3GD4A

Crystal structure of the reduced, nad-bound form of murine apoptosis inducing factor
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
483
structure length
445
Chain Sequence
PSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLQFRQWNGKERSIYFQPPSFYVSAQDLPNIENGGVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRALEKISREVKSITVIGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKILPQYLSNWTMEKVKREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKAEASEITIPEDYGKGVIFYLRDKVVVGIVLWNVFNRMPIARKIIKDGEQHEDLNEVAKLFNIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apoptosis-inducing factor 1, mitochondrial
publication title Redox-linked conformational dynamics in apoptosis-inducing factor
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 142
structure length 445
sequence length 483
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3gd4A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3gd4A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3gd4A01
5KOWA 2H89A 3NKSA 1L9EA 1XANA 3DJJA 1LQUA 1TDNA 5BVAA 2VVMA 5JCKA 4U2SA 2XYOA 1CC2A 4GDEA 3K7TA 2QA1A 3GRTA 4NTEA 3EF6A 3DJGX 3GWFA 4GF7A 1CF3A 3S5WA 3BNMA 2BABA 2A8XA 1DODA 4CNKA 5DBJA 4NEWA 3AEAA 4DGKA 4WX1A 2YR4A 3AD7B 5KRQA 2DKIA 1PXBA 2EQ8A 2Y6RA 2R9ZA 2WETA 3F8RA 2B7SA 2X8CA 3S61A 4EMWA 3VR8A 1IUTA 4TM0A 4EIPA 2FJBA 4WCTA 1GETA 1LJ1A 4EMJA 2V60A 4JDRA 1F6MA 1H7WA 1LTXR 2XLTA 3AE7A 3IHMA 1PBDA 1PXAA 4IVMB 1V59A 2FJDA 3AD8B 1D7LA 4H2QA 3UKKA 3VR9A 3P9UA 4FK1C 1DXLA 4P9SA 1KF6A 4Y4MA 1DOBA 3DK4A 2VOUA 1E1LA 1YY5A 4C74A 3SFDA 3G5QA 4OPDA 4CY8A 4U8MA 2HQMA 4EQXA 2C70A 4MJWA 2JB3A 2O9ZA 1H7XA 1NHQA 2Q7VA 1M6IA 4JY3A 1CBOA 1GRBA 2XDOA 1B37A 2XVJA 2Z5YA 1E39A 1JRYA 4D04A 2B9WA 1DOCA 4U2LA 2WPEA 2B9YA 3DH9A 2WU2A 1CL0A 4GCMA 2VVLG 1BGNA 2V3AA 3Q6JA 1IUWA 1MOKA 5EOWA 3NTAA 5U1OA 4YKFA 2DKHA 1XDIA 2WOVA 2B76A 3C96A 3K30A 3UKFA 4EQSA 1PXCA 3ALMA 3NRNA 3P4PA 4A7AA 2NPXA 4A79A 4USRA 4OPLA 2R0GA 2XFQA 1E7PA 5JCNA 1O95A 2WEUA 3UKAA 5KVHA 5BUKA 1GRTA 1OJDA 2C7GA 2VQBA 2BACA 3LJPA 1D7YA 1F3PA 3O0HA 4NEVA 2GR3A 3VRDB 2BXSA 1B8SA 1AOGA 2V6OA 4TM3A 3AYLA 4UDQA 1H86A 3FIMB 2C64A 5JCMA 5IQ1A 4Z2TA 1YQ4A 2XFNA 3Q9TA 1O5WA 2YWLA 1H81A 4IVOB 2YG5A 3AE4A 1YKJA 5C2TA 5HXIA 4ZCDA 2GQWA 1ZMDA 2JK6A 3G5RA 1XHCA 2OALA 4H7UA 1KDGA 2BK5A 4K8DA 1ONFA 2RGHA 3CTYA 5TR3A 2R45A 2YLXA 4H4VA 3FMWA 5HY5A 2YG7A 3GMBA 1ZY8A 4EM3A 2JB2A 1XPQA 1UKVG 3P4RA 4H4SA 1E1KA 4A65A 1CHUA 4CCQA 3CGBA 3UCLA 3M12A 4H2PA 4H4UA 3NYCA 3H8IA 4NTCA 1E1MA 4CRTA 1KNPA 1NEKA 1FOHA 1ZKQA 1TYTA 2C67A 1KFYA 4RG3A 3WE0A 2WESA 1L0VA 4DSGA 2FJAA 3BNUA 3CGCA 4OPUA 4HB9A 3RP8A 1D4DA 3EAOA 1GT8A 2OA1A 4B65A 2CFYA 3UOXA 4LA1A 3ATQA 4JNQA 3EANA 1GRFA 3AYIA 1SEZA 4K2XA 5J7XA 4Z44A 4CCRA 3C4AA 3OC4A 1Q1RA 1O94A 1ZOVA 1E6EA 1BWCA 1BGJA 2GAGB 2WU5A 1K0JA 1E1NA 3P4SA 1D4EA 4AT2A 2VZ2A 5C3JA 2AQJA 4CNJA 1OJCA 2OLNA 2B7RA 1S2QA 3AE8A 1MXTA 2GEWA 4GDPA 1FEBA 3AE1A 3QFAA 5U25A 2TPRA 3IC9A 4EM4A 4D03A 5GRTA 5J60A 3SM8A 2YVJA 1JEHA 3EPTA 1RYIA 2FBWA 3NHOX 1NG4A 3M13A 4YKGA 4H4RA 2RGOA 1Q9IA 3ITJA 3BI5A 1TYPA 3NTDA 1TDKA 1PBBA 3KKJA 2C3CA 1TDOA 4ZN0A 4K7ZA 3UTEA 1S3EA 4JNAA 1K4QA 2F5ZA 2WQYA 3RNMA 3VQRA 4RSLA 4FK1A 2YR6A 3URHA 1NENA 1CJ3A 1VQWA 3ADAB 4HA6A 4IA6A 2GMHA 3V3NA 2C73A 4B1BA 4XWRA 3ATRA 1EL7A 4A6NA 1JNZA 3NNEA 3DJEA 3RP6A 1TDFA 1JRZA 3L8KA 3CNSA 3GDNA 3H8LA 4I59A 4U8PA 5U63A 3BI2A 3UP4A 2TMDA 2APGA 2AR8A 4CY6A 1FECA 2JBVA 4ECHA 4C3XA 3UOYA 4B68A 3GWDA 3KA7A 4AOXA 3GSIA 4AOSA 1K0LA 1GSNA 1EBDA 2H88A 3FG2P 1QLBA 4H4XA 2R4JA 4Z2RA 3L1RA 2YVGA 4Z2UA 1N4VA 1Y56A 4DNAA 3FPZA 3C4NA 3DGHA 3AE6A 4EIQA 2BC1A 2YAUA 4OPTA 3NYEA 5JCIA 2GAHB 2E1MA 2BCPA 3AE5A 3AE3A 3ZDNA 4C5OA 1LVLA 2WOWA 3CNPA 2YVFA 2I0ZA 4OCGA 3UP5A 4U8JA 3REDA 4ZCCA 1PJ6A 4UDPA 4J2WA 4YSZA 2ZBWA 2EQ7A 3V3OA 4H50A 4UDRA 1P2HA 4J34A 5EB5A 4EMIA 2OLOA 3QSSA 4BK2A 3GD4A 3GYJA 1ZDLA 3GYIA 4U8OA 4OPGA 3UOVA 5M10A 3T37A 1F8RA 3V76A 3QVPA 5LV9A 3DA1A 2ARDA 1OJ9A 2JAEA 3DK9A 1CJCA 2BC0A 3CPIG 4Z24A 4KPRA 4J36A 2PYXA 4YXDA 4GRTA 1PBCA 3DK8A 2C3DA 1HYUA 5KOXA 5CQFA 3FBSA 3UKQA 3E1TA 3LXDA 2IIDA 1MO9A 4APNA 3PS9A 5FS9A 1IUSA 1PJ5A 5FMHA 2GQFA 1N4UA 2QA2A 2XLUA 3UOZA 3VRBA 1VG9A 2XCGA 4H4QA 3QJ4A 2YM1A 1VDCA 3AEDA 4A6NB 1GTHA 2R4EA 4YT0A 4O5QA 3BHKA 3RP7A 2BK3A 3QVRA 1IJHA 1F8SA 3KD9A 3CGEA 2IVEA 4YSHA 1GOSA 3DMEA 1LPFA 4LU6A 1OJTA 5JCLA 5HYMA 1H6VA 2C72A 3AXBA 4N9XA 2PHHA 1QJDA 2X8HA 5IPYA 1ZK7A 4BJZA 3QFBA 3D1CA 3F8PA 4A5LA 3CGDA 2BK4A 3NIXA 3BI4A 1B4VA 3ICRA 4U8KA 3ISHA 2QCUA 3AB1A 1Y56B 1RSGA 1ZX9A 3ICSA 3CIRA 1N1PA 5FS6A 1GESA 5ER0A 5EB4A 3D8XA 4BJYA 3AEEA 2GB0A 1B5QA 2GF3A 1Y0PA 2YG6A 4X4JA 3G5SA 2WS3A 3KLJA 2W0HA 1IUVA 3NK1X 2GH5A 3P4QA 1YQZA 5EBKA 2GVCA 1DNCA 2BA9A 2YQUA 2R46A 2BS3A 4EQWA 4B66A 3PVCA 2J3NA 2X50A 1PN0A 2A89A 3BHFA 4Z25A 5IQ4A 1GV4A 3UKPA 3NK2X 1GERA 2VRLA 2WPFA 2JB1A 1COYA 4H4TA 2X99A 2NVKX 3AWIA 4UP3A 2YR5A 4Z43A 1JU2A 1KSUA 2YM2A 1GNDA 4H4WA 3NYFA 1CJ4A 2UZZA 2VRMA 2ZZCA 1L9DA 3NH3X 1GRAA 3DGZA 2GR0A 4LIIA 1DOEA 3CPJG 1DJQA 1TRBA 1K0IA 2Q0LA 4O5UA 2XFOA 3UKHA 4X9MA 2YG3A 1L9CA 4GR1A 2WHDA 3GDPA 2WPCA 1ZP0A 3UTGA 3LADA 2WBAA 4TM1A 3VRAA 3GMCA 1H84A 1BF3A 4KX6A 2GR1A 3LOVA 4U8LA 4YTPA 1RP0A 4BK1A 2EQ9A 1Z6LA 2IVDA 3K7QX 1H83A 4RG4A 4USQA 1REOA 1YQ3A 2VQ7A 2CVJA 2GMJA 3NN6X 5KXJA 1GXFA 3AE2A 2ZZ0A 2YG4A 4IA5A 4M52A 2BXRA 1S3BA 1Q1WA 3AYJA 2WOIA 4H4YA 1IUXA 3QSMA 4K5SA 3GRSA 2ACZA 1NG3A 3I3LA 4YTMA 4AP3A 4J56A 1JRXA 2BCGG 4YSYA 2R0PA 5BULA 4EQRA 5BRTA 4OVIA 4E0VA 4YTNA 2WP5A 2GV8A 1GPEA 3NGCX 1CC4A 4H2NA 1VRQB 4B67A 1TDEA 2XVEA 5HHFA 3AD9B 4H4ZA 1W4XA 3AEGA 3OZ2A 2WDQA 3SGLA 2XFUA 2YLTA 3AEFA 2A87A 3CNTA 4I58A 1CC6A 3PO7A 4B64A 3H4KA 3AECA 1OJAA 4DSHA 4J33A 5L46A 3DJDA 2B9XA 1ZMCA 5FS7A 4REKA 2WP9A 4K22A 4FDCB 2GR2A 1NHSA 4TLZA 3KU9A 4J31A 1GTEA 3LB8A 1DJNA 3ICTA 1VG0A 1PJ7A 2YLSA 2CULA 1GREA 3QSEA 4A99A 4B63A 2CDUA 4B69A 3LZXA 3SQPA 3COXA 4ICYA 4U8NA 1PHHA 3R9UA 3AEBA 3I6DA 1PBEA 1ELIA 1EL8A 1EL5A 4J57A 2V5ZA 1S2YA 4BV6A 2C76A 3JSKA 2YLRA 1H82A 1KNRA 4X9NA 1NPXA 2WDRA 1NDAA 3ABVA 1D5TA 2RABA 4BURA 1BZLA 2BS2A 2E5VA 2FJEA 1ZOYA 4IV9A 4XXGA 3SFEA 5M0ZA 4H4PA 3IHGA 5CKUA 2E4GA 1LV0A 3CN8A 3K7MX 1GEUA 4TM4A 4AP1A 1LQTA 5KVIA 3NG7X 2VVLA 2XVHA 4U8IA 4C77A 1D4CA 3AE9A 1PBFA 3NN0X 3KPFA 1PS9A 2C65A 2GRTA 2R0CA 2V61A 2V3BA 1BKWA 2XVIA 1P2EA 2WDVA 4PABA 1GRGA 2JKCA 4U2TA 2OAMA 3UTFA 1CJ2A 3NT6A 3ZYXA 2C75A 3LZWA 2XLRA 4Z26A 1QO8A 2BS4A 4C3YA 1GALA 2XLPA 2AAQA 1KSSA 1JOAA 4JN9A 4Y4NA 2EQ6A 4Y4LA 4K5RA 1NHRA 1JNRA 2XLSA 4CBQA 2XFPA 4NZHA 1X31B 3UKLA 1NHPA 4PAAA 4XWZA 4YWOA 2X3NA 1N4WA 3ALJA 3NLCA 4NTDA 4OPIA 1FCDA 4JQ9A 2X8GA 2C66A 2Y6QA 1FEAA 1FL2A 3B3RA 3CNJA 3KVEA 4OPCA 5KWFA 2Q6UA 3B6DA 2RGJA 1M64A 2YLZA 5FS8A 2ZZBA 1IUUA 2Q0KA 3CNDA 4JY2A 2XVFA 3P1WA 4TLXA 2WP6A 2YLWA 3HZLA 4YSXA 3CPHG 1EL9A 3IWAA 3UTHA 3GD3A 3ALLA 4H2RA 4ADWA 4A9WA 4FX9A 2BYBA 3F8DA 4AT0A 4BK3A 3NK0X 3II4A 4GUVA 2Z5XA 3IF9A 1F8WA 3RHAA 5GSNA 1NAAA 2QAEA 3M0OA 1GRHA 1PDHA
