3GD4A

Crystal structure of the reduced, nad-bound form of murine apoptosis inducing factor
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
483
structure length
445
Chain Sequence
PSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLQFRQWNGKERSIYFQPPSFYVSAQDLPNIENGGVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRALEKISREVKSITVIGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKILPQYLSNWTMEKVKREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKAEASEITIPEDYGKGVIFYLRDKVVVGIVLWNVFNRMPIARKIIKDGEQHEDLNEVAKLFNIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redox-linked conformational dynamics in apoptosis-inducing factor
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords Apoptosis-inducing factor 1, mitochondrial
total genus 142
structure length 445
sequence length 483
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3gd4A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3gd4A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3gd4A01
5J60A 3P9UA 3QSEA 4JN9A 2IVDA 2YM2A 5U25A 3ZDNA 2NPXA 2BA9A 2E4GA 1BGNA 2BC1A 1GOSA 4MJWA 3KVEA 1XHCA 4USRA 2Q0KA 1XANA 1VQWA 4AT0A 2BS4A 2WPEA 4AOXA 3M13A 2GH5A 2R9ZA 3BHKA 3OZ2A 1OJ9A 4OPIA 5DBJA 3KD9A 2BCGG 4Z26A 3UKQA 1CJ2A 2GR1A 3NK2X 2VOUA 4EQSA 5BULA 4A65A 1LTXR 3UKKA 4TLZA 3D1CA 2E1MA 4O5UA 4O5QA 2WBAA 1PBDA 2YVGA 2CDUA 2FJBA 2EQ8A 3NTDA 4H2NA 4U8JA 5BUKA 2A89A 1ZOYA 2WOVA 2WP9A 4GR1A 3ADAB 1KFYA 1FOHA 3AD8B 2VQ7A 4NTCA 2X50A 1SEZA 3II4A 2YVJA 4JNQA 1L9EA 3NT6A 3RP7A 3F8PA 2WQYA 2FJEA 3P4RA 2B9YA 3K7QX 1S2YA 2YWLA 3NN6X 3GMCA 2QA1A 4EMJA 4DSHA 1L0VA 1ZK7A 2QCUA 3AEDA 4ECHA 3QFBA 4IV9A 4UDRA 2NVKX 3UTEA 5KVHA 2FJAA 1B8SA 2ACZA 2RGJA 3AXBA 4GDEA 4K2XA 2H88A 2YR5A 3NGCX 1BGJA 4RG4A 4DGKA 3BHFA 1NAAA 4YSYA 4GRTA 3AYIA 5L46A 1FEBA 5IQ4A 2Y6RA 3DMEA 2RGHA 3ALLA 1RP0A 3M12A 3S5WA 4X9MA 1ZMDA 4U2LA 1E1NA 2V5ZA 3COXA 1D4CA 3EAOA 5FMHA 4BURA 4J36A 1N4VA 3GDPA 1QJDA 2GR0A 2WP6A 4B64A 5EB5A 4FK1A 2WOWA 2OLNA 3F8RA 3DGHA 4J2WA 3AE8A 1TDKA 5FS6A 4I59A 3NH3X 1LV0A 3P4SA 4H4PA 1PBFA 4YT0A 3FMWA 5KVIA 3AD7B 4P9SA 4U2TA 1V59A 4YTPA 4U8KA 1JRZA 4B67A 1Q9IA 1P2EA 2WDVA 3DJJA 3CPIG 1Q1WA 2C3CA 4K5RA 5EOWA 2WDQA 4REKA 2Q6UA 4Y4MA 1GRGA 4PABA 3E1TA 4AT2A 3DJGX 5JCMA 2WS3A 3G5QA 3GWFA 4K22A 1YQZA 1MXTA 2YG4A 2C72A 1H86A 4HA6A 1GSNA 4H4SA 1GNDA 2XCGA 4YKFA 1CF3A 5BRTA 3OC4A 5M0ZA 1CC6A 1OJCA 4B65A 1VRQB 1EL9A 4H4XA 4I58A 4OPUA 3M0OA 1BWCA 3VR8A 4EMWA 3K7TA 2R46A 3ZYXA 2CVJA 1IJHA 3GDNA 4OPLA 3R9UA 1TRBA 3DGZA 4YXDA 1PDHA 5TR3A 1W4XA 2C7GA 1TDNA 2R0GA 1MOKA 2YVFA 3GYJA 1M64A 4EIQA 1GESA 1DOCA 2WESA 1NDAA 1CJCA 1B5QA 2BK4A 2C76A 2Q0LA 3DJDA 2V3BA 1GRFA 3IHGA 4USQA 3UTHA 4DSGA 3CNPA 4RSLA 2YLTA 1ZKQA 3LOVA 1EL5A 4IA5A 5KOWA 4BV6A 1EL7A 1VDCA 3ATQA 3K7MX 3UOVA 3REDA 3I6DA 4XWZA 4H4TA 2RABA 4K5SA 3NKSA 3EPTA 2C70A 3DK8A 1GT8A 2GR3A 1OJTA 3H4KA 3PO7A 4H4YA 2Q7VA 5IPYA 3GD4A 1JU2A 1TDFA 4X9NA 1H6VA 3QFAA 3VRBA 3KPFA 4EQWA 3NTAA 3ABVA 2J3NA 4U8LA 1H84A 2ZZCA 1ZX9A 3O0HA 1H7XA 2YQUA 1JRYA 2XLTA 3UTGA 2GB0A 2V6OA 3IC9A 1E7PA 3RP6A 4RG3A 1QO8A 1DXLA 1FEAA 1D5TA 5JCNA 2AR8A 4M52A 1AOGA 2GMHA 2YR6A 2X8HA 1DNCA 3UKPA 4H4UA 4NTEA 1K0LA 1L9DA 1GTEA 2ARDA 4GUVA 1TDOA 2C75A 4H2RA 5KRQA 1DJNA 4NEVA 4FX9A 4IA6A 2XVFA 3UCLA 1GRTA 1DODA 3AEAA 2YG3A 4OPGA 2PYXA 2JK6A 4Z43A 2X99A 3GWDA 4FK1C 2TMDA 3KA7A 3DK9A 1EL8A 3JSKA 3VR9A 4E0VA 4LA1A 4UDPA 3AE1A 1F8SA 2B7SA 4C3XA 2GF3A 5JCIA 4H4RA 2C73A 4D03A 1IUSA 2ZBWA 4H4QA 3VRAA 4K7ZA 3GSIA 1VG0A 1K0IA 2BACA 1GREA 3BNMA 1PHHA 1N4WA 4CRTA 4APNA 4AP1A 4CCQA 2VZ2A 1CL0A 1PJ6A 4B63A 4XWRA 2R0PA 3QJ4A 5JCLA 2GMJA 3NNEA 1DOEA 5BVAA 1ZDLA 2XVEA 2PHHA 3UOYA 5M10A 4CNKA 4Z24A 2GRTA 1IUVA 2C66A 3AE6A 1PXBA 3Q6JA 1KNPA 4LU6A 1PS9A 2BCPA 2R0CA 4YKGA 2XFNA 3BI4A 3ICTA 4H2QA 1F8RA 3AE4A 4KX6A 2XFQA 4BK1A 4HB9A 2WU2A 1B37A 1FCDA 2CFYA 1TYTA 1Y0PA 3LADA 5KOXA 2RGOA 2WOIA 2BS2A 4OCGA 1IUTA 1LQUA 3RNMA 5J7XA 2YLZA 3ISHA 3LZWA 1PXAA 3IWAA 1OJDA 4GDPA 4CBQA 5FS7A 1E39A 3EF6A 4Y4NA 4CY6A 2X3NA 1GV4A 3ALMA 1CJ4A 3CIRA 3B6DA 3KU9A 5IQ1A 4CY8A 3C96A 4C77A 3QSSA 1IUXA 1D7LA 1NENA 3IF9A 1NHQA 1GALA 3ICRA 5KXJA 2VRMA 3AEGA 3V3OA 3SFDA 2YAUA 3K30A 2C65A 1S2QA 1LPFA 1ZP0A 3CN8A 3AEFA 1GETA 3VRDB 3UTFA 4CNJA 1YQ4A 5KWFA 2R4JA 3L1RA 3UOZA 1D4DA 3NN0X 4NZHA 1NHSA 1H7WA 2YM1A 4Z2TA 2B9XA 1NPXA 1ONFA 2GQFA 1Q1RA 4EM3A 5HY5A 2I0ZA 3QVRA 4EIPA 3URHA 1REOA 3AE3A 2GQWA 3UOXA 2X8GA 5CQFA 3CPHG 2OAMA 2WHDA 1ZY8A 4WX1A 4J56A 5ER0A 4DNAA 2XLSA 4TM4A 4TM1A 4A99A 3I3LA 2BS3A 4IVMB 1IUWA 2XVIA 2OLOA 3NYCA 2ZZ0A 3UKLA 3NK1X 2ZZBA 3PVCA 4UDQA 1EBDA 4B69A 3NYEA 3QSMA 3NYFA 4U8OA 2Y6QA 2EQ6A 1O5WA 2A87A 1K4QA 4H4VA 5HYMA 3LXDA 2AQJA 2R4EA 4Z44A 2YLWA 4H7UA 3C4AA 3SQPA 4J31A 2YR4A 2GAHB 1UKVG 2JAEA 1JEHA 1NHRA 1MO9A 1N4UA 3G5RA 1JOAA 2XLRA 3PS9A 4J34A 2GAGB 2WPFA 1KSSA 1NG3A 3AWIA 3AE2A 4ZCCA 4JY3A 1YY5A 2XVHA 4EMIA 3CGEA 3AEBA 4N9XA 4H50A 1P2HA 2WETA 2H89A 2Z5YA 4JY2A 4ZCDA 1COYA 3L8KA 3DJEA 5C3JA 4J57A 5U1OA 1TYPA 2GVCA 2F5ZA 4UP3A 4OVIA 3AYJA 3CGBA 4U2SA 3CTYA 1JNZA 3NLCA 4GCMA 1CJ3A 4A6NA 1GXFA 4B68A 3KLJA 3RP8A 3GD3A 1BKWA 3NG7X 3DA1A 4C5OA 1JNRA 1CBOA 2WPCA 3NK0X 2YLXA 3UKFA 1S3BA 2B9WA 5FS9A 2XLUA 3D8XA 5C2TA 2WEUA 3FPZA 4U8IA 1E6EA 1PBBA 2B76A 2EQ9A 3GRTA 3UP4A 3CGDA 1PN0A 1DJQA 1S3EA 1O95A 1KSUA 2WU5A 2XFUA 3GYIA 2VVLA 2YG5A 4YTMA 4YSXA 1Y56A 2Z5XA 2V61A 2CULA 2W0HA 3B3RA 1X31B 1GEUA 4YTNA 2UZZA 2DKIA 1H82A 1O94A 4KPRA 4XXGA 3C4NA 1GRBA 3NRNA 3CNJA 4ICYA 3VQRA 4B1BA 5FS8A 2QAEA 4WCTA 1NHPA 3UP5A 4IVOB 4U8NA 1ZOVA 1L9CA 2BC0A 4TLXA 2C3DA 2VVMA 1Z6LA 3CPJG 2WP5A 4C74A 3LZXA 1XPQA 1PJ5A 4OPDA 1QLBA 5JCKA 1PBEA 2BXSA 3FG2P 1ZMCA 2OA1A 4Y4LA 3NHOX 1F3PA 1E1KA 1LJ1A 1K0JA 3EANA 3AYLA 2BK3A 3AE9A 1D4EA 3SM8A 4BK2A 1XDIA 1LQTA 3T37A 2C67A 1GRHA 1GPEA 2E5VA 3CNTA 2BK5A 2GEWA 1GERA 1CHUA 4EQRA 1NEKA 4BJZA 1E1LA 3S61A 1TDEA 4EM4A 4H2PA 1PXCA 3HZLA 2YG7A 2YG6A 3CGCA 4JDRA 4PAAA 3BI2A 4YSZA 3AEEA 2GV8A 1RYIA 2XFOA 4TM0A 3LB8A 4NEWA 1VG9A 3AE7A 4YSHA 3ALJA 4A7AA 3UKAA 2JB3A 2JB2A 1YQ3A 3AB1A 4Z2RA 4NTDA 4YWOA 1F6MA 4J33A 4BK3A 1GRAA 2JKCA 2JB1A 4CCRA 1M6IA 5LV9A 2YLRA 4Z2UA 4ADWA 3ICSA 4TM3A 1YKJA 3DK4A 3CNDA 2V3AA 3RHAA 4AOSA 2VVLG 4A9WA 5HXIA 1PJ7A 2AAQA 1CC2A 1DOBA 2YLSA 3QVPA 4LIIA 2JBVA 4AP3A 3LJPA 2FJDA 1FECA 3V76A 4U8MA 3AE5A 4ZN0A 4EQXA 1BF3A 2GR2A 3GRSA 1KNRA 3FIMB 2IIDA 2XYOA 2BYBA 2XVJA 4H4WA 3SFEA 1BZLA 3CNSA 3P4QA 3UKHA 2QA2A 3ITJA 3BI5A 5HHFA 4X4JA 2APGA 1D7YA 2VRLA 1H83A 4BJYA 5CKUA 3V3NA 1CC4A 2V60A 2HQMA 1JRXA 1OJAA 3WE0A 1E1MA 4K8DA 1KDGA 2A8XA 3ATRA 3P4PA 1LVLA 2FBWA 2XDOA 4H4ZA 1H81A 2VQBA 1IUUA 1FL2A 2XFPA 2X8CA 1GTHA 3FBSA 3KKJA 2C64A 5EBKA 5GSNA 4GF7A 1HYUA 3SGLA 1Y56B 3NIXA 1PBCA 3DH9A 5U63A 4C3YA 4FDCB 2OALA 3H8IA 4Z25A 3BNUA 2BXRA 2XLPA 2DKHA 4OPTA 1B4VA 3G5SA 2B7RA 4JQ9A 3AD9B 3AECA 4A79A 5EB4A 2O9ZA 4B66A 2EQ7A 4A5LA 4A6NB 1RSGA 4JNAA 2WDRA 3Q9TA 3H8LA 1F8WA 1NG4A 3IHMA 2IVEA 1KF6A 3F8DA 2R45A 1N1PA 3GMBA 4D04A 3P1WA 5GRTA 2BABA 4OPCA 2TPRA 4U8PA 1ELIA
