3GDFA

Crystal structure of the nadp-dependent mannitol dehydrogenase from cladosporium herbarum.
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
267
structure length
267
Chain Sequence
MPGQQATKHESLLDQLSLKGKVVVVTGASGPKGMGIEAARGCAEMGAAVAITYASRAQGAEENVKELEKTYGIKAKAYKCQVDSYESCEKLVKDVVADFGQIDAFIANAGATADSGILDGSVEAWNHVVQVDLNGTFHCAKAVGHHFKERGTGSLVITASMSGHIANFPQEQTSYNVAKAGCIHMARSLANEWRDFARVNSISPGYIDTGLSDFVPKETQQLWHSMIPMGRDGLAKELKGAYVYFASDASTYTTGADLLIDGGYTTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the NADP-dependent mannitol dehydrogenase from Cladosporium herbarum: Implications for oligomerisation and catalysis.
pubmed doi rcsb
source organism Cladosporium herbarum
molecule tags Oxidoreductase
molecule keywords Probable NADP-dependent mannitol dehydrogenase
total genus 92
structure length 267
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.138: Mannitol 2-dehydrogenase (NADP(+)).
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gdfA00
2IYPA 3ONEA 4E12A 1KVQA 4J2OA 3BHIA 4YA6A 4Q3DA 4DPMA 3KEOA 1N8KA 5G4KA 4CM9D 4NK5A 2DU8A 3LF1A 3QWHA 4WE3A 1VC2A 3K31A 4CPDA 5DULA 3PWZA 5HWSA 2J5RA 3NV9A 1XQ6A 2EJWA 3FNEA 3WB9A 1DXYA 4BNIA 4YXFA 1YQXA 4RVUA 1KEUA 4CL3A 1ULSA 5F1KA 2JD2A 5L7TA 3PHJA 3K92A 3WTCA 4LVUA 1ZKMA 2VHZA 2PLAA 3EVNA 1HDGO 3RC9A 3RFXA 4A03A 3WQRA 4IDEA 2EKQA 3UUWA 1AN9A 1E0DA 4N54A 2WTBA 2ZYDA 2I3GA 2HK8A 1L7EA 3WGIA 2JCVA 1KERA 3IAHA 3JQ8B 3SJUA 5FI5A 1XG5A 3JTMA 5CPFA 2PKQO 5IAAA 1HLPA 2FSVA 3FR8A 2I3AA 3KLMX 4YTEA 3DL2A 5FYDA 3HJAA 1I2CA 3KBOA 4ZICA 2QX7A 1LDGA 1GAEO 3I4FA 4U0JA 4EJ0A 1B8UA 5CDYA 3G49A 1O89A 4F46A 3DZBA 4FJ2A 1NXQA 5JO0A 3R3JA 1BW9B 2F1KA 1DPGA 2I67A 5L4NA 1B8PA 4CLDA 3IP1A 3ULKA 4O59O 3UFXA 3EUWA 4B3IA 1C1DA 1ZVMA 1EUCA 2HU2A 3UF0A 5U9CA 4J43A 1IB6A 3VPXA 3GMDA 2JFGA 5G0SA 1N2SA 3AOEA 4E33A 2V6BA 4HNHA 2VWGA 5EPOA 4YJGB 3TQHA 4Z3KA 1TT5B 5BNIA 2OZPA 2X1HA 3H9GA 3OSUA 1Y5RA 1EVYA 2AA3A 4RJTA 3GHHA 5DP1A 5IN5A 4FFMA 2XXJA 3PJDA 5A5FA 1C14A 3VPHA 1U2DA 4K9DA 3SBOA 4I8XA 3DHYA 1LSSA 3WG9A 5BNFA 3D5QA 3QWAA 1GU7A 4BNZA 1N7GA 5JBIA 4E31A 1CETA 5U1PA 1VRWA 2C5EA 3GRPA 5IF3A 1SBYA 1QLHA 2Y93A 5F5LA 4RVGA 3V5NA 1F0YA 4BNNA 4BO1A 1V6AA 2Z5LA 4OXKA 3ZU2A 4Z6KA 3GUYA 4IIUA 3I9JA 5I7VA 1F8GA 4H7PA 