3GD4A

Crystal structure of the reduced, nad-bound form of murine apoptosis inducing factor
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
483
structure length
445
Chain Sequence
b'PSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLQFRQWNGKERSIYFQPPSFYVSAQDLPNIENGGVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRALEKISREVKSITVIGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKILPQYLSNWTMEKVKREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKAEASEITIPEDYGKGVIFYLRDKVVVGIVLWNVFNRMPIARKIIKDGEQHEDLNEVAKLFNIH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apoptosis-inducing factor 1, mitochondrial
publication title Redox-linked conformational dynamics in apoptosis-inducing factor
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 142
structure length 445
sequence length 483
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3gd4A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3gd4A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3gd4A01
3C96A 1DJQA 2JK6A 3BNUA 4TLZA 4USRA 2Q0LA 1ZY8A 1CBOA 2FJBA 4CBQA 2XLPA 2OLOA 3DH9A 1KFYA 1GERA 1PDHA 2V3AA 1VG9A 1K0LA 3UKKA 3AEFA 1IUTA 2XFNA 4ZCDA 5J7XA 1IUUA 1GRBA 3KD9A 3VR8A 5KVHA 3LJPA 1MXTA 3NK1X 4I59A 1TYPA 4ADWA 4EQWA 1PBFA 3ZDNA 2RABA 1CL0A 2YR4A 4JDRA 1F8RA 4ZN0A 2GR1A 3LADA 4J31A 1ZK7A 1JEHA 3NKSA 3UKFA 1GEUA 3AXBA 3GDPA 3GD3A 1S2YA 3SGLA 1GNDA 1K0IA 1H6VA 2XFPA 4FK1A 2FJAA 4TM3A 4H4SA 3NLCA 3P4SA 4NTEA 4O5QA 3AB1A 3NH3X 3NHOX 1JRZA 5EBKA 2VRLA 3IF9A 3D8XA 2B9XA 4OPIA 4XWZA 1H7WA 2A87A 4OPTA 4Z25A 3NT6A 2E5VA 1O94A 3UCLA 3P1WA 3COXA 4U8JA 2HQMA 2WOIA 5JCKA 3ATRA 3EPTA 3UTHA 4AP1A 3V3NA 1PN0A 1JOAA 2GB0A 2IIDA 1E1NA 2CULA 3FMWA 1BF3A 3EAOA 1TDNA 2C67A 3AE1A 3JSKA 4Z24A 3SFDA 3SFEA 2J3NA 2B9YA 2GAHB 3NK0X 4K7ZA 1DOBA 4YSXA 4ZCCA 2WPCA 3AECA 4YTNA 1CC4A 2AAQA 1TRBA 5HYMA 1GESA 3AE6A 3AE7A 3B6DA 4K22A 5KOWA 4FDCB 3G5QA 3VRDB 1QO8A 2V6OA 1IUXA 4GDPA 4H4XA 4AOXA 4TLXA 2YG4A 1DJNA 4H4ZA 4PAAA 2GR3A 4B64A 3RP7A 3RP6A 3ABVA 3AD9B 1PXBA 3UKLA 3REDA 1CJ4A 4B68A 2ZZBA 4JNAA 4YTPA 3CNPA 1CF3A 1PBEA 1LQTA 1MO9A 5FS9A 2YR6A 3KKJA 3QJ4A 1BZLA 2WOWA 1JNZA 5FS8A 2VVLG 3AYIA 3ATQA 2GEWA 4NTDA 4CCRA 3DK4A 3DMEA 2IVDA 5EB4A 3Q9TA 1E7PA 1REOA 1LTXR 3PO7A 4HA6A 1Y0PA 4H4QA 3ICRA 3KVEA 1GXFA 3P9UA 5EOWA 2WP9A 1AOGA 3F8PA 4MJWA 3UKAA 1PXAA 2WU2A 2V61A 1E1MA 1ELIA 3AYLA 1OJ9A 2BK3A 1GTHA 3BHKA 1Y56B 1D7LA 1COYA 2XVFA 3ADAB 3UTFA 1Y56A 2OLNA 3E1TA 4CCQA 3K7TA 2PHHA 4OVIA 1D4EA 3P4PA 2VVLA 2C72A 4UP3A 3NN6X 4U2TA 1KSUA 5JCLA 1BKWA 4USQA 3C4NA 4H2PA 1CC2A 4BJZA 1EL8A 3KLJA 4RG3A 1JRYA 5JCMA 1GTEA 2H89A 2C3DA 4YSHA 3NNEA 3FPZA 4A6NA 4H4TA 4U8LA 1LV0A 3GDNA 3GRTA 3G5RA 3D1CA 2Z5YA 3DGHA 2WETA 2Z5XA 4AT2A 2TMDA 1H84A 2Y6QA 2WPFA 4TM0A 1PJ6A 3ICSA 1TDKA 2R4JA 1LPFA 3CNDA 1H83A 4BJYA 2WDRA 1GRHA 4A7AA 4DSGA 2GMHA 4AT0A 3AEDA 1LVLA 2B7RA 5U63A 2GQWA 3K7MX 3ZYXA 4GUVA 3CNJA 1CHUA 3LXDA 1YQ4A 4EMWA 2BACA 3RNMA 4IA6A 1GREA 2DKIA 5FS7A 5IQ1A 1ZOYA 3L1RA 1Q1RA 2YLSA 3M13A 4H2NA 3V3OA 1N4UA 2YWLA 4PABA 4EQXA 4JNQA 3LOVA 1ZMCA 2V5ZA 1N4VA 4CRTA 3ALLA 4H2QA 4RSLA 4D04A 2JB3A 4LA1A 2OA1A 4X9NA 1CJCA 3AYJA 3S61A 4J36A 1KNRA 1DNCA 3AE8A 5KVIA 4A9WA 3FG2P 2WPEA 3QSMA 3GYIA 4YTMA 1F8SA 5M10A 2XFQA 2CFYA 4IV9A 3BI5A 4K2XA 4YXDA 1H81A 2VQBA 3AEBA 4BK3A 2C66A 2YVGA 1K0JA 1P2EA 2WQYA 1B5QA 2GF3A 2XVEA 2GV8A 3IHGA 3NK2X 1XPQA 3AD7B 4CY8A 2YVFA 4J2WA 4I58A 1H86A 2V3BA 4EM4A 2X8GA 1EL5A 1KSSA 1S3EA 4GR1A 4YSZA 2C3CA 1S3BA 4OPDA 5KOXA 3K30A 1GOSA 3ITJA 3H4KA 1IUSA 2QA2A 4B66A 4D03A 4ECHA 1IUVA 4HB9A 1NAAA 3H8IA 1BGNA 2Q0KA 4NEWA 2FJEA 4Z2RA 1JNRA 1NENA 2BXSA 3NIXA 4BK2A 4BK1A 3GMCA 2BC1A 1FECA 5BRTA 5BVAA 4H7UA 3QFAA 2JKCA 2XFOA 2QA1A 3NYEA 5M0ZA 3F8DA 2EQ6A 3P4RA 3RP8A 1RSGA 5U25A 3BI4A 3O0HA 5CQFA 4EMIA 4XWRA 1EL9A 4FX9A 1EBDA 2YG3A 4WX1A 2BC0A 2X8CA 3DA1A 1TDOA 1YKJA 4GCMA 4OPLA 2YAUA 4CY6A 2BS3A 1M6IA 3AE5A 2GAGB 2E4GA 3QFBA 4U8MA 4K8DA 4OPGA 3LZXA 5C2TA 5BULA 3URHA 1CJ3A 1PBDA 3GWDA 5J60A 4YWOA 1L9DA 1D4CA 2R0GA 3I3LA 1L0VA 3NN0X 3ICTA 3G5SA 3II4A 2C70A 2XLSA 5HY5A 2I0ZA 3DJJA 1XANA 2B7SA 3T37A 5ER0A 1DXLA 2JBVA 2GMJA 3UOVA 2X99A 1ZDLA 2BXRA 4EIPA 3CN8A 1PXCA 1BGJA 4UDPA 5BUKA 2XVHA 1TDEA 3AE3A 3BHFA 1BWCA 3NYFA 2XYOA 4X4JA 5FMHA 4H4YA 2BABA 2WP6A 1V59A 4WCTA 3OZ2A 2H88A 5HHFA 4JY3A 2W0HA 1L9EA 3M0OA 4H4WA 2RGJA 4Z2TA 4JY2A 3GYJA 1OJTA 4K5SA 4EM3A 1NEKA 2YLZA 1Q1WA 3CGBA 1PHHA 2BYBA 2BS4A 3CIRA 2C76A 5IQ4A 4U2LA 1ZX9A 2C64A 2Q7VA 3UP4A 1FEAA 4A79A 3M12A 1QLBA 2JB1A 2VRMA 2YR5A 3IC9A 1S2QA 2RGHA 4U2SA 4UDRA 2IVEA 2VOUA 2APGA 2B76A 5GSNA 3VR9A 3NYCA 4EQSA 4YKFA 3OC4A 1FEBA 4EMJA 2PYXA 1KDGA 1N4WA 2AQJA 3LZWA 1XDIA 2WBAA 2X3NA 2EQ9A 1GRGA 2ZBWA 4OPUA 4DGKA 4C3XA 4GDEA 3C4AA 5GRTA 4Y4MA 3KA7A 2B9WA 2CDUA 4JQ9A 1NHPA 2JAEA 4U8NA 1B4VA 4Z44A 4B65A 3R9UA 1PS9A 1GRAA 3DK9A 3SM8A 2OAMA 4U8PA 2QCUA 3AWIA 1OJDA 4GRTA 4B63A 1N1PA 1NG4A 4E0VA 1O95A 4APNA 2ACZA 3UOXA 2TPRA 1Z6LA 4Z43A 3DK8A 3IWAA 3RHAA 2YM1A 4GF7A 1UKVG 4A65A 3CPJG 2CVJA 3NTAA 4OPCA 3CGDA 2YLXA 3UOZA 1E39A 2GQFA 4EIQA 2GR0A 1JU2A 4LIIA 4RG4A 4B1BA 1F3PA 4H4RA 2YG6A 3F8RA 1KF6A 2R46A 3IHMA 2BA9A 1H7XA 2WP5A 2WDVA 3UKHA 4NZHA 1EL7A 2R0CA 5JCNA 4ICYA 4C3YA 2Y6RA 1PJ7A 1B8SA 3AE4A 4A99A 1W4XA 2WDQA 1ZMDA 1DODA 4H4PA 4XXGA 4Z26A 3DJDA 3HZLA 1CC6A 2YLTA 1KNPA 4O5UA 2WOVA 3KU9A 1LQUA 3AEGA 3H8LA 2RGOA 1FCDA 5DBJA 1IUWA 4REKA 3I6DA 4Z2UA 2R0PA 2VVMA 4KPRA 1HYUA 1GT8A 5KXJA 5IPYA 2ZZ0A 4C77A 3CTYA 1NHSA 3CGCA 2QAEA 1ZP0A 4H4VA 3S5WA 3GSIA 4J56A 3VQRA 3AE2A 1ONFA 1QJDA 1E1KA 3UKPA 1NG3A 3UP5A 4K5RA 2A8XA 4LU6A 2ARDA 3BNMA 2R9ZA 3CPIG 1O5WA 4P9SA 3L8KA 2NPXA 1DOEA 2XCGA 1RP0A 2JB2A 4KX6A 1E6EA 3ALJA 3VRAA 4CNKA 2C73A 2C7GA 4AP3A 1SEZA 2XLRA 2XVJA 2ZZCA 3CNTA 3PS9A 2R45A 4NEVA 1X31B 3QSEA 1D4DA 1GSNA 1M64A 3DGZA 2EQ8A 4H4UA 2XDOA 2BCGG 3BI2A 1K4QA 4CNJA 4TM4A 4FK1C 1TYTA 3CNSA 3NG7X 2GVCA 2BK5A 3V76A 4U8IA 3GMBA 2AR8A 2E1MA 2X50A 3FIMB 2YG7A 3KPFA 3P4QA 3QVRA 1F8WA 1B37A 1NHRA 1DOCA 1VRQB 4IVMB 5LV9A 5KWFA 4N9XA 1LJ1A 3GWFA 1GETA 2XFUA 4EQRA 2WS3A 1XHCA 3EF6A 2R4EA 4YSYA 4YKGA 3EANA 4H2RA 4A5LA 3UTGA 1JRXA 2C75A 2XVIA 1YQ3A 4BURA 3NTDA 3QSSA 3FBSA 3GRSA 3NGCX 2YLRA 1E1LA 1NDAA 1CJ2A 2F5ZA 2XLUA 3NRNA 1VG0A 1GALA 2C65A 2YVJA 1D7YA 2YG5A 2BS2A 2VQ7A 3LB8A 3UKQA 3DJEA 1MOKA 2YM2A 3GD4A 2XLTA 4NTCA 1OJAA 2WEUA 4TM1A 1GRTA 4U8KA 1YQZA 2GRTA 4X9MA 1L9CA 1PBBA 5EB5A 4J33A 4B69A 2VZ2A 4YT0A 3Q6JA 1H82A 2Q6UA 2V60A 2FJDA 1ZKQA 2YQUA 2FBWA 2X8HA 5U1OA 3AEAA 3CPHG 2EQ7A 1Q9IA 4J34A 1RYIA 1IJHA 1TDFA 5KRQA 1NHQA 1GPEA 4OCGA 4AOSA 2DKHA 1D5TA 4H50A 5CKUA 4DSHA 2OALA 4DNAA 2NVKX 3ISHA 3UTEA 3K7QX 4C5OA 4U8OA 4BV6A 1GRFA 5HXIA 1F6MA 1FL2A 4UDQA 5JCIA 2YLWA 1FOHA 5FS6A 1PBCA 2WESA 3VRBA 4JN9A 4J57A 3SQPA 5C3JA 1PJ5A 3AD8B 1VDCA 3AE9A 3ALMA 2BK4A 1ZOVA 5L46A 1GV4A 3AEEA 4A6NB 2A89A 4Y4NA 3PVCA 4C74A 4IA5A 2O9ZA 3QVPA 4IVOB 3DJGX 2WHDA 2UZZA 1OJCA 2BCPA 2GH5A 1YY5A 2GR2A 2WU5A 4Y4LA 4B67A 3B3RA 3UOYA 5TR3A 4M52A 1NPXA 1VQWA 1P2HA 3CGEA 3WE0A