chains in the Genus database with same CATH superfamily
5U25A 2E4GA 3CXBA 2BC1A 4HN8A 4DN1A 3CB3A 1XS2A 2BS4A 1OJ9A 2BCGG 2GR1A 3NK2X 2VOUA 3IJLA 1LTXR 3SZ0A 2YVGA 3HYVA 5BUKA 3AD8B 3UJFA 4JNQA 1L9EA 3FJ4A 2YWLA 1L0VA 3QFBA 4UDRA 2NVKX 4GAPA 3N6HA 2RGJA 3IJQA 3AXBA 2H88A 4DGKA 1NAAA 3A7AA 4GRTA 5IQ4A 2FYMA 3S5WA 1E1NA 3COXA 4BURA 5FMHA 3VDGA 1QJDA 3GDPA 4FK1A 2WOWA 2OLNA 3DGHA 3AE8A 5FS6A 4DWDA 3NH3X 4KPLA 4YT0A 3GY1A 2WDVA 2C3CA 5EOWA 2Q6UA 3DJGX 3GWFA 3UXKA 1MXTA 2OVLA 2C72A 1H86A 1GSNA 3OC4A 4MMWA 3R0KA 4OPUA 3QPEA 4YXDA 3NRZB 5TR3A 2C7GA 1TDNA 4G8TA 1NDAA 3I4KA 1GRFA 4DSGA 4RSLA 4IA5A 5KOWA 3T4WA 1GT8A 2GR3A 5FJUA 3V5CA 3TW9A 2Q7VA 5IPYA 3GD4A 1TDFA 3VRBA 2J3NA 4U8LA 3O0HA 5BOEA 1JRYA 2XLTA 3DEQA 5JCNA 4M52A 1GTEA 4H2RA 5KRQA 2XVFA 4Z43A 3GWDA 2P88A 3DK9A 4GGBA 1EL8A 3JSKA 2OO6A 3D9XA 2W54A 2XH7A 1ELSA 4LA1A 1F8SA 3SY4A 2GF3A 4D03A 1IUSA 3UCCA 3VRAA 1VG0A 2BACA 1PHHA 4APNA 4B63A 1MNSA 3QJ4A 5BVAA 5JRBA 2C66A 3HPFA 1PXBA 4G9KA 4LU6A 2R0CA 3ICTA 3AE4A 5KMPA 2RGOA 2BS2A 4HCDA 2POZA 4GDPA 4CY6A 1E39A 5IQ1A 7ENLA 3C96A 3QSSA 1NENA 3IF9A 1NHQA 1R6WA 2VRMA 2GGIA 1LPFA 3AEFA 1GETA 4HCHA 1YQ4A 5KWFA 2OQHA 2R4JA 3L1RA 4GISA 3UOZA 1D4DA 3PFRA 2XH2A 3Q4DA 4EM3A 2I0ZA 3NVYB 2GQWA 2X8GA 3R07C 3CPHG 2OAMA 5ER0A 4Z1YA 4A99A 4IVMB 1IUWA 5EU9A 3NYCA 4UDQA 4GYPC 3LXDA 3C4AA 4J31A 1JEHA 4E4FA 1MO9A 3PS9A 1H2IA 3AWIA 3CGEA 4N9XA 4JY2A 4TVYA 4EWJA 2AKZA 3AYJA 3SYIA 1CJ3A 3TWAA 1SJDA 1E9IA 1WUEA 4ENLA 3KLJA 3GD3A 3SZCA 2BRYA 1CBOA 2WPCA 2B9WA 1E6EA 1PBBA 2B76A 3RR1A 2WU5A 1KSUA 2RDXA 2YG5A 4IHCA 2CULA 2W0HA 1X31B 1P43A 4YTNA 1JRPA 4KPRA 4A6GA 3VQRA 5FS8A 4IT1A 3UP5A 4IVOB 1ZOVA 4C74A 1Z6LA 2OFJA 3LZXA 2XH0A 3EKGA 1PBEA 1N61C 3AE9A 4BK2A 3P93A 3Q45A 1XDIA 1LQTA 2I5QA 2GEWA 1GERA 1CHUA 3P3BA 1NEKA 3HYWA 3HZLA 4H1ZA 2XFOA 4YSHA 4A7AA 2JB3A 3AB1A 1FIQB 1F6MA 4J33A 2JB1A 4CCRA 2HXTA 2DW7A 2PP0A 3RHAA 4A9WA 5HXIA 2AAQA 1DOBA 4AP3A 3V76A 4U8MA 3AE5A 2BYBA 2XVJA 1BZLA 3P4QA 2QA2A 4E8GA 4BJYA 5CKUA 2HQMA 1E1MA 1KDGA 3H12A 4K1WA 3ATRA 1H81A 5FJPA 2X8CA 3SJNA 1FFVC 3NO1A 2OZ3A 1P48A 5GSNA 3SGLA 1JPDX 1L8PA 1B4VA 4JQ9A 4B66A 2W3RA 4ROPA 3STPA 1F8WA 1N1PA 1ONEA 3ZVHA 5J60A 3CXOA 3P9UA 3QSEA 4JN9A 1T3QC 2IVDA 2YM2A 3ZDNA 1XHCA 4USRA 2R9ZA 4ZOHB 3OZ2A 4OPIA 2OPJA 3UKQA 2QQ6A 4MKSA 1IYXA 3UKKA 4TLZA 3UCDA 2WBAA 2EQ8A 3NTDA 2A89A 2WOVA 4G74A 1KFYA 3QLDA 4NTCA 1YEYA 1SEZA 3RP7A 3F8PA 2WQYA 2FJEA 3T14A 3K7QX 3NN6X 2QA1A 4ECHA 2QCUA 3UTEA 2FJAA 2ACZA 4K2XA 4YSYA 1FEBA 3BOXA 3AM9A 2RGHA 4E4UA 1RP0A 4X9MA 4U2LA 1D4CA 2QVHA 1N4VA 4B64A 3F8RA 3CAWA 1LV0A 4H4PA 3OZYA 1PBFA 3FMWA 5KVIA 3PWGA 4B67A 3DJJA 1TKKA 1Q1WA 4K5RA 2WDQA 1GRGA 3E1TA 5JCMA 2WS3A 4FP1A 3N6JA 4HA6A 4YKFA 1OJCA 4B65A 1VRQB 4H4XA 4KT2A 4TVWA 4I58A 3M0OA 3FXGA 2PU0A 3K7TA 3DGZA 3NVWB 3GYJA 2C76A 4MGGA 2BK4A 4II3A 1RVKA 3CNPA 2YLTA 3JW7A 3LOVA 3ATQA 3CT2A 1FHUA 3NXLA 4H4TA 3DK8A 3PO7A 3H4KA 4H4YA 3B97A 3QFAA 1ZX9A 1MUCA 2YQUA 1VQZA 2AR8A 3SX6A 2GMHA 4HNCA 1DNCA 3UKPA 4H4UA 4GUVA 4IZGA 1JPMA 1TDOA 3T2ZA 1DJNA 4IA6A 3GC2A 4H83A 3UCLA 3AEAA 4OPGA 2PYXA 4FK1C 2QJMA 2P3ZA 4IP4A 4GFIA 2HXUA 2B7SA 4C3XA 1V97A 2ZBWA 4H4QA 4K7ZA 1K0IA 3BNMA 4CRTA 2VZ2A 1CL0A 1STZA 2R0PA 5ENLA 3DFYA 1ZDLA 3UOYA 5M10A 1BQGA 3AE6A 3GYXA 1KNPA 3DG3A 2XFNA 1FFUC 2PP1A 4HCLA 1B37A 2OLAA 1TYTA 1Y0PA 4A35A 3U9IA 5KOXA 1EC7A 1EBHA 1LQUA 3RNMA 3PG6A 2OX4A 3LZWA 3IWAA 5FS7A 2X3NA 1GV4A 3ALMA 3B6DA 3KUMA 3ZLHA 4GMEA 3ICRA 3RO6A 2YAUA 3TQPA 3CN8A 1WUFA 3MWCA 2GL5A 4IP5A 2NQLA 2YM1A 2B9XA 1NPXA 1Q1RA 4EIPA 1REOA 1TE6A 1ZY8A 3DDMA 4DNAA 4G6GA 4TM4A 2BS3A 2OLOA 3UKLA 3B9JB 3NK1X 3PVCA 1EBDA 1K4QA 3VCNA 5HYMA 2AQJA 4H7UA 3SQPA 4DXKA 2JAEA 2PS2A 1NHRA 3K1GA 1N4UA 1JOAA 4J34A 3SSZA 3V5FA 2GGEA 4JY3A 1YY5A 2XVHA 3AEBA 1P2HA 2WETA 4ZCDA 4J57A 5U1OA 1TYPA 2F5ZA 3VFCA 3CGBA 4U2SA 1JNZA 3A7UA 4GCMA 3MQTA 4A6NA 3QKEA 4B68A 3D47A 1BKWA 3NK0X 3UKFA 3TWBA 2WEUA 3FPZA 3I6TA 1PN0A 3RCYA 1S3EA 4YTMA 3FYYA 2V61A 3JZUA 2DKIA 1H82A 4B1BA 3CNJA 3DG7A 2BC0A 2C3DA 2VVMA 1XPQA 4OPDA 2OA1A 4Y4LA 3FG2P 1E1KA 1D4EA 2GGHA 3T37A 1GPEA 1SJCA 1FO4A 3S61A 4H2PA 3EEZA 1PXCA 4PAAA 4JDRA 3I6EA 3BI2A 4TM0A 1BKHA 4NEWA 3UKAA 2JB2A 4YWOA 4BK3A 4GGHA 3IJIA 2P8CA 4ADWA 3ICSA 4TM3A 3SXIA 2V3AA 4AOSA 4LIIA 2JBVA 1KKOA 2GR2A 3SQSA 2IIDA 3SBFA 2XYOA 3CNSA 3GD6A 2VRLA 2XSXA 1H83A 3V3NA 2V60A 3WE0A 3CK5A 3AN1A 4K8DA 1LVLA 4GYPA 6ENLA 2VQBA 3OZMA 3R0UA 2HZGA 2C64A 4GF7A 1F9CA 1Y56B 2OALA 4A79A 2O9ZA 2EQ7A 3Q9TA 3H8LA 1KF6A 2R45A 3GMBA 3OTRA 3H70A 3NS1B 3UGVA 2ZADA 3V4BA 2E1MA 3MUCA 2BA9A 3VC6A 2Q0KA 1VQWA 3R10A 4AOXA 3HW2A 2GH5A 3M13A 5DBJA 3KD9A 1JCTA 4Z26A 4EQSA 4A65A 2FJBA 4GR1A 4KWSA 1FOHA 2VQ7A 2X50A 3GO2A 2PSNA 3NT6A 3P4RA 3GMCA 4EMJA 1ZK7A 3AEDA 2GSHA 3RRAA 4GDEA 2YR5A 4RG4A 1BGJA 4G7FA 3BHFA 2PGEA 2Y6RA 3RITA 3DMEA 3EAOA 3H7VA 2GR0A 4ZA0A 1TDKA 3P4SA 3AD7B 4U2TA 1V59A 4YTPA 1JRZA 1Q9IA 3CPIG 3G5QA 1YQZA 3SR6B 2YG4A 4YWSA 3HRDC 1KN0A 4H4SA 1GNDA 4E6MA 1CF3A 5BRTA 3KPKA 5M0ZA 1MRAA 1BWCA 3ZYXA 3GDNA 4JN8A 3R9UA 1PDHA 2R0GA 2YVFA 1M64A 4EIQA 1GESA 2WESA 1CJCA 3DJDA 3QTPA 2AL1A 2QDEA 2P8BA 1ZKQA 3ZVIA 3T9PA 1EL5A 1EL7A 3UOVA 2E5AA 3K7MX 4XWZA 3EPTA 1JU2A 3KPFA 3NTAA 3ABVA 1H84A 2ZZCA 1H7XA 4HNLA 3UTGA 2PTYA 5G5HB 2GB0A 2V6OA 1E7PA 3NVZB 3RP6A 1DXLA 2X8HA 3SN1A 4IL0A 1L9DA 2ARDA 4GAVA 1N5XA 2MNRA 4NEVA 4FX9A 1DODA 1R0MA 1N5WC 2X99A 2TMDA 5KNLA 3KA7A 3VR9A 4E0VA 4UDPA 5JCIA 4H4RA 3T31A 1GREA 3R25A 4AP1A 4XWRA 3V3WA 5JCLA 2GMJA 3NNEA 2XVEA 3VC5A 4Z24A 2GRTA 3Q6JA 1FHVA 3FVDA 2XFQA 2WU2A 3THUA 2CFYA 3LADA 2O56A 4K8GA 4OCGA 1IUTA 3ISHA 1PXAA 3OW1A 2PP3A 4C77A 1IUXA 1D7LA 3UJRA 2ONEA 3ENLA 3V3OA 3VCCA 3S47A 2C65A 3ES7A 1ZP0A 4CNJA 3JVAA 2C4CA 1NU5A 4Z2TA 3SN0A 1ONFA 3URHA 3UOXA 2WHDA 3DGBA 4J56A 4TM1A 2GDQA 2AKMA 2ZZ0A 1N62C 1SJAA 4B69A 3QSMA 3NYFA 4U8OA 2Y6QA 1O5WA 4H4VA 2R4EA 4Z44A 2YLWA 2GAHB 2XLRA 4ZCWA 1KSSA 1NG3A 4ZCCA 2PGWA 4X2PA 2H89A 2PCEA 2GVCA 4UP3A 4OVIA 2AL2A 3CTYA 3NLCA 2OZ8A 3RP8A 3DA1A 4C5OA 2YLXA 5FS9A 4U8IA 3ZVHB 2EQ9A 3GRTA 3UP4A 1DJQA 1O95A 1Y56A 1GEUA 1O94A 4J1OA 4XXGA 3C4NA 3NRNA 2QAEA 1S7MA 3OP2A 1QLBA 5JCKA 5KMRA 1ZMCA 3NHOX 3TCSA 1K0JA 3EANA 2BK3A 5KMQA 3PWIA 3TJIA 4Z17A 2C67A 2E5VA 4BJZA 2PTWA 1TDEA 3CGCA 4YSZA 2GV8A 1X2GA 3AE7A 1KCZA 3ALJA 3OPSA 4NTDA 1GRAA 1TZZA 3N4EA 5LV9A 2YLRA 1YKJA 2VVLG 2YLSA 3QVPA 1FECA 4ZN0A 4EQXA 3ZLGA 4H4WA 3CYJA 3SFEA 2OG9A 3BI5A 3ZLFA 1NELA 2FKPA 2APGA 1D7YA 3AMZA 1OEPA 1SJBA 2PA6A 1CC4A 2GGJA 2FBWA 2XH4A 1FL2A 1GTHA 3FBSA 3KKJA 1HYUA 5KMSA 3NIXA 4FDCB 3H8IA 4Z25A 3BNUA 2XLPA 2DKHA 2B7RA 3CMMA 3AD9B 3AECA 3DFHA 4A3RA 