4AJ4A 1Q0LA 3CZRA 3RQSA 4ONEA 3ASVA 4Z0HO 4GKVA 4UUOA 3AUAA 4KWIA 5T57A 3B1JA 1U5AA 2GERA 2FY8A 2EKLA 1ULUA 4JJFA 3DBHA 2YDXA 1H6BA 4HFRA 5C5IA 4HFMA 3NT2A 1GYQA 1D8AA 4EDFA 4NDNE 3QLJA 1Y8RA 3I9NA 1NPYA 4ZQHA 3K2BA 5JMPA 2HK7A 3JQ7A 1Q7CA 3EW7A 4C7KA 2O3JA 5IDXA 4ALLA 5ENVA 2ZB8A 4IINA 4XJSA 3DBVO 2W98A 2E6UX 3BIOA 3CTMA 3QSGA 1VL0A 3GVPA 3OIFA 1YBVA 2C82A 1ZUD1 4BO0A 1G0OA 3HADA 3SLKA 5IZCC 3DBRB 4QX6A 2V6FA 3WGYA 2IDZA 4J4BA 4AICA 5MDHA 3MJEA 2PZJA 5AYVA 2GZ3A 3PDJA 2O3SA 3NRCA 4BKUA 2YFHA 3B70A 1DRVA 1ZO8A 4ND3A 1U1IA 3M6IA 1ARZA 3WGQA 1LDMA 1JDJA 3N74A 3ZU5A 3HFGA 4OXNA 4FBGA 3DC2A 1HDRA 1H9BA 2EKPA 1JA9A 2IZ0A 3O38A 3GZ4A 4G2NA 2Q2VA 3K96A 4ND2A 3GEDA 1PZFA 4IXWA 5G0UA 1JLLA 4JBGA 3TZ6A 2VUTA 1EK5A 5B4TA 1NM5A 4LRTB 1ADCA 3D3WB 2GZ2A 1XGKA 3AI2A 4BNFA 2Q49A 4L73A 4CM8A 1YH3A 4XQCA 1FDUA 3GC6A 3T4XA 1H93A 3I9KA 3KV3O 3DFZA 2HRBA 4BNWA 4CM9A 2HLPA 5HS4A 5GMOA 4ZJUA 1BTOA 3I9OA 2UV8A 3ZWVA 4AJOA 4YAIA 1I0ZA 4J1QA 1UDBA 3TZHA 2ZQYA 2FPPA 4R9SA 5HTOA 2Z1MA 2XXBA 1H9AA 2D4AA 4FGSA 1PIWA 2HRZA 4W9NA 1N9GB 1O6ZA 5KVCA 3EGOA 2FRDA 5KJEA 3WWYA 3OH8A 4CV2A 1O0SA 1SEPA 1R4MB 1EK6A 1EDZA 4CV3A 4E13A 3GNTA 3MCVA 1PQWA 2HJRA 4FB5A 4GQAA 5ILOA 3I52A 4A10A 1U8FO 2P9CA 4WCFC 1WLYA 4L76A 2G17A 3EZLA 4E2XA 5JXWA 3FBTA 2RAFA 4PRLA 1I3NA 1B15A 1O8CA 2OP1A 5EQFA 2YFQA 1NQ5A 4I5GA 1UZMA 2X5OA 2P9EA 4DVJA 5AVOA 3SEFA 3A28A 4CLOA 4CLRA 2NTJA 4WOKA 4NFSA 3W8EA 1VJTA 1JVBA 2TMDA 5BQFA 1R0KA 1Z74A 3NDRA 2ZATA 1UP4A 4JCOA 3VZRA 1Z82A 3KYBA 5JC8A 5TS3A 3HN7A 2A4KA 3PVZA 4A73A 1MB4A 2ZQZA 3PK0A 4BMVA 3RBVA 1YQGA 5AXAA 3AY3A 3L9WA 2IXAA 5ICMA 5GZ1A 2P9GA 4RO0A 9LDTA 4QSMA 1NQTA 1SB9A 1GV0A 3KETA 3DAGA 3OEWA 5KTKA 5CPBA 4MKXA 4PG6A 1DIBA 3K9QO 4Q9NA 2CDAA 2ZYGA 4BO3A 3EVTA 3WGHA 3WIDA 1EFKA 5CFZA 1I01A 1ISGA 3JSAA 1E1KA 1T25A 1BSVA 1YDEA 4PG8A 9LDBA 4B4OA 3PQDA 3AFNA 3RFTA 4IJWA 4JXKA 1ZEMA 1H2HA 4FFOA 3PYMA 1LSUA 4R01A 5A05A 3S1LA 1PZGA 4DC0A 4D42A 2OBYA 3LZ6A 4CR6A 3LC7O 1J6UA 1WNTA 3IP3A 2DUWA 3JQ9A 5A3VA 4CMIB 1Q0HA 2GN6A 2VWPA 1DIHA 2NADA 4R51A 4OJNA 1E5QA 2EHDA 2HO5A 1QLJA 3DTYA 2Y0DA 3OQ1A 1MG0A 4MO2A 2WD7A 4P4GA 2IYOA 4RPLA 1ZK4A 1ZH8A 2NUAA 4CMKA 5BSGA 3PWKA 1LX6A 1GR0A 2NVUB 3U4IA 3WGZA 3QY9A 4L4XA 1R15A 5IJZA 2AE2A 2NSDA 3S2IA 5CEEA 3H9JA 4BNLA 