chains in the Genus database with same CATH superfamily
4USRA 3FVDA 1CBOA 2XLPA 2OLOA 3D47A 1VG9A 3TQPA 3UKKA 2XFNA 3KD9A 3LJPA 1MXTA 3NK1X 1CL0A 2GR1A 5FJOA 1S2YA 1GNDA 1K0IA 4FK1A 3ZLHA 4NTEA 3R1ZA 5EBKA 2B9XA 1H7WA 2A87A 3OZYA 3NT6A 3D46A 2WOIA 1FIQB 3ATRA 3EPTA 5KMQA 2IIDA 1BF3A 1TDNA 2B9YA 4K7ZA 3AECA 4YTNA 4GISA 1CC4A 3B6DA 3AE7A 3CB3A 2CHRA 1IUXA 2OZTA 4IL2A 2YG4A 2GR3A 3ZLFA 3THUA 3REDA 3OZMA 1PBEA 3KKJA 3QJ4A 1BZLA 2WOWA 3SJNA 4II2A 2QDDA 4NTDA 3DMEA 2OPJA 5EB4A 1LTXR 3FXGA 2WP9A 1X2GA 3F8PA 1PXAA 2WU2A 2V61A 2OFJA 1OJ9A 2HXUA 3BHKA 1Y56B 1D7LA 1TZZA 2XVFA 3ADAB 4GGBA 3UTFA 3E1TA 2E5AA 1SJDA 4DXKA 3RITA 1D4EA 4UP3A 3MSYA 1KSUA 1CC2A 4BJZA 2C4CA 3KLJA 4RG3A 4YSHA 4K1WA 2GGGA 4A6NA 4H4TA 4U8LA 3GRTA 3G5RA 3T31A 3GO2A 4TVYA 2W54A 3SX6A 1GRHA 3AEDA 3HW2A 4GUVA 4GYPA 3RNMA 2FKPA 3M13A 4EQXA 4CRTA 2PP0A 4LA1A 2OA1A 3S61A 4A9WA 2ZADA 2QJMA 4IV9A 4YXDA 2VQBA 3AEBA 2YVGA 1B5QA 3ZVHB 1XPQA 2V3BA 4YSZA 5JRBA 1S3BA 4GGHA 4KPLA 3ITJA 4H2HA 1IUVA 1NAAA 1BGNA 1JNRA 1NENA 2BXSA 3GMCA 1FECA 3SN1A 3NYEA 2QA1A 1N61C 3CMMA 1DTNA 3DA1A 1PDYA 4HYRA 2W3SA 2YAUA 3V4BA 4K8DA 3URHA 4YWOA 1L9DA 1D4CA 3II4A 3DJJA 1XANA 5ER0A 2JBVA 2GMJA 1KCZA 2XVHA 3P93A 3BHFA 2XYOA 4H4YA 2BABA 2H88A 5HHFA 3M0OA 4H4WA 4Z2TA 3GYJA 3OPSA 3ENLA 3N4FA 4EM3A 1PHHA 3CIRA 2BYBA 4U2LA 2C64A 3UP4A 2YR5A 3IC9A 4HNLA 3DGBA 3ES8A 2RDXA 2APGA 2B76A 2P88A 3VR9A 4HCLA 2WBAA 4MKSA 1GRGA 4HN8A 4DGKA 2B9WA 2JAEA 1B4VA 2PP1A 3DK9A 5FJTA 4E4FA 3AWIA 1N1PA 2PS2A 4ROPA 1EC8A 3IWAA 1UKVG 2CVJA 4OPCA 2MUCA 1F3PA 2WP5A 4C3YA 3AE4A 3H12A 3ZLGA 2WDQA 1ZMDA 2O56A 4H4PA 1ZXIC 3TJ4A 2YLTA 2WOVA 3H8LA 2RGOA 3IJIA 3I6DA 4M0XA 1GT8A 3CTYA 3CGCA 3S5WA 4H4VA 5FJUA 3DESA 3AE2A 3UP5A 2A8XA 2ARDA 1O5WA 2XH0A 2NPXA 1DOEA 2JB2A 3PS9A 2R45A 1D4DA 4JHMA 3AMZA 2XDOA 2BCGG 3CNSA 2GVCA 1NU5A 2E1MA 3SFDA 4N9XA 1LJ1A 1GETA 3ZVIA 4A5LA 2XVIA 3NTDA 3GRSA 3U4FA 3NGCX 2YLRA 3V5CA 1CJ2A 3B9JB 4ZA0A 2C65A 1D7YA 2YG5A 2BS2A 3LB8A 3DJEA 1RM6B 1MOKA 1STZA 4TM1A 1GRTA 1N63C 4J33A 4B69A 3Q6JA 3DG7A 2EQ7A 1Q9IA 4J34A 1RYIA 1TDFA 5KRQA 3FJ4A 4Z17A 4H50A 2OALA 4DNAA 4HPNA 5KMRA 4C5OA 3JW7A 2HNEA 5BOFA 4J57A 3SQPA 5C3JA 3AD8B 3ALMA 2XSXA 2BK4A 2BRYA 1ZOVA 3BOXA 3AEEA 2OX4A 4IA5A 3B97A 3DG6A 3UOYA 5TR3A 3BNUA 2JK6A 2W3RA 1EC7A 2PTZA 2FJBA 3V3WA 4CBQA 2GGHA 3NZGA 1KFYA 2AL2A 3H70A 1GRBA 4H1ZA 3VR8A 1TYPA 3BJSA 4ADWA 4EQWA 4HCHA 3TOYA 2QVHA 4JDRA 3LADA 2HXTA 3AXBA 3GDPA 3GD3A 4MGGA 3NLCA 3P4SA 2VRLA 3IF9A 4XWZA 3VFCA 2E5VA 1O94A 3UCLA 3COXA 2HQMA 5JCKA 4AP1A 1MDLA 2GB0A 1E1NA 2CULA 3AE1A 1DOBA 1FFVC 2PMQA 4GIRA 5HYMA 1GESA 4K22A 1QO8A 3CYJA 5ENLA 4AOXA 4TLXA 3VDGA 4DWDA 4KEMA 1WUFA 1JROA 3UCDA 3ABVA 3SN4A 3UKLA 4B68A 2DW7A 2ZZBA 3CNPA 2MNRA 1LQTA 3T2YA 3ATQA 2IVDA 4G6GA 3PO7A 1Y0PA 4H4QA 1MRAA 1TE6A 1AOGA 4MJWA 1ELIA 2XH2A 4CCQA 1JPMA 3K7TA 4OVIA 3UXLA 3NN6X 5JCLA 4H2PA 2C3DA 3PWGA 2Z5YA 3DGHA 4AT2A 1H84A 2Y6QA 4TM0A 3ICSA 3QTPA 1TDKA 3K1GA 4BJYA 3SYIA 2B7RA 2GQWA 3ZYXA 2BACA 4EMWA 1GREA 4J3ZA 1MDRA 4Z1YA 1Q1RA 2YLSA 4H2NA 3V3OA 4JNQA 1BQGA 3LOVA 1N4VA 4H2QA 2JB3A 3FV9A 3AYJA 1KNRA 1DNCA 2I5QA 5KVIA 3FG2P 2WPEA 2C66A 4FI4A 1EC9A 1K0JA 4F4RA 2XVEA 4DN1A 3IHGA 3AD7B 2YVFA 4ZOHB 1H86A 4EM4A 1S3EA 2POZA 3RGTA 4M6UA 3I6EA 2OZ3A 1IUSA 4ECHA 4NNJA 2Q0KA 1WUEA 3AN1A 3NIXA 2PODA 2BC1A 3R11A 4H7UA 2XFOA 5M0ZA 3RP8A 5U25A 3BI4A 5CQFA 4EMIA 4FX9A 1EBDA 2BC0A 2X8CA 4OPLA 1M6IA 1N5XA 2GAGB 3GD6A 4U8MA 5BULA 1CJ3A 3GWDA 2R0GA 3I3LA 4E6MA 3ICTA 3G5SA 2C70A 2I0ZA 1DXLA 4EIPA 3CN8A 1BGJA 3EUB3 1BWCA 3EKGA 1V59A 4WCTA 2AKZA 4K5SA 1OJTA 3CGBA 1JDFA 3MQTA 2BS4A 5IQ4A 2C76A 1FEAA 3M12A 2VRMA 3NVYB 5GSNA 4EQSA 3OC4A 1N4WA 1XDIA 3N6JA 4OPUA 4J1OA 3C4AA 4Y4MA 3KA7A 1NHPA 3ETRB 4Z44A 3R0UA 2OAMA 1EBGA 2QCUA 2QDEA 2ACZA 1Z6LA 4Z43A 3DK8A 2YM1A 4GF7A 1KKRA 1E39A 1KD0A 4EIQA 1JU2A 4LIIA 4B1BA 1R0MA 4H4RA 3F8RA 1KF6A 3I4KA 2BA9A 2R0CA 1SJAA 3NXLA 1PJ7A 7ENLA 1CC6A 4O5UA 3T6CA 1LQUA 2ONEA 3FYYA 3CAWA 1IUWA 4REKA 3UJEA 2R0PA 2VVMA 4KPRA 2QAEA 1IYXA 4J56A 5IDZA 3VQRA 1ONFA 3DFHA 3UKPA 1NG3A 2E3TA 3L8KA 2XCGA 3VRAA 4AP3A 4K2SA 3CNTA 3QSEA 3NRZB 4TM4A 4FK1C 3SSZA 2GSHA 3SBFA 2X50A 3QVRA 3KPFA 1NHRA 4YKGA 1W6TA 2C75A 1YQ3A 2PSNA 4DHGA 3FBSA 5KMPA 1NDAA 3SY4A 1VG0A 2P0IA 3DFYA 3CT2A 3MKCA 4HCDA 2YM2A 3GD4A 1PDZA 1KKOA 3UJFA 1YQZA 4YT0A 1L9CA 5EB5A 1ZKQA 3CPHG 3KPKA 3PG6A 2DKHA 1D5TA 5CKUA 1F9CA 4II3A 1GRFA 4IHCA 5JCIA 3BSMA 1YEYA 3AE9A 4Y4NA 5G5GB 2WHDA 2BCPA 2GR2A 4B67A 1XS2A 4M52A 1X31B 2WP6A 4TLZA 1JRPA 2FYMA 2PTYA 3HYWA 1KN0A 2P8BA 3DH9A 1GERA 4ZCWA 2AL2B 1PDHA 2V3AA 1K0LA 5J7XA 1IUTA 4ZCDA 4G73A 3T14A 3VA8A 3ZDNA 4ENLA 2YR4A 1F8RA 4ZN0A 4J31A 1T3QC 1ZK7A 1JEHA 3UKFA 1GEUA 2P3ZA 2XFPA 4GYPC 3NH3X 3A7UA 2PTWA 4OPTA 2AL1A 4U8JA 1WYGA 3DEQA 1PN0A 1JOAA 3SFEA 2HZGA 3HRDC 4ZCCA 2WPCA 1TRBA 3CXBA 4DX3A 5KOWA 3VRDB 4JN7A 4KT2A 1DJNA 4H4ZA 5BOEA 2XH7A 4B64A 3RP6A 4JNAA 4YTPA 2AKMA 1MO9A 5FS9A 5FS8A 3AYIA 4CCRA 3DK4A 2OO6A 4DYEA 1E7PA 3TTEA 1JPDX 3KVEA 1GXFA 3P9UA 5EOWA 3UKAA 4EWJA 3AYLA 2BK3A 1SJCA 1S7MA 1MUCA 3UJSA 3VC5A 3P4PA 2NQLA 6ENLA 3H8AA 2VVLA 1BKWA 3C4NA 1EL8A 3MWCA 5JCMA 1GTEA 2H89A 3JVAA 3EEZA 3NNEA 3D1CA 2WETA 2TMDA 2WPFA 4G6HA 2W55A 1MNSA 1H83A 4A7AA 2GMHA 3K7MX 3CNJA 1CHUA 1YQ4A 4IA6A 5IQ1A 3L1RA 2YWLA 4IT1A 1FHVA 2V5ZA 3ALLA 4X9NA 1CJCA 4J36A 3QSMA 5M10A 1F8SA 2XFQA 2CFYA 3BI5A 4K2XA 4G74A 3A7AA 2GF3A 2GV8A 4I58A 3Q4DA 2BRAA 3SZCA 5KOXA 3NFUA 3K30A 4B66A 2QA2A 1FHUA 3H8IA 3H7VA 3PFRA 3P0WA 4NEWA 4Z2RA 3NVWB 3F8DA 1RSGA 4A6GA 4XWRA 1ECQA 2YG3A 2GL5A 3R25A 4GCMA 3NS1B 2E4GA 3QFBA 5C2TA 4GMEA 5J60A 1L0VA 4IZGA 5HY5A 2XLSA 3SZFA 3A7RA 2B7SA 1EBHA 3UOVA 2BXRA 1V97A 3VCCA 3GC2A 3T9PA 3OZ2A 2PU1A 1L9EA 1NELA 2YLZA 1ZX9A 1TKKA 4A79A 2JB1A 3QLDA 3T2ZA 1S2QA 2RGHA 5J04A 2PA6A 2IVEA 2VOUA 3NYCA 3MZNA 4EMJA 1FEBA 2PYXA 3LZWA 2EQ9A 2ZBWA 2GGEA 2QJNA 3TCSA 2CDUA 4JQ9A 4B65A 2GGJA 3SM8A 1OJDA 4GRTA 4E0VA 3UOXA 3V5FA 3DERA 3TJIA 4A65A 3MY9A 3NTAA 3CGDA 3UOZA 2GQFA 4G8TA 4RG4A 3T4WA 3I6TA 1H7XA 2WDVA 4NZHA 1L8PA 2Y6RA 1B8SA 4A99A 4XXGA 3HZLA 3TW9A 1KNPA 3KU9A 3TWBA 3PWIA 5DBJA 3HYVA 4H83A 4Z2UA 1HYUA 5IPYA 4C77A 1ZP0A 3SN0A 1QJDA 1E1KA 4K5RA 4LU6A 3BNMA 3CPIG 2R9ZA 3UJ2A 3MUCA 3SZWA 3ALJA 2C73A 2C7GA 3HYXA 2ZZCA 4HNCA 1GSNA 3BI2A 2EQ8A 4H4UA 1K4QA 4CNJA 3DIPA 2BK5A 3V76A 4U8IA 2AR8A 3FIMB 3P4QA 4IVMB 3N4EA 5KWFA 2XFUA 2WS3A 2R4EA 4YSYA 3EANA 3VCNA 4GAVA 4BURA 2PCEA 2OKTA 2XGZA 2F5ZA 2XLUA 3NRNA 1GALA 3IJQA 1H2IA 4NTCA 2DW6A 4U8KA 2GRTA 2VZ2A 1H82A 1FFUC 2Q6UA 2V60A 3AEAA 1GPEA 4A3RA 3FCPA 4DSHA 2NVKX 3UTEA 3N6HA 4U8OA 4BV6A 5HXIA 1FL2A 5FS6A 