4JNAA 2WDRA 2MUCA 1NG4A 3F8DA 1EBGA 5GRTA 2BABA 4OPCA 4H19A 2B9YA 4U8PA 4G6HA 1ELIA 2NPXA 3MY9A 1BGNA 1GOSA 4MJWA 3KVEA 1XANA 2PPGA 4AT0A 2WPEA 1PDZA 1MDLA 3BHKA 3EUB3 3P0WA 3FCPA 1CJ2A 5BULA 3ETRB 3D1CA 4O5UA 4O5QA 1PBDA 2CDUA 3IK4A 3MZNA 3TOYA 4U8JA 4H2NA 3DG6A 1ZOYA 2WP9A 3ADAB 3II4A 2YVJA 1S2YA 4DSHA 4IV9A 5KVHA 1B8SA 3NGCX 5G5GB 3AYIA 5L46A 1N60C 3ALLA 3M12A 1ZMDA 2V5ZA 4J36A 2WP6A 5EB5A 3TTEA 4J2WA 3NVVB 4I59A 3UJSA 4P9SA 4U8KA 2E3TA 2DW6A 1P2EA 3U4FA 4REKA 5J04A 4Y4MA 4PABA 4AT2A 1RM6B 4K22A 2XCGA 3H8AA 1CC6A 3R1ZA 1EL9A 4E5TA 3VR8A 4EMWA 2R46A 1JROA 1IJHA 2CVJA 4OPLA 1TRBA 1W4XA 3T2YA 1MOKA 4NNJA 1DOCA 3IHGA 1B5QA 2Q0LA 4USQA 2V3BA 3QN3A 3UTHA 1EC8A 4BV6A 1VDCA 3REDA 3L5OA 3I6DA 2P0IA 5FJOA 2RABA 4K5SA 3NKSA 2C70A 3S5SA 1OJTA 3SN4A 4X9NA 1H6VA 3NFUA 4EQWA 5FJTA 3IC9A 1ECQA 1JDFA 4RG3A 1QO8A 1FEAA 1D5TA 1AOGA 2YR6A 4NTEA 1K0LA 4DX3A 3T2KA 2C75A 4HPNA 1GRTA 2YG3A 2JK6A 4GIRA 3AE1A 2C73A 3GSIA 1N4WA 4CCQA 1PJ6A 4DYEA 1DOEA 2PHHA 4CNKA 1IUVA 2CHRA 1PS9A 2PMQA 2BCPA 4YKGA 4KX6A 3BI4A 4H2QA 2OQYA 2PTXA 1F8RA 4BK1A 4HB9A 1FCDA 2WOIA 5J7XA 2YLZA 1OJDA 4CBQA 3EF6A 4Y4NA 2W55A 3A7RA 1CJ4A 3CIRA 3KU9A 4CY8A 1GALA 5KXJA 4KEMA 3AEGA 3RGTA 3SFDA 3K30A 4K2SA 1S2QA 4JHMA 3VRDB 3UTFA 3T6CA 2XGZA 4M6UA 3NN0X 4NZHA 1NHSA 1H7WA 5HY5A 2GQFA 3UJ2A 3QVRA 5BOFA 3AE3A 2BRAA 5CQFA 3VA8A 4WX1A 2XLSA 2QDDA 3I3LA 2XVIA 2ZZBA 3NYEA 3N4FA 4IL2A 2EQ6A 2A87A 1KD0A 1WYGA 2YR4A 1UKVG 2QJJA 2W3SA 3G5RA 3DIPA 2QJNA 1W6TA 2GAGB 2WPFA 2HNEA 3AE2A 3UJEA 1ZXIC 4EMIA 4H50A 2Z5YA 1COYA 3L8KA 3DJEA 5C3JA 2GGGA 3TJ4A 1X2HA 1GXFA 3NG7X 1XPYA 1JNRA 1S3BA 3PK7A 2XLUA 3DESA 3FV9A 3D8XA 5C2TA 4G73A 3SZWA 3CGDA 2XFUA 3GYIA 2VVLA 4YSXA 2Z5XA 1EC9A 3B3RA 2UZZA 4NWZA 4ICYA 1GRBA 3HYXA 3NZGA 4WCTA 1NHPA 4U8NA 4TLXA 1L9CA 1DTNA 3CPJG 2WP5A 1PJ5A 2BXSA 1VDVA 1F3PA 4H2HA 1LJ1A 3AYLA 2OKTA 3SM8A 1MDRA 4HYRA 1SB3B 1GRHA 3CNTA 3ES8A 2BK5A 3UXLA 1PDYA 4EQRA 1E1LA 4EM4A 4F4RA 4FI4A 2YG6A 2YG7A 3AEEA 1RYIA 3LB8A 1VG9A 4II2A 1YQ3A 3DERA 4Z2RA 3R11A 2JKCA 1M6IA 4Z2UA 3T8QA 3DK4A 3CNDA 1PJ7A 1CC2A 2PU1A 4DHGA 3LJPA 2FJDA 1BF3A 3GRSA 1KNRA 3FIMB 2AL2B 3UKHA 4J3ZA 3ITJA 2ZC8A 5HHFA 4X4JA 4M0XA 1KKRA 5FJRA 1JRXA 1OJAA 2A8XA 3P4PA 3BJSA 2XDOA 4H4ZA 2QGYA 1IUUA 2XFPA 3MSYA 5EBKA 2PODA 1PBCA 3DH9A 5U63A 4C3YA 2PTZA 3MKCA 1N63C 2BXRA 4OPTA 2OZTA 3G5SA 3T0KA 5EB4A 5IDZA 4A5LA 4A6NB 1RSGA 4JN7A 3SZFA 3IHMA 2IVEA 3BSMA 3D46A 4D04A 3P1WA 2TPRA
chains in the Genus database with same CATH topology
5J60A 3P9UA 3QSEA 4JN9A 2IVDA 2YM2A 5U25A 3ZDNA 2NPXA 2BA9A 2E4GA 1BGNA 2BC1A 1GOSA 4MJWA 3KVEA 1XHCA 4USRA 2Q0KA 1XANA 1VQWA 4AT0A 2BS4A 2WPEA 4AOXA 3M13A 2GH5A 2R9ZA 3BHKA 3OZ2A 1OJ9A 4OPIA 5DBJA 3KD9A 2BCGG 4Z26A 3UKQA 1CJ2A 2GR1A 3NK2X 2VOUA 4EQSA 5BULA 4A65A 1LTXR 3UKKA 4TLZA 3SZ0A 3D1CA 2E1MA 4O5UA 4O5QA 2WBAA 1PBDA 2YVGA 3HYVA 2CDUA 2FJBA 2EQ8A 3NTDA 4H2NA 4U8JA 5BUKA 2A89A 1ZOYA 2WOVA 2WP9A 4GR1A 3ADAB 1KFYA 1FOHA 3AD8B 4G74A 2VQ7A 4NTCA 2X50A 1SEZA 3II4A 2YVJA 4JNQA 1L9EA 3NT6A 3RP7A 3F8PA 2WQYA 2FJEA 3P4RA 2B9YA 3K7QX 3T14A 1S2YA 2YWLA 3NN6X 3GMCA 2QA1A 4EMJA 4DSHA 1L0VA 1ZK7A 2QCUA 3AEDA 4ECHA 3QFBA 4IV9A 4UDRA 2NVKX 3UTEA 4GAPA 5KVHA 2FJAA 1B8SA 2ACZA 2RGJA 3AXBA 4GDEA 4K2XA 2H88A 2YR5A 3NGCX 1BGJA 4RG4A 4DGKA 3BHFA 1NAAA 4YSYA 4GRTA 3AYIA 5L46A 1FEBA 5IQ4A 2Y6RA 3DMEA 2RGHA 3ALLA 1RP0A 3M12A 3S5WA 4X9MA 1ZMDA 4U2LA 1E1NA 2V5ZA 3COXA 1D4CA 3EAOA 5FMHA 4BURA 4J36A 1N4VA 3GDPA 1QJDA 2GR0A 2WP6A 4B64A 5EB5A 4FK1A 2WOWA 2OLNA 3F8RA 3DGHA 4J2WA 3AE8A 1TDKA 5FS6A 4I59A 3NH3X 1LV0A 3P4SA 4H4PA 1PBFA 4YT0A 3FMWA 5KVIA 3AD7B 4P9SA 4U2TA 1V59A 4YTPA 4U8KA 1JRZA 4B67A 1Q9IA 1P2EA 2WDVA 3DJJA 3CPIG 1Q1WA 2C3CA 4K5RA 5EOWA 2WDQA 4REKA 2Q6UA 4Y4MA 1GRGA 4PABA 3E1TA 4AT2A 3DJGX 5JCMA 2WS3A 3G5QA 3GWFA 4K22A 1YQZA 1MXTA 2YG4A 2C72A 1H86A 4HA6A 1GSNA 1KN0A 4H4SA 1GNDA 2XCGA 4YKFA 1CF3A 5BRTA 3OC4A 3KPKA 5M0ZA 1CC6A 1OJCA 4B65A 1VRQB 1EL9A 4H4XA 4I58A 4OPUA 3M0OA 1BWCA 3VR8A 4EMWA 3K7TA 2R46A 3ZYXA 2CVJA 1IJHA 3GDNA 4OPLA 3R9UA 1TRBA 3DGZA 4YXDA 1PDHA 5TR3A 1W4XA 2C7GA 1TDNA 2R0GA 1MOKA 2YVFA 3T2YA 3GYJA 1M64A 4EIQA 4NNJA 1GESA 1DOCA 2WESA 1NDAA 1CJCA 1B5QA 2BK4A 2C76A 2Q0LA 3DJDA 2V3BA 1GRFA 3IHGA 4II3A 4USQA 3UTHA 4DSGA 3CNPA 4RSLA 2YLTA 1ZKQA 3LOVA 1EL5A 4IA5A 5KOWA 4BV6A 1EL7A 1VDCA 3ATQA 3K7MX 3UOVA 3REDA 3L5OA 3I6DA 4XWZA 4H4TA 2RABA 4K5SA 3NKSA 3EPTA 2C70A 3DK8A 1GT8A 2GR3A 1OJTA 3H4KA 3PO7A 4H4YA 2Q7VA 5IPYA 3GD4A 1JU2A 1TDFA 4X9NA 1H6VA 3QFAA 3VRBA 3KPFA 4EQWA 3NTAA 3ABVA 2J3NA 4U8LA 1H84A 2ZZCA 1ZX9A 3O0HA 1H7XA 2YQUA 1JRYA 2XLTA 3UTGA 2GB0A 2V6OA 3IC9A 1E7PA 3RP6A 4RG3A 1QO8A 1DXLA 1FEAA 1D5TA 5JCNA 2AR8A 3SX6A 4M52A 1AOGA 2GMHA 2YR6A 2X8HA 1DNCA 3UKPA 4H4UA 4NTEA 1K0LA 1L9DA 1GTEA 2ARDA 4GUVA 1TDOA 4GAVA 3T2KA 2C75A 4H2RA 3T2ZA 5KRQA 1DJNA 4NEVA 4FX9A 4IA6A 2XVFA 3UCLA 1GRTA 1DODA 3AEAA 2YG3A 4OPGA 2PYXA 2JK6A 4Z43A 2X99A 3GWDA 4FK1C 2TMDA 5KNLA 3KA7A 3DK9A 1EL8A 3JSKA 3VR9A 4E0VA 3D9XA 4LA1A 4UDPA 3AE1A 1F8SA 2B7SA 3SY4A 2GF3A 5JCIA 4C3XA 4H4RA 2C73A 3T31A 4D03A 1IUSA 2ZBWA 4H4QA 3VRAA 4K7ZA 3GSIA 1VG0A 1K0IA 2BACA 1GREA 3BNMA 1PHHA 1N4WA 4CRTA 4APNA 4AP1A 4CCQA 2VZ2A 1CL0A 1PJ6A 4B63A 4XWRA 2R0PA 3QJ4A 5JCLA 2GMJA 3NNEA 1DOEA 5BVAA 1ZDLA 2XVEA 2PHHA 3UOYA 5M10A 4CNKA 4Z24A 2GRTA 5JRBA 1IUVA 2C66A 3AE6A 1PXBA 3GYXA 4G9KA 3Q6JA 1KNPA 4LU6A 1PS9A 2BCPA 2R0CA 4YKGA 2XFNA 3BI4A 3ICTA 4H2QA 1F8RA 3AE4A 4KX6A 2XFQA 4BK1A 4HB9A 5KMPA 2WU2A 1B37A 1FCDA 2CFYA 1TYTA 1Y0PA 3LADA 5KOXA 2RGOA 2WOIA 2BS2A 4OCGA 1IUTA 1LQUA 3RNMA 3PG6A 5J7XA 2YLZA 3ISHA 3LZWA 1PXAA 3IWAA 1OJDA 4GDPA 4CBQA 5FS7A 1E39A 3EF6A 4Y4NA 4CY6A 2X3NA 1GV4A 3ALMA 1CJ4A 3CIRA 3B6DA 3KU9A 5IQ1A 4CY8A 3C96A 4C77A 3QSSA 1IUXA 1D7LA 1NENA 3IF9A 1NHQA 1GALA 3ICRA 5KXJA 2VRMA 3AEGA 3V3OA 3SFDA 2YAUA 3K30A 2C65A 1S2QA 1LPFA 1ZP0A 3CN8A 3AEFA 1GETA 3VRDB 3UTFA 4CNJA 1YQ4A 5KWFA 2R4JA 3L1RA 2C4CA 3UOZA 1D4DA 3NN0X 4NZHA 1NHSA 1H7WA 2YM1A 4Z2TA 2B9XA 1NPXA 1ONFA 2GQFA 1Q1RA 4EM3A 5HY5A 2I0ZA 3QVRA 4EIPA 3URHA 1REOA 3AE3A 2GQWA 3UOXA 2BRAA 2X8GA 5CQFA 3CPHG 2OAMA 2WHDA 1ZY8A 4WX1A 4J56A 5ER0A 4DNAA 2XLSA 4G6GA 4TM4A 4TM1A 3I3LA 4A99A 2BS3A 4IVMB 1IUWA 2XVIA 2OLOA 3NYCA 2ZZ0A 3UKLA 3NK1X 2ZZBA 3PVCA 4UDQA 1EBDA 4B69A 3NYEA 3QSMA 3NYFA 4U8OA 2Y6QA 2EQ6A 1O5WA 2A87A 1K4QA 4H4VA 5HYMA 3LXDA 2AQJA 2R4EA 4Z44A 2YLWA 4H7UA 3C4AA 3SQPA 4J31A 2YR4A 2GAHB 1UKVG 2JAEA 1JEHA 1NHRA 1MO9A 1N4UA 3G5RA 1JOAA 2XLRA 3PS9A 4J34A 2GAGB 2WPFA 1KSSA 1NG3A 1H2IA 3AE2A 3AWIA 4ZCCA 4JY3A 1YY5A 2XVHA 4EMIA 3CGEA 3AEBA 4N9XA 4H50A 1P2HA 2WETA 2H89A 2Z5YA 4JY2A 4ZCDA 1COYA 3L8KA 3DJEA 5C3JA 4J57A 5U1OA 1TYPA 2GVCA 2F5ZA 4UP3A 4OVIA 3AYJA 3CGBA 4U2SA 3CTYA 1JNZA 3SYIA 3NLCA 4GCMA 1CJ3A 4A6NA 1GXFA 4B68A 3KLJA 3RP8A 3GD3A 1BKWA 3NG7X 3SZCA 3DA1A 2BRYA 