A;  1VRQ B;  3NYE A;  3QSM A;  1CJ2 A;  1GT8 A;  1S2Q A;  3SXI A;  3KA7 A;  4OPU A;  2A89 A;  2V5Z A;  2XVH A;  3KKJ A;  3PS9 A;  3D1C A;  3UKF A;  1NPX A;  3ICS A;  4NZH A;  4EMI A;  3EAO A;  3IHG A;  3SQP A;  1REO A;  4H4Y A;  4UDQ A;  1L9D A;  3CTY A;  4N9X A;  1DOE A;  2YLT A;  4A99 A;  2C72 A;  1GND A;  4G6H A;  4YKG A;  1BWC A;  2X8G A;  4C77 A;  1W4X A;  2R0P A;  3VR9 A;  1GRA A;  3F8D A;  2R4J A;  4DNA A;  1HYU A;  4BK1 A;  4BK2 A;  4U2T A;  1BKW A;  1VG0 A;  4IVO B;  4U8L A;  3AE9 A;  3UOY A;  4D03 A;  4OPD A;  2WP6 A;  1ZOY A;  1N4U A;  1TDK A;  3K7Q X;  4M52 A;  4NNJ A;  2QCU A;  2YWL A;  2BRY A;  3SGL A;  2VVM A;  5TR3 A;  3AD8 B;  5M0Z A;  3CIR A;  1CC6 A;  1MOK A;  2Z5X A;  3AE6 A;  2RGO A;  1ONF A;  1VDC A;  1FL2 A;  2O9Z A;  3AE8 A;  4U8M A;  4H4W A;  2Q7V A;  3SX6 A;  3AEA A;  2VQB A;  2EQ7 A;  3M12 A;  2TPR A;  2WP5 A;  1B4V A;  1EL9 A;  1BZL A;  3NK1 X;  4H2P A;  4Z26 A;  1XHC A;  3CGB A;  1RP0 A;  3DGZ A;  1TDO A;  2R0G A;  3ATR A;  3UOZ A;  2BAB A;  3P9U A;  1PS9 A;  3P4P A;  5FS9 A;  3UKP A;  1GRT A;  4ADW A;  1LTX R;  4J36 A;  1PDH A;  4TLZ A;  1PXC A;  2WES A;  1NEN A;  2EQ9 A;  4TLX A;  5JCM A;  3RP6 A;  4II2 A;  2YVF A;  2GRT A;  5EBK A;  4J56 A;  1F3P A;  4YXD A;  2GR3 A;  3H8I A;  1H6V A;  2BC1 A;  4MJW A;  1Y56 A;  3AYI A;  1DXL A;  4A79 A;  4USR A;  5J60 A;  3SM8 A;  5JRB A;  2IVD A;  3V3O A;  2GH5 A;  4YTP A;  2YAU A;  2B7S A;  2WHD A;  4Z24 A;  1KDG A;  2JAE A;  2XFN A;  1GAL A;  4WX1 A;  1XAN A;  4EMJ A;  1E7P A;  2CUL A;  4J2W A;  2XYO A;  4GCM A;  1FEA A;  5IQ4 A;  4BK3 A;  3F8R A;  1E6E A;  3CNP A;  2GQF A;  1GER A;  2X8C A;  3PVC A;  3II4 A;  5FS8 A;  4ICY A;  3UTE A;  4WCT A;  1PN0 A;  4EM3 A;  4J31 A;  2C65 A;  1S7M A;  3VRB A;  4H4U A;  4K22 A;  3M13 A;  1BGN A;  1IUW A;  4RSL A;  3UKK A;  4BJY A;  2X50 A;  3AE7 A;  3ZDN A;  3C4A A;  3URH A;  2WPF A;  3AE2 A;  4B63 A;  5C3J A;  1GEU A;  5J7X A;  2VOU A;  4Y4N A;  4IA5 A;  1MO9 A;  4RG4 A;  3CPJ G;  3VQR A;  2BCG G;  5C2T A;  1D4D A;  3CNJ A;  4JDR A;  3GD3 A;  1H7W A;  2FJA A;  2V61 A;  3ABV A;  3DJJ A;  4A9W A;  3P4R A;  4LII A;  1V59 A;  1JNR A;  1RYI A;  2Q0L A;  2GMJ A;  3D8X A;  1Q9I A;  2BK4 A;  5KVH A;  3AE3 A;  1F8W A;  3BHK A;  5EB4 A;  1SEZ A;  1GRH A;  2YVG A;  3DJE A;  4U8O A;  3ICT A;  1IJH A;  3NYF A;  4LA1 A;  1JNZ A;  1ZOV A;  4B64 A;  2F5Z A;  1H81 A;  2OAM A;  3SZF A;  2I0Z A;  5CKU A;  5JCL A;  2BK3 A;  4NEV A;  2OAL A;  4ZCC A;  3DK9 A;  5JCN A;  1Y56 B;  4H2N A;  2V6O A;  2W0H A;  1ZY8 A;  3T37 A;  1P2E A;  3FPZ A;  3COX A;  4OCG A;  1GRG A;  4OPT A;  3UOV A;  1KSU A;  3F8P A;  2OA1 A;  3AEE A;  4JNA A;  4Y4M A;  4C5O A;  2B7R A;  3K30 A;  1PJ5 A;  3NT6 A;  4DGK A;  3T0K A;  2GR1 A;  3ZYX A;  3LXD A;  1DOC A;  1PBD A;  3CNS A;  2YG7 A;  4C3X A;  4YT0 A;  2FJE A;  4AT0 A;  2BS3 A;  2QAE A;  3QVR A;  4H4V A;  2VRM A;  2B9Y A;  3AWI A;  2YR4 A;  2RAB A;  2ZZ0 A;  4ZN0 A;  3GMC A;  3DJG X;  5KXJ A;  2GR0 A;  4AP1 A;  1X31 B;  2WEU A;  3DH9 A;  1YKJ A;  1K0I A;  3AEB A;  4Z43 A;  4X9M A;  1DNC A;  4EQR A;  4J33 A;  2YG6 A;  4JY3 A;  3GD4 A;  4OPL A;  4H4X A;  4I58 A;  1TDF A;  5U63 A;  3DME A;  4IV9 A;  4USQ A;  1ZK7 A;  4A5L A;  4C74 A;  4KPR A;  1EBD A;  3EPT A;  5BVA A;  4O5Q A;  4NEW A;  3GYI A;  2ZBW A;  1O95 A;  2H89 A;  1DOD A;  2Q6U A;  1GSN A;  4TM1 A;  1LVL A;  4B67 A;  4CCQ A;  2FBW A;  3R9U A;  1PJ6 A;  1Z6L A;  3HYW A;  1TRB A;  1F6M A;  4G6G A;  1ZMD A;  2VZ2 A;  1ZKQ A;  3SYI A;  3ITJ A;  4EIP A;  3ATQ A;  5IPY A;  2WPC A;  5GRT A;  2ARD A;  3UTF A;  1L9C A;  2CFY A;  4GR1 A;  4EQW A;  3AE4 A;  4LU6 A;  4XWZ A;  2C76 A;  2GMH A;  1IUS A;  4GDP A;  4EIQ A;  2VRL A;  2WBA A;  3L5O A;  1JOA A;  3B6D A;  3ISH A;  4Z2U A;  1GRE A;  5FMH A;  3QFB A;  3UKH A;  2C73 A;  2UZZ A;  5U1O A;  3UTG A;  3NGC X;  2WET A;  2IVE A;  2RGJ A;  3UCL A;  2GVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...