1PBCA 1RVKA 4JN9A 1VDCA 3SZ0A 4KWSA 2A89A 4A35A 4C74A 4IVOB 2GH5A 1YY5A 2WU5A 3B3RA 1NPXA 1VQWA 3WE0A 3C96A 1DJQA 3IK4A 2Q0LA 1ZY8A 3AEFA 1IUUA 5KVHA 4I59A 1PBFA 1ELSA 3CK5A 2RABA 2OLAA 3DDMA 3GYXA 3TWAA 3NKSA 4H19A 3T0KA 3SGLA 1H6VA 3L5OA 3OW1A 2FJAA 4TM3A 4H4SA 4O5QA 3AB1A 3NHOX 1JRZA 4OPIA 3D8XA 4Z25A 3IJLA 2QJJA 4GFIA 3P1WA 4MMWA 3UTHA 3V3NA 3FMWA 3EAOA 5FJRA 2C67A 3JSKA 4Z24A 3SXIA 2J3NA 2GAHB 3NK0X 4YSXA 4IL0A 2AAQA 3AE6A 4FDCB 3G5QA 2V6OA 1VDVA 2PTXA 4GAPA 3NO1A 4H4XA 4GDPA 4PAAA 3RP7A 3AD9B 1PXBA 1CJ4A 1CF3A 2GDQA 3RR1A 2YR6A 1JNZA 2OVLA 2VVLG 2GEWA 3Q9TA 1REOA 4HA6A 2GGIA 3D9XA 3ICRA 3GY1A 4IP4A 1E1MA 1GTHA 4FP1A 1COYA 1Y56A 2OLNA 3UGVA 3Q45A 2XH4A 3UCCA 2PHHA 2C72A 1JCTA 4U2TA 3VC6A 4USQA 5KNLA 1JRYA 3FPZA 3RCYA 1LV0A 5EU9A 3GDNA 4G9KA 1VQZA 2Z5XA 1PJ6A 1N5WC 3UXKA 2R4JA 1LPFA 3CNDA 2WDRA 4DSGA 4AT0A 1LVLA 5U63A 2PP3A 3LXDA 2OZ8A 3QN3A 2DKIA 5FS7A 1ZOYA 1BKHA 1SB3B 1N4UA 4PABA 1ZMCA 4RSLA 4D04A 3S5SA 2P8CA 3AE8A 3GYIA 4YTMA 1H81A 4BK3A 1P2EA 2WQYA 1N60C 2PGEA 3ZVHA 3NK2X 4CY8A 4J2WA 2X8GA 1EL5A 1KSSA 4GR1A 4JN8A 2C3CA 4OPDA 1GOSA 4K8GA 3H4KA 4D03A 4HB9A 3SR6B 2FJEA 4TVWA 4BK2A 4BK1A 1N62C 5BRTA 5BVAA 3R0KA 3QFAA 2JKCA 2EQ6A 3P4RA 3JZUA 3O0HA 1EL9A 4WX1A 2PPGA 3KUMA 1TDOA 1YKJA 4CY6A 2BS3A 3AE5A 4OPGA 3LZXA 3P3BA 3SQSA 1PBDA 3HPFA 3NN0X 5KMSA 3T37A 3NVZB 2X99A 1ZDLA 1PXCA 4UDPA 5BUKA 2OQYA 1TDEA 3AE3A 3NYFA 4X4JA 5FMHA 4JY3A 3U9IA 2W0HA 3PK7A 2RGJA 4E4UA 4JY2A 1SJBA 1NEKA 1Q1WA 1E9IA 1OEPA 2Q7VA 2QQ6A 1QLBA 4U2SA 4UDRA 3R10A 4E5TA 4YKFA 2OQHA 1KDGA 2AQJA 2X3NA 4C3XA 4GDEA 5GRTA 2PGWA 4U8NA 3R9UA 1PS9A 1GRAA 4U8PA 3ES7A 3AM9A 4B63A 1NG4A 1O95A 2ZC8A 2QGYA 4APNA 2TPRA 5G5HB 3RHAA 3CPJG 3S47A 2YLXA 2GR0A 4G7FA 1FO4A 2YG6A 3IHMA 2R46A 3UKHA 1EL7A 5JCNA 4ICYA 1W4XA 1DODA 4Z26A 3DJDA 3AEGA 2PU0A 1FCDA 3STPA 5KXJA 2ZZ0A 3QPEA 1NHSA 5FJPA 3GSIA 4P9SA 1X2HA 1RP0A 4KX6A 1E6EA 4CNKA 3OP2A 1SEZA 2XLRA 3CXOA 2XVJA 3T2KA 1R6WA 4NEVA 1M64A 3UJRA 3DGZA 1TYTA 3NG7X 3GMBA 2YG7A 1F8WA 1B37A 1DOCA 1VRQB 5LV9A 3GWFA 3RRAA 4EQRA 1XHCA 3EF6A 4YWSA 4H2RA 3UTGA 1JRXA 3QSSA 1E1LA 1ONEA 2OG9A 2YVJA 1P48A 2VQ7A 3UKQA 3RO6A 2XLTA 1P43A 1OJAA 2WEUA 4X9MA 1PBBA 2FJDA 2FBWA 2YQUA 2X8HA 5U1OA 1IJHA 4NWZA 1NHQA 4AOSA 4OCGA 3QKEA 4E8GA 3T8QA 3ISHA 4IP5A 3K7QX 1F6MA 4UDQA 2YLWA 4X2PA 1FOHA 1XPYA 2WESA 3VRBA 1PJ5A 5L46A 3DG3A 1GV4A 4A6NB 3PVCA 2O9ZA 3QVPA 3OTRA 3DJGX 2UZZA 1OJCA 3NVVB 4Y4LA 3R07C 1P2HA 3CGEA
chains in the Genus database with same CATH topology
3C96A 1DJQA 2JK6A 3BNUA 4TLZA 4USRA 3HYWA 2Q0LA 1KN0A 1ZY8A 1CBOA 2FJBA 4CBQA 2XLPA 2OLOA 3DH9A 1KFYA 1GERA 1PDHA 2V3AA 1VG9A 1K0LA 3UKKA 3AEFA 1IUTA 2XFNA 4ZCDA 5J7XA 1IUUA 1GRBA 4G73A 3T14A 3KD9A 3VR8A 5KVHA 3LJPA 1MXTA 3NK1X 4I59A 1TYPA 4ADWA 4EQWA 1PBFA 3ZDNA 2RABA 1CL0A 2YR4A 4JDRA 1F8RA 4ZN0A 2GR1A 3LADA 4J31A 1ZK7A 3GYXA 1JEHA 3NKSA 3UKFA 1GEUA 3AXBA 3GDPA 3T0KA 3GD3A 1S2YA 3SGLA 1GNDA 1K0IA 1H6VA 2XFPA 3L5OA 4FK1A 2FJAA 4TM3A 4H4SA 3NLCA 3P4SA 4NTEA 4O5QA 3AB1A 3NH3X 3NHOX 1JRZA 5EBKA 2VRLA 3IF9A 3D8XA 2B9XA 4OPIA 4XWZA 1H7WA 2A87A 4OPTA 4Z25A 3NT6A 2E5VA 1O94A 3UCLA 3P1WA 3COXA 4U8JA 2HQMA 2WOIA 5JCKA 3ATRA 3EPTA 3UTHA 4AP1A 3V3NA 1PN0A 1JOAA 2GB0A 5KMQA 2IIDA 1E1NA 2CULA 3FMWA 1BF3A 3EAOA 1TDNA 2C67A 3AE1A 3JSKA 4Z24A 3SFDA 3SXIA 3SFEA 2J3NA 2B9YA 2GAHB 3NK0X 4K7ZA 1DOBA 4YSXA 4ZCCA 2WPCA 3AECA 4YTNA 1CC4A 2AAQA 1TRBA 5HYMA 1GESA 3AE6A 3AE7A 3B6DA 4K22A 5KOWA 4FDCB 3G5QA 3VRDB 1QO8A 2V6OA 1IUXA 4GAPA 4GDPA 4H4XA 4AOXA 4TLXA 2YG4A 1DJNA 4H4ZA 4PAAA 2GR3A 4B64A 3RP7A 3RP6A 3ABVA 3AD9B 1PXBA 3UKLA 3REDA 1CJ4A 4B68A 2ZZBA 4JNAA 4YTPA 3CNPA 1CF3A 1PBEA 1LQTA 1MO9A 5FS9A 2YR6A 3KKJA 3QJ4A 1BZLA 2WOWA 1JNZA 4II2A 5FS8A 2VVLG 3T2YA 3AYIA 3ATQA 2GEWA 4NTDA 4CCRA 3DK4A 3DMEA 2IVDA 4G6GA 5EB4A 3Q9TA 1E7PA 1REOA 1LTXR 3PO7A 4HA6A 1Y0PA 4H4QA 3D9XA 3ICRA 3KVEA 1GXFA 3P9UA 5EOWA 2WP9A 1AOGA 3F8PA 4MJWA 3UKAA 1PXAA 2WU2A 2V61A 1E1MA 1ELIA 3AYLA 1OJ9A 2BK3A 1GTHA 3BHKA 1Y56B 1D7LA 1COYA 2XVFA 3ADAB 3UTFA 1Y56A 2OLNA 3E1TA 1S7MA 4CCQA 3K7TA 2PHHA 4OVIA 1D4EA 3P4PA 2VVLA 2C72A 4UP3A 3NN6X 4U2TA 1KSUA 5JCLA 1BKWA 4USQA 5KNLA 3C4NA 4H2PA 1CC2A 4BJZA 1EL8A 2C4CA 3KLJA 4RG3A 1JRYA 5JCMA 1GTEA 2H89A 2C3DA 4YSHA 3NNEA 3FPZA 4A6NA 4H4TA 4U8LA 1LV0A 3GDNA 3GRTA 3G5RA 3D1CA 2Z5YA 3DGHA 2WETA 2Z5XA 4G9KA 3T31A 4AT2A 2TMDA 1H84A 2Y6QA 2WPFA 4G6HA 4TM0A 1PJ6A 3ICSA 1TDKA 3SX6A 2R4JA 1LPFA 3CNDA 1H83A 4BJYA 2WDRA 1GRHA 4A7AA 4DSGA 2GMHA 3SYIA 4AT0A 3AEDA 1LVLA 2B7RA 5U63A 2GQWA 3K7MX 3ZYXA 4GUVA 3CNJA 1CHUA 3LXDA 1YQ4A 4EMWA 2BACA 3RNMA 4IA6A 1GREA 2DKIA 5FS7A 5IQ1A 1ZOYA 3L1RA 1Q1RA 2YLSA 3M13A 4H2NA 3V3OA 1N4UA 2YWLA 4PABA 4EQXA 4JNQA 3LOVA 1ZMCA 2V5ZA 1N4VA 4CRTA 3ALLA 4H2QA 4RSLA 4D04A 2JB3A 4LA1A 2OA1A 4X9NA 1CJCA 3AYJA 3S61A 4J36A 1KNRA 1DNCA 3AE8A 5KVIA 4A9WA 3FG2P 2WPEA 3QSMA 3GYIA 4YTMA 1F8SA 5M10A 2XFQA 2CFYA 4IV9A 3BI5A 4K2XA 4YXDA 1H81A 2VQBA 3AEBA 4G74A 4BK3A 2C66A 2YVGA 1K0JA 1P2EA 2WQYA 1B5QA 2GF3A 2XVEA 2GV8A 3IHGA 3NK2X 1XPQA 3AD7B 4CY8A 2YVFA 4J2WA 4I58A 1H86A 2BRAA 2V3BA 4EM4A 2X8GA 1EL5A 1KSSA 1S3EA 4GR1A 4YSZA 3SZCA 2C3CA 5JRBA 1S3BA 4OPDA 5KOXA 3K30A 1GOSA 3ITJA 3H4KA 1IUSA 2QA2A 4B66A 4D03A 4ECHA 1IUVA 4HB9A 1NAAA 3H8IA 4NNJA 1BGNA 2Q0KA 4NEWA 2FJEA 4Z2RA 1JNRA 1NENA 2BXSA 3NIXA 4BK2A 4BK1A 3GMCA 2BC1A 1FECA 5BRTA 5BVAA 4H7UA 3QFAA 2JKCA 2XFOA 2QA1A 3NYEA 5M0ZA 3F8DA 2EQ6A 3P4RA 3RP8A 1RSGA 5U25A 3BI4A 3O0HA 5CQFA 4EMIA 4XWRA 3CMMA 1EL9A 4FX9A 1EBDA 2YG3A 4WX1A 2BC0A 2X8CA 3DA1A 1TDOA 1YKJA 4GCMA 4OPLA 2YAUA 4CY6A 2BS3A 1M6IA 3AE5A 2GAGB 2E4GA 3QFBA 4U8MA 4K8DA 4OPGA 3LZXA 5C2TA 5BULA 3URHA 1CJ3A 1PBDA 3GWDA 5J60A 4YWOA 1L9DA 1D4CA 2R0GA 3I3LA 1L0VA 3NN0X 3ICTA 3G5SA 3II4A 2C70A 2XLSA 3SZFA 2I0ZA 5HY5A 5KMSA 3DJJA 1XANA 2B7SA 3T37A 5ER0A 1DXLA 2JBVA 2GMJA 3UOVA 2X99A 1ZDLA 2BXRA 4EIPA 3CN8A 1PXCA 1BGJA 4UDPA 5BUKA 2XVHA 1TDEA 3AE3A 3BHFA 1BWCA 3NYFA 2XYOA 4X4JA 5FMHA 4H4YA 2BABA 2WP6A 1V59A 4WCTA 3OZ2A 2H88A 5HHFA 4JY3A 2W0HA 1L9EA 3M0OA 4H4WA 2RGJA 4Z2TA 4JY2A 3GYJA 1OJTA 4K5SA 4EM3A 1NEKA 2YLZA 1Q1WA 3CGBA 1PHHA 2BYBA 2BS4A 3CIRA 2C76A 5IQ4A 4U2LA 1ZX9A 2C64A 2Q7VA 3UP4A 1FEAA 4A79A 3M12A 1QLBA 2JB1A 2VRMA 2YR5A 3T2ZA 3IC9A 1S2QA 2RGHA 4U2SA 4UDRA 2IVEA 2VOUA 2APGA 2B76A 5GSNA 3VR9A 3NYCA 4EQSA 4YKFA 3OC4A 1FEBA 4EMJA 2PYXA 1KDGA 1N4WA 2AQJA 3LZWA 1XDIA 2WBAA 2X3NA 2EQ9A 1GRGA 2ZBWA 4OPUA 4DGKA 4C3XA 4GDEA 3C4AA 5GRTA 4Y4MA 3KA7A 2B9WA 2CDUA 4JQ9A 1NHPA 2JAEA 4U8NA 1B4VA 4Z44A 4B65A 3R9UA 1PS9A 1GRAA 3DK9A 3SM8A 2OAMA 4U8PA 2QCUA 3AWIA 1OJDA 4GRTA 4B63A 1N1PA 1NG4A 4E0VA 1O95A 4APNA 2ACZA 3UOXA 2TPRA 1Z6LA 4Z43A 3DK8A 3IWAA 3RHAA 2YM1A 4GF7A 1UKVG 4A65A 3CPJG 2CVJA 3NTAA 4OPCA 3CGDA 2YLXA 3UOZA 1E39A 2GQFA 4EIQA 2GR0A 1JU2A 4LIIA 4RG4A 4B1BA 1F3PA 4H4RA 2YG6A 3F8RA 1KF6A 