1JNRA 4C5OA 1CBOA 2WPCA 3NK0X 2YLXA 3UKFA 1S3BA 2B9WA 5FS9A 2XLUA 3D8XA 5C2TA 2WEUA 3FPZA 4U8IA 4G73A 1E6EA 1PBBA 3SZWA 2B76A 2EQ9A 3GRTA 3UP4A 3CGDA 1PN0A 1DJQA 1S3EA 1O95A 1KSUA 2WU5A 2XFUA 3GYIA 2VVLA 2YG5A 4YTMA 4YSXA 1Y56A 2Z5XA 2V61A 2CULA 2W0HA 3B3RA 1X31B 1GEUA 4YTNA 2UZZA 2DKIA 1H82A 1O94A 4NWZA 4KPRA 4XXGA 3C4NA 1GRBA 3HYXA 3CNJA 3NRNA 4ICYA 3VQRA 4B1BA 5FS8A 2QAEA 4WCTA 1NHPA 3UP5A 4IVOB 4U8NA 1ZOVA 1L9CA 2BC0A 4TLXA 2C3DA 2VVMA 1Z6LA 3CPJG 2WP5A 4C74A 3LZXA 1XPQA 1S7MA 1PJ5A 4OPDA 1QLBA 5JCKA 1PBEA 2BXSA 3FG2P 1ZMCA 2OA1A 4Y4LA 3NHOX 1F3PA 5KMRA 1E1KA 1LJ1A 1K0JA 3EANA 3AYLA 2BK3A 5KMQA 3AE9A 1D4EA 3SM8A 4BK2A 1XDIA 1LQTA 3T37A 2C67A 1GRHA 1GPEA 2E5VA 3CNTA 2BK5A 2GEWA 1GERA 1CHUA 4EQRA 1NEKA 3HYWA 1E1LA 3S61A 1TDEA 4BJZA 4EM4A 4H2PA 1PXCA 3HZLA 2YG7A 2YG6A 3CGCA 4JDRA 4PAAA 3BI2A 4YSZA 3AEEA 2GV8A 1RYIA 2XFOA 4TM0A 3LB8A 4NEWA 1VG9A 3AE7A 4YSHA 4II2A 3ALJA 4A7AA 3UKAA 2JB3A 2JB2A 1YQ3A 3AB1A 4Z2RA 4NTDA 4YWOA 1F6MA 4J33A 4BK3A 1GRAA 2JKCA 2JB1A 4CCRA 1M6IA 5LV9A 2YLRA 4Z2UA 4ADWA 3ICSA 4TM3A 1YKJA 3DK4A 3CNDA 2V3AA 3RHAA 3SXIA 4AOSA 2VVLG 4A9WA 5HXIA 2AAQA 1DOBA 1CC2A 1PJ7A 2YLSA 3QVPA 4LIIA 2JBVA 4AP3A 3LJPA 2FJDA 1FECA 3V76A 4U8MA 3AE5A 4ZN0A 4EQXA 1BF3A 2GR2A 3GRSA 1KNRA 3FIMB 2IIDA 2XYOA 2BYBA 2XVJA 4H4WA 3SFEA 1BZLA 3CNSA 3P4QA 3UKHA 2QA2A 3ITJA 3BI5A 5HHFA 4X4JA 2APGA 1D7YA 2VRLA 1H83A 4BJYA 5CKUA 3V3NA 1CC4A 2V60A 2HQMA 1JRXA 1OJAA 3WE0A 1E1MA 4K8DA 1KDGA 2A8XA 3ATRA 3P4PA 1LVLA 2FBWA 2XDOA 4H4ZA 1H81A 2VQBA 1IUUA 1FL2A 2XFPA 2X8CA 1GTHA 3FBSA 3KKJA 2C64A 5EBKA 5GSNA 4GF7A 1HYUA 3SGLA 1Y56B 3NIXA 5KMSA 1PBCA 3DH9A 5U63A 4C3YA 4FDCB 2OALA 3H8IA 4Z25A 3BNUA 2BXRA 2XLPA 2DKHA 4OPTA 1B4VA 3G5SA 2B7RA 3CMMA 3T0KA 4JQ9A 3AD9B 3AECA 4A79A 5EB4A 2O9ZA 4B66A 2EQ7A 4A5LA 4A6NB 1RSGA 4JNAA 2WDRA 3Q9TA 3H8LA 1F8WA 1NG4A 3SZFA 3IHMA 2IVEA 1KF6A 3F8DA 2R45A 1N1PA 3GMBA 4D04A 3P1WA 5GRTA 2BABA 4OPCA 2TPRA 4U8PA 4G6HA 1ELIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J60 A;  3P9U A;  3QSE A;  4JN9 A;  2IVD A;  2YM2 A;  5U25 A;  3ZDN A;  2NPX A;  2BA9 A;  2E4G A;  1BGN A;  2BC1 A;  1GOS A;  4MJW A;  3KVE A;  1XHC A;  4USR A;  2Q0K A;  1XAN A;  1VQW A;  4AT0 A;  2BS4 A;  2WPE A;  4AOX A;  3M13 A;  2GH5 A;  2R9Z A;  3BHK A;  3OZ2 A;  1OJ9 A;  4OPI A;  5DBJ A;  3KD9 A;  2BCG G;  4Z26 A;  3UKQ A;  1CJ2 A;  2GR1 A;  3NK2 X;  2VOU A;  4EQS A;  5BUL A;  4A65 A;  1LTX R;  3UKK A;  4TLZ A;  3D1C A;  2E1M A;  4O5U A;  4O5Q A;  2WBA A;  1PBD A;  2YVG A;  2CDU A;  2FJB A;  2EQ8 A;  3NTD A;  4H2N A;  4U8J A;  5BUK A;  2A89 A;  1ZOY A;  2WOV A;  2WP9 A;  4GR1 A;  3ADA B;  1KFY A;  1FOH A;  3AD8 B;  2VQ7 A;  4NTC A;  2X50 A;  1SEZ A;  3II4 A;  2YVJ A;  4JNQ A;  1L9E A;  3NT6 A;  3RP7 A;  3F8P A;  2WQY A;  2FJE A;  3P4R A;  2B9Y A;  3K7Q X;  1S2Y A;  2YWL A;  3NN6 X;  3GMC A;  2QA1 A;  4EMJ A;  4DSH A;  1L0V A;  1ZK7 A;  2QCU A;  3AED A;  4ECH A;  3QFB A;  4IV9 A;  4UDR A;  2NVK X;  3UTE A;  5KVH A;  2FJA A;  1B8S A;  2ACZ A;  2RGJ A;  3AXB A;  4GDE A;  4K2X A;  2H88 A;  2YR5 A;  3NGC X;  1BGJ A;  4RG4 A;  4DGK A;  3BHF A;  1NAA A;  4YSY A;  4GRT A;  3AYI A;  5L46 A;  1FEB A;  5IQ4 A;  2Y6R A;  3DME A;  2RGH A;  3ALL A;  1RP0 A;  3M12 A;  3S5W A;  4X9M A;  1ZMD A;  4U2L A;  1E1N A;  2V5Z A;  3COX A;  1D4C A;  3EAO A;  5FMH A;  4BUR A;  4J36 A;  1N4V A;  3GDP A;  1QJD A;  2GR0 A;  2WP6 A;  4B64 A;  5EB5 A;  4FK1 A;  2WOW A;  2OLN A;  3F8R A;  3DGH A;  4J2W A;  3AE8 A;  1TDK A;  5FS6 A;  4I59 A;  3NH3 X;  1LV0 A;  3P4S A;  4H4P A;  1PBF A;  4YT0 A;  3FMW A;  5KVI A;  3AD7 B;  4P9S A;  4U2T A;  1V59 A;  4YTP A;  4U8K A;  1JRZ A;  4B67 A;  1Q9I A;  1P2E A;  2WDV A;  3DJJ A;  3CPI G;  1Q1W A;  2C3C A;  4K5R A;  5EOW A;  2WDQ A;  4REK A;  2Q6U A;  4Y4M A;  1GRG A;  4PAB A;  3E1T A;  4AT2 A;  3DJG X;  5JCM A;  2WS3 A;  3G5Q A;  3GWF A;  4K22 A;  1YQZ A;  1MXT A;  2YG4 A;  2C72 A;  1H86 A;  4HA6 A;  1GSN A;  4H4S A;  1GND A;  2XCG A;  4YKF A;  1CF3 A;  5BRT A;  3OC4 A;  5M0Z A;  1CC6 A;  1OJC A;  4B65 A;  1VRQ B;  1EL9 A;  4H4X A;  4I58 A;  4OPU A;  3M0O A;  1BWC A;  3VR8 A;  4EMW A;  3K7T A;  2R46 A;  3ZYX A;  2CVJ A;  1IJH A;  3GDN A;  4OPL A;  3R9U A;  1TRB A;  3DGZ A;  4YXD A;  1PDH A;  5TR3 A;  1W4X A;  2C7G A;  1TDN A;  2R0G A;  1MOK A;  2YVF A;  3GYJ A;  1M64 A;  4EIQ A;  1GES A;  1DOC A;  2WES A;  1NDA A;  1CJC A;  1B5Q A;  2BK4 A;  2C76 A;  2Q0L A;  3DJD A;  2V3B A;  1GRF A;  3IHG A;  4USQ A;  3UTH A;  4DSG A;  3CNP A;  4RSL A;  2YLT A;  1ZKQ A;  3LOV A;  1EL5 A;  4IA5 A;  5KOW A;  4BV6 A;  1EL7 A;  1VDC A;  3ATQ A;  3K7M X;  3UOV A;  3RED A;  3I6D A;  4XWZ A;  4H4T A;  2RAB A;  4K5S A;  3NKS A;  3EPT A;  2C70 A;  3DK8 A;  1GT8 A;  2GR3 A;  1OJT A;  3H4K A;  3PO7 A;  4H4Y A;  2Q7V A;  5IPY A;  3GD4 A;  1JU2 A;  1TDF A;  4X9N A;  1H6V A;  3QFA A;  3VRB A;  3KPF A;  4EQW A;  3NTA A;  3ABV A;  2J3N A;  4U8L A;  1H84 A;  2ZZC A;  1ZX9 A;  3O0H A;  1H7X A;  2YQU A;  1JRY A;  2XLT A;  3UTG A;  2GB0 A;  2V6O A;  3IC9 A;  1E7P A;  3RP6 A;  4RG3 A;  1QO8 A;  1DXL A;  1FEA A;  1D5T A;  5JCN A;  2AR8 A;  4M52 A;  1AOG A;  2GMH A;  2YR6 A;  2X8H A;  1DNC A;  3UKP A;  4H4U A;  4NTE A;  1K0L A;  1L9D A;  1GTE A;  2ARD A;  4GUV A;  1TDO A;  2C75 A;  4H2R A;  5KRQ A;  1DJN A;  4NEV A;  4FX9 A;  4IA6 A;  2XVF A;  3UCL A;  1GRT A;  1DOD A;  3AEA A;  2YG3 A;  4OPG A;  2PYX A;  2JK6 A;  4Z43 A;  2X99 A;  3GWD A;  4FK1 C;  2TMD A;  3KA7 A;  3DK9 A;  1EL8 A;  3JSK A;  3VR9 A;  4E0V A;  4LA1 A;  4UDP A;  3AE1 A;  1F8S A;  2B7S A;  4C3X A;  2GF3 A;  5JCI A;  4H4R A;  2C73 A;  4D03 A;  1IUS A;  2ZBW A;  4H4Q A;  3VRA A;  4K7Z A;  3GSI A;  1VG0 A;  1K0I A;  2BAC A;  1GRE A;  3BNM A;  1PHH A;  1N4W A;  4CRT A;  4APN A;  4AP1 A;  4CCQ A;  2VZ2 A;  1CL0 A;  1PJ6 A;  4B63 A;  4XWR A;  2R0P A;  3QJ4 A;  5JCL A;  2GMJ A;  3NNE A;  1DOE A;  5BVA A;  1ZDL A;  2XVE A;  2PHH A;  3UOY A;  5M10 A;  4CNK A;  4Z24 A;  2GRT A;  1IUV A;  2C66 A;  3AE6 A;  1PXB A;  3Q6J A;  1KNP A;  4LU6 A;  1PS9 A;  2BCP A;  2R0C A;  4YKG A;  2XFN A;  3BI4 A;  3ICT A;  4H2Q A;  1F8R A;  3AE4 A;  4KX6 A;  2XFQ A;  4BK1 A;  4HB9 A;  2WU2 A;  1B37 A;  1FCD A;  2CFY A;  1TYT A;  1Y0P A;  3LAD A;  5KOX A;  2RGO A;  2WOI A;  2BS2 A;  4OCG A;  1IUT A;  1LQU A;  3RNM A;  5J7X A;  2YLZ A;  3ISH A;  3LZW A;  1PXA A;  3IWA A;  1OJD A;  4GDP A;  4CBQ A;  5FS7 A;  1E39 A;  3EF6 A;  4Y4N A;  4CY6 A;  2X3N A;  1GV4 A;  3ALM A;  1CJ4 A;  3CIR A;  3B6D A;  3KU9 A;  5IQ1 A;  4CY8 A;  3C96 A;  4C77 A;  3QSS A;  1IUX A;  1D7L A;  1NEN A;  3IF9 A;  1NHQ A;  1GAL A;  3ICR A;  5KXJ A;  2VRM A;  3AEG A;  3V3O A;  3SFD A;  2YAU A;  3K30 A;  2C65 A;  1S2Q A;  1LPF A;  1ZP0 A;  3CN8 A;  3AEF