1Z73A 3INTA 3E5RA 3L9XA 3ONFA 5EESA 1J4AA 2Z1NA 2HCTA 4W99A 1C3VA 1H0KA 3U62A 3PJFA 3WJAA 2X9NA 4GVXA 2O3RA 3I6QA 2P68A 1P3DA 4PLZA 5TJ9A 3AOGA 4D46A 4WUVA 2YDYA 3FNGA 5DNAA 5KVVA 1LRJA 4YQZA 1BVRA 4E6PA 4CLEA 4YJFA 5EL0A 4E5NA 4QXMA 4FSHA 1N92A 4GPD1 4PVDA 5KCZA 1VM6A 1NAHA 4Q3AA 4OGWA 4NG5A 1D3AA 3QP9A 4F3YA 2BGMA 1RM5A 4G5HA 1C0KA 4DYVA 1U7TA 4PGFA 2OORA 1DJNA 4M86A 4QFCA 5I9NA 1UAGA 8LDHA 4ID9A 4AJHA 2NU9A 3FHLA 2B0JA 4A27A 1LLDA 5CHEA 5L45A 1BXZA 4E5PA 4YT5A 4D3DA 5IZCA 3V1YA 4DPKA 4G65A 3GK3A 1OZAA 2V6MA 1X15A 2PZMA 1Y9AA 4BQRA 2NTNA 2VT3A 4XGKA 1PTJA 5TX7A 3WNVA 4JP2A 1A4UA 5JDIA 1ADGA 2BLLA 4L0QA 3RUEA 4BKQA 1BW9A 1NNUA 2BF7A 3JQBA 4CMEA 4A5OA 3K5PA 1YONA 4DQXA 3HB4X 4MVJP 1TI7A 1Y6JA 1YXMA 4KTVE 1X0VA 2X0JA 1FDVA 2YHIB 4RORA 5EIOA 3GNQA 4CMIA 5IFLA 4O1MA 3M1LA 2FOIA 3WGTA 2X4GA 4UVEA 3PHLA 1YL6A 3GEMA 1NBOA 2G76A 3BZUA 4NMHA 1R4NB 3FRJA 4CMCA 4BGEA 1D1SA 3DR3A 3F5QA 1M67A 1PWZA 1X7DA 1DC4A 1TT5A 1NHGA 4XYGA 3Q6IA 4ZHSA 3E9QA 4UEKA 5JAMA 3ZHBA 4F6CA 3PQFA 3VTFA 2TMGA 2VOEA 1PEDA 5LDGA 3WX0A 2VUUA 4ALMA 4I5DA 5DDIP 3E9MA 4MOWA 4TRJA 2GN9A 1PJ2A 1EVJA 4K6FA 4UUNA 4KDFA 1AXEA 4CR7A 3QVTA 1DO8A 3VKVA 3W4JA 2WEKA 1QG6A 4TVBA 5KKCA 4GX1A 5ER6A 4XDZA 5B4UA 3QQPA 5DP2A 4AVYA 2R2GA 5F5NA 2UYYA 1N5DA 4XYEA 4Q3EA 4B4VA 4XWYA 1ISMA 1QRRA 1ZEJA 3TOXA 3VDRA 4TKLA 2PGJA 2PKQP 4R5HA 2VYND 3GG2A 4E21A 3GPDG 4CM4A 1B3BA 2EF1A 3ZHZA 3JYOA 4RF4A 2X22A 5THQA 4XYLA 1X7GA 1C0LA 2YV2A 2AEFA 4MKZA 4ZVVA 2FWMX 2VZ8A 4J16A 2G82A 3L6DA 4N5LA 1MFPA 1PGNA 5DF1A 3GGOA 1C1XA 3I1JA 4BNGA 3AWDA 1H2BA 3GN2A 1KC3A 4PIVA 4Y98A 3KYDB 4DUPA 4LRSB 1MGOA 1B14A 4EJ6A 2I66A 3WYBA 4GGOA 1YVEI 2IEBA 1E1LA 3E48A 4XX0A 3EK2A 4WOJA 1ZK1A 1XSEA 1LJ8A 4CQLB 1PJLA 3QVOA 2UAGA 3O03A 2YQ5A 3DO5A 4J0FA 1FF9A 1XQ1A 4RPGA 1PJ4A 5JE8A 1GD1O 5CP8A 4NNJA 5CDUA 1K0UA 2NACA 3GH3A 3OMLA 3JQFA 3TFQA 3CPSA 2X9GA 3ZH2A 4CM5A 1IL0A 3I6IA 4AL4A 3WFIA 2X6TA 5AQ1A 4J0EA 1MXFA 4KTTE 1U8XX 3TPCA 4AJ2A 4C7JA 3UOGA 5TSDA 4BKRA 1Y8QB 4CMHA 3VC7A 3VZSA 1H5QA 3MWDB 5JFOA 2W2KB 1TLTA 7ADHA 3MJ4A 3QW2A 4DC1A 4NPCA 3KB6A 4YT4A 1E1MA 2C54A 2BI7A 4PG5A 3V2HA 2CDBA 4RGBA 1P9LA 3PI7A 3ZDFA 1IPFA 2NU7A 1BMDA 4E2ZA 1DFGA 4J1SA 1MFZA 2FPIA 3ZNQA 5G0TA 3RASA 3JQGA 1PU2A 2SCUA 4IS3A 4OKNA 1C1DB 2RBEA 2IE0A 1LA2A 