chains in the Genus database with same CATH superfamily
5KOWA 2QJNA 2C4CA 1LQUA 3DJGX 4GF7A 2BRAA 3BNMA 2A8XA 4IL0A 3OW1A 4K8GA 4WCTA 1LJ1A 2NQLA 2V60A 4JDRA 2XLTA 3IHMA 1PBDA 1PXAA 4DHGA 3P9UA 1KN0A 1FFVC 3R0KA 4K2SA 4Y4MA 1E1LA 1YY5A 1L8PA 1ONEA 4U8MA 4EQXA 2C70A 3UJSA 2XDOA 3P0WA 2B9WA 4U2LA 2B9YA 3DH9A 3R07C 2V3AA 1MOKA 2GGIA 2B76A 3C96A 4IHCA 3OPSA 2XFQA 5BUKA 3FVDA 2VQBA 2BACA 1B8SA 2PSNA 2C64A 4Z2TA 2XFNA 4GYPA 2YWLA 2YG5A 5HXIA 3G5RA 4H7UA 1KDGA 4NNJA 5TR3A 3FMWA 4H4VA 2YG7A 1XPQA 2PA6A 1E1KA 4A65A 4H4UA 4CRTA 2C67A 1TYTA 3DFYA 1WUFA 3RP8A 3EAOA 4B65A 2CFYA 3ATQA 4JNQA 1SEZA 4K2XA 3JVAA 1O94A 2CHRA 2GAGB 1BWCA 1BGJA 3NXLA 1K0JA 2VZ2A 5C3JA 1OJCA 4GDPA 4II2A 4EM4A 5J60A 2YVJA 2HZGA 3DESA 3NHOX 3ITJA 3BI5A 3KKJA 4K7ZA 1S3EA 4JNAA 1N60C 2F5ZA 4RSLA 4HA6A 1VQWA 1CJ3A 3ADAB 4IZGA 2GMHA 4XWRA 4ROPA 1JNZA 4HNCA 1JRZA 3L8KA 3RR1A 4I59A 5U63A 3BI2A 3UP4A 2AR8A 1YEYA 1WYGA 3V5CA 3GWDA 3CAWA 2R4JA 3QKEA 2YVGA 3KUMA 3OZMA 3SZ0A 3DGHA 2YAUA 4GISA 4C5OA 5JCIA 3AE5A 4H2HA 4Z17A 3TJ4A 2YVFA 4DXKA 1KCZA 3N6HA 4J2WA 2GDQA 4UDRA 4J34A 5EB5A 2OLOA 3QSSA 4BK2A 3TWAA 3QVPA 1CJCA 4Z24A 2PYXA 4YXDA 3D46A 4EWJA 3FBSA 7ENLA 1MO9A 3VRBA 4H4QA 3A7RA 1VDCA 2R4EA 3BHKA 2BK3A 1F8SA 3CGEA 4LU6A 3JZUA 3ETRB 4G8TA 2C72A 4N9XA 5IPYA 4BJZA 3MQTA 3NIXA 4U8KA 3H7VA 2QCUA 1Y56B 1RSGA 1ZX9A 3CIRA 1JPMA 2OQHA 5EB4A 3D8XA 3OP2A 3CXOA 3NK1X 2GH5A 1PDZA 2YQUA 4B66A 2J3NA 1PN0A 2A89A 4Z25A 3UKPA 3ZVHB 1COYA 4H4TA 3GYXA 2QVHA 3V5FA 1JU2A 4G9KA 1GNDA 3NYFA 3DGZA 3CPJG 1EC8A 1K0IA 1FIQB 3BOXA 3GDPA 2WPCA 3GMCA 3PK7A 2GR1A 3LOVA 3ZLHA 3IJQA 3SN0A 2CVJA 2GMJA 4DN1A 3HPFA 3FV9A 3UXLA 3AE2A 2QDEA 2ZZ0A 3DFHA 4IA5A 4M52A 1Q1WA 3U4FA 3AYJA 3SXIA 2WOIA 4E4UA 1NG3A 4YTMA 2BCGG 5BULA 5BRTA 4YTNA 5FJUA 2GV8A 1GPEA 4H2NA 4B67A 1TDEA 1R0MA 2ZC8A 4E5TA 2A87A 1R6WA 4I58A 1ECQA 3THUA 4DSHA 2XH0A 4E6MA 2I5QA 3MKCA 2WP9A 3T4WA 3KU9A 1GTEA 4JN8A 3R0UA 1VG0A 2CDUA 3TOYA 1PHHA 3R9UA 1EL8A 4KEMA 1EL5A 3SZWA 1SJDA 4FP1A 1EC7A 1H82A 4X9NA 3ABVA 2WDRA 2RABA 1ZOYA 4IV9A 4XXGA 1MRAA 5FJRA 3VA8A 1GEUA 4AP1A 5KVIA 2VVLA 5FJTA 1PBFA 3KPFA 2V61A 2V3BA 1BKWA 2P8CA 2DW6A 3AN1A 3DIPA 3NT6A 2C75A 1QO8A 4C3YA 3NO1A 2OVLA 4Y4NA 4GYPC 4K5RA 2XLSA 1X31B 3T14A 2X3NA 3H12A 2MUCA 4NTDA 3DG3A 1FL2A 3RO6A 3CNJA 3KVEA 4OPCA 5KWFA 3Q4DA 3U9IA 2ZZBA 1IUUA 2XVFA 2WP6A 3HZLA 3CPHG 3UTHA 3I6TA 4ADWA 2BYBA 3IF9A 2QAEA 4YKFA 1GRHA 4J1OA 3DJJA 2XYOA 4GDEA 2QA1A 3GRTA 4NTEA 3GWFA 4TVWA 3S5WA 3MWCA 1DODA 5DBJA 4NEWA 3UXKA 3AD7B 5KRQA 1PXBA 2Y6RA 3T9PA 2WETA 2X8CA 3VR8A 2FJBA 3VC6A 4EMJA 2FJDA 3PFRA 1D7LA 3AD8B 3VFCA 4DYEA 3NVZB 4P9SA 3K1GA 1BQGA 4C74A 3SFDA 4OPDA 4MJWA 1NHQA 1CBOA 1GRBA 1B37A 2Z5YA 4D04A 2QDDA 3S5SA 2VVLG 3Q6JA 1IUWA 5EOWA 3NTAA 5U1OA 2WOVA 4EQSA 4A79A 4OPLA 1E7PA 5JCNA 1NU5A 3LJPA 3P3BA 4NEVA 3EKGA 4TM3A 3EUB3 3CYJA 5JCMA 5IQ1A 1H81A 3AE4A 4GAPA 3GO2A 2OALA 1SJBA 3MZNA 1ONFA 2RGHA 2R45A 2YLXA 5HY5A 4IP4A 3P4RA 4H4SA 3ES7A 3SSZA 2BRYA 3M12A 3NZGA 2RDXA 1KFYA 4RG3A 2PTWA 4DSGA 2O56A 3BNUA 4OPUA 4HB9A 1GT8A 4LA1A 4G74A 3EANA 5J7XA 3C4AA 3I4KA 1E1NA 3UJEA 2OLNA 2B7RA 1MXTA 1FEBA 3AE1A 3QFAA 2XH2A 3IC9A 5GRTA 2W54A 1JEHA 1RYIA 4H83A 2FBWA 1NG4A 3M13A 4YKGA 1TYPA 1PBBA 4ZN0A 2C3CA 3QN3A 1K4QA 2E5AA 2WQYA 3VQRA 4FK1A 3URHA 5KMQA 4B1BA 4HN8A 4IT1A 3SBFA 3DJEA 3GDNA 3H8LA 3T2ZA 4U8PA 2PGWA 2PU1A 2JBVA 3IJLA 4B68A 3KA7A 3GSIA 3CB3A 4AOSA 4MKSA 4Z2RA 3L1RA 3SN4A 2PGEA 4Z2UA 1N4VA 4ZOHB 1Y56A 4DNAA 3FPZA 2BC1A 4G6GA 4OPTA 4OCGA 3REDA 2EQ7A 4H50A 1P2HA 3ZVHA 1ZDLA 1N61C 5M10A 1F8RA 3HW2A 3N6JA 3V76A 3B9JB 3H8AA 2BC0A 4KPRA 1S7MA 4GRTA 3DK8A 5CQFA 3UKQA 3E1TA 2IIDA 1JRPA 2GQFA 3S47A 4A6NB 1GTHA 4O5QA 2DW7A 3NRZB 3QVRA 6ENLA 3DMEA 3SR6B 1H6VA 2PHHA 1QJDA 3D1CA 3IK4A 4A5LA 2GGHA 3UJFA 3ISHA 3T8QA 2GB0A 2GF3A 1Y0PA 3G5SA 2WS3A 1X2HA 1DNCA 2R46A 3PVCA 1GV4A 1MDRA 3NK2X 2VRLA 2HXTA 1KSUA 3SN1A 2OZ8A 4H4WA 3RGTA 2ZZCA 1L9DA 1GRAA 3QTPA 1DOEA 4O5UA 2XFOA 3UKHA 4X9MA 3UTGA 3LADA 4TM1A 3VRAA 3RCYA 4YTPA 2XH4A 5KXJA 1S3BA 4JHMA 1STZA 4H4YA 3UGVA 1PDYA 4HNLA 3SY4A 3I3LA 4J56A 1JRXA 3DDMA 2R0PA 4E0VA 2XVEA 2WDQA 3SGLA 3AEFA 1MDLA 2OLAA 3PO7A 2PTYA 3AECA 5L46A 3DJDA 1E9IA 3ES8A 4K22A 4FDCB 1NHSA 1TE6A 4TLZA 1JROA 1EBHA 1SJAA 1PJ7A 3QSEA 4A99A 4B63A 4ICYA 4U8NA 2HXUA 1ELIA 3R11A 3FCPA 2V5ZA 2C76A 2YLRA 1KNRA 1NPXA 1NDAA 1D5TA 3SQSA 1BZLA 2BS2A 2FJEA 3SFEA 5M0ZA 1LV0A 3K7MX 3AM9A 2XVHA 4U8IA 2OPJA 2PS2A 3TJIA 2C65A 2R0CA 3NVVB 3UTFA 1CJ2A 2HNEA 3ZYXA 1OEPA 2POZA 1GALA 2AAQA 4JN9A 2QQ6A 1NHRA 1JNRA 4NZHA 3UKLA 1NHPA 3PG6A 3FYYA 1W6TA 4YWOA 3NLCA 2C66A 1FEAA 2RGJA 1M64A 4KWSA 2FKPA 3GD3A 3ALLA 4H2RA 4A9WA 3VCNA 4BK3A 3AMZA 3RHAA 1NAAA 3M0OA 2PU0A 3MSYA 5BVAA 2VVMA 5JCKA 1CC2A 3EF6A 2QJMA 2XGZA 2BABA 4GGBA 4DGKA 1MUCA 3DEQA 2YR4A 2DKIA 3ZLFA 3UJRA 3F8RA 2B7SA 2AKZA 4TM0A 1VQZA 3ENLA 1GETA 1F6MA 1LTXR 3BJSA 4IVMB 1V59A 4H2QA 3VR9A 4FK1C 1DXLA 1FHVA 3Q45A 3DK4A 2VOUA 3G5QA 2HQMA 2JB3A 2O9ZA 4H19A 1H7XA 2Q7VA 1M6IA 4M6UA 2XVJA 1E39A 2WPEA 2WU2A 2GGGA 1BGNA 2DKHA 3D9XA 1PXCA 3FJ4A 3P4PA 2NPXA 1O95A 5KVHA 3R1ZA 3VRDB 3O0HA 1F3PA 2PP3A 2GR3A 2BXSA 2V6OA 1H86A 4G73A 3Q9TA 4IVOB 3N4FA 1ZMDA 2JK6A 2BK5A 3TWBA 4K8DA 3CTYA 1ZY8A 4EM3A 2JB2A 1XS2A 1WUEA 4CCQA 2OG9A 2P8BA 4H2PA 3NYCA 4NTCA 3NVYB 1NEKA 1FOHA 4A3RA 2PCEA 2WESA 1L0VA 3CGCA 2OO6A 3UOXA 5G5HB 4Z44A 3T0KA 1Q1RA 1ZOVA 3P4SA 4AT2A 4ENLA 2AQJA 1S2QA 3AE8A 2GEWA 5U25A 5BOFA 2TPRA 1SB3B 3SM8A 2OZTA 3FXGA 3MY9A 3EPTA 5JRBA 1KKOA 2PODA 2RGOA 1Q9IA 1TDKA 3DERA 1TDOA 1JDFA 3VC5A 3RNMA 1NENA 3V3NA 4IA6A 2C73A 5IDZA 3ATRA 3HYVA 4A6NA 4KT2A 5FJOA 3RP6A 2APGA 4CY6A 1FECA 4MMWA 4AOXA 1K0LA 1GSNA 1EBDA 4H4XA 2OFJA 3C4NA 3AE6A 3NYEA 2GAHB 2BCPA 3AE3A 3ZDNA 1LVLA 2WOWA 1KKRA 3CNPA 2I0ZA 3UP5A 3SZFA 4U8JA 1PJ6A 2W55A 3V4BA 4EMIA 3GD4A 4U8OA 3UOVA 3GYIA 4OPGA 3VCCA 2JAEA 3DK9A 1ELSA 1PBCA 1HYUA 2OZ3A 3LXDA 4APNA 3PS9A 1IUSA 5FMHA 2PP0A 2QA2A 3UOZA 2XCGA 3QJ4A 2YM1A 3RITA 2XSXA 4YT0A 2PTZA 5KMRA 4A6GA 4YSHA 1GOSA 3A7UA 2FYMA 1OJTA 3TQPA 3AXBA 1P43A 2OX4A 3EEZA 3QFBA 3SJNA 3F8PA 2BK4A 1B4VA 4HCLA 5BOEA 3ICSA 1N1PA 3STPA 4BJYA 3AEEA 2YG6A 4X4JA 3KLJA 3P4QA 2QJJA 5EBKA 3CK5A 2GVCA 3B97A 3BHFA 1GERA 3SX6A 2WPFA 2JB1A 2NVKX 3AWIA 4UP3A 3NS1B 4Z43A 2VRMA 1F9CA 2GR0A 1TRBA 2Q0LA 2PP1A 1ZP0A 3UCCA 2WBAA 1H84A 4KX6A 3UCDA 1RP0A 2AL2B 4BK1A 1Z6LA 1H83A 4RG4A 2VQ7A 3NN6X 1GXFA 4GFIA 1EBGA 2BXRA 4HCDA 3NVWB 4K5SA 2ACZA 4AP3A 3NGCX 1CC4A 1VRQB 4H4ZA 1W4XA 2XFUA 2YLTA 3H4KA 4J33A 2AL1A 2AKMA 4J3ZA 4J31A 1EC9A 3LB8A 1DJNA 2P3ZA 2YLSA 1GREA 3LZXA 3COXA 3I6DA 1XPYA 4BV6A 3JSKA 4BURA 2E5VA 4A35A 1DTNA 