A;  1GET A;  3VRD B;  3UTF A;  4CNJ A;  1YQ4 A;  5KWF A;  2R4J A;  3L1R A;  3UOZ A;  1D4D A;  3NN0 X;  4NZH A;  1NHS A;  1H7W A;  2YM1 A;  4Z2T A;  2B9X A;  1NPX A;  1ONF A;  2GQF A;  1Q1R A;  4EM3 A;  5HY5 A;  2I0Z A;  3QVR A;  4EIP A;  3URH A;  1REO A;  3AE3 A;  2GQW A;  3UOX A;  2X8G A;  5CQF A;  3CPH G;  2OAM A;  2WHD A;  1ZY8 A;  4WX1 A;  4J56 A;  5ER0 A;  4DNA A;  2XLS A;  4TM4 A;  4TM1 A;  4A99 A;  3I3L A;  2BS3 A;  4IVM B;  1IUW A;  2XVI A;  2OLO A;  3NYC A;  2ZZ0 A;  3UKL A;  3NK1 X;  2ZZB A;  3PVC A;  4UDQ A;  1EBD A;  4B69 A;  3NYE A;  3QSM A;  3NYF A;  4U8O A;  2Y6Q A;  2EQ6 A;  1O5W A;  2A87 A;  1K4Q A;  4H4V A;  5HYM A;  3LXD A;  2AQJ A;  2R4E A;  4Z44 A;  2YLW A;  4H7U A;  3C4A A;  3SQP A;  4J31 A;  2YR4 A;  2GAH B;  1UKV G;  2JAE A;  1JEH A;  1NHR A;  1MO9 A;  1N4U A;  3G5R A;  1JOA A;  2XLR A;  3PS9 A;  4J34 A;  2GAG B;  2WPF A;  1KSS A;  1NG3 A;  3AWI A;  3AE2 A;  4ZCC A;  4JY3 A;  1YY5 A;  2XVH A;  4EMI A;  3CGE A;  3AEB A;  4N9X A;  4H50 A;  1P2H A;  2WET A;  2H89 A;  2Z5Y A;  4JY2 A;  4ZCD A;  1COY A;  3L8K A;  3DJE A;  5C3J A;  4J57 A;  5U1O A;  1TYP A;  2GVC A;  2F5Z A;  4UP3 A;  4OVI A;  3AYJ A;  3CGB A;  4U2S A;  3CTY A;  1JNZ A;  3NLC A;  4GCM A;  1CJ3 A;  4A6N A;  1GXF A;  4B68 A;  3KLJ A;  3RP8 A;  3GD3 A;  1BKW A;  3NG7 X;  3DA1 A;  4C5O A;  1JNR A;  1CBO A;  2WPC A;  3NK0 X;  2YLX A;  3UKF A;  1S3B A;  2B9W A;  5FS9 A;  2XLU A;  3D8X A;  5C2T A;  2WEU A;  3FPZ A;  4U8I A;  1E6E A;  1PBB A;  2B76 A;  2EQ9 A;  3GRT A;  3UP4 A;  3CGD A;  1PN0 A;  1DJQ A;  1S3E A;  1O95 A;  1KSU A;  2WU5 A;  2XFU A;  3GYI A;  2VVL A;  2YG5 A;  4YTM A;  4YSX A;  1Y56 A;  2Z5X A;  2V61 A;  2CUL A;  2W0H A;  3B3R A;  1X31 B;  1GEU A;  4YTN A;  2UZZ A;  2DKI A;  1H82 A;  1O94 A;  4KPR A;  4XXG A;  3C4N A;  1GRB A;  3NRN A;  3CNJ A;  4ICY A;  3VQR A;  4B1B A;  5FS8 A;  2QAE A;  4WCT A;  1NHP A;  3UP5 A;  4IVO B;  4U8N A;  1ZOV A;  1L9C A;  2BC0 A;  4TLX A;  2C3D A;  2VVM A;  1Z6L A;  3CPJ G;  2WP5 A;  4C74 A;  3LZX A;  1XPQ A;  1PJ5 A;  4OPD A;  1QLB A;  5JCK A;  1PBE A;  2BXS A;  3FG2 P;  1ZMC A;  2OA1 A;  4Y4L A;  3NHO X;  1F3P A;  1E1K A;  1LJ1 A;  1K0J A;  3EAN A;  3AYL A;  2BK3 A;  3AE9 A;  1D4E A;  3SM8 A;  4BK2 A;  1XDI A;  1LQT A;  3T37 A;  2C67 A;  1GRH A;  1GPE A;  2E5V A;  3CNT A;  2BK5 A;  2GEW A;  1GER A;  1CHU A;  4EQR A;  1NEK A;  4BJZ A;  1E1L A;  3S61 A;  1TDE A;  4EM4 A;  4H2P A;  1PXC A;  3HZL A;  2YG7 A;  2YG6 A;  3CGC A;  4JDR A;  4PAA A;  3BI2 A;  4YSZ A;  3AEE A;  2GV8 A;  1RYI A;  2XFO A;  4TM0 A;  3LB8 A;  4NEW A;  1VG9 A;  3AE7 A;  4YSH A;  3ALJ A;  4A7A A;  3UKA A;  2JB3 A;  2JB2 A;  1YQ3 A;  3AB1 A;  4Z2R A;  4NTD A;  4YWO A;  1F6M A;  4J33 A;  4BK3 A;  1GRA A;  2JKC A;  2JB1 A;  4CCR A;  1M6I A;  5LV9 A;  2YLR A;  4Z2U A;  4ADW A;  3ICS A;  4TM3 A;  1YKJ A;  3DK4 A;  3CND A;  2V3A A;  3RHA A;  4AOS A;  2VVL G;  4A9W A;  5HXI A;  1PJ7 A;  2AAQ A;  1CC2 A;  1DOB A;  2YLS A;  3QVP A;  4LII A;  2JBV A;  4AP3 A;  3LJP A;  2FJD A;  1FEC A;  3V76 A;  4U8M A;  3AE5 A;  4ZN0 A;  4EQX A;  1BF3 A;  2GR2 A;  3GRS A;  1KNR A;  3FIM B;  2IID A;  2XYO A;  2BYB A;  2XVJ A;  4H4W A;  3SFE A;  1BZL A;  3CNS A;  3P4Q A;  3UKH A;  2QA2 A;  3ITJ A;  3BI5 A;  5HHF A;  4X4J A;  2APG A;  1D7Y A;  2VRL A;  1H83 A;  4BJY A;  5CKU A;  3V3N A;  1CC4 A;  2V60 A;  2HQM A;  1JRX A;  1OJA A;  3WE0 A;  1E1M A;  4K8D A;  1KDG A;  2A8X A;  3ATR A;  3P4P A;  1LVL A;  2FBW A;  2XDO A;  4H4Z A;  1H81 A;  2VQB A;  1IUU A;  1FL2 A;  2XFP A;  2X8C A;  1GTH A;  3FBS A;  3KKJ A;  2C64 A;  5EBK A;  5GSN A;  4GF7 A;  1HYU A;  3SGL A;  1Y56 B;  3NIX A;  1PBC A;  3DH9 A;  5U63 A;  4C3Y A;  4FDC B;  2OAL A;  3H8I A;  4Z25 A;  3BNU A;  2BXR A;  2XLP A;  2DKH A;  4OPT A;  1B4V A;  3G5S A;  2B7R A;  4JQ9 A;  3AD9 B;  3AEC A;  4A79 A;  5EB4 A;  2O9Z A;  4B66 A;  2EQ7 A;  4A5L A;  4A6N B;  1RSG A;  4JNA A;  2WDR A;  3Q9T A;  3H8L A;  1F8W A;  1NG4 A;  3IHM A;  2IVE A;  1KF6 A;  3F8D A;  2R45 A;  1N1P A;  3GMB A;  4D04 A;  3P1W A;  5GRT A;  2BAB A;  4OPC A;  2TPR A;  4U8P A;  1ELI A; 
#chains in the Genus database with same CATH topology
 5U25 A;  2E4G A;  3CXB A;  2BC1 A;  4HN8 A;  4DN1 A;  3CB3 A;  1XS2 A;  2BS4 A;  1OJ9 A;  2BCG G;  2GR1 A;  3NK2 X;  2VOU A;  3IJL A;  1LTX R;  3SZ0 A;  2YVG A;  3HYV A;  5BUK A;  3AD8 B;  3UJF A;  4JNQ A;  1L9E A;  3FJ4 A;  2YWL A;  1L0V A;  3QFB A;  4UDR A;  2NVK X;  4GAP A;  3N6H A;  2RGJ A;  3IJQ A;  3AXB A;  2H88 A;  4DGK A;  1NAA A;  3A7A A;  4GRT A;  5IQ4 A;  2FYM A;  3S5W A;  1E1N A;  3COX A;  4BUR A;  5FMH A;  3VDG A;  1QJD A;  3GDP A;  4FK1 A;  2WOW A;  2OLN A;  3DGH A;  3AE8 A;  5FS6 A;  4DWD A;  3NH3 X;  4KPL A;  4YT0 A;  3GY1 A;  2WDV A;  2C3C A;  5EOW A;  2Q6U A;  3DJG X;  3GWF A;  3UXK A;  1MXT A;  2OVL A;  2C72 A;  1H86 A;  1GSN A;  3OC4 A;  4MMW A;  3R0K A;  4OPU A;  3QPE A;  4YXD A;  3NRZ B;  5TR3 A;  2C7G A;  1TDN A;  4G8T A;  1NDA A;  3I4K A;  1GRF A;  4DSG A;  4RSL A;  4IA5 A;  5KOW A;  3T4W A;  1GT8 A;  2GR3 A;  5FJU A;  3V5C A;  3TW9 A;  2Q7V A;  5IPY A;  3GD4 A;  1TDF A;  3VRB A;  2J3N A;  4U8L A;  3O0H A;  5BOE A;  1JRY A;  2XLT A;  3DEQ A;  5JCN A;  4M52 A;  1GTE A;  4H2R A;  5KRQ A;  2XVF A;  4Z43 A;  3GWD A;  2P88 A;  3DK9 A;  4GGB A;  1EL8 A;  3JSK A;  2OO6 A;  3D9X A;  2W54 A;  2XH7 A;  1ELS A;  4LA1 A;  1F8S A;  3SY4 A;  2GF3 A;  4D03 A;  1IUS A;  3UCC A;  3VRA A;  1VG0 A;  2BAC A;  1PHH A;  4APN A;  4B63 A;  1MNS A;  3QJ4 A;  5BVA A;  5JRB A;  2C66 A;  3HPF A;  1PXB A;  4G9K A;  4LU6 A;  2R0C A;  3ICT A;  3AE4 A;  5KMP A;  2RGO A;  2BS2 A;  4HCD A;  2POZ A;  4GDP A;  4CY6 A;  1E39 A;  5IQ1 A;  7ENL A;  3C96 A;  3QSS A;  1NEN A;  3IF9 A;  1NHQ A;  1R6W A;  2VRM A;  2GGI A;  1LPF A;  3AEF A;  1GET A;  4HCH A;  1YQ4 A;  5KWF A;  2OQH A;  2R4J A;  3L1R A;  4GIS A;  3UOZ A;  1D4D A;  3PFR A;  2XH2 A;  3Q4D A;  4EM3 A;  2I0Z A;  3NVY B;  2GQW A;  2X8G A;  3R07 C;  3CPH G;  2OAM A;  5ER0 A;  4Z1Y A;  4A99 A;  4IVM B;  1IUW A;  5EU9 A;  3NYC A;  4UDQ A;  4GYP C;  3LXD A;  3C4A A;  4J31 A;  1JEH A;  4E4F A;  1MO9 A;  3PS9 A;  1H2I A;  3AWI A;  3CGE A;  4N9X A;  4JY2 A;  4TVY A;  4EWJ A;  2AKZ A;  3AYJ A;  3SYI A;  1CJ3 A;  3TWA A;  1SJD A;  1E9I A;  1WUE A;  4ENL A;  3KLJ A;  3GD3 A;  3SZC A;  2BRY A;  1CBO A;  2WPC A;  2B9W A;  1E6E A;  1PBB A;  2B76 A;  3RR1 A;  2WU5 A;  1KSU A;  2RDX A;  2YG5 A;  4IHC A;  2CUL A;  2W0H A;  1X31 B;  1P43 A;  4YTN A;  1JRP A;  4KPR A;  4A6G A;  3VQR A;  5FS8 A;  4IT1 A;  3UP5 A;  4IVO B;  1ZOV A;  4C74 A;  1Z6L A;  2OFJ A;  3LZX A;  2XH0 A;  3EKG A;  1PBE A;  1N61 C;  3AE9 A;  4BK2 A;  3P93 A;  3Q45 A;  1XDI A;  1LQT A;  2I5Q A;  