2R46A 3IHMA 2BA9A 1H7XA 2WP5A 2WDVA 3UKHA 4NZHA 1EL7A 2R0CA 5JCNA 4ICYA 4C3YA 2Y6RA 1PJ7A 1B8SA 3AE4A 4A99A 1W4XA 2WDQA 1ZMDA 1DODA 4H4PA 4XXGA 4Z26A 3DJDA 3HZLA 1CC6A 2YLTA 1KNPA 4O5UA 2WOVA 3KU9A 1LQUA 3AEGA 3H8LA 2RGOA 1FCDA 5DBJA 1IUWA 3HYVA 4REKA 3I6DA 4Z2UA 2R0PA 2VVMA 4KPRA 1HYUA 1GT8A 5KXJA 5IPYA 2ZZ0A 4C77A 3CTYA 1NHSA 3CGCA 2QAEA 1ZP0A 4H4VA 3S5WA 3GSIA 4J56A 3VQRA 3AE2A 1ONFA 1QJDA 1E1KA 3UKPA 1NG3A 3UP5A 4K5RA 2A8XA 4LU6A 2ARDA 3BNMA 2R9ZA 3CPIG 1O5WA 4P9SA 3L8KA 2NPXA 1DOEA 2XCGA 3SZWA 1RP0A 2JB2A 4KX6A 1E6EA 3ALJA 3VRAA 4CNKA 2C73A 2C7GA 4AP3A 1SEZA 2XLRA 3T2KA 2XVJA 3HYXA 2ZZCA 3CNTA 3PS9A 2R45A 4NEVA 1X31B 3QSEA 1D4DA 1GSNA 1M64A 3DGZA 2EQ8A 4H4UA 2XDOA 2BCGG 3BI2A 1K4QA 4CNJA 4TM4A 4FK1C 1TYTA 3CNSA 3NG7X 2GVCA 2BK5A 3V76A 4U8IA 3GMBA 2AR8A 2E1MA 2X50A 3FIMB 2YG7A 3KPFA 3P4QA 3QVRA 1F8WA 1B37A 1NHRA 1DOCA 1VRQB 4IVMB 5LV9A 5KWFA 4N9XA 1LJ1A 3GWFA 1GETA 2XFUA 4EQRA 2WS3A 1XHCA 3EF6A 2R4EA 4YSYA 4YKGA 3EANA 4H2RA 4A5LA 3UTGA 1JRXA 2C75A 2XVIA 1YQ3A 4GAVA 4BURA 3NTDA 3QSSA 3FBSA 5KMPA 3GRSA 3NGCX 2YLRA 1E1LA 1NDAA 1CJ2A 2F5ZA 2XLUA 3NRNA 3SY4A 1VG0A 1GALA 2C65A 2YVJA 1D7YA 2YG5A 2BS2A 2VQ7A 3LB8A 3UKQA 3DJEA 1MOKA 1H2IA 2YM2A 3GD4A 2XLTA 4NTCA 1OJAA 2WEUA 4TM1A 1GRTA 4U8KA 1YQZA 2GRTA 4X9MA 1L9CA 1PBBA 5EB5A 4J33A 4B69A 2VZ2A 4YT0A 3Q6JA 1H82A 2Q6UA 2V60A 2FJDA 1ZKQA 2YQUA 2FBWA 2X8HA 5U1OA 3AEAA 3CPHG 2EQ7A 1Q9IA 4J34A 3KPKA 1RYIA 1IJHA 3PG6A 1TDFA 1NHQA 1GPEA 4NWZA 4OCGA 4AOSA 5KRQA 2DKHA 1D5TA 4H50A 5CKUA 4DSHA 2OALA 4DNAA 2NVKX 3ISHA 3UTEA 5KMRA 3K7QX 4C5OA 4U8OA 4BV6A 4II3A 1GRFA 5HXIA 1F6MA 1FL2A 4UDQA 5JCIA 2YLWA 1FOHA 5FS6A 1PBCA 2WESA 3VRBA 4JN9A 4J57A 3SQPA 5C3JA 1PJ5A 3AD8B 1VDCA 3AE9A 3SZ0A 3ALMA 2BRYA 2BK4A 1ZOVA 5L46A 1GV4A 3AEEA 4A6NB 2A89A 4Y4NA 3PVCA 4C74A 4IA5A 2O9ZA 3QVPA 4IVOB 3DJGX 2WHDA 2UZZA 1OJCA 2BCPA 2GH5A 1YY5A 2GR2A 2WU5A 4Y4LA 4B67A 3B3RA 3UOYA 5TR3A 4M52A 1NPXA 1VQWA 1P2HA 3CGEA 3WE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C96 A;  1DJQ A;  2JK6 A;  3BNU A;  4TLZ A;  4USR A;  2Q0L A;  1ZY8 A;  1CBO A;  2FJB A;  4CBQ A;  2XLP A;  2OLO A;  3DH9 A;  1KFY A;  1GER A;  1PDH A;  2V3A A;  1VG9 A;  1K0L A;  3UKK A;  3AEF A;  1IUT A;  2XFN A;  4ZCD A;  5J7X A;  1IUU A;  1GRB A;  3KD9 A;  3VR8 A;  5KVH A;  3LJP A;  1MXT A;  3NK1 X;  4I59 A;  1TYP A;  4ADW A;  4EQW A;  1PBF A;  3ZDN A;  2RAB A;  1CL0 A;  2YR4 A;  4JDR A;  1F8R A;  4ZN0 A;  2GR1 A;  3LAD A;  4J31 A;  1ZK7 A;  1JEH A;  3NKS A;  3UKF A;  1GEU A;  3AXB A;  3GDP A;  3GD3 A;  1S2Y A;  3SGL A;  1GND A;  1K0I A;  1H6V A;  2XFP A;  4FK1 A;  2FJA A;  4TM3 A;  4H4S A;  3NLC A;  3P4S A;  4NTE A;  4O5Q A;  3AB1 A;  3NH3 X;  3NHO X;  1JRZ A;  5EBK A;  2VRL A;  3IF9 A;  3D8X A;  2B9X A;  4OPI A;  4XWZ A;  1H7W A;  2A87 A;  4OPT A;  4Z25 A;  3NT6 A;  2E5V A;  1O94 A;  3UCL A;  3P1W A;  3COX A;  4U8J A;  2HQM A;  2WOI A;  5JCK A;  3ATR A;  3EPT A;  3UTH A;  4AP1 A;  3V3N A;  1PN0 A;  1JOA A;  2GB0 A;  2IID A;  1E1N A;  2CUL A;  3FMW A;  1BF3 A;  3EAO A;  1TDN A;  2C67 A;  3AE1 A;  3JSK A;  4Z24 A;  3SFD A;  3SFE A;  2J3N A;  2B9Y A;  2GAH B;  3NK0 X;  4K7Z A;  1DOB A;  4YSX A;  4ZCC A;  2WPC A;  3AEC A;  4YTN A;  1CC4 A;  2AAQ A;  1TRB A;  5HYM A;  1GES A;  3AE6 A;  3AE7 A;  3B6D A;  4K22 A;  5KOW A;  4FDC B;  3G5Q A;  3VRD B;  1QO8 A;  2V6O A;  1IUX A;  4GDP A;  4H4X A;  4AOX A;  4TLX A;  2YG4 A;  1DJN A;  4H4Z A;  4PAA A;  2GR3 A;  4B64 A;  3RP7 A;  3RP6 A;  3ABV A;  3AD9 B;  1PXB A;  3UKL A;  3RED A;  1CJ4 A;  4B68 A;  2ZZB A;  4JNA A;  4YTP A;  3CNP A;  1CF3 A;  1PBE A;  1LQT A;  1MO9 A;  5FS9 A;  2YR6 A;  3KKJ A;  3QJ4 A;  1BZL A;  2WOW A;  1JNZ A;  5FS8 A;  2VVL G;  3AYI A;  3ATQ A;  2GEW A;  4NTD A;  4CCR A;  3DK4 A;  3DME A;  2IVD A;  5EB4 A;  3Q9T A;  1E7P A;  1REO A;  1LTX R;  3PO7 A;  4HA6 A;  1Y0P A;  4H4Q A;  3ICR A;  3KVE A;  1GXF A;  3P9U A;  5EOW A;  2WP9 A;  1AOG A;  3F8P A;  4MJW A;  3UKA A;  1PXA A;  2WU2 A;  2V61 A;  1E1M A;  1ELI A;  3AYL A;  1OJ9 A;  2BK3 A;  1GTH A;  3BHK A;  1Y56 B;  1D7L A;  1COY A;  2XVF A;  3ADA B;  3UTF A;  1Y56 A;  2OLN A;  3E1T A;  4CCQ A;  3K7T A;  2PHH A;  4OVI A;  1D4E A;  3P4P A;  2VVL A;  2C72 A;  4UP3 A;  3NN6 X;  4U2T A;  1KSU A;  5JCL A;  1BKW A;  4USQ A;  3C4N A;  4H2P A;  1CC2 A;  4BJZ A;  1EL8 A;  3KLJ A;  4RG3 A;  1JRY A;  5JCM A;  1GTE A;  2H89 A;  2C3D A;  4YSH A;  3NNE A;  3FPZ A;  4A6N A;  4H4T A;  4U8L A;  1LV0 A;  3GDN A;  3GRT A;  3G5R A;  3D1C A;  2Z5Y A;  3DGH A;  2WET A;  2Z5X A;  4AT2 A;  2TMD A;  1H84 A;  2Y6Q A;  2WPF A;  4TM0 A;  1PJ6 A;  3ICS A;  1TDK A;  2R4J A;  1LPF A;  3CND A;  1H83 A;  4BJY A;  2WDR A;  1GRH A;  4A7A A;  4DSG A;  2GMH A;  4AT0 A;  3AED A;  1LVL A;  2B7R A;  5U63 A;  2GQW A;  3K7M X;  3ZYX A;  4GUV A;  3CNJ A;  1CHU A;  3LXD A;  1YQ4 A;  4EMW A;  2BAC A;  3RNM A;  4IA6 A;  1GRE A;  2DKI A;  5FS7 A;  5IQ1 A;  1ZOY A;  3L1R A;  1Q1R A;  2YLS A;  3M13 A;  4H2N A;  3V3O A;  1N4U A;  2YWL A;  4PAB A;  4EQX A;  4JNQ A;  3LOV A;  1ZMC A;  2V5Z A;  1N4V A;  4CRT A;  3ALL A;  4H2Q A;  4RSL A;  4D04 A;  2JB3 A;  4LA1 A;  2OA1 A;  4X9N A;  1CJC A;  3AYJ A;  3S61 A;  4J36 A;  1KNR A;  1DNC A;  3AE8 A;  5KVI A;  4A9W A;  3FG2 P;  2WPE A;  3QSM A;  3GYI A;  4YTM A;  1F8S A;  5M10 A;  2XFQ A;  2CFY A;  4IV9 A;  3BI5 A;  4K2X A;  4YXD A;  1H81 A;  2VQB A;  3AEB A;  4BK3 A;  2C66 A;  2YVG A;  1K0J A;  1P2E A;  2WQY A;  1B5Q A;  2GF3 A;  2XVE A;  2GV8 A;  3IHG A;  3NK2 X;  1XPQ A;  3AD7 B;  4CY8 A;  2YVF A;  4J2W A;  4I58 A;  1H86 A;  2V3B A;  4EM4 A;  2X8G A;  1EL5 A;  1KSS A;  1S3E A;  4GR1 A;  4YSZ A;  2C3C A;  1S3B A;  4OPD A;  5KOX A;  3K30 A;  1GOS A;  3ITJ A;  3H4K A;  1IUS A;  2QA2 A;  4B66 A;  4D03 A;  4ECH A;  1IUV A;  4HB9 A;  1NAA A;  3H8I A;  1BGN A;  2Q0K A;  4NEW A;  2FJE A;  4Z2R A;  1JNR A;  1NEN A;  2BXS A;  3NIX A;  4BK2 A;  4BK1 A;  3GMC A;  2BC1 A;  1FEC A;  5BRT A;  5BVA A;  4H7U A;  3QFA A;  2JKC A;  2XFO A;  2QA1 A;  3NYE A;  5M0Z A;  3F8D A;  2EQ6 A;  3P4R A;  3RP8 A;  1RSG A;  5U25 A;  3BI4 A;  3O0H A;  5CQF A;  4EMI A;  4XWR A;  1EL9 A;  4FX9 A;  1EBD A;  2YG3 A;  4WX1 A;  2BC0 A;  2X8C A;  3DA1 A;  1TDO A;  1YKJ A;  4GCM A;  4OPL A;  2YAU A;  4CY6 A;  2BS3 A;  1M6I A;  3AE5 A;  2GAG B;  2E4G A;  3QFB A;  4U8M A;  4K8D A;  4OPG A;  3LZX A;  5C2T A;  5BUL A;  3URH A;  1CJ3 A;  1PBD A;  3GWD A;  5J60 A;  4YWO A;  1L9D A;  1D4C A;  2R0G A;  3I3L A;  1L0V A;  3NN0 X;  3ICT A;  3G5S A;  3II4 A;  2C70 A;  2XLS A;  5HY5 A;  2I0Z A;  3DJJ A;  1XAN A;  2B7S A;  3T37 A;  5ER0 A;  1DXL A;  2JBV A;  2GMJ A;  3UOV A;  2X99 A;  1ZDL A;  2BXR A;  4EIP A;  3CN8 A;  1PXC A;  1BGJ A;  4UDP A;  5BUK A;  2XVH A;  1TDE A;  3AE3 