3QPEA 1N62C 5CKUA 2E4GA 3I6EA 3CN8A 3CT2A 4TM4A 4JN7A 4MGGA 3NG7X 1D4CA 3R10A 3AE9A 3NN0X 1PS9A 2GRTA 4ZCWA 1P2EA 4PABA 2JKCA 4U2TA 2OAMA 4Z26A 2XLPA 1X2GA 3ZLGA 3BSMA 2GL5A 4OPIA 3ALJA 2P0IA 3B6DA 3TW9A 2YLZA 1BKHA 3P1WA 4YSXA 1EL9A 4G7FA 4FX9A 3NK0X 4GUVA 1F8WA 2OKTA 4KPLA 2H89A 3NKSA 1L9EA 1XANA 1TDNA 4U2SA 3K7TA 4K1WA 1CF3A 4CNKA 3AEAA 4WX1A 3L5OA 2EQ8A 2R9ZA 3S61A 4EMWA 3T31A 1IUTA 3PWGA 4EIPA 3TCSA 5KMPA 4GGHA 1H7WA 3AE7A 3UKKA 2GSHA 1KF6A 1DOBA 1FFUC 3OZYA 4CY8A 4JY3A 1JRYA 1DOCA 1CL0A 4GCMA 4H1ZA 1XDIA 3K30A 3UKFA 3ALMA 3NRNA 4A7AA 4USRA 2R0GA 3T2YA 2WEUA 3UKAA 4HPNA 1GRTA 1OJDA 2C7GA 1D7YA 3D47A 1AOGA 3AYLA 4UDQA 3FIMB 1YQ4A 1O5WA 1YKJA 4M0XA 5C2TA 3GC2A 4ZCDA 2GQWA 1XHCA 3UJ2A 3VDGA 3GMBA 1UKVG 1CHUA 3CGBA 3A7AA 3UCLA 3H8IA 1E1MA 1KNPA 2PTXA 1ZKQA 3KPKA 1IYXA 3WE0A 1ZXIC 2FJAA 3DGBA 1D4DA 2OA1A 4G6HA 1JCTA 1GRFA 3AYIA 4CCRA 3OC4A 4GMEA 1E6EA 2WU5A 1D4EA 4CNJA 4HCHA 4D03A 4H4RA 5G5GB 3NTDA 3IJIA 3UTEA 2MNRA 4IL2A 2YR6A 1SJCA 2W3SA 1EL7A 3NNEA 1TDFA 3CNSA 3P93A 2TMDA 3SYIA 4ECHA 4C3XA 3T2KA 3UOYA 3T6CA 3R25A 2H88A 3FG2P 1QLBA 1TKKA 2OQYA 5KMSA 3RRAA 4EIQA 2E1MA 5KNLA 3V3WA 3HYWA 3DG7A 2QGYA 3GY1A 4ZCCA 2E3TA 4UDPA 4YSZA 2ZBWA 3V3OA 3PWIA 3GYJA 1RM6B 3T37A 4E8GA 3OTRA 5LV9A 3DA1A 2ARDA 3CXBA 1OJ9A 3CPIG 4J36A 2W3RA 2C3DA 5KOXA 1N5WC 4NWZA 4FI4A 4GAVA 5FS9A 1PJ5A 2AL2A 1N4UA 2XLUA 1VG9A 5J04A 3TTEA 3AEDA 2GGEA 3RP7A 1VDVA 1IJHA 3KD9A 2IVEA 1FO4A 1LPFA 5JCLA 5HYMA 2X8HA 1ZK7A 3GD6A 3CGDA 2PMQA 3BI4A 1P48A 3ICRA 3AB1A 3ZVIA 1RVKA 3MUCA 5FS6A 1GESA 5ER0A 1B5QA 4E4FA 4F4RA 2W0HA 1IUVA 1YQZA 2BA9A 2BS3A 4EQWA 1N63C 2X50A 3QLDA 5IQ4A 1H2IA 2X99A 2YR5A 2YM2A 4HYRA 1CJ4A 2UZZA 4DX3A 3NH3X 4LIIA 3NFUA 1DJQA 4YWSA 2YG3A 1L9CA 4GR1A 2WHDA 1BF3A 4U8LA 1T3QC 1FHUA 2EQ9A 2IVDA 3K7QX 3HYXA 4USQA 3N4EA 1REOA 1YQ3A 3SZCA 5ENLA 1JPDX 3HRDC 1TZZA 2YG4A 4GIRA 4Z1YA 1IUXA 3QSMA 4IP5A 3GRSA 4YSYA 4EQRA 4OVIA 2ONEA 2WP5A 3H70A 2XH7A 4X2PA 5HHFA 3AD9B 3AEGA 3OZ2A 3CNTA 1CC6A 2PPGA 4B64A 1OJAA 2B9XA 1ZMCA 5FS7A 4REKA 2GR2A 2P88A 1N5XA 4ZA0A 3ICTA 3CMMA 2CULA 4B69A 3SQPA 1MNSA 3AEBA 1PBEA 1NELA 4J57A 1S2YA 2ZADA 4H4PA 3IHGA 5FJPA 1LQTA 4C77A 4TVYA 2XVIA 2WDVA 4DWDA 1GRGA 3LZWA 2XLRA 2BS4A 1KSSA 1JOAA 2EQ6A 4Y4LA 3JW7A 1V97A 4CBQA 2XFPA 4PAAA 4XWZA 1KD0A 5EU9A 1N4WA 1FCDA 4JQ9A 2X8GA 2Y6QA 3B3RA 2Q6UA 5FS8A 2Q0KA 3CNDA 4JY2A 4TLXA 2YLWA 3IWAA 4II3A 3F8DA 4AT0A 2GGJA 3II4A 2Z5XA 5GSNA 3DG6A 1PDHA
chains in the Genus database with same CATH topology
5KOWA 2C4CA 2H89A 3NKSA 1L9EA 1XANA 3DJJA 1LQUA 1TDNA 5BVAA 2VVMA 5JCKA 4U2SA 2XYOA 1CC2A 4GDEA 3K7TA 2QA1A 3GRTA 4NTEA 3EF6A 3DJGX 3GWFA 4GF7A 1CF3A 3S5WA 2BRAA 3BNMA 2BABA 2A8XA 1DODA 4CNKA 5DBJA 4NEWA 3AEAA 4DGKA 4WX1A 3L5OA 2YR4A 3AD7B 5KRQA 2DKIA 1PXBA 2EQ8A 2Y6RA 2R9ZA 2WETA 3F8RA 2B7SA 2X8CA 3S61A 4EMWA 3T31A 3VR8A 1IUTA 4TM0A 4EIPA 2FJBA 4WCTA 5KMPA 1GETA 1LJ1A 4EMJA 2V60A 4JDRA 1F6MA 1H7WA 1LTXR 2XLTA 3AE7A 3IHMA 1PBDA 1PXAA 4IVMB 1V59A 2FJDA 3AD8B 1D7LA 4H2QA 3UKKA 3VR9A 3P9UA 1KN0A 4FK1C 1DXLA 4P9SA 1KF6A 4Y4MA 1DOBA 3DK4A 2VOUA 1E1LA 1YY5A 4C74A 3SFDA 3G5QA 4OPDA 4CY8A 4U8MA 2HQMA 4EQXA 2C70A 4MJWA 2JB3A 2O9ZA 1H7XA 1NHQA 2Q7VA 1M6IA 4JY3A 1CBOA 1GRBA 2XDOA 1B37A 2XVJA 2Z5YA 1E39A 1JRYA 4D04A 2B9WA 1DOCA 4U2LA 2WPEA 2B9YA 3DH9A 2WU2A 1CL0A 4GCMA 2VVLG 1BGNA 2V3AA 3Q6JA 1IUWA 1MOKA 5EOWA 3NTAA 5U1OA 4YKFA 2DKHA 1XDIA 2WOVA 2B76A 3C96A 3K30A 3D9XA 4EQSA 3UKFA 1PXCA 3ALMA 3NRNA 3P4PA 4A7AA 2NPXA 4A79A 4USRA 4OPLA 2R0GA 3T2YA 2XFQA 1E7PA 5JCNA 1O95A 2WEUA 3UKAA 5KVHA 5BUKA 1GRTA 1OJDA 2C7GA 2VQBA 2BACA 3LJPA 1D7YA 1F3PA 3O0HA 4NEVA 2GR3A 3VRDB 2BXSA 1B8SA 1AOGA 2V6OA 4TM3A 3AYLA 4UDQA 1H86A 3FIMB 2C64A 5JCMA 5IQ1A 4Z2TA 1YQ4A 4G73A 2XFNA 3Q9TA 1O5WA 2YWLA 1H81A 4IVOB 2YG5A 3AE4A 1YKJA 5C2TA 5HXIA 4ZCDA 2GQWA 1ZMDA 2JK6A 3G5RA 1XHCA 2OALA 4GAPA 4H7UA 1KDGA 2BK5A 4K8DA 1ONFA 2RGHA 4NNJA 3CTYA 5TR3A 2R45A 2YLXA 4H4VA 3FMWA 5HY5A 2YG7A 3GMBA 1ZY8A 4EM3A 2JB2A 1XPQA 1UKVG 3P4RA 4H4SA 1E1KA 4A65A 1CHUA 4CCQA 3CGBA 3UCLA 2BRYA 3M12A 4H2PA 4H4UA 3NYCA 3H8IA 4NTCA 1E1MA 4CRTA 1KNPA 1NEKA 1FOHA 1ZKQA 1TYTA 2C67A 3KPKA 1KFYA 4RG3A 3WE0A 2WESA 1L0VA 4DSGA 2FJAA 3BNUA 3CGCA 4OPUA 4HB9A 3RP8A 1D4DA 3EAOA 1GT8A 2OA1A 4B65A 2CFYA 3UOXA 4G6HA 4LA1A 3ATQA 4G74A 4JNQA 3EANA 1GRFA 3AYIA 1SEZA 4K2XA 5J7XA 4Z44A 3T0KA 4CCRA 3C4AA 3OC4A 1Q1RA 1O94A 1ZOVA 1E6EA 1BWCA 1BGJA 2GAGB 2WU5A 1K0JA 1E1NA 3P4SA 1D4EA 4AT2A 2VZ2A 5C3JA 2AQJA 4CNJA 1OJCA 2OLNA 2B7RA 1S2QA 3AE8A 1MXTA 2GEWA 4GDPA 1FEBA 3AE1A 3QFAA 5U25A 4II2A 2TPRA 3IC9A 4EM4A 4D03A 5GRTA 5J60A 3SM8A 2YVJA 1JEHA 3EPTA 1RYIA 5JRBA 2FBWA 3NHOX 1NG4A 3M13A 4YKGA 4H4RA 2RGOA 1Q9IA 3ITJA 3BI5A 1TYPA 3NTDA 1TDKA 1PBBA 3KKJA 2C3CA 1TDOA 4ZN0A 4K7ZA 3UTEA 1S3EA 4JNAA 1K4QA 2F5ZA 2WQYA 3RNMA 3VQRA 4RSLA 4FK1A 2YR6A 3URHA 1NENA 1CJ3A 1VQWA 3ADAB 4HA6A 4IA6A 2GMHA 5KMQA 3V3NA 2C73A 4B1BA 4XWRA 3ATRA 3HYVA 1EL7A 4A6NA 1JNZA 3NNEA 3DJEA 3RP6A 1TDFA 1JRZA 3L8KA 3CNSA 3GDNA 3H8LA 4I59A 4U8PA 5U63A 3T2ZA 3BI2A 3UP4A 2TMDA 2APGA 2AR8A 4CY6A 1FECA 2JBVA 3SYIA 4ECHA 4C3XA 3T2KA 3UOYA 4B68A 3GWDA 3KA7A 4AOXA 3GSIA 4AOSA 1K0LA 1GSNA 1EBDA 2H88A 3FG2P 1QLBA 4H4XA 2R4JA 4Z2RA 3L1RA 2YVGA 4Z2UA 5KMSA 1N4VA 1Y56A 3SZ0A 4DNAA 3FPZA 3C4NA 3DGHA 3AE6A 4EIQA 2BC1A 2YAUA 4G6GA 4OPTA 3NYEA 5JCIA 2GAHB 2E1MA 2BCPA 3AE5A 3AE3A 3ZDNA 4C5OA 5KNLA 1LVLA 3HYWA 2WOWA 3CNPA 2YVFA 2I0ZA 4OCGA 3UP5A 3SZFA 4U8JA 3REDA 4ZCCA 1PJ6A 4UDPA 4J2WA 4YSZA 2ZBWA 2EQ7A 3V3OA 4H50A 4UDRA 1P2HA 4J34A 5EB5A 4EMIA 2OLOA 3QSSA 4BK2A 3GD4A 3GYJA 1ZDLA 3GYIA 4U8OA 4OPGA 3UOVA 5M10A 3T37A 1F8RA 3V76A 3QVPA 5LV9A 3DA1A 2ARDA 1OJ9A 2JAEA 3DK9A 1CJCA 2BC0A 3CPIG 4Z24A 4KPRA 4J36A 2PYXA 1S7MA 4YXDA 4GRTA 1PBCA 3DK8A 2C3DA 1HYUA 5KOXA 5CQFA 3FBSA 3UKQA 4NWZA 3E1TA 3LXDA 2IIDA 1MO9A 4GAVA 4APNA 3PS9A 5FS9A 1IUSA 1PJ5A 5FMHA 2GQFA 1N4UA 2QA2A 2XLUA 3UOZA 3VRBA 1VG9A 2XCGA 4H4QA 3QJ4A 2YM1A 1VDCA 3AEDA 4A6NB 1GTHA 2R4EA 4YT0A 4O5QA 3BHKA 3RP7A 5KMRA 2BK3A 3QVRA 1IJHA 1F8SA 3KD9A 3CGEA 2IVEA 4YSHA 1GOSA 3DMEA 1LPFA 4LU6A 1OJTA 5JCLA 5HYMA 1H6VA 2C72A 3AXBA 4N9XA 2PHHA 1QJDA 2X8HA 5IPYA 1ZK7A 4BJZA 3QFBA 3D1CA 3F8PA 4A5LA 3CGDA 2BK4A 3NIXA 3BI4A 1B4VA 3ICRA 4U8KA 3ISHA 2QCUA 3AB1A 1Y56B 1RSGA 1ZX9A 3ICSA 3CIRA 1N1PA 5FS6A 1GESA 5ER0A 5EB4A 3D8XA 4BJYA 3AEEA 2GB0A 1B5QA 2GF3A 1Y0PA 2YG6A 4X4JA 3G5SA 2WS3A 3KLJA 2W0HA 1IUVA 3NK1X 2GH5A 3P4QA 1YQZA 5EBKA 2GVCA 1DNCA 2BA9A 2YQUA 2R46A 2BS3A 4EQWA 4B66A 3PVCA 2J3NA 2X50A 1PN0A 2A89A 3BHFA 4Z25A 5IQ4A 1GV4A 3UKPA 3NK2X 1GERA 3SX6A 1H2IA 2VRLA 2WPFA 2JB1A 1COYA 4H4TA 2X99A 3GYXA 2NVKX 3AWIA 4UP3A 2YR5A 4Z43A 1JU2A 1KSUA 2YM2A 4G9KA 1GNDA 4H4WA 3NYFA 1CJ4A 2UZZA 2VRMA 2ZZCA 1L9DA 3NH3X 1GRAA 3DGZA 2GR0A 4LIIA 1DOEA 3CPJG 1DJQA 1TRBA 1K0IA 2Q0LA 4O5UA 2XFOA 3UKHA 