2GEW A;  1GER A;  1CHU A;  3P3B A;  1NEK A;  3HYW A;  3HZL A;  4H1Z A;  2XFO A;  4YSH A;  4A7A A;  2JB3 A;  3AB1 A;  1FIQ B;  1F6M A;  4J33 A;  2JB1 A;  4CCR A;  2HXT A;  2DW7 A;  2PP0 A;  3RHA A;  4A9W A;  5HXI A;  2AAQ A;  1DOB A;  4AP3 A;  3V76 A;  4U8M A;  3AE5 A;  2BYB A;  2XVJ A;  1BZL A;  3P4Q A;  2QA2 A;  4E8G A;  4BJY A;  5CKU A;  2HQM A;  1E1M A;  1KDG A;  3H12 A;  4K1W A;  3ATR A;  1H81 A;  5FJP A;  2X8C A;  3SJN A;  1FFV C;  3NO1 A;  2OZ3 A;  1P48 A;  5GSN A;  3SGL A;  1JPD X;  1L8P A;  1B4V A;  4JQ9 A;  4B66 A;  2W3R A;  4ROP A;  3STP A;  1F8W A;  1N1P A;  1ONE A;  3ZVH A;  5J60 A;  3CXO A;  3P9U A;  3QSE A;  4JN9 A;  1T3Q C;  2IVD A;  2YM2 A;  3ZDN A;  1XHC A;  4USR A;  2R9Z A;  4ZOH B;  3OZ2 A;  4OPI A;  2OPJ A;  3UKQ A;  2QQ6 A;  4MKS A;  1IYX A;  3UKK A;  4TLZ A;  3UCD A;  2WBA A;  2EQ8 A;  3NTD A;  2A89 A;  2WOV A;  4G74 A;  1KFY A;  3QLD A;  4NTC A;  1YEY A;  1SEZ A;  3RP7 A;  3F8P A;  2WQY A;  2FJE A;  3T14 A;  3K7Q X;  3NN6 X;  2QA1 A;  4ECH A;  2QCU A;  3UTE A;  2FJA A;  2ACZ A;  4K2X A;  4YSY A;  1FEB A;  3BOX A;  3AM9 A;  2RGH A;  4E4U A;  1RP0 A;  4X9M A;  4U2L A;  1D4C A;  2QVH A;  1N4V A;  4B64 A;  3F8R A;  3CAW A;  1LV0 A;  4H4P A;  3OZY A;  1PBF A;  3FMW A;  5KVI A;  3PWG A;  4B67 A;  3DJJ A;  1TKK A;  1Q1W A;  4K5R A;  2WDQ A;  1GRG A;  3E1T A;  5JCM A;  2WS3 A;  4FP1 A;  3N6J A;  4HA6 A;  4YKF A;  1OJC A;  4B65 A;  1VRQ B;  4H4X A;  4KT2 A;  4TVW A;  4I58 A;  3M0O A;  3FXG A;  2PU0 A;  3K7T A;  3DGZ A;  3NVW B;  3GYJ A;  2C76 A;  4MGG A;  2BK4 A;  4II3 A;  1RVK A;  3CNP A;  2YLT A;  3JW7 A;  3LOV A;  3ATQ A;  3CT2 A;  1FHU A;  3NXL A;  4H4T A;  3DK8 A;  3PO7 A;  3H4K A;  4H4Y A;  3B97 A;  3QFA A;  1ZX9 A;  1MUC A;  2YQU A;  1VQZ A;  2AR8 A;  3SX6 A;  2GMH A;  4HNC A;  1DNC A;  3UKP A;  4H4U A;  4GUV A;  4IZG A;  1JPM A;  1TDO A;  3T2Z A;  1DJN A;  4IA6 A;  3GC2 A;  4H83 A;  3UCL A;  3AEA A;  4OPG A;  2PYX A;  4FK1 C;  2QJM A;  2P3Z A;  4IP4 A;  4GFI A;  2HXU A;  2B7S A;  4C3X A;  1V97 A;  2ZBW A;  4H4Q A;  4K7Z A;  1K0I A;  3BNM A;  4CRT A;  2VZ2 A;  1CL0 A;  1STZ A;  2R0P A;  5ENL A;  3DFY A;  1ZDL A;  3UOY A;  5M10 A;  1BQG A;  3AE6 A;  3GYX A;  1KNP A;  3DG3 A;  2XFN A;  1FFU C;  2PP1 A;  4HCL A;  1B37 A;  2OLA A;  1TYT A;  1Y0P A;  4A35 A;  3U9I A;  5KOX A;  1EC7 A;  1EBH A;  1LQU A;  3RNM A;  3PG6 A;  2OX4 A;  3LZW A;  3IWA A;  5FS7 A;  2X3N A;  1GV4 A;  3ALM A;  3B6D A;  3KUM A;  3ZLH A;  4GME A;  3ICR A;  3RO6 A;  2YAU A;  3TQP A;  3CN8 A;  1WUF A;  3MWC A;  2GL5 A;  4IP5 A;  2NQL A;  2YM1 A;  2B9X A;  1NPX A;  1Q1R A;  4EIP A;  1REO A;  1TE6 A;  1ZY8 A;  3DDM A;  4DNA A;  4G6G A;  4TM4 A;  2BS3 A;  2OLO A;  3UKL A;  3B9J B;  3NK1 X;  3PVC A;  1EBD A;  1K4Q A;  3VCN A;  5HYM A;  2AQJ A;  4H7U A;  3SQP A;  4DXK A;  2JAE A;  2PS2 A;  1NHR A;  3K1G A;  1N4U A;  1JOA A;  4J34 A;  3SSZ A;  3V5F A;  2GGE A;  4JY3 A;  1YY5 A;  2XVH A;  3AEB A;  1P2H A;  2WET A;  4ZCD A;  4J57 A;  5U1O A;  1TYP A;  2F5Z A;  3VFC A;  3CGB A;  4U2S A;  1JNZ A;  3A7U A;  4GCM A;  3MQT A;  4A6N A;  3QKE A;  4B68 A;  3D47 A;  1BKW A;  3NK0 X;  3UKF A;  3TWB A;  2WEU A;  3FPZ A;  3I6T A;  1PN0 A;  3RCY A;  1S3E A;  4YTM A;  3FYY A;  2V61 A;  3JZU A;  2DKI A;  1H82 A;  4B1B A;  3CNJ A;  3DG7 A;  2BC0 A;  2C3D A;  2VVM A;  1XPQ A;  4OPD A;  2OA1 A;  4Y4L A;  3FG2 P;  1E1K A;  1D4E A;  2GGH A;  3T37 A;  1GPE A;  1SJC A;  1FO4 A;  3S61 A;  4H2P A;  3EEZ A;  1PXC A;  4PAA A;  4JDR A;  3I6E A;  3BI2 A;  4TM0 A;  1BKH A;  4NEW A;  3UKA A;  2JB2 A;  4YWO A;  4BK3 A;  4GGH A;  3IJI A;  2P8C A;  4ADW A;  3ICS A;  4TM3 A;  3SXI A;  2V3A A;  4AOS A;  4LII A;  2JBV A;  1KKO A;  2GR2 A;  3SQS A;  2IID A;  3SBF A;  2XYO A;  3CNS A;  3GD6 A;  2VRL A;  2XSX A;  1H83 A;  3V3N A;  2V60 A;  3WE0 A;  3CK5 A;  3AN1 A;  4K8D A;  1LVL A;  4GYP A;  6ENL A;  2VQB A;  3OZM A;  3R0U A;  2HZG A;  2C64 A;  4GF7 A;  1F9C A;  1Y56 B;  2OAL A;  4A79 A;  2O9Z A;  2EQ7 A;  3Q9T A;  3H8L A;  1KF6 A;  2R45 A;  3GMB A;  3OTR A;  3H70 A;  3NS1 B;  3UGV A;  2ZAD A;  3V4B A;  2E1M A;  3MUC A;  2BA9 A;  3VC6 A;  2Q0K A;  1VQW A;  3R10 A;  4AOX A;  3HW2 A;  2GH5 A;  3M13 A;  5DBJ A;  3KD9 A;  1JCT A;  4Z26 A;  4EQS A;  4A65 A;  2FJB A;  4GR1 A;  4KWS A;  1FOH A;  2VQ7 A;  2X50 A;  3GO2 A;  2PSN A;  3NT6 A;  3P4R A;  3GMC A;  4EMJ A;  1ZK7 A;  3AED A;  2GSH A;  3RRA A;  4GDE A;  2YR5 A;  4RG4 A;  1BGJ A;  4G7F A;  3BHF A;  2PGE A;  2Y6R A;  3RIT A;  3DME A;  3EAO A;  3H7V A;  2GR0 A;  4ZA0 A;  1TDK A;  3P4S A;  3AD7 B;  4U2T A;  1V59 A;  4YTP A;  1JRZ A;  1Q9I A;  3CPI G;  3G5Q A;  1YQZ A;  3SR6 B;  2YG4 A;  4YWS A;  3HRD C;  1KN0 A;  4H4S A;  1GND A;  4E6M A;  1CF3 A;  5BRT A;  3KPK A;  5M0Z A;  1MRA A;  1BWC A;  3ZYX A;  3GDN A;  4JN8 A;  3R9U A;  1PDH A;  2R0G A;  2YVF A;  1M64 A;  4EIQ A;  1GES A;  2WES A;  1CJC A;  3DJD A;  3QTP A;  2AL1 A;  2QDE A;  2P8B A;  1ZKQ A;  3ZVI A;  3T9P A;  1EL5 A;  1EL7 A;  3UOV A;  2E5A A;  3K7M X;  4XWZ A;  3EPT A;  1JU2 A;  3KPF A;  3NTA A;  3ABV A;  1H84 A;  2ZZC A;  1H7X A;  4HNL A;  3UTG A;  2PTY A;  5G5H B;  2GB0 A;  2V6O A;  1E7P A;  3NVZ B;  3RP6 A;  1DXL A;  2X8H A;  3SN1 A;  4IL0 A;  1L9D A;  2ARD A;  4GAV A;  1N5X A;  2MNR A;  4NEV A;  4FX9 A;  1DOD A;  1R0M A;  1N5W C;  2X99 A;  2TMD A;  5KNL A;  3KA7 A;  3VR9 A;  4E0V A;  4UDP A;  5JCI A;  4H4R A;  3T31 A;  1GRE A;  3R25 A;  4AP1 A;  4XWR A;  3V3W A;  5JCL A;  2GMJ A;  3NNE A;  2XVE A;  3VC5 A;  4Z24 A;  2GRT A;  3Q6J A;  1FHV A;  3FVD A;  2XFQ A;  2WU2 A;  3THU A;  2CFY A;  3LAD A;  2O56 A;  4K8G A;  4OCG A;  1IUT A;  3ISH A;  1PXA A;  3OW1 A;  2PP3 A;  4C77 A;  1IUX A;  1D7L A;  3UJR A;  2ONE A;  3ENL A;  3V3O A;  3VCC A;  3S47 A;  2C65 A;  3ES7 A;  1ZP0 A;  4CNJ A;  3JVA A;  2C4C A;  1NU5 A;  4Z2T A;  3SN0 A;  1ONF A;  3URH A;  3UOX A;  2WHD A;  3DGB A;  4J56 A;  4TM1 A;  2GDQ A;  2AKM A;  2ZZ0 A;  1N62 C;  1SJA A;  4B69 A;  3QSM A;  3NYF A;  4U8O A;  2Y6Q A;  1O5W A;  4H4V A;  2R4E A;  4Z44 A;  2YLW A;  2GAH B;  2XLR A;  4ZCW A;  1KSS A;  1NG3 A;  4ZCC A;  2PGW A;  4X2P A;  2H89 A;  2PCE A;  2GVC A;  4UP3 A;  4OVI A;  2AL2 A;  3CTY A;  3NLC A;  2OZ8 A;  3RP8 A;  3DA1 A;  4C5O A;  2YLX A;  5FS9 A;  4U8I A;  3ZVH B;  2EQ9 A;  3GRT A;  3UP4 A;  1DJQ A;  1O95 A;  1Y56 A;  1GEU A;  1O94 A;  4J1O A;  4XXG A;  3C4N A;  3NRN A;  2QAE A;  1S7M A;  3OP2 A;  1QLB A;  5JCK A;  5KMR A;  1ZMC A;  3NHO X;  3TCS A;  1K0J A;  3EAN A;  2BK3 A;  5KMQ A;  3PWI A;  3TJI A;  4Z17 A;  2C67 A;  2E5V A;  4BJZ A;  2PTW A;  1TDE A;  3CGC A;  4YSZ A;  2GV8 A;  1X2G A;  3AE7 A;  1KCZ A;  3ALJ A;  3OPS A;  4NTD A;  1GRA A;  1TZZ A;  3N4E A;  5LV9 A;  2YLR A;  1YKJ A;  2VVL G;  2YLS A;  3QVP A;  1FEC A;  4ZN0 A;  4EQX A;  3ZLG A;  4H4W A;  3CYJ A;  3SFE A;  2OG9 A;  3BI5 A;  3ZLF A;  1NEL A;  2FKP A;  2APG A;  1D7Y A;  3AMZ A;  1OEP A;  1SJB A;  2PA6 A;  1CC4 A;  2GGJ A;  2FBW A;  2XH4 A;  1FL2 A;  1GTH A;  3FBS A;  3KKJ A;  1HYU A;  5KMS A;  3NIX A;  4FDC B;  3H8I A;  4Z25 A;  3BNU A;  2XLP A;  2DKH A;  2B7R A;  3CMM A;  3AD9 B;  3AEC A;  3DFH A;  4A3R A;  4JNA A;  2WDR A;  2MUC A;  1NG4 A;  3F8D A;  1EBG A;  5GRT A;  2BAB A;  4OPC A;  4H19 A;  2B9Y A;  4U8P A;  4G6H A;  1ELI A;  2NPX A;  3MY9 A;  1BGN A;  1GOS A;  4MJW A;  3KVE A;  1XAN A;  2PPG A;  4AT0 A;  2WPE A;  1PDZ A;  1MDL A;  3BHK A;  3EUB 3;  3P0W A;  3FCP A;  1CJ2 A;  5BUL A;  3ETR B;  3D1C A;  4O5U A;  4O5Q A;  1PBD A;  2CDU A;  3IK4 A;  3MZN A;  3TOY A;  4U8J A;  4H2N A;  3DG6 A;  1ZOY A;  2WP9 A;  3ADA B;  3II4 A;  2YVJ A;  1S2Y A;  4DSH A;  4IV9 A;  5KVH A;  1B8S A;  3NGC X;  5G5G B;  3AYI A;  5L46 A;  1N60 C;  3ALL A;  3M12 A;  1ZMD A;  2V5Z A;  4J36 A;  2WP6 A;  5EB5 A;  3TTE A;  4J2W A;  3NVV B;  4I59 A;  3UJS A;  4P9S A;  4U8K A;  2E3T A;  2DW6 A;  1P2E A;  3U4F A;  4REK A;  5J04 A;  4Y4M A;  4PAB A;  4AT2 A;  1RM6 B;  4K22 A;  2XCG A;  3H8A A;  1CC6 A;  3R1Z A;  1EL9 A;  4E5T A;  3VR8 A;  4EMW A;  2R46 A;  1JRO A;  1IJH A;  2CVJ A;  4OPL A;  1TRB A;  1W4X A;  3T2Y A;  1MOK A;  4NNJ A;  1DOC A;  3IHG A;  1B5Q A;  2Q0L A;  4USQ A;  2V3B A;  3QN3 A;  3UTH A;  1EC8 A;  4BV6 A;  1VDC A;  3RED A;  3L5O A;  3I6D A;  2P0I A;  5FJO A;  2RAB A;  4K5S A;  3NKS A;  2C70 A;  3S5S A;  1OJT A;  3SN4 A;  4X9N A;  1H6V A;  3NFU A;  4EQW A;  5FJT A;  3IC9 A;  1ECQ A;  1JDF A;  4RG3 A;  1QO8 A;  1FEA A;  1D5T A;  1AOG A;  2YR6 A;  4NTE A;  1K0L A;  4DX3 A;  3T2K A;  2C75 A;  4HPN A;  1GRT A;  2YG3 A;  2JK6 A;  4GIR A;  3AE1 A;  2C73 A;  3GSI A;  1N4W A;  4CCQ A;  1PJ6 A;  4DYE A;  1DOE A;  2PHH A;  4CNK A;  1IUV A;  2CHR A;  1PS9 A;  2PMQ A;  2BCP A;  4YKG A;  4KX6 A;  3BI4 A;  4H2Q A;  2OQY A;  2PTX A;  1F8R A;  4BK1 A;  4HB9 A;  1FCD A;  2WOI A;  5J7X A;  2YLZ A;  1OJD A;  4CBQ A;  3EF6 A;  4Y4N A;  2W55 A;  3A7R A;  1CJ4 A;  3CIR A;  3KU9 A;  4CY8 A;  1GAL A;  5KXJ A;  4KEM A;  3AEG A;  3RGT A;  3SFD A;  3K30 A;  4K2S A;  1S2Q A;  4JHM A;  3VRD B;  3UTF A;  3T6C A;  2XGZ A;  4M6U A;  3NN0 X;  4NZH A;  1NHS A;  1H7W A;  5HY5 A;  2GQF A;  3UJ2 A;  3QVR A;  5BOF A;  3AE3 A;  2BRA A;  5CQF A;  3VA8 A;  4WX1 A;  2XLS A;  2QDD A;  3I3L A;  2XVI A;  2ZZB A;  3NYE A;  3N4F A;  4IL2 A;  2EQ6 A;  2A87 A;  1KD0 A;  1WYG A;  2YR4 A;  1UKV G;  2QJJ A;  2W3S A;  3G5R A;  3DIP A;  2QJN A;  1W6T A;  2GAG B;  2WPF A;  2HNE A;  3AE2 A;  3UJE A;  1ZXI C;  4EMI A;  4H50 A;  2Z5Y A;  1COY A;  3L8K A;  3DJE A;  5C3J A;  2GGG A;  3TJ4 A;  1X2H A;  1GXF A;  3NG7 X;  1XPY A;  1JNR A;  1S3B A;  3PK7 A;  2XLU A;  3DES A;  3FV9 A;  3D8X A;  5C2T A;  4G73 A;  3SZW A;  3CGD A;  2XFU A;  3GYI A;  2VVL A;  4YSX A;  2Z5X A;  1EC9 A;  3B3R A;  2UZZ A;  4NWZ A;  4ICY A;  1GRB A;  3HYX A;  3NZG A;  4WCT A;  1NHP A;  4U8N A;  4TLX A;  1L9C A;  1DTN A;  3CPJ G;  2WP5 A;  1PJ5 A;  2BXS A;  1VDV A;  1F3P A;  4H2H A;  1LJ1 A;  3AYL A;  2OKT A;  3SM8 A;  1MDR A;  4HYR A;  1SB3 B;  1GRH A;  3CNT A;  3ES8 A;  2BK5 A;  3UXL A;  1PDY A;  4EQR A;  1E1L A;  4EM4 A;  4F4R A;  4FI4 A;  2YG6 A;  2YG7 A;  3AEE A;  1RYI A;  3LB8 A;  1VG9 A;  4II2 A;  1YQ3 A;  3DER A;  4Z2R A;  3R11 A;  2JKC A;  1M6I A;  4Z2U A;  3T8Q A;  3DK4 A;  3CND A;  1PJ7 A;  1CC2 A;  2PU1 A;  4DHG A;  3LJP A;  2FJD A;  1BF3 A;  3GRS A;  1KNR A;  3FIM B;  2AL2 B;  3UKH A;  4J3Z A;  3ITJ A;  2ZC8 A;  5HHF A;  4X4J A;  4M0X A;  1KKR A;  5FJR A;  1JRX A;  1OJA A;  2A8X A;  3P4P A;  3BJS A;  2XDO A;  4H4Z A;  2QGY A;  1IUU A;  2XFP A;  3MSY A;  5EBK A;  2POD A;  1PBC A;  3DH9 A;  5U63 A;  4C3Y A;  2PTZ A;  3MKC A;  1N63 C;  2BXR A;  4OPT A;  2OZT A;  3G5S A;  3T0K A;  5EB4 A;  5IDZ A;  4A5L A;  4A6N B;  1RSG A;  4JN7 A;  3SZF A;  3IHM A;  2IVE A;  3BSM A;  3D46 A;  4D04 A;  3P1W A;  2TPR A; 
#chains in the Genus database with same CATH homology
 5J60 A;  3P9U A;  3QSE A;  4JN9 A;  2IVD A;  2YM2 A;  5U25 A;  3ZDN A;  2NPX A;  2BA9 A;  2E4G A;  1BGN A;  2BC1 A;  1GOS A;  4MJW A;  3KVE A;  1XHC A;  4USR A;  2Q0K A;  1XAN A;  1VQW A;  4AT0 A;  2BS4 A;  2WPE A;  4AOX A;  3M13 A;  2GH5 A;  2R9Z A;  3BHK A;  3OZ2 A;  1OJ9 A;  4OPI A;  5DBJ A;  3KD9 A;  2BCG G;  4Z26 A;  3UKQ A;  1CJ2 A;  2GR1 A;  3NK2 X;  2VOU A;  4EQS A;  5BUL A;  4A65 A;  1LTX R;  3UKK A;  4TLZ A;  3SZ0 A;  3D1C A;  2E1M A;  4O5U A;  4O5Q A;  2WBA A;  1PBD A;  2YVG A;  3HYV A;  2CDU A;  2FJB A;  2EQ8 A;  3NTD A;  4H2N A;  4U8J A;  5BUK A;  2A89 A;  1ZOY A;  2WOV A;  2WP9 A;  4GR1 A;  3ADA B;  1KFY A;  1FOH A;  3AD8 B;  4G74 A;  2VQ7 A;  4NTC A;  2X50 A;  1SEZ A;  3II4 A;  2YVJ A;  4JNQ A;  1L9E A;  3NT6 A;  3RP7 A;  3F8P A;  2WQY A;  2FJE A;  3P4R A;  2B9Y A;  3K7Q X;  3T14 A;  1S2Y A;  2YWL A;  3NN6 X;  3GMC A;  2QA1 A;  4EMJ A;  4DSH A;  1L0V A;  1ZK7 A;  2QCU A;  3AED A;  4ECH A;  3QFB A;  4IV9 A;  4UDR A;  2NVK X;  3UTE A;  4GAP A;  5KVH A;  2FJA A;  1B8S A;  2ACZ A;  2RGJ A;  3AXB A;  4GDE A;  4K2X A;  2H88 A;  2YR5 A;  3NGC X;  1BGJ A;  4RG4 A;  4DGK A;  3BHF A;  1NAA A;  4YSY A;  4GRT A;  3AYI A;  5L46 A;  1FEB A;  5IQ4 A;  2Y6R A;  3DME A;  2RGH A;  3ALL A;  1RP0 A;  3M12 A;  3S5W A;  4X9M A;  1ZMD A;  4U2L A;  1E1N A;  2V5Z A;  3COX A;  1D4C A;  3EAO A;  5FMH A;  4BUR A;  4J36 A;  1N4V A;  3GDP A;  1QJD A;  2GR0 A;  2WP6 A;  4B64 A;  5EB5 A;  4FK1 A;  2WOW A;  2OLN A;  3F8R A;  3DGH A;  4J2W A;  3AE8 A;  1TDK A;  5FS6 A;  4I59 A;  3NH3 X;  1LV0 A;  3P4S A;  4H4P A;  1PBF A;  4YT0 A;  3FMW A;  5KVI A;  3AD7 B;  4P9S A;  4U2T A;  1V59 A;  4YTP A;  4U8K A;  1JRZ A;  4B67 A;  1Q9I A;  1P2E A;  2WDV A;  3DJJ A;  3CPI G;  1Q1W A;  2C3C A;  4K5R A;  5EOW A;  2WDQ A;  4REK A;  2Q6U A;  4Y4M A;  1GRG A;  4PAB A;  3E1T A;  4AT2 A;  3DJG X;  5JCM A;  2WS3 A;  3G5Q A;  3GWF A;  4K22 A;  1YQZ A;  1MXT A;  2YG4 A;  2C72 A;  1H86 A;  4HA6 A;  1GSN A;  1KN0 A;  4H4S A;  1GND A;  2XCG A;  4YKF A;  1CF3 A;  5BRT A;  3OC4 A;  3KPK A;  5M0Z A;  1CC6 A;  1OJC A;  4B65 A;  1VRQ B;  1EL9 A;  4H4X A;  4I58 A;  4OPU A;  3M0O A;  1BWC A;  3VR8 A;  4EMW A;  3K7T A;  2R46 A;  3ZYX A;  2CVJ A;  1IJH A;  3GDN A;  4OPL A;  3R9U A;  1TRB A;  3DGZ A;  4YXD A;  1PDH A;  5TR3 A;  1W4X A;  2C7G A;  1TDN A;  2R0G A;  1MOK A;  2YVF A;  3T2Y A;  3GYJ A;  1M64 A;  4EIQ A;  4NNJ A;  1GES A;  1DOC A;  2WES A;  1NDA A;  1CJC A;  1B5Q A;  2BK4 A;  2C76 A;  2Q0L A;  3DJD A;  2V3B A;  1GRF A;  3IHG A;  4II3 A;  4USQ A;  3UTH A;  4DSG A;  3CNP A;  4RSL A;  2YLT A;  