A;  3BHF A;  1BWC A;  3NYF A;  2XYO A;  4X4J A;  5FMH A;  4H4Y A;  2BAB A;  2WP6 A;  1V59 A;  4WCT A;  3OZ2 A;  2H88 A;  5HHF A;  4JY3 A;  2W0H A;  1L9E A;  3M0O A;  4H4W A;  2RGJ A;  4Z2T A;  4JY2 A;  3GYJ A;  1OJT A;  4K5S A;  4EM3 A;  1NEK A;  2YLZ A;  1Q1W A;  3CGB A;  1PHH A;  2BYB A;  2BS4 A;  3CIR A;  2C76 A;  5IQ4 A;  4U2L A;  1ZX9 A;  2C64 A;  2Q7V A;  3UP4 A;  1FEA A;  4A79 A;  3M12 A;  1QLB A;  2JB1 A;  2VRM A;  2YR5 A;  3IC9 A;  1S2Q A;  2RGH A;  4U2S A;  4UDR A;  2IVE A;  2VOU A;  2APG A;  2B76 A;  5GSN A;  3VR9 A;  3NYC A;  4EQS A;  4YKF A;  3OC4 A;  1FEB A;  4EMJ A;  2PYX A;  1KDG A;  1N4W A;  2AQJ A;  3LZW A;  1XDI A;  2WBA A;  2X3N A;  2EQ9 A;  1GRG A;  2ZBW A;  4OPU A;  4DGK A;  4C3X A;  4GDE A;  3C4A A;  5GRT A;  4Y4M A;  3KA7 A;  2B9W A;  2CDU A;  4JQ9 A;  1NHP A;  2JAE A;  4U8N A;  1B4V A;  4Z44 A;  4B65 A;  3R9U A;  1PS9 A;  1GRA A;  3DK9 A;  3SM8 A;  2OAM A;  4U8P A;  2QCU A;  3AWI A;  1OJD A;  4GRT A;  4B63 A;  1N1P A;  1NG4 A;  4E0V A;  1O95 A;  4APN A;  2ACZ A;  3UOX A;  2TPR A;  1Z6L A;  4Z43 A;  3DK8 A;  3IWA A;  3RHA A;  2YM1 A;  4GF7 A;  1UKV G;  4A65 A;  3CPJ G;  2CVJ A;  3NTA A;  4OPC A;  3CGD A;  2YLX A;  3UOZ A;  1E39 A;  2GQF A;  4EIQ A;  2GR0 A;  1JU2 A;  4LII A;  4RG4 A;  4B1B A;  1F3P A;  4H4R A;  2YG6 A;  3F8R A;  1KF6 A;  2R46 A;  3IHM A;  2BA9 A;  1H7X A;  2WP5 A;  2WDV A;  3UKH A;  4NZH A;  1EL7 A;  2R0C A;  5JCN A;  4ICY A;  4C3Y A;  2Y6R A;  1PJ7 A;  1B8S A;  3AE4 A;  4A99 A;  1W4X A;  2WDQ A;  1ZMD A;  1DOD A;  4H4P A;  4XXG A;  4Z26 A;  3DJD A;  3HZL A;  1CC6 A;  2YLT A;  1KNP A;  4O5U A;  2WOV A;  3KU9 A;  1LQU A;  3AEG A;  3H8L A;  2RGO A;  1FCD A;  5DBJ A;  1IUW A;  4REK A;  3I6D A;  4Z2U A;  2R0P A;  2VVM A;  4KPR A;  1HYU A;  1GT8 A;  5KXJ A;  5IPY A;  2ZZ0 A;  4C77 A;  3CTY A;  1NHS A;  3CGC A;  2QAE A;  1ZP0 A;  4H4V A;  3S5W A;  3GSI A;  4J56 A;  3VQR A;  3AE2 A;  1ONF A;  1QJD A;  1E1K A;  3UKP A;  1NG3 A;  3UP5 A;  4K5R A;  2A8X A;  4LU6 A;  2ARD A;  3BNM A;  2R9Z A;  3CPI G;  1O5W A;  4P9S A;  3L8K A;  2NPX A;  1DOE A;  2XCG A;  1RP0 A;  2JB2 A;  4KX6 A;  1E6E A;  3ALJ A;  3VRA A;  4CNK A;  2C73 A;  2C7G A;  4AP3 A;  1SEZ A;  2XLR A;  2XVJ A;  2ZZC A;  3CNT A;  3PS9 A;  2R45 A;  4NEV A;  1X31 B;  3QSE A;  1D4D A;  1GSN A;  1M64 A;  3DGZ A;  2EQ8 A;  4H4U A;  2XDO A;  2BCG G;  3BI2 A;  1K4Q A;  4CNJ A;  4TM4 A;  4FK1 C;  1TYT A;  3CNS A;  3NG7 X;  2GVC A;  2BK5 A;  3V76 A;  4U8I A;  3GMB A;  2AR8 A;  2E1M A;  2X50 A;  3FIM B;  2YG7 A;  3KPF A;  3P4Q A;  3QVR A;  1F8W A;  1B37 A;  1NHR A;  1DOC A;  1VRQ B;  4IVM B;  5LV9 A;  5KWF A;  4N9X A;  1LJ1 A;  3GWF A;  1GET A;  2XFU A;  4EQR A;  2WS3 A;  1XHC A;  3EF6 A;  2R4E A;  4YSY A;  4YKG A;  3EAN A;  4H2R A;  4A5L A;  3UTG A;  1JRX A;  2C75 A;  2XVI A;  1YQ3 A;  4BUR A;  3NTD A;  3QSS A;  3FBS A;  3GRS A;  3NGC X;  2YLR A;  1E1L A;  1NDA A;  1CJ2 A;  2F5Z A;  2XLU A;  3NRN A;  1VG0 A;  1GAL A;  2C65 A;  2YVJ A;  1D7Y A;  2YG5 A;  2BS2 A;  2VQ7 A;  3LB8 A;  3UKQ A;  3DJE A;  1MOK A;  2YM2 A;  3GD4 A;  2XLT A;  4NTC A;  1OJA A;  2WEU A;  4TM1 A;  1GRT A;  4U8K A;  1YQZ A;  2GRT A;  4X9M A;  1L9C A;  1PBB A;  5EB5 A;  4J33 A;  4B69 A;  2VZ2 A;  4YT0 A;  3Q6J A;  1H82 A;  2Q6U A;  2V60 A;  2FJD A;  1ZKQ A;  2YQU A;  2FBW A;  2X8H A;  5U1O A;  3AEA A;  3CPH G;  2EQ7 A;  1Q9I A;  4J34 A;  1RYI A;  1IJH A;  1TDF A;  5KRQ A;  1NHQ A;  1GPE A;  4OCG A;  4AOS A;  2DKH A;  1D5T A;  4H50 A;  5CKU A;  4DSH A;  2OAL A;  4DNA A;  2NVK X;  3ISH A;  3UTE A;  3K7Q X;  4C5O A;  4U8O A;  4BV6 A;  1GRF A;  5HXI A;  1F6M A;  1FL2 A;  4UDQ A;  5JCI A;  2YLW A;  1FOH A;  5FS6 A;  1PBC A;  2WES A;  3VRB A;  4JN9 A;  4J57 A;  3SQP A;  5C3J A;  1PJ5 A;  3AD8 B;  1VDC A;  3AE9 A;  3ALM A;  2BK4 A;  1ZOV A;  5L46 A;  1GV4 A;  3AEE A;  4A6N B;  2A89 A;  4Y4N A;  3PVC A;  4C74 A;  4IA5 A;  2O9Z A;  3QVP A;  4IVO B;  3DJG X;  2WHD A;  2UZZ A;  1OJC A;  2BCP A;  2GH5 A;  1YY5 A;  2GR2 A;  2WU5 A;  4Y4L A;  4B67 A;  3B3R A;  3UOY A;  5TR3 A;  4M52 A;  1NPX A;  1VQW A;  1P2H A;  3CGE A;  3WE0 A; 
#chains in the Genus database with same CATH topology
 4USR A;  3FVD A;  1CBO A;  2XLP A;  2OLO A;  3D47 A;  1VG9 A;  3TQP A;  3UKK A;  2XFN A;  3KD9 A;  3LJP A;  1MXT A;  3NK1 X;  1CL0 A;  2GR1 A;  5FJO A;  1S2Y A;  1GND A;  1K0I A;  4FK1 A;  3ZLH A;  4NTE A;  3R1Z A;  5EBK A;  2B9X A;  1H7W A;  2A87 A;  3OZY A;  3NT6 A;  3D46 A;  2WOI A;  1FIQ B;  3ATR A;  3EPT A;  5KMQ A;  2IID A;  1BF3 A;  1TDN A;  2B9Y A;  4K7Z A;  3AEC A;  4YTN A;  4GIS A;  1CC4 A;  3B6D A;  3AE7 A;  3CB3 A;  2CHR A;  1IUX A;  2OZT A;  4IL2 A;  2YG4 A;  2GR3 A;  3ZLF A;  3THU A;  3RED A;  3OZM A;  1PBE A;  3KKJ A;  3QJ4 A;  1BZL A;  2WOW A;  3SJN A;  4II2 A;  2QDD A;  4NTD A;  3DME A;  2OPJ A;  5EB4 A;  1LTX R;  3FXG A;  2WP9 A;  1X2G A;  3F8P A;  1PXA A;  2WU2 A;  2V61 A;  2OFJ A;  1OJ9 A;  2HXU A;  3BHK A;  1Y56 B;  1D7L A;  1TZZ A;  2XVF A;  3ADA B;  4GGB A;  3UTF A;  3E1T A;  2E5A A;  1SJD A;  4DXK A;  3RIT A;  1D4E A;  4UP3 A;  3MSY A;  1KSU A;  1CC2 A;  4BJZ A;  2C4C A;  3KLJ A;  4RG3 A;  4YSH A;  4K1W A;  2GGG A;  4A6N A;  4H4T A;  4U8L A;  3GRT A;  3G5R A;  3T31 A;  3GO2 A;  4TVY A;  2W54 A;  3SX6 A;  1GRH A;  3AED A;  3HW2 A;  4GUV A;  4GYP A;  3RNM A;  2FKP A;  3M13 A;  4EQX A;  4CRT A;  2PP0 A;  4LA1 A;  2OA1 A;  3S61 A;  4A9W A;  2ZAD A;  2QJM A;  4IV9 A;  4YXD A;  2VQB A;  3AEB A;  2YVG A;  1B5Q A;  3ZVH B;  1XPQ A;  2V3B A;  4YSZ A;  5JRB A;  1S3B A;  4GGH A;  4KPL A;  3ITJ A;  4H2H A;  1IUV A;  1NAA A;  1BGN A;  1JNR A;  1NEN A;  2BXS A;  3GMC A;  1FEC A;  3SN1 A;  3NYE A;  2QA1 A;  1N61 C;  3CMM A;  1DTN A;  3DA1 A;  1PDY A;  4HYR A;  2W3S A;  2YAU A;  3V4B A;  4K8D A;  3URH A;  4YWO A;  1L9D A;  1D4C A;  3II4 A;  3DJJ A;  1XAN A;  5ER0 A;  2JBV A;  2GMJ A;  1KCZ A;  2XVH A;  3P93 A;  3BHF A;  2XYO A;  4H4Y A;  2BAB A;  2H88 A;  5HHF A;  3M0O A;  4H4W A;  4Z2T A;  3GYJ A;  3OPS A;  3ENL A;  3N4F A;  4EM3 A;  1PHH A;  3CIR A;  2BYB A;  4U2L A;  2C64 A;  3UP4 A;  2YR5 A;  3IC9 A;  4HNL A;  3DGB A;  3ES8 A;  2RDX A;  2APG A;  2B76 A;  2P88 A;  3VR9 A;  4HCL A;  2WBA A;  4MKS A;  1GRG A;  4HN8 A;  4DGK A;  2B9W A;  2JAE A;  1B4V A;  2PP1 A;  3DK9 A;  5FJT A;  4E4F A;  3AWI A;  1N1P A;  2PS2 A;  4ROP A;  1EC8 A;  3IWA A;  1UKV G;  2CVJ A;  4OPC A;  2MUC A;  1F3P A;  2WP5 A;  4C3Y A;  3AE4 A;  3H12 A;  3ZLG A;  2WDQ A;  1ZMD A;  2O56 A;  4H4P A;  1ZXI C;  3TJ4 A;  2YLT A;  2WOV A;  3H8L A;  2RGO A;  3IJI A;  3I6D A;  4M0X A;  1GT8 A;  3CTY A;  3CGC A;  3S5W A;  4H4V A;  5FJU A;  3DES A;  3AE2 A;  3UP5 A;  2A8X A;  2ARD A;  1O5W A;  2XH0 A;  2NPX A;  1DOE A;  