4CM3A 4EW6A 4EEXA 4MVJD 4I9UA 1WMAA 2C2YA 3ADPA 1B16A 5A02A 4XR4A 3IUSA 3U5TA 2DKNA 1I10A 3HUDA 5DBIA 4YR9A 3AU8A 4BMNA 4YPOA 3JYNA 3P2YA 3O9ZA 1PZHA 4OO3A 1Y1PA 5A9TA 4BV8A 4Q3NA 4FJ1A 1P0FA 1NR7A 4CMJA 5KJCA 2XAAA 1BVUA 4XZ3A 1E7MA 4J6FA 4IGFA 3JD4A 4OSOA 2Q1UA 1W73A 5TC4A 4DMMA 1TT7A 2VYVA 4IJUA 4O63O 4HKTA 3MTGA 1UDCA 4FIZA 5A4DA 4R1UA 2BMAA 1QYXA 4B3HA 2CVQA 4EEZA 3UICA 4E5MA 1F17A 1HYHA 4GI2A 1XLTA 2GSDA 3PTZA 4WLFA 3OA0A 2VYVD 2NVUA 4BKOA 2O4UX 2AQ8A 4PRKA 2BELA 4YACA 5HBRA 4OOEA 3M2TA 1HZJA 1U3VA 2GN4A 3CINA 1YL5A 3D0OA 4KQWA 2QQ5A 3TZQA 2HMSA 3PWSA 2QRLA 4XGNA 5ICSA 1ZNQO 4EITA 3VPFA 1B2LA 1MC4A 2O48X 1IHYA 4FFLA 5FFFA 2J3KA 5TT0A 4I5EA 4MIYA 1F14A 4ZRNA 4HY3A 4ZRMA 4GX0A 4IPTA 1K3TA 3Q0EA 4HXYA 4L4SA 1E6EA 4L74A 3SJ7A 1PWXA 1KY5A 5MGBA 2AG8A 4RV9A 1P0CA 4XYBA 2E48A 2CZCA 3JQ7B 1WDLA 2JHGA 1NVGA 2P5YA 3GDFA 1YB4A 2WSBA 4ZGWA 1XDWA 4OSPA 3NJ8A 5G4KB 5IZ4A 5EQDA 2B35A 2GF2A 1XU7A 5T6BA 3PYLA 4QQRA 5FWNA 2CF6A 3U4HA 1J49A 1EZ4A 1NYTA 1U3TA 1QMGA 2ZTLA 3OFSA 4O5OA 4UULA 2VZ0A 3KM0A 4CMGA 4PLWA 1FJHA 2EGGA 1IPEA 3G1TA 3ITKA 3BHMA 3OJ0A 5LC1A 2QYSA 1NFQA 3HNPA 4BO2A 4FCCA 4LSWA 4AJPA 4DREA 2D8AA 2CSUA 2DPGA 1KVSA 1E7WA 2Y99A 1TEHA 3GGPA 2BD0A 2PD3A 4AJLA 1HETA 4ALIA 4EI2A 1GQ2A 5KJ1A 3JQ8A 1XWFA 3BTSA 4J1TA 4DXHA 4PG7A 3JQAA 3S55A 3RKUA 2Y67A 4NI5A 3QRWA 4BO8A 4IDCA 2Q2WA 3Q9UA 2ZTVA 4TMFA 3PFWO 5KOIA 2RCYA 4OOFA 3VTZA 3KSZO 3VVBA 1NX6A 1GZ3A 1K6XA 4DYDA 3ETDA 3F1KA 5K0ZA 1L7DA 3TZCA 1ZJZA 2GNAA 1H6DA 5H82A 4URFA 5JS6A 4DPLA 5TJHA 3GA0A 4YJFB 3HFSA 3PJEA 1E92A 7MDHA 3DZKA 3TOZA 1LUAA 1U4OA 2X86A 3BTVA 3M1AA 3WQQA 1LRKA 3NT4A 1N9GA 3ZZNA 4IQ0A 5EINA 4NBTA 2VT2A 3LT2A 5HS6A 4M1QA 3MZ0A 2OP0A 2AXQA 1JU9A 1V3VA 2JFHA 1HE4A 2QG4A 4WNCA 5COBA 5JSFA 1N7HA 1UZNA 1ZJYA 5JO9A 3P5SA 3PIIA 3LSYA 4RVDA 3WMWA 1BXKA 2OUIA 4NFHA 3GR6A 4ZQBA 1E1NA 4I9HA 6LDHA 2YW9A 3E82A 3FNHA 4PZCA 3PGJA 3LYLA 4MIEA 2X58A 4RPKA 1Y81A 3CH6A 2DBRA 5B12A 3F4BA 4FFPA 4R69A 4J1NA 3GRKA 3DMTA 4NFYA 4FFRA 2PY6A 4D43A 1P1HA 3OA2A 3UXYA 3W8DA 1SB8A 2EEZA 4IBOA 3VPGA 3VZQA 1M6WA 1R66A 1DRUA 1NHWA 1W4ZA 3G3EA 3NGLA 5HM8A 1R0LA 4CV1A 3D5TA 1YO6A 2FR0A 2PH5A 3OBBA 1UDAA 4IDBA 3ANMA 1E3SA 4ALKA 1EQ2A 1NFFA 1LC3A 2VRCA 2ZB7A 3HZZA 1ID1A 4BL5A 1E6UA 3ST7A 1ZIDA 4UUPA 1NWCA 