4X9MA 2YG3A 1L9CA 4GR1A 2WHDA 3GDPA 2WPCA 1ZP0A 3UTGA 3LADA 2WBAA 4TM1A 3VRAA 3GMCA 1H84A 1BF3A 4KX6A 2GR1A 3LOVA 4U8LA 4YTPA 1RP0A 4BK1A 2EQ9A 1Z6LA 2IVDA 3K7QX 1H83A 4RG4A 3HYXA 4USQA 1REOA 1YQ3A 2VQ7A 3SZCA 2CVJA 2GMJA 3NN6X 5KXJA 1GXFA 3AE2A 2ZZ0A 2YG4A 4IA5A 4M52A 2BXRA 1S3BA 1Q1WA 3AYJA 3SXIA 2WOIA 4H4YA 1IUXA 3QSMA 4K5SA 3GRSA 2ACZA 3SY4A 1NG3A 3I3LA 4YTMA 4AP3A 4J56A 1JRXA 2BCGG 4YSYA 2R0PA 5BULA 4EQRA 5BRTA 4OVIA 4E0VA 4YTNA 2WP5A 2GV8A 1GPEA 3NGCX 1CC4A 4H2NA 1VRQB 4B67A 1TDEA 2XVEA 5HHFA 3AD9B 4H4ZA 1W4XA 3AEGA 3OZ2A 2WDQA 3SGLA 2XFUA 2YLTA 3AEFA 2A87A 3CNTA 4I58A 1CC6A 3PO7A 4B64A 3H4KA 3AECA 1OJAA 4DSHA 4J33A 5L46A 3DJDA 2B9XA 1ZMCA 5FS7A 4REKA 2WP9A 4K22A 4FDCB 2GR2A 1NHSA 4TLZA 3KU9A 4J31A 1GTEA 3LB8A 1DJNA 3ICTA 1VG0A 1PJ7A 2YLSA 3CMMA 2CULA 1GREA 3QSEA 4A99A 4B63A 2CDUA 4B69A 3LZXA 3SQPA 3COXA 4ICYA 4U8NA 1PHHA 3R9UA 3AEBA 3I6DA 1PBEA 1ELIA 1EL8A 1EL5A 4J57A 2V5ZA 3SZWA 1S2YA 4BV6A 2C76A 3JSKA 2YLRA 1H82A 1KNRA 4X9NA 1NPXA 2WDRA 1NDAA 3ABVA 1D5TA 2RABA 4BURA 1BZLA 2BS2A 2E5VA 2FJEA 1ZOYA 4IV9A 4XXGA 3SFEA 5M0ZA 4H4PA 3IHGA 5CKUA 2E4GA 1LV0A 3CN8A 3K7MX 1GEUA 4TM4A 4AP1A 1LQTA 5KVIA 3NG7X 2VVLA 2XVHA 4U8IA 4C77A 1D4CA 3AE9A 1PBFA 3NN0X 3KPFA 1PS9A 2C65A 2GRTA 2R0CA 2V61A 2V3BA 1BKWA 2XVIA 1P2EA 2WDVA 4PABA 1GRGA 2JKCA 4U2TA 2OAMA 3UTFA 1CJ2A 3NT6A 3ZYXA 2C75A 3LZWA 2XLRA 4Z26A 1QO8A 2BS4A 4C3YA 1GALA 2XLPA 2AAQA 1KSSA 1JOAA 4JN9A 4Y4NA 2EQ6A 4Y4LA 4K5RA 1NHRA 1JNRA 2XLSA 4CBQA 2XFPA 4NZHA 1X31B 3UKLA 1NHPA 3PG6A 4PAAA 4XWZA 3T14A 4YWOA 2X3NA 1N4WA 3ALJA 3NLCA 4NTDA 4OPIA 1FCDA 4JQ9A 2X8GA 2C66A 2Y6QA 1FEAA 1FL2A 3B3RA 3CNJA 3KVEA 4OPCA 5KWFA 2Q6UA 3B6DA 2RGJA 1M64A 2YLZA 5FS8A 2ZZBA 1IUUA 2Q0KA 3CNDA 4JY2A 2XVFA 3P1WA 4TLXA 2WP6A 2YLWA 3HZLA 4YSXA 3CPHG 1EL9A 3IWAA 3UTHA 3GD3A 3ALLA 4II3A 4H2RA 4ADWA 4A9WA 4FX9A 2BYBA 3F8DA 4AT0A 4BK3A 3NK0X 3II4A 4GUVA 2Z5XA 3IF9A 1F8WA 3RHAA 5GSNA 1NAAA 2QAEA 3M0OA 1GRHA 1PDHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KOW A;  2H89 A;  3NKS A;  1L9E A;  1XAN A;  3DJJ A;  1LQU A;  1TDN A;  5BVA A;  2VVM A;  5JCK A;  4U2S A;  2XYO A;  1CC2 A;  4GDE A;  3K7T A;  2QA1 A;  3GRT A;  4NTE A;  3EF6 A;  3DJG X;  3GWF A;  4GF7 A;  1CF3 A;  3S5W A;  3BNM A;  2BAB A;  2A8X A;  1DOD A;  4CNK A;  5DBJ A;  4NEW A;  3AEA A;  4DGK A;  4WX1 A;  2YR4 A;  3AD7 B;  5KRQ A;  2DKI A;  1PXB A;  2EQ8 A;  2Y6R A;  2R9Z A;  2WET A;  3F8R A;  2B7S A;  2X8C A;  3S61 A;  4EMW A;  3VR8 A;  1IUT A;  4TM0 A;  4EIP A;  2FJB A;  4WCT A;  1GET A;  1LJ1 A;  4EMJ A;  2V60 A;  4JDR A;  1F6M A;  1H7W A;  1LTX R;  2XLT A;  3AE7 A;  3IHM A;  1PBD A;  1PXA A;  4IVM B;  1V59 A;  2FJD A;  3AD8 B;  1D7L A;  4H2Q A;  3UKK A;  3VR9 A;  3P9U A;  4FK1 C;  1DXL A;  4P9S A;  1KF6 A;  4Y4M A;  1DOB A;  3DK4 A;  2VOU A;  1E1L A;  1YY5 A;  4C74 A;  3SFD A;  3G5Q A;  4OPD A;  4CY8 A;  4U8M A;  2HQM A;  4EQX A;  2C70 A;  4MJW A;  2JB3 A;  2O9Z A;  1H7X A;  1NHQ A;  2Q7V A;  1M6I A;  4JY3 A;  1CBO A;  1GRB A;  2XDO A;  1B37 A;  2XVJ A;  2Z5Y A;  1E39 A;  1JRY A;  4D04 A;  2B9W A;  1DOC A;  4U2L A;  2WPE A;  2B9Y A;  3DH9 A;  2WU2 A;  1CL0 A;  4GCM A;  2VVL G;  1BGN A;  2V3A A;  3Q6J A;  1IUW A;  1MOK A;  5EOW A;  3NTA A;  5U1O A;  4YKF A;  2DKH A;  1XDI A;  2WOV A;  2B76 A;  3C96 A;  3K30 A;  3UKF A;  4EQS A;  1PXC A;  3ALM A;  3NRN A;  3P4P A;  4A7A A;  2NPX A;  4A79 A;  4USR A;  4OPL A;  2R0G A;  2XFQ A;  1E7P A;  5JCN A;  1O95 A;  2WEU A;  3UKA A;  5KVH A;  5BUK A;  1GRT A;  1OJD A;  2C7G A;  2VQB A;  2BAC A;  3LJP A;  1D7Y A;  1F3P A;  3O0H A;  4NEV A;  2GR3 A;  3VRD B;  2BXS A;  1B8S A;  1AOG A;  2V6O A;  4TM3 A;  3AYL A;  4UDQ A;  1H86 A;  3FIM B;  2C64 A;  5JCM A;  5IQ1 A;  4Z2T A;  1YQ4 A;  2XFN A;  3Q9T A;  1O5W A;  2YWL A;  1H81 A;  4IVO B;  2YG5 A;  3AE4 A;  1YKJ A;  5C2T A;  5HXI A;  4ZCD A;  2GQW A;  1ZMD A;  2JK6 A;  3G5R A;  1XHC A;  2OAL A;  4H7U A;  1KDG A;  2BK5 A;  4K8D A;  1ONF A;  2RGH A;  3CTY A;  5TR3 A;  2R45 A;  2YLX A;  4H4V A;  3FMW A;  5HY5 A;  2YG7 A;  3GMB A;  1ZY8 A;  4EM3 A;  2JB2 A;  1XPQ A;  1UKV G;  3P4R A;  4H4S A;  1E1K A;  4A65 A;  1CHU A;  4CCQ A;  3CGB A;  3UCL A;  3M12 A;  4H2P A;  4H4U A;  3NYC A;  3H8I A;  4NTC A;  1E1M A;  4CRT A;  1KNP A;  1NEK A;  1FOH A;  1ZKQ A;  1TYT A;  2C67 A;  1KFY A;  4RG3 A;  3WE0 A;  2WES A;  1L0V A;  4DSG A;  2FJA A;  3BNU A;  3CGC A;  4OPU A;  4HB9 A;  3RP8 A;  1D4D A;  3EAO A;  1GT8 A;  2OA1 A;  4B65 A;  2CFY A;  3UOX A;  4LA1 A;  3ATQ A;  4JNQ A;  3EAN A;  1GRF A;  3AYI A;  1SEZ A;  4K2X A;  5J7X A;  4Z44 A;  4CCR A;  3C4A A;  3OC4 A;  1Q1R A;  1O94 A;  1ZOV A;  1E6E A;  1BWC A;  1BGJ A;  2GAG B;  2WU5 A;  1K0J A;  1E1N A;  3P4S A;  1D4E A;  4AT2 A;  2VZ2 A;  5C3J A;  2AQJ A;  4CNJ A;  1OJC A;  2OLN A;  2B7R A;  1S2Q A;  3AE8 A;  1MXT A;  2GEW A;  4GDP A;  1FEB A;  3AE1 A;  3QFA A;  5U25 A;  2TPR A;  3IC9 A;  4EM4 A;  4D03 A;  5GRT A;  5J60 A;  3SM8 A;  2YVJ A;  1JEH A;  3EPT A;  1RYI A;  2FBW A;  3NHO X;  1NG4 A;  3M13 A;  4YKG A;  4H4R A;  2RGO A;  1Q9I A;  3ITJ A;  3BI5 A;  1TYP A;  3NTD A;  1TDK A;  1PBB A;  3KKJ A;  2C3C A;  1TDO A;  4ZN0 A;  4K7Z A;  3UTE A;  1S3E A;  4JNA A;  1K4Q A;  2F5Z A;  2WQY A;  3RNM A;  3VQR A;  4RSL A;  4FK1 A;  2YR6 A;  3URH A;  1NEN A;  1CJ3 A;  1VQW A;  3ADA B;  4HA6 A;  4IA6 A;  2GMH A;  3V3N A;  2C73 A;  4B1B A;  4XWR A;  3ATR A;  1EL7 A;  4A6N A;  1JNZ A;  3NNE A;  3DJE A;  3RP6 A;  1TDF A;  1JRZ A;  3L8K A;  3CNS A;  3GDN A;  3H8L A;  4I59 A;  4U8P A;  5U63 A;  3BI2 A;  3UP4 A;  2TMD A;  2APG A;  2AR8 A;  4CY6 A;  1FEC A;  2JBV A;  4ECH A;  4C3X A;  3UOY A;  4B68 A;  3GWD A;  3KA7 A;  4AOX A;  3GSI A;  4AOS A;  1K0L A;  1GSN A;  1EBD A;  2H88 A;  3FG2 P;  1QLB A;  4H4X A;  2R4J A;  4Z2R A;  3L1R A;  2YVG A;  4Z2U A;  1N4V A;  1Y56 A;  4DNA A;  3FPZ A;  3C4N A;  3DGH A;  3AE6 A;  4EIQ A;  2BC1 A;  2YAU A;  4OPT A;  3NYE A;  5JCI A;  2GAH B;  2E1M A;  2BCP A;  3AE5 A;  3AE3 A;  3ZDN A;  4C5O A;  1LVL A;  2WOW A;  3CNP A;  2YVF A;  2I0Z A;  4OCG A;  3UP5 A;  4U8J A;  3RED A;  4ZCC A;  1PJ6 A;  4UDP A;  4J2W A;  4YSZ A;  2ZBW A;  2EQ7 A;  3V3O A;  4H50 A;  4UDR A;  1P2H A;  4J34 A;  5EB5 A;  4EMI A;  2OLO A;  3QSS A;  4BK2 A;  3GD4 A;  3GYJ A;  1ZDL A;  3GYI A;  4U8O A;  4OPG A;  3UOV A;  5M10 A;  3T37 A;  1F8R A;  3V76 A;  3QVP A;  5LV9 A;  3DA1 A;  2ARD A;  1OJ9 A;  2JAE A;  3DK9 A;  1CJC A;  2BC0 A;  3CPI G;  4Z24 A;  4KPR A;  4J36 A;  2PYX A;  4YXD A;  4GRT A;  1PBC A;  3DK8 A;  2C3D A;  1HYU A;  5KOX A;  5CQF A;  3FBS A;  3UKQ A;  3E1T A;  3LXD A;  2IID A;  1MO9 A;  4APN A;  3PS9 A;  5FS9 A;  1IUS A;  1PJ5 A;  5FMH A;  2GQF A;  1N4U A;  2QA2 A;  2XLU A;  3UOZ A;  3VRB A;  1VG9 A;  2XCG