2JB2 A;  3PS9 A;  2R45 A;  1D4D A;  4JHM A;  3AMZ A;  2XDO A;  2BCG G;  3CNS A;  2GVC A;  1NU5 A;  2E1M A;  3SFD A;  4N9X A;  1LJ1 A;  1GET A;  3ZVI A;  4A5L A;  2XVI A;  3NTD A;  3GRS A;  3U4F A;  3NGC X;  2YLR A;  3V5C A;  1CJ2 A;  3B9J B;  4ZA0 A;  2C65 A;  1D7Y A;  2YG5 A;  2BS2 A;  3LB8 A;  3DJE A;  1RM6 B;  1MOK A;  1STZ A;  4TM1 A;  1GRT A;  1N63 C;  4J33 A;  4B69 A;  3Q6J A;  3DG7 A;  2EQ7 A;  1Q9I A;  4J34 A;  1RYI A;  1TDF A;  5KRQ A;  3FJ4 A;  4Z17 A;  4H50 A;  2OAL A;  4DNA A;  4HPN A;  5KMR A;  4C5O A;  3JW7 A;  2HNE A;  5BOF A;  4J57 A;  3SQP A;  5C3J A;  3AD8 B;  3ALM A;  2XSX A;  2BK4 A;  2BRY A;  1ZOV A;  3BOX A;  3AEE A;  2OX4 A;  4IA5 A;  3B97 A;  3DG6 A;  3UOY A;  5TR3 A;  3BNU A;  2JK6 A;  2W3R A;  1EC7 A;  2PTZ A;  2FJB A;  3V3W A;  4CBQ A;  2GGH A;  3NZG A;  1KFY A;  2AL2 A;  3H70 A;  1GRB A;  4H1Z A;  3VR8 A;  1TYP A;  3BJS A;  4ADW A;  4EQW A;  4HCH A;  3TOY A;  2QVH A;  4JDR A;  3LAD A;  2HXT A;  3AXB A;  3GDP A;  3GD3 A;  4MGG A;  3NLC A;  3P4S A;  2VRL A;  3IF9 A;  4XWZ A;  3VFC A;  2E5V A;  1O94 A;  3UCL A;  3COX A;  2HQM A;  5JCK A;  4AP1 A;  1MDL A;  2GB0 A;  1E1N A;  2CUL A;  3AE1 A;  1DOB A;  1FFV C;  2PMQ A;  4GIR A;  5HYM A;  1GES A;  4K22 A;  1QO8 A;  3CYJ A;  5ENL A;  4AOX A;  4TLX A;  3VDG A;  4DWD A;  4KEM A;  1WUF A;  1JRO A;  3UCD A;  3ABV A;  3SN4 A;  3UKL A;  4B68 A;  2DW7 A;  2ZZB A;  3CNP A;  2MNR A;  1LQT A;  3T2Y A;  3ATQ A;  2IVD A;  4G6G A;  3PO7 A;  1Y0P A;  4H4Q A;  1MRA A;  1TE6 A;  1AOG A;  4MJW A;  1ELI A;  2XH2 A;  4CCQ A;  1JPM A;  3K7T A;  4OVI A;  3UXL A;  3NN6 X;  5JCL A;  4H2P A;  2C3D A;  3PWG A;  2Z5Y A;  3DGH A;  4AT2 A;  1H84 A;  2Y6Q A;  4TM0 A;  3ICS A;  3QTP A;  1TDK A;  3K1G A;  4BJY A;  3SYI A;  2B7R A;  2GQW A;  3ZYX A;  2BAC A;  4EMW A;  1GRE A;  4J3Z A;  1MDR A;  4Z1Y A;  1Q1R A;  2YLS A;  4H2N A;  3V3O A;  4JNQ A;  1BQG A;  3LOV A;  1N4V A;  4H2Q A;  2JB3 A;  3FV9 A;  3AYJ A;  1KNR A;  1DNC A;  2I5Q A;  5KVI A;  3FG2 P;  2WPE A;  2C66 A;  4FI4 A;  1EC9 A;  1K0J A;  4F4R A;  2XVE A;  4DN1 A;  3IHG A;  3AD7 B;  2YVF A;  4ZOH B;  1H86 A;  4EM4 A;  1S3E A;  2POZ A;  3RGT A;  4M6U A;  3I6E A;  2OZ3 A;  1IUS A;  4ECH A;  4NNJ A;  2Q0K A;  1WUE A;  3AN1 A;  3NIX A;  2POD A;  2BC1 A;  3R11 A;  4H7U A;  2XFO A;  5M0Z A;  3RP8 A;  5U25 A;  3BI4 A;  5CQF A;  4EMI A;  4FX9 A;  1EBD A;  2BC0 A;  2X8C A;  4OPL A;  1M6I A;  1N5X A;  2GAG B;  3GD6 A;  4U8M A;  5BUL A;  1CJ3 A;  3GWD A;  2R0G A;  3I3L A;  4E6M A;  3ICT A;  3G5S A;  2C70 A;  2I0Z A;  1DXL A;  4EIP A;  3CN8 A;  1BGJ A;  3EUB 3;  1BWC A;  3EKG A;  1V59 A;  4WCT A;  2AKZ A;  4K5S A;  1OJT A;  3CGB A;  1JDF A;  3MQT A;  2BS4 A;  5IQ4 A;  2C76 A;  1FEA A;  3M12 A;  2VRM A;  3NVY B;  5GSN A;  4EQS A;  3OC4 A;  1N4W A;  1XDI A;  3N6J A;  4OPU A;  4J1O A;  3C4A A;  4Y4M A;  3KA7 A;  1NHP A;  3ETR B;  4Z44 A;  3R0U A;  2OAM A;  1EBG A;  2QCU A;  2QDE A;  2ACZ A;  1Z6L A;  4Z43 A;  3DK8 A;  2YM1 A;  4GF7 A;  1KKR A;  1E39 A;  1KD0 A;  4EIQ A;  1JU2 A;  4LII A;  4B1B A;  1R0M A;  4H4R A;  3F8R A;  1KF6 A;  3I4K A;  2BA9 A;  2R0C A;  1SJA A;  3NXL A;  1PJ7 A;  7ENL A;  1CC6 A;  4O5U A;  3T6C A;  1LQU A;  2ONE A;  3FYY A;  3CAW A;  1IUW A;  4REK A;  3UJE A;  2R0P A;  2VVM A;  4KPR A;  2QAE A;  1IYX A;  4J56 A;  5IDZ A;  3VQR A;  1ONF A;  3DFH A;  3UKP A;  1NG3 A;  2E3T A;  3L8K A;  2XCG A;  3VRA A;  4AP3 A;  4K2S A;  3CNT A;  3QSE A;  3NRZ B;  4TM4 A;  4FK1 C;  3SSZ A;  2GSH A;  3SBF A;  2X50 A;  3QVR A;  3KPF A;  1NHR A;  4YKG A;  1W6T A;  2C75 A;  1YQ3 A;  2PSN A;  4DHG A;  3FBS A;  5KMP A;  1NDA A;  3SY4 A;  1VG0 A;  2P0I A;  3DFY A;  3CT2 A;  3MKC A;  4HCD A;  2YM2 A;  3GD4 A;  1PDZ A;  1KKO A;  3UJF A;  1YQZ A;  4YT0 A;  1L9C A;  5EB5 A;  1ZKQ A;  3CPH G;  3KPK A;  3PG6 A;  2DKH A;  1D5T A;  5CKU A;  1F9C A;  4II3 A;  1GRF A;  4IHC A;  5JCI A;  3BSM A;  1YEY A;  3AE9 A;  4Y4N A;  5G5G B;  2WHD A;  2BCP A;  2GR2 A;  4B67 A;  1XS2 A;  4M52 A;  1X31 B;  2WP6 A;  4TLZ A;  1JRP A;  2FYM A;  2PTY A;  3HYW A;  1KN0 A;  2P8B A;  3DH9 A;  1GER A;  4ZCW A;  2AL2 B;  1PDH A;  2V3A A;  1K0L A;  5J7X A;  1IUT A;  4ZCD A;  4G73 A;  3T14 A;  3VA8 A;  3ZDN A;  4ENL A;  2YR4 A;  1F8R A;  4ZN0 A;  4J31 A;  1T3Q C;  1ZK7 A;  1JEH A;  3UKF A;  1GEU A;  2P3Z A;  2XFP A;  4GYP C;  3NH3 X;  3A7U A;  2PTW A;  4OPT A;  2AL1 A;  4U8J A;  1WYG A;  3DEQ A;  1PN0 A;  1JOA A;  3SFE A;  2HZG A;  3HRD C;  4ZCC A;  2WPC A;  1TRB A;  3CXB A;  4DX3 A;  5KOW A;  3VRD B;  4JN7 A;  4KT2 A;  1DJN A;  4H4Z A;  5BOE A;  2XH7 A;  4B64 A;  3RP6 A;  4JNA A;  4YTP A;  2AKM A;  1MO9 A;  5FS9 A;  5FS8 A;  3AYI A;  4CCR A;  3DK4 A;  2OO6 A;  4DYE A;  1E7P A;  3TTE A;  1JPD X;  3KVE A;  1GXF A;  3P9U A;  5EOW A;  3UKA A;  4EWJ A;  3AYL A;  2BK3 A;  1SJC A;  1S7M A;  1MUC A;  3UJS A;  3VC5 A;  3P4P A;  2NQL A;  6ENL A;  3H8A A;  2VVL A;  1BKW A;  3C4N A;  1EL8 A;  3MWC A;  5JCM A;  1GTE A;  2H89 A;  3JVA A;  3EEZ A;  3NNE A;  3D1C A;  2WET A;  2TMD A;  2WPF A;  4G6H A;  2W55 A;  1MNS A;  1H83 A;  4A7A A;  2GMH A;  3K7M X;  3CNJ A;  1CHU A;  1YQ4 A;  4IA6 A;  5IQ1 A;  3L1R A;  2YWL A;  4IT1 A;  1FHV A;  2V5Z A;  3ALL A;  4X9N A;  1CJC A;  4J36 A;  3QSM A;  5M10 A;  1F8S A;  2XFQ A;  2CFY A;  3BI5 A;  4K2X A;  4G74 A;  3A7A A;  2GF3 A;  2GV8 A;  4I58 A;  3Q4D A;  2BRA A;  3SZC A;  5KOX A;  3NFU A;  3K30 A;  4B66 A;  2QA2 A;  1FHU A;  3H8I A;  3H7V A;  3PFR A;  3P0W A;  4NEW A;  4Z2R A;  3NVW B;  3F8D A;  1RSG A;  4A6G A;  4XWR A;  1ECQ A;  2YG3 A;  2GL5 A;  3R25 A;  4GCM A;  3NS1 B;  2E4G A;  3QFB A;  5C2T A;  4GME A;  5J60 A;  1L0V A;  4IZG A;  5HY5 A;  2XLS A;  3SZF A;  3A7R A;  2B7S A;  1EBH A;  3UOV A;  2BXR A;  1V97 A;  3VCC A;  3GC2 A;  3T9P A;  3OZ2 A;  2PU1 A;  1L9E A;  1NEL A;  2YLZ A;  1ZX9 A;  1TKK A;  4A79 A;  2JB1 A;  3QLD A;  3T2Z A;  1S2Q A;  2RGH A;  5J04 A;  2PA6 A;  2IVE A;  2VOU A;  3NYC A;  3MZN A;  4EMJ A;  1FEB A;  2PYX A;  3LZW A;  2EQ9 A;  2ZBW A;  2GGE A;  2QJN A;  3TCS A;  2CDU A;  4JQ9 A;  4B65 A;  2GGJ A;  3SM8 A;  1OJD A;  4GRT A;  4E0V A;  3UOX A;  3V5F A;  3DER A;  3TJI A;  4A65 A;  3MY9 A;  3NTA A;  3CGD A;  3UOZ A;  2GQF A;  4G8T A;  4RG4 A;  3T4W A;  3I6T A;  1H7X A;  2WDV A;  4NZH A;  1L8P A;  2Y6R A;  1B8S A;  4A99 A;  4XXG A;  3HZL A;  3TW9 A;  1KNP A;  3KU9 A;  3TWB A;  3PWI A;  5DBJ A;  3HYV A;  4H83 A;  4Z2U A;  1HYU A;  5IPY A;  4C77 A;  1ZP0 A;  3SN0 A;  1QJD A;  1E1K A;  4K5R A;  4LU6 A;  3BNM A;  3CPI G;  2R9Z A;  3UJ2 A;  3MUC A;  3SZW A;  3ALJ A;  2C73 A;  2C7G A;  3HYX A;  2ZZC A;  4HNC A;  1GSN A;  3BI2 A;  2EQ8 A;  4H4U A;  1K4Q A;  4CNJ A;  3DIP A;  2BK5 A;  3V76 A;  4U8I A;  2AR8 A;  3FIM