1DLJA 1GDHA 3RU9A 5AXCA 3LDHA 3FNFA 3U49A 1YWGO 3DOJA 2B5WA 1I2BA 1JKFA 2HDHA 1BXGB 2HSDA 3FBGA 3VDQA 4BIIA 1NAIA 3OF2A 1KC1A 2ZK7A 3RUFA 4EBFA 3OIDA 2UVDA 3IJRA 4B4UA 2GLXA 1WZIA 2YV1A 3R1IA 4JN6B 3QWBA 1XCBA 2X0RA 4J7CA 2WE8A 2B83A 4MVJI 3T7CA 3VPSA 5K6AC 3FD8A 4OL9A 3PHGA 1I3KA 1GUZA 1ZSVA 2JL1A 2ZJ0A 1GCUA 1JWAB 3RUIA 5J23A 4IJVA 1BHSA 3E9NA 5IDQA 3HSKA 4DGSA 1E3WB 2C20A 1AXGA 1GADO 2WD7B 4WGGA 4NIMA 3OECA 2E82A 5JAQA 3G0OA 5CEFA 1ZSNA 2H9IA 3ROPA 1IE3A 1WP4A 3OJEA 1HSZA 3QE3A 4FD3A 4FN4A 4XQ9A 2VN8A 4E3ZA 5EJ2A 3C1OA 5G0WA 2NV6A 5DZSA 4D0RA 1AHHA 5L7WA 4YAJA 3DOOA 2VHWA 1GTMA 3BMCA 3I3OA 5EMHA 4BNHA 3GFBA 4IGEA 4E5YA 1JKJA 5DT9A 2VTEA 1VSVA 1P31A 5A5EA 2H6EA 3ZW8A 4DMLA 3KYDA 3Q2KA 1QR6A 3FTPA 4BVAA 1PZEA 3FWNA 1ONOA 4KWHA 5BSHA 4YWJA 3UH1A 3C7DB 3LU1A 3HHPA 2HUNA 1OBFO 3RROA 8ADHA 1I33A 3HDYA 4LISA 1HYGA 3IKTA 3G1UA 1T2AA 1GPDG 2G5CA 1LQUA 1FDSA 1RPNA 2BKAA 3RC7A 2HMWA 4H16A 4YYZA 1PL7A 3GG9A 4PLFA 1HDZA 3L4BA 2FR8A 5FF9A 4LMRA 3WXBA 4U7WA 3TRIA 1PSDA 1E7RA 2A9FA 3RUHA 4D3SA 3C24A 4HFJA 1Q2XA 1TXGA 4U0KA 3QVXA 2YY7A 1DEHA 3FTNA 1T26A 1IOLA 1YKFA 2Y1OA 1GYPA 3GN1A 3H2ZA 4MVJH 4Y67A 4CV0A 3ICCA 3B20A 4Z0PA 5DCUA 3ZCXA 4NU6A 2CD9A 3V1TC 1H6AA 3GFGA 2FN7A 1U28A 4II2A 1LBEA 3RJ9A 2GCGA 4BGUA 2NQTA 3ZWOA 5KJ6A 3K2EA 5I8WA 3M2PA 4WCDA 5JDCA 2JCYA 3Q11A 3OHSX 1QV6A 3NYWA 2CVZA 4UEJA 4Z3DA 4PLGA 4RPHA 4GLOA 2GO1A 4CMEC 1K2WA 1VE9A 2P4HX 4J9VA 3T4EA 1UUFA 5F1PA 1I5RA 2P91A 2OHXA 3PRJA 1IHXA 4WLOA 3TL2A 4RDIA 1WAMA 4TRMA 3C8MA 3A1NA 3DMYA 3WFJA 1Y5MA 1DHRA 2Y05A 5BSEA 2I99A 1GV1A 4Q3BA 3ZWPA 3H65A 4YRDA 3UGKA 2GGSA 2IEDA 3F4LA 5L95A 3Q9NA 4K26A 3COSA 4I5FA 3NX4A 4AJ1A 3Q1LA 4R1SA 3I5MA 4QO7A 4BNVA 4GSLA 1GL3A 4D3FA 3F3SA 3N58A 1QYWA 1D1TA 2ZCVA 4BB5A 2O3UA 5JCJA 1J5PA 3JQDA 4NR0A 3CSDA 4MP6A 3K73O 1P1KA 4UVDA 1N1GA 3R3SA 2PGDA 1DFHA 1E7QA 1V35A 4NZ9A 2NU8A 1PGJA 2OL4A 4N5NA 1UR5A 3GVIA 3VH4A 1PGPA 5A9SB 1F06A 4JJGA 1P45A 1U9JA 1LDBA 3TN7A 4BB6A 3GAFA 1ISHA 2H1SA 1SPXA 3VH2A 4XR9A 5IG2A 4BNTA 1WZEA 2DVMA 3GGGA 1YDWA 3PIDA 1R4MA 1LNQA 2HK9A 4CM4B 1DHTA 1YGYA 3C3XA 3I4CA 1IULA 2AHRA 2IXBA 2YZ7A 2R6JA 2NVBA 3ZV4A 1T1RA 3OEYA 3JD2A 3DZFA 1T4BA 3FWZA 4RL6A 1NFRA 1QV7A 1RWBA 2OOSA 4FQ8A 3RUCA 4BNUA 2PR2A 3AW9A 3CKYA 1Y9EA 3KEQA 1SOVA 4EUFA 