1ZKQ A;  3LOV A;  1EL5 A;  4IA5 A;  5KOW A;  4BV6 A;  1EL7 A;  1VDC A;  3ATQ A;  3K7M X;  3UOV A;  3RED A;  3L5O A;  3I6D A;  4XWZ A;  4H4T A;  2RAB A;  4K5S A;  3NKS A;  3EPT A;  2C70 A;  3DK8 A;  1GT8 A;  2GR3 A;  1OJT A;  3H4K A;  3PO7 A;  4H4Y A;  2Q7V A;  5IPY A;  3GD4 A;  1JU2 A;  1TDF A;  4X9N A;  1H6V A;  3QFA A;  3VRB A;  3KPF A;  4EQW A;  3NTA A;  3ABV A;  2J3N A;  4U8L A;  1H84 A;  2ZZC A;  1ZX9 A;  3O0H A;  1H7X A;  2YQU A;  1JRY A;  2XLT A;  3UTG A;  2GB0 A;  2V6O A;  3IC9 A;  1E7P A;  3RP6 A;  4RG3 A;  1QO8 A;  1DXL A;  1FEA A;  1D5T A;  5JCN A;  2AR8 A;  3SX6 A;  4M52 A;  1AOG A;  2GMH A;  2YR6 A;  2X8H A;  1DNC A;  3UKP A;  4H4U A;  4NTE A;  1K0L A;  1L9D A;  1GTE A;  2ARD A;  4GUV A;  1TDO A;  4GAV A;  3T2K A;  2C75 A;  4H2R A;  3T2Z A;  5KRQ A;  1DJN A;  4NEV A;  4FX9 A;  4IA6 A;  2XVF A;  3UCL A;  1GRT A;  1DOD A;  3AEA A;  2YG3 A;  4OPG A;  2PYX A;  2JK6 A;  4Z43 A;  2X99 A;  3GWD A;  4FK1 C;  2TMD A;  5KNL A;  3KA7 A;  3DK9 A;  1EL8 A;  3JSK A;  3VR9 A;  4E0V A;  3D9X A;  4LA1 A;  4UDP A;  3AE1 A;  1F8S A;  2B7S A;  3SY4 A;  2GF3 A;  5JCI A;  4C3X A;  4H4R A;  2C73 A;  3T31 A;  4D03 A;  1IUS A;  2ZBW A;  4H4Q A;  3VRA A;  4K7Z A;  3GSI A;  1VG0 A;  1K0I A;  2BAC A;  1GRE A;  3BNM A;  1PHH A;  1N4W A;  4CRT A;  4APN A;  4AP1 A;  4CCQ A;  2VZ2 A;  1CL0 A;  1PJ6 A;  4B63 A;  4XWR A;  2R0P A;  3QJ4 A;  5JCL A;  2GMJ A;  3NNE A;  1DOE A;  5BVA A;  1ZDL A;  2XVE A;  2PHH A;  3UOY A;  5M10 A;  4CNK A;  4Z24 A;  2GRT A;  5JRB A;  1IUV A;  2C66 A;  3AE6 A;  1PXB A;  3GYX A;  4G9K A;  3Q6J A;  1KNP A;  4LU6 A;  1PS9 A;  2BCP A;  2R0C A;  4YKG A;  2XFN A;  3BI4 A;  3ICT A;  4H2Q A;  1F8R A;  3AE4 A;  4KX6 A;  2XFQ A;  4BK1 A;  4HB9 A;  5KMP A;  2WU2 A;  1B37 A;  1FCD A;  2CFY A;  1TYT A;  1Y0P A;  3LAD A;  5KOX A;  2RGO A;  2WOI A;  2BS2 A;  4OCG A;  1IUT A;  1LQU A;  3RNM A;  3PG6 A;  5J7X A;  2YLZ A;  3ISH A;  3LZW A;  1PXA A;  3IWA A;  1OJD A;  4GDP A;  4CBQ A;  5FS7 A;  1E39 A;  3EF6 A;  4Y4N A;  4CY6 A;  2X3N A;  1GV4 A;  3ALM A;  1CJ4 A;  3CIR A;  3B6D A;  3KU9 A;  5IQ1 A;  4CY8 A;  3C96 A;  4C77 A;  3QSS A;  1IUX A;  1D7L A;  1NEN A;  3IF9 A;  1NHQ A;  1GAL A;  3ICR A;  5KXJ A;  2VRM A;  3AEG A;  3V3O A;  3SFD A;  2YAU A;  3K30 A;  2C65 A;  1S2Q A;  1LPF A;  1ZP0 A;  3CN8 A;  3AEF A;  1GET A;  3VRD B;  3UTF A;  4CNJ A;  1YQ4 A;  5KWF A;  2R4J A;  3L1R A;  2C4C A;  3UOZ A;  1D4D A;  3NN0 X;  4NZH A;  1NHS A;  1H7W A;  2YM1 A;  4Z2T A;  2B9X A;  1NPX A;  1ONF A;  2GQF A;  1Q1R A;  4EM3 A;  5HY5 A;  2I0Z A;  3QVR A;  4EIP A;  3URH A;  1REO A;  3AE3 A;  2GQW A;  3UOX A;  2BRA A;  2X8G A;  5CQF A;  3CPH G;  2OAM A;  2WHD A;  1ZY8 A;  4WX1 A;  4J56 A;  5ER0 A;  4DNA A;  2XLS A;  4G6G A;  4TM4 A;  4TM1 A;  3I3L A;  4A99 A;  2BS3 A;  4IVM B;  1IUW A;  2XVI A;  2OLO A;  3NYC A;  2ZZ0 A;  3UKL A;  3NK1 X;  2ZZB A;  3PVC A;  4UDQ A;  1EBD A;  4B69 A;  3NYE A;  3QSM A;  3NYF A;  4U8O A;  2Y6Q A;  2EQ6 A;  1O5W A;  2A87 A;  1K4Q A;  4H4V A;  5HYM A;  3LXD A;  2AQJ A;  2R4E A;  4Z44 A;  2YLW A;  4H7U A;  3C4A A;  3SQP A;  4J31 A;  2YR4 A;  2GAH B;  1UKV G;  2JAE A;  1JEH A;  1NHR A;  1MO9 A;  1N4U A;  3G5R A;  1JOA A;  2XLR A;  3PS9 A;  4J34 A;  2GAG B;  2WPF A;  1KSS A;  1NG3 A;  1H2I A;  3AE2 A;  3AWI A;  4ZCC A;  4JY3 A;  1YY5 A;  2XVH A;  4EMI A;  3CGE A;  3AEB A;  4N9X A;  4H50 A;  1P2H A;  2WET A;  2H89 A;  2Z5Y A;  4JY2 A;  4ZCD A;  1COY A;  3L8K A;  3DJE A;  5C3J A;  4J57 A;  5U1O A;  1TYP A;  2GVC A;  2F5Z A;  4UP3 A;  4OVI A;  3AYJ A;  3CGB A;  4U2S A;  3CTY A;  1JNZ A;  3SYI A;  3NLC A;  4GCM A;  1CJ3 A;  4A6N A;  1GXF A;  4B68 A;  3KLJ A;  3RP8 A;  3GD3 A;  1BKW A;  3NG7 X;  3SZC A;  3DA1 A;  2BRY A;  1JNR A;  4C5O A;  1CBO A;  2WPC A;  3NK0 X;  2YLX A;  3UKF A;  1S3B A;  2B9W A;  5FS9 A;  2XLU A;  3D8X A;  5C2T A;  2WEU A;  3FPZ A;  4U8I A;  4G73 A;  1E6E A;  1PBB A;  3SZW A;  2B76 A;  2EQ9 A;  3GRT A;  3UP4 A;  3CGD A;  1PN0 A;  1DJQ A;  1S3E A;  1O95 A;  1KSU A;  2WU5 A;  2XFU A;  3GYI A;  2VVL A;  2YG5 A;  4YTM A;  4YSX A;  1Y56 A;  2Z5X A;  2V61 A;  2CUL A;  2W0H A;  3B3R A;  1X31 B;  1GEU A;  4YTN A;  2UZZ A;  2DKI A;  1H82 A;  1O94 A;  4NWZ A;  4KPR A;  4XXG A;  3C4N A;  1GRB A;  3HYX A;  3CNJ A;  3NRN A;  4ICY A;  3VQR A;  4B1B A;  5FS8 A;  2QAE A;  4WCT A;  1NHP A;  3UP5 A;  4IVO B;  4U8N A;  1ZOV A;  1L9C A;  2BC0 A;  4TLX A;  2C3D A;  2VVM A;  1Z6L A;  3CPJ G;  2WP5 A;  4C74 A;  3LZX A;  1XPQ A;  1S7M A;  1PJ5 A;  4OPD A;  1QLB A;  5JCK A;  1PBE A;  2BXS A;  3FG2 P;  1ZMC A;  2OA1 A;  4Y4L A;  3NHO X;  1F3P A;  5KMR A;  1E1K A;  1LJ1 A;  1K0J A;  3EAN A;  3AYL A;  2BK3 A;  5KMQ A;  3AE9 A;  1D4E A;  3SM8 A;  4BK2 A;  1XDI A;  1LQT A;  3T37 A;  2C67 A;  1GRH A;  1GPE A;  2E5V A;  3CNT A;  2BK5 A;  2GEW A;  1GER A;  1CHU A;  4EQR A;  1NEK A;  3HYW A;  1E1L A;  3S61 A;  1TDE A;  4BJZ A;  4EM4 A;  4H2P A;  1PXC A;  3HZL A;  2YG7 A;  2YG6 A;  3CGC A;  4JDR A;  4PAA A;  3BI2 A;  4YSZ A;  3AEE A;  2GV8 A;  1RYI A;  2XFO A;  4TM0 A;  3LB8 A;  4NEW A;  1VG9 A;  3AE7 A;  4YSH A;  4II2 A;  3ALJ A;  4A7A A;  3UKA A;  2JB3 A;  2JB2 A;  1YQ3 A;  3AB1 A;  4Z2R A;  4NTD A;  4YWO A;  1F6M A;  4J33 A;  4BK3 A;  1GRA A;  2JKC A;  2JB1 A;  4CCR A;  1M6I A;  5LV9 A;  2YLR A;  4Z2U A;  4ADW A;  3ICS A;  4TM3 A;  1YKJ A;  3DK4 A;  3CND A;  2V3A A;  3RHA A;  3SXI A;  4AOS A;  2VVL G;  4A9W A;  5HXI A;  2AAQ A;  1DOB A;  1CC2 A;  1PJ7 A;  2YLS A;  3QVP A;  4LII A;  2JBV A;  4AP3 A;  3LJP A;  2FJD A;  1FEC A;  3V76 A;  4U8M A;  3AE5 A;  4ZN0 A;  4EQX A;  1BF3 A;  2GR2 A;  3GRS A;  1KNR A;  3FIM B;  2IID A;  2XYO A;  2BYB A;  2XVJ A;  4H4W A;  3SFE A;  1BZL A;  3CNS A;  3P4Q A;  3UKH A;  2QA2 A;  3ITJ A;  3BI5 A;  5HHF A;  4X4J A;  2APG A;  1D7Y A;  2VRL A;  1H83 A;  4BJY A;  5CKU A;  3V3N A;  1CC4 A;  2V60 A;  2HQM A;  1JRX A;  1OJA A;  3WE0 A;  1E1M A;  4K8D A;  1KDG A;  2A8X A;  3ATR A;  3P4P A;  1LVL A;  2FBW A;  2XDO A;  4H4Z A;  1H81 A;  2VQB A;  1IUU A;  1FL2 A;  2XFP A;  2X8C A;  1GTH A;  3FBS A;  3KKJ A;  2C64 A;  5EBK A;  5GSN A;  4GF7 A;  1HYU A;  3SGL A;  1Y56 B;  3NIX A;  5KMS A;  1PBC A;  3DH9 A;  5U63 A;  4C3Y A;  4FDC B;  2OAL A;  3H8I A;  4Z25 A;  3BNU A;  2BXR A;  2XLP A;  2DKH A;  4OPT A;  1B4V A;  3G5S A;  2B7R A;  3CMM A;  3T0K A;  4JQ9 A;  3AD9 B;  3AEC A;  4A79 A;  5EB4 A;  2O9Z A;  4B66 A;  2EQ7 A;  4A5L A;  4A6N B;  1RSG A;  4JNA A;  2WDR A;  3Q9T A;  3H8L A;  1F8W A;  1NG4 A;  3SZF A;  3IHM A;  2IVE A;  1KF6 A;  3F8D A;  2R45 A;  1N1P A;  3GMB A;  4D04 A;  3P1W A;  5GRT A;  2BAB A;  4OPC A;  2TPR A;  4U8P A;  4G6H A;  1ELI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...