B;  3P4Q A;  4IVM B;  3N4E A;  5KWF A;  2XFU A;  2WS3 A;  2R4E A;  4YSY A;  3EAN A;  3VCN A;  4GAV A;  4BUR A;  2PCE A;  2OKT A;  2XGZ A;  2F5Z A;  2XLU A;  3NRN A;  1GAL A;  3IJQ A;  1H2I A;  4NTC A;  2DW6 A;  4U8K A;  2GRT A;  2VZ2 A;  1H82 A;  1FFU C;  2Q6U A;  2V60 A;  3AEA A;  1GPE A;  4A3R A;  3FCP A;  4DSH A;  2NVK X;  3UTE A;  3N6H A;  4U8O A;  4BV6 A;  5HXI A;  1FL2 A;  5FS6 A;  1PBC A;  1RVK A;  4JN9 A;  1VDC A;  3SZ0 A;  4KWS A;  2A89 A;  4A35 A;  4C74 A;  4IVO B;  2GH5 A;  1YY5 A;  2WU5 A;  3B3R A;  1NPX A;  1VQW A;  3WE0 A;  3C96 A;  1DJQ A;  3IK4 A;  2Q0L A;  1ZY8 A;  3AEF A;  1IUU A;  5KVH A;  4I59 A;  1PBF A;  1ELS A;  3CK5 A;  2RAB A;  2OLA A;  3DDM A;  3GYX A;  3TWA A;  3NKS A;  4H19 A;  3T0K A;  3SGL A;  1H6V A;  3L5O A;  3OW1 A;  2FJA A;  4TM3 A;  4H4S A;  4O5Q A;  3AB1 A;  3NHO X;  1JRZ A;  4OPI A;  3D8X A;  4Z25 A;  3IJL A;  2QJJ A;  4GFI A;  3P1W A;  4MMW A;  3UTH A;  3V3N A;  3FMW A;  3EAO A;  5FJR A;  2C67 A;  3JSK A;  4Z24 A;  3SXI A;  2J3N A;  2GAH B;  3NK0 X;  4YSX A;  4IL0 A;  2AAQ A;  3AE6 A;  4FDC B;  3G5Q A;  2V6O A;  1VDV A;  2PTX A;  4GAP A;  3NO1 A;  4H4X A;  4GDP A;  4PAA A;  3RP7 A;  3AD9 B;  1PXB A;  1CJ4 A;  1CF3 A;  2GDQ A;  3RR1 A;  2YR6 A;  1JNZ A;  2OVL A;  2VVL G;  2GEW A;  3Q9T A;  1REO A;  4HA6 A;  2GGI A;  3D9X A;  3ICR A;  3GY1 A;  4IP4 A;  1E1M A;  1GTH A;  4FP1 A;  1COY A;  1Y56 A;  2OLN A;  3UGV A;  3Q45 A;  2XH4 A;  3UCC A;  2PHH A;  2C72 A;  1JCT A;  4U2T A;  3VC6 A;  4USQ A;  5KNL A;  1JRY A;  3FPZ A;  3RCY A;  1LV0 A;  5EU9 A;  3GDN A;  4G9K A;  1VQZ A;  2Z5X A;  1PJ6 A;  1N5W C;  3UXK A;  2R4J A;  1LPF A;  3CND A;  2WDR A;  4DSG A;  4AT0 A;  1LVL A;  5U63 A;  2PP3 A;  3LXD A;  2OZ8 A;  3QN3 A;  2DKI A;  5FS7 A;  1ZOY A;  1BKH A;  1SB3 B;  1N4U A;  4PAB A;  1ZMC A;  4RSL A;  4D04 A;  3S5S A;  2P8C A;  3AE8 A;  3GYI A;  4YTM A;  1H81 A;  4BK3 A;  1P2E A;  2WQY A;  1N60 C;  2PGE A;  3ZVH A;  3NK2 X;  4CY8 A;  4J2W A;  2X8G A;  1EL5 A;  1KSS A;  4GR1 A;  4JN8 A;  2C3C A;  4OPD A;  1GOS A;  4K8G A;  3H4K A;  4D03 A;  4HB9 A;  3SR6 B;  2FJE A;  4TVW A;  4BK2 A;  4BK1 A;  1N62 C;  5BRT A;  5BVA A;  3R0K A;  3QFA A;  2JKC A;  2EQ6 A;  3P4R A;  3JZU A;  3O0H A;  1EL9 A;  4WX1 A;  2PPG A;  3KUM A;  1TDO A;  1YKJ A;  4CY6 A;  2BS3 A;  3AE5 A;  4OPG A;  3LZX A;  3P3B A;  3SQS A;  1PBD A;  3HPF A;  3NN0 X;  5KMS A;  3T37 A;  3NVZ B;  2X99 A;  1ZDL A;  1PXC A;  4UDP A;  5BUK A;  2OQY A;  1TDE A;  3AE3 A;  3NYF A;  4X4J A;  5FMH A;  4JY3 A;  3U9I A;  2W0H A;  3PK7 A;  2RGJ A;  4E4U A;  4JY2 A;  1SJB A;  1NEK A;  1Q1W A;  1E9I A;  1OEP A;  2Q7V A;  2QQ6 A;  1QLB A;  4U2S A;  4UDR A;  3R10 A;  4E5T A;  4YKF A;  2OQH A;  1KDG A;  2AQJ A;  2X3N A;  4C3X A;  4GDE A;  5GRT A;  2PGW A;  4U8N A;  3R9U A;  1PS9 A;  1GRA A;  4U8P A;  3ES7 A;  3AM9 A;  4B63 A;  1NG4 A;  1O95 A;  2ZC8 A;  2QGY A;  4APN A;  2TPR A;  5G5H B;  3RHA A;  3CPJ G;  3S47 A;  2YLX A;  2GR0 A;  4G7F A;  1FO4 A;  2YG6 A;  3IHM A;  2R46 A;  3UKH A;  1EL7 A;  5JCN A;  4ICY A;  1W4X A;  1DOD A;  4Z26 A;  3DJD A;  3AEG A;  2PU0 A;  1FCD A;  3STP A;  5KXJ A;  2ZZ0 A;  3QPE A;  1NHS A;  5FJP A;  3GSI A;  4P9S A;  1X2H A;  1RP0 A;  4KX6 A;  1E6E A;  4CNK A;  3OP2 A;  1SEZ A;  2XLR A;  3CXO A;  2XVJ A;  3T2K A;  1R6W A;  4NEV A;  1M64 A;  3UJR A;  3DGZ A;  1TYT A;  3NG7 X;  3GMB A;  2YG7 A;  1F8W A;  1B37 A;  1DOC A;  1VRQ B;  5LV9 A;  3GWF A;  3RRA A;  4EQR A;  1XHC A;  3EF6 A;  4YWS A;  4H2R A;  3UTG A;  1JRX A;  3QSS A;  1E1L A;  1ONE A;  2OG9 A;  2YVJ A;  1P48 A;  2VQ7 A;  3UKQ A;  3RO6 A;  2XLT A;  1P43 A;  1OJA A;  2WEU A;  4X9M A;  1PBB A;  2FJD A;  2FBW A;  2YQU A;  2X8H A;  5U1O A;  1IJH A;  4NWZ A;  1NHQ A;  4AOS A;  4OCG A;  3QKE A;  4E8G A;  3T8Q A;  3ISH A;  4IP5 A;  3K7Q X;  1F6M A;  4UDQ A;  2YLW A;  4X2P A;  1FOH A;  1XPY A;  2WES A;  3VRB A;  1PJ5 A;  5L46 A;  3DG3 A;  1GV4 A;  4A6N B;  3PVC A;  2O9Z A;  3QVP A;  3OTR A;  3DJG X;  2UZZ A;  1OJC A;  3NVV B;  4Y4L A;  3R07 C;  1P2H A;  3CGE A; 
#chains in the Genus database with same CATH homology
 3C96 A;  1DJQ A;  2JK6 A;  3BNU A;  4TLZ A;  4USR A;  3HYW A;  2Q0L A;  1KN0 A;  1ZY8 A;  1CBO A;  2FJB A;  4CBQ A;  2XLP A;  2OLO A;  3DH9 A;  1KFY A;  1GER A;  1PDH A;  2V3A A;  1VG9 A;  1K0L A;  3UKK A;  3AEF A;  1IUT A;  2XFN A;  4ZCD A;  5J7X A;  1IUU A;  1GRB A;  4G73 A;  3T14 A;  3KD9 A;  3VR8 A;  5KVH A;  3LJP A;  1MXT A;  3NK1 X;  4I59 A;  1TYP A;  4ADW A;  4EQW A;  1PBF A;  3ZDN A;  2RAB A;  1CL0 A;  2YR4 A;  4JDR A;  1F8R A;  4ZN0 A;  2GR1 A;  3LAD A;  4J31 A;  1ZK7 A;  3GYX A;  1JEH A;  3NKS A;  3UKF A;  1GEU A;  3AXB A;  3GDP A;  3T0K A;  3GD3 A;  1S2Y A;  3SGL A;  1GND A;  1K0I A;  1H6V A;  2XFP A;  3L5O A;  4FK1 A;  2FJA A;  4TM3 A;  4H4S A;  3NLC A;  3P4S A;  4NTE A;  4O5Q A;  3AB1 A;  3NH3 X;  3NHO X;  1JRZ A;  5EBK A;  2VRL A;  3IF9 A;  3D8X A;  2B9X A;  4OPI A;  4XWZ A;  1H7W A;  2A87 A;  4OPT A;  4Z25 A;  3NT6 A;  2E5V A;  1O94 A;  3UCL A;  3P1W A;  3COX A;  4U8J A;  2HQM A;  2WOI A;  5JCK A;  3ATR A;  3EPT A;  3UTH A;  4AP1 A;  3V3N A;  1PN0 A;  1JOA A;  2GB0 A;  5KMQ A;  2IID A;  1E1N A;  2CUL A;  3FMW A;  1BF3 A;  3EAO A;  1TDN A;  2C67 A;  3AE1 A;  3JSK A;  4Z24 A;  3SFD A;  3SXI A;  3SFE A;  2J3N A;  2B9Y A;  2GAH B;  3NK0 X;  4K7Z A;  1DOB A;  4YSX A;  4ZCC A;  2WPC A;  3AEC A;  4YTN A;  1CC4 A;  2AAQ A;  1TRB A;  5HYM A;  1GES A;  3AE6 A;  3AE7 A;  3B6D A;  4K22 A;  5KOW A;  4FDC B;  3G5Q A;  3VRD B;  1QO8 A;  2V6O A;  1IUX A;  4GAP A;  4GDP A;  4H4X A;  4AOX A;  4TLX A;  2YG4 A;  1DJN A;  4H4Z A;  4PAA A;  2GR3 A;  4B64 A;  3RP7 A;  3RP6 A;  3ABV A;  3AD9 B;  1PXB A;  3UKL A;  3RED A;  1CJ4 A;  4B68 A;  2ZZB A;  4JNA A;  4YTP A;  3CNP A;  1CF3 A;  1PBE A;  1LQT A;  1MO9 A;  5FS9 A;  2YR6 A;  3KKJ A;  3QJ4 A;  1BZL A;  2WOW A;  1JNZ A;  4II2 A;  5FS8 A;  2VVL G;  3T2Y A;  3AYI A;  3ATQ A;  2GEW A;  4NTD A;  4CCR A;  3DK4 A;  3DME A;  2IVD A;  4G6G A;  5EB4 A;  3Q9T A;  1E7P A;  1REO A;  1LTX R;  3PO7 A;  4HA6 A;  1Y0P A;  4H4Q A;  3D9X A;  3ICR A;  3KVE A;  1GXF A;  3P9U A;  5EOW A;  2WP9 A;  1AOG A;  3F8P A;  4MJW A;  3UKA A;  1PXA A;  2WU2 A;  2V61 A;  1E1M A;  1ELI A;  3AYL A;  1OJ9 A;  2BK3 A;  1GTH A;  3BHK A;  1Y56 B;  1D7L A;  1COY A;  2XVF A;  3ADA B;  3UTF A;  1Y56 A;  2OLN A;  3E1T A;  1S7M A;  4CCQ A;  3K7T A;  2PHH A;  4OVI A;  1D4E A;  3P4P A;  2VVL A;  2C72 A;  4UP3 A;  3NN6 X;  4U2T A;  1KSU A;  5JCL A;  1BKW A;  4USQ A;  5KNL A;  3C4N A;  4H2P A;  1CC2 A;  4BJZ A;  1EL8 A;  2C4C A;  3KLJ A;  4RG3 A;  1JRY A;  5JCM A;  1GTE A;  2H89 A;  2C3D A;  4YSH A;  3NNE A;  3FPZ A;  4A6N A;  4H4T A;  4U8L A;  1LV0 A;  