3H9UA 2Y1FA 1QXSA 1X14A 4RLSA 3ROMA 2O7QA 3IS3A 3GAZA 4ZA2A 3SLGA 3NDIA 1OFGA 4HADA 4GSKA 4LCJA 4E2YA 2P5UA 3IOYA 4NBUA 5B1YA 1BDMA 3JV7A 1T4DA 4XIYA 3GQVA 4YJHB 4ALJA 3DTTA 3ZWCA 1U7HA 2WDZA 2V7PA 2DPHA 4MJLA 4PLCA 4D41A 1Q7BA 5JY1A 3HG7A 1O95A 3LQFA 2BFAA 1DDOA 1NPDA 1XIVA 1YRLA 1UH5A 1P44A 4CM7A 2VUSA 2O4CA 4HUJA 1KEVA 1YB5A 1E77A 1Y8QA 4NJMA 4M8SA 1YL7A 1I30A 1BGVA 1I32A 3G79A 3ZHXA 2Y66A 3WS7A 3KLPX 4MVJG 4W7HA 3D4PA 3CZMA 4ITUA 4FOSA 5CDGA 2Q4EA 3B6ZA 4D0SA 3EHEA 4EJMA 5T64A 2HKIA 2HMTA 1CEQA 3ZV6A 1P33A 2OXIA 1RKXA 4BNXA 4HNGA 5L4LA 3TF5A 2DAPA 3JD1A 4O0LA 1ONPA 4B8WA 1HSOA 3WSWA 3PFFA 3BYZA 1JTVA 1HEUA 3AUUA 3ZV3A 2CMDA 3WNQA 4CMBA 1MP0A 4DLLA 1UP7A 4IDFA 3P7MA 3UVEA 1KVUA 4E4YA 1MA0A 5TQVA 3ZWBA 1PJSA 1ZXLA 2CVOA 5JDCC 5CG2A 1KIFA 4M49A 3HDHA 1HE3A 2J5QA 1E6WA 1YJ8A 1YQDA 5JC1A 3RKRA 4GLLA 2ZB4A 3IIEA 4P38A 2R00A 2DM6A 1HTBA 4IDAA 1ISJA 2A94A 3O8QA 4F6LA 4YT2A 5JDIC 3GF4A 5F1OA 3MOIA 1A5ZA 4WEQA 4PCVA 1E7SA 2I9PA 1E5LA 1GUFA 4D79A 2C7GA 2JAPA 2X7HA 2RHCA 1OOEA 4LSMA 3UW3A 3E03A 4BUCA 5A9RA 3H7AA 1B26A 2BI8A 1CQIA 2Q99A 4J3FA 1UXIA 1RM3A 2O2YA 4MIOA 3ADOA 1CQJA 4AJKA 2X0NA 4CMAA 1PJTA 3JD0A 4PLTA 5AXBA 4W82A 4GAEA 3D4OA 3AY6A 4N18A 4R5MA 3ZWYA 4YEDA 4PN3A 2NU6A 4YAKA 2RH4A 2LDBA 3BTUA 3QHAA 1ZMOA 4MP3A 1E3EA 3DAFA 4U6SA 2GZ1A 2IRWA 5I7SA 3L6EA 2X5KO 1Z7BA 4DQUA 3H6KA 3P19A 4XB2A 4I1IA 4IDDA 1KEPA 3ZU3A 3GT0A 5GZ6A 3PQEA 1M2WA 4AJEA 3KOUA 3ROQA 4TZTA 1QYVA 4J9UE 4KOAA 2PK3A 1V3UA 1AE1A 1H6CA 3BXXA 3QJ5A 3W6UA 1C1XB 3AUSA 5CEJA 2QZZA 1J0XO 1P77A 3MOGA 3HDJA 2NQ8A 3RBXA 3PLRA 1TB4A 2O23A 3JCZA 3CMCO 3NEPX 4U6QA 2BFMA 3F6YA 4Z9FA 4A26A 2X9VA 3LF2A 1RYDA 1ZK2A 1PS0A 3SC6A 1ML3A 4NU5A 1E3JA 2NVWA 4KUGA 4WKGA 5THKA 4P4LA 3ZU4A 2OFPA 3OQBA 5F21A 1S6YA 4LW8A 4P8RA 2B5VA 1XHLA 1ISFA 4INAA 2WWRA 4RDHA 2PV7A 4H3VA 5AXDA 3ENKA 1X7HA 5JPIA 5B4VA 3JQEA 3AI1A 1CRWG 3BMNB 5TNXA 1ENPA 4TRNA 4C4OA 1PQUA 2J3IA 1EMDA 3MWEB 3NUGA 1PGQA 3WMXA 3NAQA 2WJPA 1PR9A 1PJBA 3LK7A 1KBZA 3DFUA 5DOZA 3NJ4A 5ES3A 4DL9A 1S7CA 1KVRA 3DZIA 5KIAA 4B8ZA 5KWEA 1DC5A 1UXKA 3O8QB 2VWHA 3I23A 5BR7A 4YJGA 4XKJA 1LEHA 5T8KA 2QW8A 3RVDA 3PHIA 1QSGA 4XDYA 1F12A 1HZZA 4R68A 1PJCA 4MVJA 3DHEA 4JROA 1HL3A 3AJRA 1A7AA 2C7VA 3ICPA 4IMRA 4BO9A 1T24A 3LLSA 4L4RA 2H5LA 4Z0TA 3PEFA 