A;  4H4Q A;  3QJ4 A;  2YM1 A;  1VDC A;  3AED A;  4A6N B;  1GTH A;  2R4E A;  4YT0 A;  4O5Q A;  3BHK A;  3RP7 A;  2BK3 A;  3QVR A;  1IJH A;  1F8S A;  3KD9 A;  3CGE A;  2IVE A;  4YSH A;  1GOS A;  3DME A;  1LPF A;  4LU6 A;  1OJT A;  5JCL A;  5HYM A;  1H6V A;  2C72 A;  3AXB A;  4N9X A;  2PHH A;  1QJD A;  2X8H A;  5IPY A;  1ZK7 A;  4BJZ A;  3QFB A;  3D1C A;  3F8P A;  4A5L A;  3CGD A;  2BK4 A;  3NIX A;  3BI4 A;  1B4V A;  3ICR A;  4U8K A;  3ISH A;  2QCU A;  3AB1 A;  1Y56 B;  1RSG A;  1ZX9 A;  3ICS A;  3CIR A;  1N1P A;  5FS6 A;  1GES A;  5ER0 A;  5EB4 A;  3D8X A;  4BJY A;  3AEE A;  2GB0 A;  1B5Q A;  2GF3 A;  1Y0P A;  2YG6 A;  4X4J A;  3G5S A;  2WS3 A;  3KLJ A;  2W0H A;  1IUV A;  3NK1 X;  2GH5 A;  3P4Q A;  1YQZ A;  5EBK A;  2GVC A;  1DNC A;  2BA9 A;  2YQU A;  2R46 A;  2BS3 A;  4EQW A;  4B66 A;  3PVC A;  2J3N A;  2X50 A;  1PN0 A;  2A89 A;  3BHF A;  4Z25 A;  5IQ4 A;  1GV4 A;  3UKP A;  3NK2 X;  1GER A;  2VRL A;  2WPF A;  2JB1 A;  1COY A;  4H4T A;  2X99 A;  2NVK X;  3AWI A;  4UP3 A;  2YR5 A;  4Z43 A;  1JU2 A;  1KSU A;  2YM2 A;  1GND A;  4H4W A;  3NYF A;  1CJ4 A;  2UZZ A;  2VRM A;  2ZZC A;  1L9D A;  3NH3 X;  1GRA A;  3DGZ A;  2GR0 A;  4LII A;  1DOE A;  3CPJ G;  1DJQ A;  1TRB A;  1K0I A;  2Q0L A;  4O5U A;  2XFO A;  3UKH A;  4X9M A;  2YG3 A;  1L9C A;  4GR1 A;  2WHD A;  3GDP A;  2WPC A;  1ZP0 A;  3UTG A;  3LAD A;  2WBA A;  4TM1 A;  3VRA A;  3GMC A;  1H84 A;  1BF3 A;  4KX6 A;  2GR1 A;  3LOV A;  4U8L A;  4YTP A;  1RP0 A;  4BK1 A;  2EQ9 A;  1Z6L A;  2IVD A;  3K7Q X;  1H83 A;  4RG4 A;  4USQ A;  1REO A;  1YQ3 A;  2VQ7 A;  2CVJ A;  2GMJ A;  3NN6 X;  5KXJ A;  1GXF A;  3AE2 A;  2ZZ0 A;  2YG4 A;  4IA5 A;  4M52 A;  2BXR A;  1S3B A;  1Q1W A;  3AYJ A;  2WOI A;  4H4Y A;  1IUX A;  3QSM A;  4K5S A;  3GRS A;  2ACZ A;  1NG3 A;  3I3L A;  4YTM A;  4AP3 A;  4J56 A;  1JRX A;  2BCG G;  4YSY A;  2R0P A;  5BUL A;  4EQR A;  5BRT A;  4OVI A;  4E0V A;  4YTN A;  2WP5 A;  2GV8 A;  1GPE A;  3NGC X;  1CC4 A;  4H2N A;  1VRQ B;  4B67 A;  1TDE A;  2XVE A;  5HHF A;  3AD9 B;  4H4Z A;  1W4X A;  3AEG A;  3OZ2 A;  2WDQ A;  3SGL A;  2XFU A;  2YLT A;  3AEF A;  2A87 A;  3CNT A;  4I58 A;  1CC6 A;  3PO7 A;  4B64 A;  3H4K A;  3AEC A;  1OJA A;  4DSH A;  4J33 A;  5L46 A;  3DJD A;  2B9X A;  1ZMC A;  5FS7 A;  4REK A;  2WP9 A;  4K22 A;  4FDC B;  2GR2 A;  1NHS A;  4TLZ A;  3KU9 A;  4J31 A;  1GTE A;  3LB8 A;  1DJN A;  3ICT A;  1VG0 A;  1PJ7 A;  2YLS A;  2CUL A;  1GRE A;  3QSE A;  4A99 A;  4B63 A;  2CDU A;  4B69 A;  3LZX A;  3SQP A;  3COX A;  4ICY A;  4U8N A;  1PHH A;  3R9U A;  3AEB A;  3I6D A;  1PBE A;  1ELI A;  1EL8 A;  1EL5 A;  4J57 A;  2V5Z A;  1S2Y A;  4BV6 A;  2C76 A;  3JSK A;  2YLR A;  1H82 A;  1KNR A;  4X9N A;  1NPX A;  2WDR A;  1NDA A;  3ABV A;  1D5T A;  2RAB A;  4BUR A;  1BZL A;  2BS2 A;  2E5V A;  2FJE A;  1ZOY A;  4IV9 A;  4XXG A;  3SFE A;  5M0Z A;  4H4P A;  3IHG A;  5CKU A;  2E4G A;  1LV0 A;  3CN8 A;  3K7M X;  1GEU A;  4TM4 A;  4AP1 A;  1LQT A;  5KVI A;  3NG7 X;  2VVL A;  2XVH A;  4U8I A;  4C77 A;  1D4C A;  3AE9 A;  1PBF A;  3NN0 X;  3KPF A;  1PS9 A;  2C65 A;  2GRT A;  2R0C A;  2V61 A;  2V3B A;  1BKW A;  2XVI A;  1P2E A;  2WDV A;  4PAB A;  1GRG A;  2JKC A;  4U2T A;  2OAM A;  3UTF A;  1CJ2 A;  3NT6 A;  3ZYX A;  2C75 A;  3LZW A;  2XLR A;  4Z26 A;  1QO8 A;  2BS4 A;  4C3Y A;  1GAL A;  2XLP A;  2AAQ A;  1KSS A;  1JOA A;  4JN9 A;  4Y4N A;  2EQ6 A;  4Y4L A;  4K5R A;  1NHR A;  1JNR A;  2XLS A;  4CBQ A;  2XFP A;  4NZH A;  1X31 B;  3UKL A;  1NHP A;  4PAA A;  4XWZ A;  4YWO A;  2X3N A;  1N4W A;  3ALJ A;  3NLC A;  4NTD A;  4OPI A;  1FCD A;  4JQ9 A;  2X8G A;  2C66 A;  2Y6Q A;  1FEA A;  1FL2 A;  3B3R A;  3CNJ A;  3KVE A;  4OPC A;  5KWF A;  2Q6U A;  3B6D A;  2RGJ A;  1M64 A;  2YLZ A;  5FS8 A;  2ZZB A;  1IUU A;  2Q0K A;  3CND A;  4JY2 A;  2XVF A;  3P1W A;  4TLX A;  2WP6 A;  2YLW A;  3HZL A;  4YSX A;  3CPH G;  1EL9 A;  3IWA A;  3UTH A;  3GD3 A;  3ALL A;  4H2R A;  4ADW A;  4A9W A;  4FX9 A;  2BYB A;  3F8D A;  4AT0 A;  4BK3 A;  3NK0 X;  3II4 A;  4GUV A;  2Z5X A;  3IF9 A;  1F8W A;  3RHA A;  5GSN A;  1NAA A;  2QAE A;  3M0O A;  1GRH A;  1PDH A; 
#chains in the Genus database with same CATH topology
 5KOW A;  2QJN A;  2C4C A;  1LQU A;  3DJG X;  4GF7 A;  2BRA A;  3BNM A;  2A8X A;  4IL0 A;  3OW1 A;  4K8G A;  4WCT A;  1LJ1 A;  2NQL A;  2V60 A;  4JDR A;  2XLT A;  3IHM A;  1PBD A;  1PXA A;  4DHG A;  3P9U A;  1KN0 A;  1FFV C;  3R0K A;  4K2S A;  4Y4M A;  1E1L A;  1YY5 A;  1L8P A;  1ONE A;  4U8M A;  4EQX A;  2C70 A;  3UJS A;  2XDO A;  3P0W A;  2B9W A;  4U2L A;  2B9Y A;  3DH9 A;  3R07 C;  2V3A A;  1MOK A;  2GGI A;  2B76 A;  3C96 A;  4IHC A;  3OPS A;  2XFQ A;  5BUK A;  3FVD A;  2VQB A;  2BAC A;  1B8S A;  2PSN A;  2C64 A;  4Z2T A;  2XFN A;  4GYP A;  2YWL A;  2YG5 A;  5HXI A;  3G5R A;  4H7U A;  1KDG A;  4NNJ A;  5TR3 A;  3FMW A;  4H4V A;  2YG7 A;  1XPQ A;  2PA6 A;  1E1K A;  4A65 A;  4H4U A;  4CRT A;  2C67 A;  1TYT A;  3DFY A;  1WUF A;  3RP8 A;  3EAO A;  4B65 A;  2CFY A;  3ATQ A;  4JNQ A;  1SEZ A;  4K2X A;  3JVA A;  1O94 A;  2CHR A;  2GAG B;  1BWC A;  1BGJ A;  3NXL A;  1K0J A;  2VZ2 A;  5C3J A;  1OJC A;  4GDP A;  4II2 A;  4EM4 A;  5J60 A;  2YVJ A;  2HZG A;  3DES A;  3NHO X;  3ITJ A;  3BI5 A;  3KKJ A;  4K7Z A;  1S3E A;  4JNA A;  1N60 C;  2F5Z A;  4RSL A;  4HA6 A;  1VQW A;  1CJ3 A;  3ADA B;  4IZG A;  2GMH A;  4XWR A;  4ROP A;  1JNZ A;  4HNC A;  1JRZ A;  3L8K A;  3RR1 A;  4I59 A;  5U63 A;  3BI2 A;  3UP4 A;  2AR8 A;  1YEY A;  1WYG A;  3V5C A;  3GWD A;  3CAW A;  2R4J A;  3QKE A;  2YVG A;  3KUM A;  3OZM A;  3SZ0 A;  3DGH A;  2YAU A;  4GIS A;  4C5O A;  5JCI A;  3AE5 A;  4H2H A;  4Z17 A;  3TJ4 A;  2YVF A;  4DXK A;  1KCZ A;  3N6H A;  4J2W A;  2GDQ A;  4UDR A;  4J34 A;  5EB5 A;  2OLO A;  3QSS A;  4BK2 A;  3TWA A;  3QVP A;  1CJC A;  4Z24 A;  2PYX A;  4YXD A;  3D46 A;  4EWJ A;  3FBS A;  7ENL A;  1MO9 A;  3VRB A;  4H4Q A;  3A7R A;  1VDC A;  2R4E A;  3BHK A;  2BK3 A;  1F8S A;  3CGE A;  4LU6 A;  3JZU A;  3ETR B;  4G8T A;  2C72 A;  4N9X A;  5IPY A;  4BJZ A;  3MQT A;  3NIX A;  4U8K A;  3H7V A;  2QCU A;  1Y56 B;  1RSG A;  1ZX9 A;  3CIR A;  1JPM A;  2OQH A;  5EB4 A;  3D8X A;  3OP2 A;  3CXO A;  3NK1 X;  2GH5 A;  1PDZ A;  2YQU A;  4B66 A;  2J3N A;  1PN0 A;  2A89 A;  4Z25 A;  3UKP A;  3ZVH B;  1COY A;  4H4T A;  3GYX A;  2QVH A;  3V5F A;  1JU2 A;  4G9K A;  1GND A;  3NYF A;  3DGZ A;  3CPJ G;  1EC8 A;  1K0I A;  1FIQ B;  3BOX A;  3GDP A;  2WPC A;  3GMC A;  3PK7 A;  2GR1 A;  3LOV A;  3ZLH A;  3IJQ A;  3SN0 A;  2CVJ A;  2GMJ A;  4DN1 A;  3HPF A;  3FV9 A;  3UXL A;  3AE2 A;  2QDE A;  2ZZ0 A;  3DFH A;  4IA5 A;  4M52 A;  1Q1W A;  3U4F A;  3AYJ A;  3SXI A;  2WOI A;  4E4U A;  1NG3 A;  4YTM A;  2BCG G;  5BUL A;  5BRT A;  4YTN A;  5FJU A;  2GV8 A;  1GPE A;  4H2N A;  4B67 A;  1TDE A;  1R0M A;  2ZC8 A;  4E5T A;  2A87 A;  1R6W A;  4I58 A;  1ECQ A;  3THU A;  4DSH A;  2XH0 A;  4E6M A;  2I5Q A;  3MKC A;  2WP9 A;  3T4W A;  3KU9 A;  1GTE A;  4JN8 A;  3R0U A;  1VG0 A;  2CDU A;  3TOY A;  1PHH A;  3R9U A;  1EL8 A;  4KEM A;  1EL5 A;  3SZW A;  1SJD A;  4FP1 A;  1EC7 A;  1H82 A;  4X9N A;  3ABV A;  2WDR A;  2RAB A;  1ZOY A;  4IV9 A;  4XXG A;  1MRA A;  5FJR A;  3VA8 A;  1GEU A;  4AP1 A;  5KVI A;  2VVL A;  5FJT A;  1PBF A;  3KPF A;  2V61 A;  2V3B A;  1BKW A;  2P8C A;  2DW6 A;  3AN1 A;  3DIP A;  3NT6 A;  2C75 A;  1QO8 A;  4C3Y A;  3NO1 A;  2OVL A;  4Y4N A;  4GYP C;  4K5R A;  2XLS A;  1X31 B;  3T14 A;  2X3N A;  3H12 A;  2MUC A;  4NTD A;  3DG3 A;  1FL2 A;  3RO6 A;  3CNJ A;  3KVE A;  4OPC A;  5KWF A;  3Q4D A;  3U9I A;  2ZZB A;  1IUU A;  2XVF A;  2WP6 A;  3HZL A;  3CPH G;  3UTH A;  3I6T A;  4ADW A;  2BYB A;  3IF9 A;  2QAE A;  4YKF A;  1GRH A;  4J1O A;  3DJJ A;  2XYO A;  4GDE A;  2QA1 A;  3GRT A;  4NTE A;  3GWF A;  4TVW A;  3S5W A;  3MWC A;  1DOD A;  5DBJ A;  4NEW A;  3UXK A;  3AD7 B;  5KRQ A;  1PXB A;  2Y6R A;  3T9P A;  2WET A;  2X8C A;  3VR8 A;  2FJB A;  3VC6 A;  4EMJ A;  2FJD A;  3PFR A;  1D7L A;  3AD8 B;  3VFC A;  4DYE A;  3NVZ B;  4P9S A;  3K1G A;  1BQG A;  4C74 A;  3SFD A;  4OPD A;  4MJW A;  1NHQ A;  1CBO A;  1GRB A;  1B37 A;  2Z5Y A;  4D04 A;  2QDD A;  3S5S A;  2VVL G;  3Q6J A;  1IUW A;  5EOW A;  3NTA A;  5U1O A;  2WOV A;  4EQS A;  4A79 A;  4OPL A;  1E7P A;  5JCN A;  1NU5 A;  3LJP A;  3P3B A;  4NEV A;  3EKG A;  4TM3 A;  3EUB 3;  3CYJ A;  5JCM A;  5IQ1 A;  1H81 A;  3AE4 A;  4GAP A;  3GO2 A;  2OAL A;  1SJB A;  3MZN A;  1ONF A;  2RGH A;  2R45 A;  2YLX A;  5HY5 A;  4IP4 A;  3P4R A;  4H4S A;  3ES7 A;  3SSZ A;  2BRY A;  3M12 A;  3NZG A;  2RDX A;  1KFY A;  4RG3 A;  2PTW A;  4DSG A;  2O56 A;  3BNU A;  4OPU A;  4HB9 A;  1GT8 A;  4LA1 A;  4G74 A;  3EAN A;  5J7X A;  3C4A A;  3I4K A;  1E1N A;  3UJE A;  2OLN A;  2B7R A;  1MXT A;  1FEB A;  3AE1 A;  3QFA A;  2XH2 A;  3IC9 A;  5GRT A;  2W54 A;  1JEH A;  1RYI A;  4H83 A;  2FBW A;  1NG4 A;  3M13 A;  4YKG A;  1TYP A;  1PBB A;  4ZN0 A;  2C3C A;  3QN3 A;  1K4Q A;  2E5A A;  2WQY A;  3VQR A;  4FK1 A;  3URH A;  5KMQ A;  4B1B A;  4HN8 A;  4IT1 A;  3SBF A;  3DJE A;  3GDN A;  3H8L A;  3T2Z A;  4U8P A;  2PGW A;  2PU1 A;  2JBV A;  3IJL A;  4B68 A;  3KA7 A;  3GSI A;  3CB3 A;  4AOS A;  4MKS A;  4Z2R A;  3L1R A;  3SN4 A;  2PGE A;  4Z2U A;  1N4V A;  4ZOH B;  1Y56 A;  4DNA A;  3FPZ A;  2BC1 A;  4G6G A;  4OPT A;  4OCG A;  3RED A;  2EQ7 A;  4H50 A;  1P2H A;  3ZVH A;  1ZDL A;  1N61 C;  5M10 A;  1F8R A;  3HW2 A;  3N6J A;  3V76 A;  3B9J B;  3H8A A;  2BC0 A;  4KPR A;  1S7M A;  4GRT A;  3DK8 A;  5CQF A;  3UKQ A;  3E1T A;  2IID A;  1JRP A;  2GQF A;  3S47 A;  4A6N B;  1GTH A;  4O5Q A;  2DW7 A;  3NRZ B;  3QVR A;  6ENL A;  3DME A;  3SR6 B;  1H6V A;  2PHH A;  1QJD A;  3D1C A;  3IK4 A;  4A5L A;  2GGH A;  3UJF A;  3ISH A;  3T8Q A;  2GB0 A;  2GF3 A;  1Y0P A;  3G5S A;  2WS3 A;  1X2H A;  1DNC A;  2R46 A;  3PVC A;  1GV4 A;  1MDR A;  3NK2 X;  2VRL A;  2HXT A;  1KSU A;  3SN1 A;  2OZ8 A;  4H4W A;  3RGT A;  2ZZC A;  1L9D A;  1GRA A;  3QTP A;  1DOE A;  4O5U A;  2XFO A;  3UKH A;  4X9M A;  3UTG A;  3LAD A;  4TM1 A;  3VRA A;  3RCY A;  4YTP A;  2XH4 A;  5KXJ A;  1S3B A;  4JHM A;  1STZ A;  4H4Y A;  3UGV A;  1PDY A;  4HNL A;  3SY4 A;  3I3L A;  4J56 A;  1JRX A;  3DDM A;  2R0P A;  4E0V A;  2XVE A;  2WDQ A;  3SGL A;  3AEF A;  1MDL A;  2OLA A;  3PO7 A;  2PTY A;  3AEC A;  5L46 A;  3DJD A;  1E9I A;  3ES8 A;  4K22 A;  4FDC B;  1NHS A;  1TE6 A;  4TLZ A;  1JRO A;  1EBH A;  1SJA A;  1PJ7 A;  3QSE A;  4A99 A;  4B63 A;  4ICY A;  4U8N A;  2HXU A;  1ELI A;  3R11 A;  3FCP A;  2V5Z A;  2C76 A;  2YLR A;  1KNR A;  1NPX A;  1NDA A;  1D5T A;  3SQS A;  1BZL A;  2BS2 A;  2FJE A;  3SFE A;  5M0Z A;  1LV0 A;  3K7M X;  3AM9 A;  2XVH A;  4U8I A;  2OPJ A;  2PS2 A;  3TJI A;  2C65 A;  2R0C A;  3NVV B;  3UTF A;  1CJ2 A;  2HNE A;  3ZYX A;  1OEP A;  2POZ A;  1GAL A;  2AAQ A;  4JN9 A;  2QQ6 A;  1NHR A;  1JNR A;  4NZH A;  3UKL A;  1NHP A;  3PG6 A;  3FYY A;  1W6T A;  4YWO A;  3NLC A;  2C66 A;  1FEA A;  2RGJ A;  1M64 A;  4KWS A;  2FKP A;  3GD3 A;  3ALL A;  4H2R A;  4A9W A;  3VCN A;  4BK3 A;  3AMZ A;  3RHA A;  1NAA A;  3M0O A;  2PU0 A;  3MSY A;  5BVA A;  2VVM A;  5JCK A;  1CC2 A;  3EF6 A;  2QJM A;  2XGZ A;  2BAB A;  4GGB A;  4DGK A;  1MUC A;  3DEQ A;  2YR4 A;  2DKI A;  3ZLF A;  3UJR A;  3F8R A;  2B7S A;  2AKZ A;  4TM0 A;  1VQZ A;  3ENL A;  1GET A;  1F6M A;  1LTX R;  3BJS A;  4IVM B;  1V59 A;  4H2Q A;  3VR9 A;  4FK1 C;  1DXL A;  1FHV A;  3Q45 A;  3DK4 A;  2VOU A;  3G5Q A;  2HQM A;  2JB3 A;  2O9Z A;  4H19 A;  1H7X A;  2Q7V A;  1M6I A;  4M6U A;  2XVJ A;  1E39 A;  2WPE A;  2WU2 A;  2GGG A;  1BGN A;  2DKH A;  3D9X A;  1PXC A;  3FJ4 A;  3P4P A;  2NPX A;  1O95 A;  5KVH A;  3R1Z A;  3VRD B;  3O0H A;  1F3P A;  2PP3 A;  2GR3 A;  2BXS A;  2V6O A;  1H86 A;  4G73 A;  3Q9T A;  4IVO B;  3N4F A;  1ZMD A;  2JK6 A;  2BK5 A;  3TWB A;  4K8D A;  3CTY A;  1ZY8 A;  4EM3 A;  2JB2 A;  1XS2 A;  1WUE A;  4CCQ A;  2OG9 A;  2P8B A;  4H2P A;  3NYC A;  4NTC A;  3NVY B;  1NEK A;  1FOH A;  4A3R A;  2PCE A;  2WES A;  1L0V A;  3CGC A;  2OO6 A;  3UOX A;  5G5H B;  4Z44 A;  3T0K A;  1Q1R A;  1ZOV A;  3P4S A;  4AT2 A;  4ENL A;  2AQJ A;  1S2Q A;  3AE8 A;  2GEW A;  5U25 A;  5BOF A;  2TPR A;  1SB3 B;  3SM8 A;  2OZT A;  3FXG A;  3MY9 A;  3EPT A;  5JRB A;  1KKO A;  2POD A;  2RGO A;  1Q9I A;  1TDK A;  3DER A;  1TDO A;  1JDF A;  3VC5 A;  3RNM A;  1NEN A;  3V3N A;  4IA6 A;  2C73 A;  5IDZ A;  3ATR A;  3HYV A;  4A6N A;  4KT2 A;  5FJO A;  3RP6 A;  2APG A;  4CY6 A;  1FEC A;  4MMW A;  4AOX A;  1K0L A;  1GSN A;  1EBD A;  4H4X A;  2OFJ A;  3C4N A;  3AE6 A;  3NYE A;  2GAH B;  2BCP A;  3AE3 A;  3ZDN A;  1LVL A;  2WOW A;  1KKR A;  3CNP A;  2I0Z A;  3UP5 A;  3SZF A;  4U8J A;  1PJ6 A;  2W55 A;  3V4B A;  4EMI A;  3GD4 A;  4U8O A;  3UOV A;  3GYI A;  4OPG A;  3VCC A;  2JAE A;  3DK9 A;  1ELS A;  1PBC A;  1HYU A;  2OZ3 A;  3LXD A;  4APN A;  3PS9 A;  1IUS A;  5FMH A;  2PP0 A;  2QA2 A;  3UOZ A;  2XCG A;  3QJ4 A;  2YM1 A;  3RIT A;  2XSX A;  4YT0 A;  2PTZ A;  5KMR A;  4A6G A;  4YSH A;  1GOS A;  3A7U A;  2FYM A;  1OJT A;  3TQP A;  3AXB A;  1P43 A;  2OX4 A;  3EEZ A;  3QFB A;  3SJN A;  3F8P A;  2BK4 A;  1B4V A;  4HCL A;  5BOE A;  3ICS A;  1N1P A;  3STP A;  4BJY A;  3AEE A;  2YG6 A;  4X4J A;  3KLJ A;  3P4Q A;  2QJJ A;  5EBK A;  3CK5 A;  2GVC A;  3B97 A;  3BHF A;  1GER A;  3SX6 A;  2WPF A;  2JB1 A;  2NVK X;  3AWI A;  4UP3 A;  3NS1 B;  4Z43 A;  2VRM A;  1F9C A;  2GR0 A;  1TRB A;  2Q0L A;  2PP1 A;  1ZP0 A;  3UCC A;  2WBA A;  1H84 A;  4KX6 A;  3UCD A;  1RP0 A;  2AL2 