3GDN A;  3GRT A;  3G5R A;  3D1C A;  2Z5Y A;  3DGH A;  2WET A;  2Z5X A;  4G9K A;  3T31 A;  4AT2 A;  2TMD A;  1H84 A;  2Y6Q A;  2WPF A;  4G6H A;  4TM0 A;  1PJ6 A;  3ICS A;  1TDK A;  3SX6 A;  2R4J A;  1LPF A;  3CND A;  1H83 A;  4BJY A;  2WDR A;  1GRH A;  4A7A A;  4DSG A;  2GMH A;  3SYI A;  4AT0 A;  3AED A;  1LVL A;  2B7R A;  5U63 A;  2GQW A;  3K7M X;  3ZYX A;  4GUV A;  3CNJ A;  1CHU A;  3LXD A;  1YQ4 A;  4EMW A;  2BAC A;  3RNM A;  4IA6 A;  1GRE A;  2DKI A;  5FS7 A;  5IQ1 A;  1ZOY A;  3L1R A;  1Q1R A;  2YLS A;  3M13 A;  4H2N A;  3V3O A;  1N4U A;  2YWL A;  4PAB A;  4EQX A;  4JNQ A;  3LOV A;  1ZMC A;  2V5Z A;  1N4V A;  4CRT A;  3ALL A;  4H2Q A;  4RSL A;  4D04 A;  2JB3 A;  4LA1 A;  2OA1 A;  4X9N A;  1CJC A;  3AYJ A;  3S61 A;  4J36 A;  1KNR A;  1DNC A;  3AE8 A;  5KVI A;  4A9W A;  3FG2 P;  2WPE A;  3QSM A;  3GYI A;  4YTM A;  1F8S A;  5M10 A;  2XFQ A;  2CFY A;  4IV9 A;  3BI5 A;  4K2X A;  4YXD A;  1H81 A;  2VQB A;  3AEB A;  4G74 A;  4BK3 A;  2C66 A;  2YVG A;  1K0J A;  1P2E A;  2WQY A;  1B5Q A;  2GF3 A;  2XVE A;  2GV8 A;  3IHG A;  3NK2 X;  1XPQ A;  3AD7 B;  4CY8 A;  2YVF A;  4J2W A;  4I58 A;  1H86 A;  2BRA A;  2V3B A;  4EM4 A;  2X8G A;  1EL5 A;  1KSS A;  1S3E A;  4GR1 A;  4YSZ A;  3SZC A;  2C3C A;  5JRB A;  1S3B A;  4OPD A;  5KOX A;  3K30 A;  1GOS A;  3ITJ A;  3H4K A;  1IUS A;  2QA2 A;  4B66 A;  4D03 A;  4ECH A;  1IUV A;  4HB9 A;  1NAA A;  3H8I A;  4NNJ A;  1BGN A;  2Q0K A;  4NEW A;  2FJE A;  4Z2R A;  1JNR A;  1NEN A;  2BXS A;  3NIX A;  4BK2 A;  4BK1 A;  3GMC A;  2BC1 A;  1FEC A;  5BRT A;  5BVA A;  4H7U A;  3QFA A;  2JKC A;  2XFO A;  2QA1 A;  3NYE A;  5M0Z A;  3F8D A;  2EQ6 A;  3P4R A;  3RP8 A;  1RSG A;  5U25 A;  3BI4 A;  3O0H A;  5CQF A;  4EMI A;  4XWR A;  3CMM A;  1EL9 A;  4FX9 A;  1EBD A;  2YG3 A;  4WX1 A;  2BC0 A;  2X8C A;  3DA1 A;  1TDO A;  1YKJ A;  4GCM A;  4OPL A;  2YAU A;  4CY6 A;  2BS3 A;  1M6I A;  3AE5 A;  2GAG B;  2E4G A;  3QFB A;  4U8M A;  4K8D A;  4OPG A;  3LZX A;  5C2T A;  5BUL A;  3URH A;  1CJ3 A;  1PBD A;  3GWD A;  5J60 A;  4YWO A;  1L9D A;  1D4C A;  2R0G A;  3I3L A;  1L0V A;  3NN0 X;  3ICT A;  3G5S A;  3II4 A;  2C70 A;  2XLS A;  3SZF A;  2I0Z A;  5HY5 A;  5KMS A;  3DJJ A;  1XAN A;  2B7S A;  3T37 A;  5ER0 A;  1DXL A;  2JBV A;  2GMJ A;  3UOV A;  2X99 A;  1ZDL A;  2BXR A;  4EIP A;  3CN8 A;  1PXC A;  1BGJ A;  4UDP A;  5BUK A;  2XVH A;  1TDE A;  3AE3 A;  3BHF A;  1BWC A;  3NYF A;  2XYO A;  4X4J A;  5FMH A;  4H4Y A;  2BAB A;  2WP6 A;  1V59 A;  4WCT A;  3OZ2 A;  2H88 A;  5HHF A;  4JY3 A;  2W0H A;  1L9E A;  3M0O A;  4H4W A;  2RGJ A;  4Z2T A;  4JY2 A;  3GYJ A;  1OJT A;  4K5S A;  4EM3 A;  1NEK A;  2YLZ A;  1Q1W A;  3CGB A;  1PHH A;  2BYB A;  2BS4 A;  3CIR A;  2C76 A;  5IQ4 A;  4U2L A;  1ZX9 A;  2C64 A;  2Q7V A;  3UP4 A;  1FEA A;  4A79 A;  3M12 A;  1QLB A;  2JB1 A;  2VRM A;  2YR5 A;  3T2Z A;  3IC9 A;  1S2Q A;  2RGH A;  4U2S A;  4UDR A;  2IVE A;  2VOU A;  2APG A;  2B76 A;  5GSN A;  3VR9 A;  3NYC A;  4EQS A;  4YKF A;  3OC4 A;  1FEB A;  4EMJ A;  2PYX A;  1KDG A;  1N4W A;  2AQJ A;  3LZW A;  1XDI A;  2WBA A;  2X3N A;  2EQ9 A;  1GRG A;  2ZBW A;  4OPU A;  4DGK A;  4C3X A;  4GDE A;  3C4A A;  5GRT A;  4Y4M A;  3KA7 A;  2B9W A;  2CDU A;  4JQ9 A;  1NHP A;  2JAE A;  4U8N A;  1B4V A;  4Z44 A;  4B65 A;  3R9U A;  1PS9 A;  1GRA A;  3DK9 A;  3SM8 A;  2OAM A;  4U8P A;  2QCU A;  3AWI A;  1OJD A;  4GRT A;  4B63 A;  1N1P A;  1NG4 A;  4E0V A;  1O95 A;  4APN A;  2ACZ A;  3UOX A;  2TPR A;  1Z6L A;  4Z43 A;  3DK8 A;  3IWA A;  3RHA A;  2YM1 A;  4GF7 A;  1UKV G;  4A65 A;  3CPJ G;  2CVJ A;  3NTA A;  4OPC A;  3CGD A;  2YLX A;  3UOZ A;  1E39 A;  2GQF A;  4EIQ A;  2GR0 A;  1JU2 A;  4LII A;  4RG4 A;  4B1B A;  1F3P A;  4H4R A;  2YG6 A;  3F8R A;  1KF6 A;  2R46 A;  3IHM A;  2BA9 A;  1H7X A;  2WP5 A;  2WDV A;  3UKH A;  4NZH A;  1EL7 A;  2R0C A;  5JCN A;  4ICY A;  4C3Y A;  2Y6R A;  1PJ7 A;  1B8S A;  3AE4 A;  4A99 A;  1W4X A;  2WDQ A;  1ZMD A;  1DOD A;  4H4P A;  4XXG A;  4Z26 A;  3DJD A;  3HZL A;  1CC6 A;  2YLT A;  1KNP A;  4O5U A;  2WOV A;  3KU9 A;  1LQU A;  3AEG A;  3H8L A;  2RGO A;  1FCD A;  5DBJ A;  1IUW A;  3HYV A;  4REK A;  3I6D A;  4Z2U A;  2R0P A;  2VVM A;  4KPR A;  1HYU A;  1GT8 A;  5KXJ A;  5IPY A;  2ZZ0 A;  4C77 A;  3CTY A;  1NHS A;  3CGC A;  2QAE A;  1ZP0 A;  4H4V A;  3S5W A;  3GSI A;  4J56 A;  3VQR A;  3AE2 A;  1ONF A;  1QJD A;  1E1K A;  3UKP A;  1NG3 A;  3UP5 A;  4K5R A;  2A8X A;  4LU6 A;  2ARD A;  3BNM A;  2R9Z A;  3CPI G;  1O5W A;  4P9S A;  3L8K A;  2NPX A;  1DOE A;  2XCG A;  3SZW A;  1RP0 A;  2JB2 A;  4KX6 A;  1E6E A;  3ALJ A;  3VRA A;  4CNK A;  2C73 A;  2C7G A;  4AP3 A;  1SEZ A;  2XLR A;  3T2K A;  2XVJ A;  3HYX A;  2ZZC A;  3CNT A;  3PS9 A;  2R45 A;  4NEV A;  1X31 B;  3QSE A;  1D4D A;  1GSN A;  1M64 A;  3DGZ A;  2EQ8 A;  4H4U A;  2XDO A;  2BCG G;  3BI2 A;  1K4Q A;  4CNJ A;  4TM4 A;  4FK1 C;  1TYT A;  3CNS A;  3NG7 X;  2GVC A;  2BK5 A;  3V76 A;  4U8I A;  3GMB A;  2AR8 A;  2E1M A;  2X50 A;  3FIM B;  2YG7 A;  3KPF A;  3P4Q A;  3QVR A;  1F8W A;  1B37 A;  1NHR A;  1DOC A;  1VRQ B;  4IVM B;  5LV9 A;  5KWF A;  4N9X A;  1LJ1 A;  3GWF A;  1GET A;  2XFU A;  4EQR A;  2WS3 A;  1XHC A;  3EF6 A;  2R4E A;  4YSY A;  4YKG A;  3EAN A;  4H2R A;  4A5L A;  3UTG A;  1JRX A;  2C75 A;  2XVI A;  1YQ3 A;  4GAV A;  4BUR A;  3NTD A;  3QSS A;  3FBS A;  5KMP A;  3GRS A;  3NGC X;  2YLR A;  1E1L A;  1NDA A;  1CJ2 A;  2F5Z A;  2XLU A;  3NRN A;  3SY4 A;  1VG0 A;  1GAL A;  2C65 A;  2YVJ A;  1D7Y A;  2YG5 A;  2BS2 A;  2VQ7 A;  3LB8 A;  3UKQ A;  3DJE A;  1MOK A;  1H2I A;  2YM2 A;  3GD4 A;  2XLT A;  4NTC A;  1OJA A;  2WEU A;  4TM1 A;  1GRT A;  4U8K A;  1YQZ A;  2GRT A;  4X9M A;  1L9C A;  1PBB A;  5EB5 A;  4J33 A;  4B69 A;  2VZ2 A;  4YT0 A;  3Q6J A;  1H82 A;  2Q6U A;  2V60 A;  2FJD A;  1ZKQ A;  2YQU A;  2FBW A;  2X8H A;  5U1O A;  3AEA A;  3CPH G;  2EQ7 A;  1Q9I A;  4J34 A;  3KPK A;  1RYI A;  1IJH A;  3PG6 A;  1TDF A;  1NHQ A;  1GPE A;  4NWZ A;  4OCG A;  4AOS A;  5KRQ A;  2DKH A;  1D5T A;  4H50 A;  5CKU A;  4DSH A;  2OAL A;  4DNA A;  2NVK X;  3ISH A;  3UTE A;  5KMR A;  3K7Q X;  4C5O A;  4U8O A;  4BV6 A;  4II3 A;  1GRF A;  5HXI A;  1F6M A;  1FL2 A;  4UDQ A;  5JCI A;  2YLW A;  1FOH A;  5FS6 A;  1PBC A;  2WES A;  3VRB A;  4JN9 A;  4J57 A;  3SQP A;  5C3J A;  1PJ5 A;  3AD8 B;  1VDC A;  3AE9 A;  3SZ0 A;  3ALM A;  2BRY A;  2BK4 A;  1ZOV A;  5L46 A;  1GV4 A;  3AEE A;  4A6N B;  2A89 A;  4Y4N A;  3PVC A;  4C74 A;  4IA5 A;  2O9Z A;  3QVP A;  4IVO B;  3DJG X;  2WHD A;  2UZZ A;  1OJC A;  2BCP A;  2GH5 A;  1YY5 A;  2GR2 A;  2WU5 A;  4Y4L A;  4B67 A;  3B3R A;  3UOY A;  5TR3 A;  4M52 A;  1NPX A;  1VQW A;  1P2H A;  3CGE A;  3WE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...