1OAAA 1ZSYA 4JNKA 3ITDA 3JD3A 4AJIA 5TGDA 2NLOA 2HMVA 3U4DA 1GY8A 2EP5A 3C1TA 4M55A 5IXYA 1Z6ZA 3WBBA 3A14A 5T8KC 4L75A 1X1EA 4DBZA 3L4SO 1FDWA 3L4BC 1G1AA 2X23A 3PHHA 3CMMA 5GZ3A 3AOEC 3H9QA 3RFVA 2C59A 3H5NA 3GHYA 3BAZA 4CM1A 2FHSA 1KYQA 1Z45A 4K6CA 1ZMTA 4WCFA 1PX0A 3RU7A 1NASA 3TJRA 4ZN6A 1BWSA 1EDOA 2AG5A 5L51A 4FGWA 1N1EA 3VOSA 5EN4A 3DBHB 3A4VA 4IY1A 2Y0CA 2Q45A 3CXRA 1EVZA 3UCEA 1DAPA 3OICA 1DAOA 5L9AA 2PNFA 3PDUA 1JAXA 4MVJE 4TZKA 5IN4A 1G6KA 4OAQA 4WPGA 1IY8A 1V0JA 1PL6A 1A72A 3H3FA 4BO6A 3ROKA 1WMBA 1IZ0A 4UEOA 5ER9A 5B37A 2ZTUA 5ITWA 1T2DA 2W2KA 1B8VA 1ZXBA 4JLWA 2QHXA 4WCFB 2GRAA 4BGIA 1SC6A 3D64A 1O94A 3ANLA 3L0DA 2E4AA 4YJHA 3KTDA 2DLDA 1HE2A 3HDQA 4IZIA 2Y68A 1EQUA 1Y7TA 1GZ4A 2AQHA 4PZEA 3AU9A 1MX3A 3NDJA 5F3RA 1UP6A 2I76A 2Y1EA 1LSOA 1HXHA 4TSKA 1K89A 3MEQA 4WLUA 2DTXA 3VH3A 4LK3A 4TROA 2ZCUA 3LLVA 2PD6A 5GY7A 5JAIA 4MVJF 3RD5A 3DONA 1CWUA 4OHUA 1U2GA 3RC1A 1VL6A 3KRTA 3ZNOA 2HAEA 1P1FA 4JX8A 1AHIA 2JJYA 4YB8A 3DZGA 5IDWA 1T2FA 4TQGA 4RPJA 3ZHYA 5EERA 2DBVO 2NNLD 3FPCA 2VNSA 1SO8A 2O2SA 3F1LA 4Z9YA 3INGA 2Q1SA 4GGPA 4WK6A 3EDMA 1A71A 3PYXA 1ONNA 4U5QA 3UHAA 2R00C 3WGOA 2ZIZA 5H81A 3AFMA 3IMFA 4YQYA 3RUDA 4D7AA 2FPGA 2VNAA 1HKUA 5G2OA 1LQTA 2ZYAA 4R1TA 1L1FA 1HWYA 2VHYA 3EC7A 5DN9A 1XKQA 2HMUA 1V8BA 4R41A 3AM3A 3AM5A 4YBZA 3JQ6A 2XOXA 4JP3A 2HJSA 2UUPA 1B3RA 2A35A 3HN2A 3NTQA 1PS9A 4L9RA 3DB2A 2EW2A 4ZQGA 4R4JA 2WYUA 3WYEA 2G0TA 2P2SA 1G0NA 1LRLA 1WDMA 3GDOA 1IUKA 1NVTA 1YOVA 2DBQA 3QWIA 3WLFA 2WMDA 4RQUA 2EV9A 1MUUA 4S1VA 3JYLA 4BNJA 4OQZA 4NJMB 4W6ZA 5DBGA 3UCFA 5L3ZA 4DRYA 1XU9A 1DJQA 1HDXA 3Q2IA 4II3A 5CAEA 2PZKA 2FZWA 1I24A 4AJJA 1D4FA 3ABIA 4GWKA 4IDGA 5ENDA 4PLHA 1F8FA 3TWOA 4P22A 4A0SA 1DC3A 5KNLA 4NBWA 3FCOA 3LT1A 2I65A 4QUKA 5TLSA 4IQGA 3C1AA 1JKIA 3B1KA 4YVFA 4WJZA 1JW9B 4M54A 3WSVA 3GPIA 1OI7A 2BGKA 3A06A 2GDZA 3ZV5A 4DIOA 2VRBA 2EERA 3GOHA 2J5KA 4HWKA 4XRRA 3TSCA 2WD8A 1LXCA 4CUJA 2OGUA 1NP3A 3FN4A 1U3UA 1Z7EA 3AUTA 4M89A 2W2LA 1I3LA 3GUCA 1ENYA 4DIFA 2FP4A 1A9ZA 5JYDA 4WECA 3A9WA 2C07A 3V2UA 1CERA 2JCXA 5L53A 4IJKA 2EW8A 3ORFA 1XYGA 2VWQA 1WPQA 4NJOA 3HQ4O 3PJGA 3TNLA 2PD4A 4KDEA 5T5QA 1NWHA 2CNBA 2VQ3A 2ZKLA 4P4NA 3SVTA 1MLDA 3ASUA 4YRBA 3MJTA 4I9NA 5A9SA 3DBLB 4UREA 5JLAA 3BMOA 3ZNPA 4F45A 4CM6A 