B;  4BK1 A;  1Z6L A;  1H83 A;  4RG4 A;  2VQ7 A;  3NN6 X;  1GXF A;  4GFI A;  1EBG A;  2BXR A;  4HCD A;  3NVW B;  4K5S A;  2ACZ A;  4AP3 A;  3NGC X;  1CC4 A;  1VRQ B;  4H4Z A;  1W4X A;  2XFU A;  2YLT A;  3H4K A;  4J33 A;  2AL1 A;  2AKM A;  4J3Z A;  4J31 A;  1EC9 A;  3LB8 A;  1DJN A;  2P3Z A;  2YLS A;  1GRE A;  3LZX A;  3COX A;  3I6D A;  1XPY A;  4BV6 A;  3JSK A;  4BUR A;  2E5V A;  4A35 A;  1DTN A;  3QPE A;  1N62 C;  5CKU A;  2E4G A;  3I6E A;  3CN8 A;  3CT2 A;  4TM4 A;  4JN7 A;  4MGG A;  3NG7 X;  1D4C A;  3R10 A;  3AE9 A;  3NN0 X;  1PS9 A;  2GRT A;  4ZCW A;  1P2E A;  4PAB A;  2JKC A;  4U2T A;  2OAM A;  4Z26 A;  2XLP A;  1X2G A;  3ZLG A;  3BSM A;  2GL5 A;  4OPI A;  3ALJ A;  2P0I A;  3B6D A;  3TW9 A;  2YLZ A;  1BKH A;  3P1W A;  4YSX A;  1EL9 A;  4G7F A;  4FX9 A;  3NK0 X;  4GUV A;  1F8W A;  2OKT A;  4KPL A;  2H89 A;  3NKS A;  1L9E A;  1XAN A;  1TDN A;  4U2S A;  3K7T A;  4K1W A;  1CF3 A;  4CNK A;  3AEA A;  4WX1 A;  3L5O A;  2EQ8 A;  2R9Z A;  3S61 A;  4EMW A;  3T31 A;  1IUT A;  3PWG A;  4EIP A;  3TCS A;  5KMP A;  4GGH A;  1H7W A;  3AE7 A;  3UKK A;  2GSH A;  1KF6 A;  1DOB A;  1FFU C;  3OZY A;  4CY8 A;  4JY3 A;  1JRY A;  1DOC A;  1CL0 A;  4GCM A;  4H1Z A;  1XDI A;  3K30 A;  3UKF A;  3ALM A;  3NRN A;  4A7A A;  4USR A;  2R0G A;  3T2Y A;  2WEU A;  3UKA A;  4HPN A;  1GRT A;  1OJD A;  2C7G A;  1D7Y A;  3D47 A;  1AOG A;  3AYL A;  4UDQ A;  3FIM B;  1YQ4 A;  1O5W A;  1YKJ A;  4M0X A;  5C2T A;  3GC2 A;  4ZCD A;  2GQW A;  1XHC A;  3UJ2 A;  3VDG A;  3GMB A;  1UKV G;  1CHU A;  3CGB A;  3A7A A;  3UCL A;  3H8I A;  1E1M A;  1KNP A;  2PTX A;  1ZKQ A;  3KPK A;  1IYX A;  3WE0 A;  1ZXI C;  2FJA A;  3DGB A;  1D4D A;  2OA1 A;  4G6H A;  1JCT A;  1GRF A;  3AYI A;  4CCR A;  3OC4 A;  4GME A;  1E6E A;  2WU5 A;  1D4E A;  4CNJ A;  4HCH A;  4D03 A;  4H4R A;  5G5G B;  3NTD A;  3IJI A;  3UTE A;  2MNR A;  4IL2 A;  2YR6 A;  1SJC A;  2W3S A;  1EL7 A;  3NNE A;  1TDF A;  3CNS A;  3P93 A;  2TMD A;  3SYI A;  4ECH A;  4C3X A;  3T2K A;  3UOY A;  3T6C A;  3R25 A;  2H88 A;  3FG2 P;  1QLB A;  1TKK A;  2OQY A;  5KMS A;  3RRA A;  4EIQ A;  2E1M A;  5KNL A;  3V3W A;  3HYW A;  3DG7 A;  2QGY A;  3GY1 A;  4ZCC A;  2E3T A;  4UDP A;  4YSZ A;  2ZBW A;  3V3O A;  3PWI A;  3GYJ A;  1RM6 B;  3T37 A;  4E8G A;  3OTR A;  5LV9 A;  3DA1 A;  2ARD A;  3CXB A;  1OJ9 A;  3CPI G;  4J36 A;  2W3R A;  2C3D A;  5KOX A;  1N5W C;  4NWZ A;  4FI4 A;  4GAV A;  5FS9 A;  1PJ5 A;  2AL2 A;  1N4U A;  2XLU A;  1VG9 A;  5J04 A;  3TTE A;  3AED A;  2GGE A;  3RP7 A;  1VDV A;  1IJH A;  3KD9 A;  2IVE A;  1FO4 A;  1LPF A;  5JCL A;  5HYM A;  2X8H A;  1ZK7 A;  3GD6 A;  3CGD A;  2PMQ A;  3BI4 A;  1P48 A;  3ICR A;  3AB1 A;  3ZVI A;  1RVK A;  3MUC A;  5FS6 A;  1GES A;  5ER0 A;  1B5Q A;  4E4F A;  4F4R A;  2W0H A;  1IUV A;  1YQZ A;  2BA9 A;  2BS3 A;  4EQW A;  1N63 C;  2X50 A;  3QLD A;  5IQ4 A;  1H2I A;  2X99 A;  2YR5 A;  2YM2 A;  4HYR A;  1CJ4 A;  2UZZ A;  4DX3 A;  3NH3 X;  4LII A;  3NFU A;  1DJQ A;  4YWS A;  2YG3 A;  1L9C A;  4GR1 A;  2WHD A;  1BF3 A;  4U8L A;  1T3Q C;  1FHU A;  2EQ9 A;  2IVD A;  3K7Q X;  3HYX A;  4USQ A;  3N4E A;  1REO A;  1YQ3 A;  3SZC A;  5ENL A;  1JPD X;  3HRD C;  1TZZ A;  2YG4 A;  4GIR A;  4Z1Y A;  1IUX A;  3QSM A;  4IP5 A;  3GRS A;  4YSY A;  4EQR A;  4OVI A;  2ONE A;  2WP5 A;  3H70 A;  2XH7 A;  4X2P A;  5HHF A;  3AD9 B;  3AEG A;  3OZ2 A;  3CNT A;  1CC6 A;  2PPG A;  4B64 A;  1OJA A;  2B9X A;  1ZMC A;  5FS7 A;  4REK A;  2GR2 A;  2P88 A;  1N5X A;  4ZA0 A;  3ICT A;  3CMM A;  2CUL A;  4B69 A;  3SQP A;  1MNS A;  3AEB A;  1PBE A;  1NEL A;  4J57 A;  1S2Y A;  2ZAD A;  4H4P A;  3IHG A;  5FJP A;  1LQT A;  4C77 A;  4TVY A;  2XVI A;  2WDV A;  4DWD A;  1GRG A;  3LZW A;  2XLR A;  2BS4 A;  1KSS A;  1JOA A;  2EQ6 A;  4Y4L A;  3JW7 A;  1V97 A;  4CBQ A;  2XFP A;  4PAA A;  4XWZ A;  1KD0 A;  5EU9 A;  1N4W A;  1FCD A;  4JQ9 A;  2X8G A;  2Y6Q A;  3B3R A;  2Q6U A;  5FS8 A;  2Q0K A;  3CND A;  4JY2 A;  4TLX A;  2YLW A;  3IWA A;  4II3 A;  3F8D A;  4AT0 A;  2GGJ A;  3II4 A;  2Z5X A;  5GSN A;  3DG6 A;  1PDH A; 
#chains in the Genus database with same CATH homology
 5KOW A;  2C4C A;  2H89 A;  3NKS A;  1L9E A;  1XAN A;  3DJJ A;  1LQU A;  1TDN A;  5BVA A;  2VVM A;  5JCK A;  4U2S A;  2XYO A;  1CC2 A;  4GDE A;  3K7T A;  2QA1 A;  3GRT A;  4NTE A;  3EF6 A;  3DJG X;  3GWF A;  4GF7 A;  1CF3 A;  3S5W A;  2BRA A;  3BNM A;  2BAB A;  2A8X A;  1DOD A;  4CNK A;  5DBJ A;  4NEW A;  3AEA A;  4DGK A;  4WX1 A;  3L5O A;  2YR4 A;  3AD7 B;  5KRQ A;  2DKI A;  1PXB A;  2EQ8 A;  2Y6R A;  2R9Z A;  2WET A;  3F8R A;  2B7S A;  2X8C A;  3S61 A;  4EMW A;  3T31 A;  3VR8 A;  1IUT A;  4TM0 A;  4EIP A;  2FJB A;  4WCT A;  5KMP A;  1GET A;  1LJ1 A;  4EMJ A;  2V60 A;  4JDR A;  1F6M A;  1H7W A;  1LTX R;  2XLT A;  3AE7 A;  3IHM A;  1PBD A;  1PXA A;  4IVM B;  1V59 A;  2FJD A;  3AD8 B;  1D7L A;  4H2Q A;  3UKK A;  3VR9 A;  3P9U A;  1KN0 A;  4FK1 C;  1DXL A;  4P9S A;  1KF6 A;  4Y4M A;  1DOB A;  3DK4 A;  2VOU A;  1E1L A;  1YY5 A;  4C74 A;  3SFD A;  3G5Q A;  4OPD A;  4CY8 A;  4U8M A;  2HQM A;  4EQX A;  2C70 A;  4MJW A;  2JB3 A;  2O9Z A;  1H7X A;  1NHQ A;  2Q7V A;  1M6I A;  4JY3 A;  1CBO A;  1GRB A;  2XDO A;  1B37 A;  2XVJ A;  2Z5Y A;  1E39 A;  1JRY A;  4D04 A;  2B9W A;  1DOC A;  4U2L A;  2WPE A;  2B9Y A;  3DH9 A;  2WU2 A;  1CL0 A;  4GCM A;  2VVL G;  1BGN A;  2V3A A;  3Q6J A;  1IUW A;  1MOK A;  5EOW A;  3NTA A;  5U1O A;  4YKF A;  2DKH A;  1XDI A;  2WOV A;  2B76 A;  3C96 A;  3K30 A;  3D9X A;  4EQS A;  3UKF A;  1PXC A;  3ALM A;  3NRN A;  3P4P A;  4A7A A;  2NPX A;  4A79 A;  4USR A;  4OPL A;  2R0G A;  3T2Y A;  2XFQ A;  1E7P A;  5JCN A;  1O95 A;  2WEU A;  3UKA A;  5KVH A;  5BUK A;  1GRT A;  1OJD A;  2C7G A;  2VQB A;  2BAC A;  3LJP A;  1D7Y A;  1F3P A;  3O0H A;  4NEV A;  2GR3 A;  3VRD B;  2BXS A;  1B8S A;  1AOG A;  2V6O A;  4TM3 A;  3AYL A;  4UDQ A;  1H86 A;  3FIM B;  2C64 A;  5JCM A;  5IQ1 A;  4Z2T A;  1YQ4 A;  4G73 A;  2XFN A;  3Q9T A;  1O5W A;  2YWL A;  1H81 A;  4IVO B;  2YG5 A;  3AE4 A;  1YKJ A;  5C2T A;  5HXI A;  4ZCD A;  2GQW A;  1ZMD A;  2JK6 A;  3G5R A;  1XHC A;  2OAL A;  4GAP A;  4H7U A;  1KDG A;  2BK5 A;  4K8D A;  1ONF A;  2RGH A;  4NNJ A;  3CTY A;  5TR3 A;  2R45 A;  2YLX A;  4H4V A;  3FMW A;  5HY5 A;  2YG7 A;  3GMB A;  1ZY8 A;  4EM3 A;  2JB2 A;  1XPQ A;  1UKV G;  3P4R A;  4H4S A;  1E1K A;  4A65 A;  1CHU A;  4CCQ A;  3CGB A;  3UCL A;  2BRY A;  3M12 A;  4H2P A;  4H4U A;  3NYC A;  3H8I A;  4NTC A;  1E1M A;  4CRT A;  1KNP A;  1NEK A;  1FOH A;  1ZKQ A;  1TYT A;  2C67 A;  3KPK A;  1KFY A;  4RG3 A;  3WE0 A;  2WES A;  1L0V A;  4DSG A;  2FJA A;  3BNU A;  3CGC A;  4OPU A;  4HB9 A;  3RP8 A;  1D4D A;  3EAO A;  1GT8 A;  2OA1 A;  4B65 A;  2CFY A;  3UOX A;  4G6H A;  4LA1 A;  3ATQ A;  4G74 A;  4JNQ A;  3EAN A;  1GRF A;  3AYI A;  1SEZ A;  4K2X A;  5J7X A;  4Z44 A;  3T0K A;  4CCR A;  3C4A A;  3OC4 A;  1Q1R A;  1O94 A;  1ZOV A;  1E6E A;  1BWC A;  1BGJ A;  2GAG B;  2WU5 A;  1K0J A;  1E1N A;  3P4S A;  1D4E A;  4AT2 A;  2VZ2 A;  5C3J A;  2AQJ A;  4CNJ A;  1OJC A;  2OLN A;  2B7R A;  1S2Q A;  3AE8 A;  1MXT A;  2GEW A;  4GDP A;  1FEB A;  3AE1 A;  3QFA A;  5U25 A;  4II2 A;  2TPR A;  3IC9 A;  4EM4 A;  4D03 A;  5GRT A;  5J60 A;  3SM8 A;  2YVJ A;  1JEH A;  3EPT A;  1RYI A;  5JRB A;  2FBW A;  3NHO X;  1NG4 A;  3M13 A;  4YKG A;  4H4R A;  2RGO A;  1Q9I A;  3ITJ A;  3BI5 A;  1TYP A;  3NTD A;  1TDK A;  1PBB A;  3KKJ A;  2C3C A;  1TDO A;  4ZN0 A;  4K7Z A;  3UTE A;  1S3E A;  4JNA A;  1K4Q A;  2F5Z A;  2WQY A;  3RNM A;  3VQR A;  4RSL A;  4FK1 A;  2YR6 A;  3URH A;  1NEN A;  1CJ3 A;  1VQW A;  3ADA B;  4HA6 A;  4IA6 A;  2GMH A;  5KMQ A;  3V3N A;  2C73 A;  4B1B A;  4XWR A;  3ATR A;  3HYV A;  1EL7 A;  4A6N A;  1JNZ A;  3NNE A;  3DJE A;  3RP6 A;  1TDF A;  1JRZ A;  3L8K A;  3CNS A;  3GDN A;  3H8L A;  4I59 A;  4U8P A;  5U63 A;  3T2Z A;  3BI2 A;  3UP4 A;  2TMD A;  2APG A;  2AR8 A;  4CY6 A;  1FEC A;  2JBV A;  3SYI A;  4ECH A;  4C3X A;  3T2K A;  3UOY A;  4B68 A;  3GWD A;  3KA7 A;  4AOX A;  3GSI A;  4AOS A;  1K0L A;  1GSN A;  1EBD A;  2H88 A;  3FG2 P;  1QLB A;  4H4X A;  2R4J A;  4Z2R A;  3L1R A;  2YVG A;  4Z2U A;  5KMS A;  1N4V A;  1Y56 A;  3SZ0 A;  4DNA A;  3FPZ A;  3C4N A;  3DGH A;  3AE6 A;  4EIQ A;  2BC1 A;  2YAU A;  4G6G A;  4OPT A;  3NYE A;  5JCI A;  2GAH B;  2E1M A;  2BCP A;  3AE5 A;  3AE3 A;  3ZDN A;  4C5O A;  5KNL A;  1LVL A;  3HYW A;  2WOW A;  3CNP A;  2YVF A;  2I0Z A;  4OCG A;  3UP5 A;  3SZF A;  4U8J A;  3RED A;  4ZCC A;  1PJ6 A;  4UDP A;  4J2W A;  4YSZ A;  2ZBW A;  2EQ7 A;  3V3O A;  4H50 A;  4UDR A;  1P2H A;  4J34 A;  5EB5 A;  4EMI A;  2OLO A;  3QSS A;  4BK2 A;  3GD4 A;  3GYJ A;  1ZDL A;  3GYI A;  4U8O A;  4OPG A;  3UOV A;  5M10 A;  3T37 A;  1F8R A;  3V76 A;  3QVP A;  5LV9 A;  3DA1 A;  2ARD A;  1OJ9 A;  2JAE A;  3DK9 A;  1CJC A;  2BC0 A;  3CPI G;  4Z24 A;  4KPR A;  4J36 A;  2PYX A;  1S7M A;  4YXD A;  4GRT A;  1PBC A;  3DK8 A;  2C3D A;  1HYU A;  5KOX A;  5CQF A;  3FBS A;  3UKQ A;  4NWZ A;  3E1T A;  3LXD A;  2IID A;  1MO9 A;  4GAV A;  4APN A;  3PS9 A;  5FS9 A;  1IUS A;  1PJ5 A;  5FMH A;  2GQF A;  1N4U A;  2QA2 A;  2XLU A;  3UOZ A;  3VRB A;  1VG9 A;  2XCG A;  4H4Q A;  3QJ4 A;  2YM1 A;  1VDC A;  3AED A;  4A6N B;  1GTH A;  2R4E A;  4YT0 A;  4O5Q A;  3BHK A;  3RP7 A;  5KMR A;  2BK3 A;  3QVR A;  1IJH A;  1F8S A;  3KD9 A;  3CGE A;  2IVE A;  4YSH A;  1GOS A;  3DME A;  1LPF A;  4LU6 A;  1OJT A;  5JCL A;  5HYM A;  1H6V A;  2C72 A;  3AXB A;  4N9X A;  2PHH A;  1QJD A;  2X8H A;  5IPY A;  1ZK7 A;  4BJZ A;  3QFB A;  3D1C A;  3F8P A;  4A5L A;  3CGD A;  2BK4 A;  3NIX A;  3BI4 A;  1B4V A;  3ICR A;  4U8K A;  3ISH A;  2QCU A;  3AB1 A;  1Y56 B;  1RSG A;  1ZX9 A;  3ICS A;  3CIR A;  1N1P A;  5FS6 A;  1GES A;  5ER0 A;  5EB4 A;  3D8X A;  4BJY A;  3AEE A;  2GB0 A;  1B5Q A;  2GF3 A;  1Y0P A;  2YG6 A;  4X4J A;  3G5S A;  2WS3 A;  3KLJ A;  2W0H A;  1IUV A;  3NK1 X;  2GH5 A;  3P4Q A;  1YQZ A;  5EBK A;  2GVC A;  1DNC A;  2BA9 A;  2YQU A;  2R46 A;  2BS3 A;  4EQW A;  4B66 A;  3PVC A;  2J3N A;  2X50 A;  1PN0 A;  2A89 A;  3BHF A;  4Z25 A;  5IQ4 A;  1GV4 A;  3UKP A;  3NK2 X;  1GER A;  3SX6 A;  1H2I A;  2VRL A;  2WPF A;  2JB1 A;  1COY A;  4H4T A;  2X99 A;  3GYX A;  2NVK X;  3AWI A;  4UP3 A;  2YR5 A;  4Z43 A;  1JU2 A;  1KSU A;  2YM2 A;  4G9K A;  1GND A;  4H4W A;  3NYF A;  1CJ4 A;  2UZZ A;  2VRM A;  2ZZC A;  1L9D A;  3NH3 X;  1GRA A;  3DGZ A;  2GR0 A;  4LII A;  1DOE A;  3CPJ G;  1DJQ A;  1TRB A;  1K0I A;  2Q0L A;  4O5U A;  2XFO A;  3UKH A;  4X9M A;  2YG3 A;  1L9C A;  4GR1 A;  2WHD A;  3GDP A;  2WPC A;  1ZP0 A;  3UTG A;  3LAD A;  2WBA A;  4TM1 A;  3VRA A;  3GMC A;  1H84 A;  1BF3 A;  4KX6 A;  2GR1 A;  3LOV A;  4U8L A;  4YTP A;  1RP0 A;  4BK1 A;  2EQ9 A;  1Z6L A;  2IVD A;  3K7Q X;  1H83 A;  4RG4 A;  3HYX A;  4USQ A;  1REO A;  1YQ3 A;  2VQ7 A;  3SZC A;  2CVJ A;  2GMJ A;  3NN6 X;  5KXJ A;  1GXF A;  3AE2 A;  2ZZ0 A;  2YG4 A;  4IA5 A;  4M52 A;  2BXR A;  1S3B A;  1Q1W A;  3AYJ A;  3SXI A;  2WOI A;  4H4Y A;  1IUX A;  3QSM A;  4K5S A;  3GRS A;  2ACZ A;  3SY4 A;  1NG3 A;  3I3L A;  4YTM A;  4AP3 A;  4J56 A;  1JRX A;  2BCG G;  4YSY A;  2R0P A;  5BUL A;  4EQR A;  5BRT A;  4OVI A;  4E0V A;  4YTN A;  2WP5 A;  2GV8 A;  1GPE A;  3NGC X;  1CC4 A;  4H2N A;  1VRQ B;  4B67 A;  1TDE A;  2XVE A;  5HHF A;  3AD9 B;  4H4Z A;  1W4X A;  3AEG A;  3OZ2 A;  2WDQ A;  3SGL A;  2XFU A;  2YLT A;  3AEF A;  2A87 A;  3CNT A;  4I58 A;  1CC6 A;  3PO7 A;  4B64 A;  3H4K A;  3AEC A;  1OJA A;  4DSH A;  4J33 A;  5L46 A;  3DJD A;  2B9X A;  1ZMC A;  5FS7 A;  4REK A;  2WP9 A;  4K22 A;  4FDC B;  2GR2 A;  1NHS A;  4TLZ A;  3KU9 A;  4J31 A;  1GTE A;  3LB8 A;  1DJN A;  3ICT A;  1VG0 A;  1PJ7 A;  2YLS A;  3CMM A;  2CUL A;  1GRE A;  3QSE A;  4A99 A;  4B63 A;  2CDU A;  4B69 A;  3LZX A;  3SQP A;  3COX A;  4ICY A;  4U8N A;  1PHH A;  3R9U A;  3AEB A;  3I6D A;  1PBE A;  1ELI A;  1EL8 A;  1EL5 A;  4J57 A;  2V5Z A;  3SZW A;  1S2Y A;  4BV6 A;  2C76 A;  3JSK A;  2YLR A;  1H82 A;  1KNR A;  4X9N A;  1NPX A;  2WDR A;  1NDA A;  3ABV A;  1D5T A;  2RAB A;  4BUR A;  1BZL A;  2BS2 A;  2E5V A;  2FJE A;  1ZOY A;  4IV9 A;  4XXG A;  3SFE A;  5M0Z A;  4H4P A;  3IHG A;  5CKU A;  2E4G A;  1LV0 A;  3CN8 A;  3K7M X;  1GEU A;  4TM4 A;  4AP1 A;  1LQT A;  5KVI A;  3NG7 X;  2VVL A;  2XVH A;  4U8I A;  4C77 A;  1D4C A;  3AE9 A;  1PBF A;  3NN0 X;  3KPF A;  1PS9 A;  2C65 A;  2GRT A;  2R0C A;  2V61 A;  2V3B A;  1BKW A;  2XVI A;  1P2E A;  2WDV A;  4PAB A;  1GRG A;  2JKC A;  4U2T A;  2OAM A;  3UTF A;  1CJ2 A;  3NT6 A;  3ZYX A;  2C75 A;  3LZW A;  2XLR A;  4Z26 A;  1QO8 A;  2BS4 A;  4C3Y A;  1GAL A;  2XLP A;  2AAQ A;  1KSS A;  1JOA A;  4JN9 A;  4Y4N A;  2EQ6 A;  4Y4L A;  4K5R A;  1NHR A;  1JNR A;  2XLS A;  4CBQ A;  2XFP A;  4NZH A;  1X31 B;  3UKL A;  1NHP A;  3PG6 A;  4PAA A;  4XWZ A;  3T14 A;  4YWO A;  2X3N A;  1N4W A;  3ALJ A;  3NLC A;  4NTD A;  4OPI A;  1FCD A;  4JQ9 A;  2X8G A;  2C66 A;  2Y6Q A;  1FEA A;  1FL2 A;  3B3R A;  3CNJ A;  3KVE A;  4OPC A;  5KWF A;  2Q6U A;  3B6D A;  2RGJ A;  1M64 A;  2YLZ A;  5FS8 A;  2ZZB A;  1IUU A;  2Q0K A;  3CND A;  4JY2 A;  2XVF A;  3P1W A;  4TLX A;  2WP6 A;  2YLW A;  3HZL A;  4YSX A;  3CPH G;  1EL9 A;  3IWA A;  3UTH A;  3GD3 A;  3ALL A;  4II3 A;  4H2R A;  4ADW A;  4A9W A;  4FX9 A;  2BYB A;  3F8D A;  4AT0 A;  4BK3 A;  3NK0 X;  3II4 A;  4GUV A;  2Z5X A;  3IF9 A;  1F8W A;  3RHA A;  5GSN A;  1NAA A;  2QAE A;  3M0O A;  1GRH A;  1PDH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...