1FDTA 2GPTA 3TL3A 2YQ4A 1EE9A 2BRUA 2VOJA 4EUHA 2BFPA 4GX5A 3DDNA 3KSDO 5C3MA 1K5HA 1XA0A 3BA1A 1A27A 3KHUA 1X13A 3RBZA 4BOYA 4XCVA 3ZN2A 1AGNA 2P4QA 4BHTA 2ZB3A 4R54A 3WWZA 4CUKA 2UUOA 3Q3CA 3IC5A 2DTEA 2QIOA 4KP7A 2YV3A 2Q1WA 4QTZA 5TRTA 1QORA 4J49A 4D44A 3GEGA 5L4SA 1EUDA 2D1YA 1A4IA 4DLBA 2LDXA 2EG9A 2O50A 3H9EO 3AK4A 2OBNA 3GVXA 3EMKA 1UAYA 3JYQA 1EFLA 2JHFA 4MKRA 4XIJA 4J91A 4ZQEA 3WYCA 4R3WA 1U3WA 2PFGA 4K28A 4WLEA 5I7EA 3F47A 4DQVA 3OJOA 5HRUA 3ZI0A 4ND5A 3VHRA 1P1IA 1R0SA 5A03A 1SMKA 4HV4A 5DBFA 1PJ3A 4Y6RA 2ET6A 1DFIA 2PTGA 3BMQB 3IL2A 4YDRA 1WWKA 3T7EA 4BO5A 2DFVA 4PLVA 3BHJA 1KEWA 3RI3A 4BNMA 1JWBB 3WLEA 3EYWA 3PXXA 3INRA 1GYRA 2YJZA 4HFNA 1QYDA 1X1TA 2JFFA 2C2XA 2Y1CA 4B4WA 1IYZA 5BNTA 1T1SA 3DXFA 4A2CA 4XRGA 5JW6A 2J3HA 5A04A 1EBFA 1YBAA 1ZK0A 4UAGA 4CL8A 4AG3A 2Q50A 5JCXA 3WGGA 3NT5A 4N5MA 5BT9A 5ADHA 3HB5X 4JJIA 2B37A 3F9IA 3ZGYA 4LVCA 1Y8RB 2JAHA 4Y8VA 1LC0A 4LGVA 3FI9A 2PZLA 3MJCA 4PG4A 4IS2A 4R9RA 4DBVO 3DZJA 2AW5A 3OQ6A 1ADFA 4JK3A 4U8GA 5JCJD 3H5AA 4IM7A 2J8ZA 1R4NA 4KUHA 1QYCA 1C0IA 4YRAA 2BH9A 2QZ9A 1DIAA 1JQBA 3X2FA 2D0IA 3P2OA 2C5AA 2WM3A 5L7YA 4RZHA 4XEHA 3BMOB 4B7XA 1P1RA 2DTDA 2YUTA 1JVSA 4KUEA 3RCBA 1HF3A 4GKBA 2DFDA 5CDTA 1DRWA 4CLRB 2F00A 3KUXA 3QV1A 3KYCB 2CFCA 4BNKA 4Y6PA 3O26A 4PLPA 3NKLA 4FS3A 4NBRA 4I08A 3EAGA 2DQ4A 1ZFNA 3PLNA 4NHEA 1EVIA 3WIEA 2CF5A 3LT0A 1ADBA 4RF2A 1CF2O 1PGOA 3MJSA 2Q3EA 1QKIA 2IZZA 1LDNA 4BGVA 1HRDA 2ILTA 3ZWNA 1OC4A 1WVGA 6ADHA 1T2CA 3SXPA 4XGIA 4WLNA 5TF4A 3JQFC 3E6AA 4GL4A 4HBGA 2NTVA 3HWRA 4TWRA 2WYVA 1WDKA 4TRRA 5I9MA 1ENOA 1H94A 2D5CA 4XJTA 4EZBA 4W4TA 1E7YA 1DSSG 3JQAB 3PZRA 5I7FA 2EWMA 4ROSA 5A3JA 3E8XA 3UCXA 2VRCD 1HLDA 3EY4A 3PPIA 3S8MA 4QEDA 1LDEA 1GQYA 4XB1A 3DEYX 1FMCA 4K1LA 4OH1A 4OYRA 2CY0A 3GY0A 4CQMA 4CQLA 3G17A 4EUEA 3KZVA 4WLVA 1OMOA 5DCYA 4CR8A 4DWVA 3MJVA 4ZQFA 4PZDA 4XYMA 5HA5A 4EYEA 2AMFA 1VL8A 1Q7GA 3U4CA 2G1UA 3U3XA 5COQA 2Q4BA 5U4QA 2B4TO 3IQDB 2W2LD 4WNIA 1XEAA 1YOVB 4IMPA 4YCAA 3EZYA 2PGLA 4RCVA 4FC6A 4ESOA 2RIRA 3KVOA 5ILGA 1GEEA 4NH4A 4RF5A 2QRKA 1FK8A 3IDSA 4IUYA 2A92A 3LVFO 1UZLA 2RH8A 1A7KA 2NWQA 2BFOA 2Q2QA 2Y1GA 4NQZA 4Y9DA 3OETA 1U4SA 1UXJA 1LU9A 3WQSB 4XQGA 2AQKA 3TZKA 4L8VA 3F5SA 3B1FA 5COAA 2CDCA 3CE6A 3KO8A 3JQ9C 4IXTA 4H15A 5FI3A 3WR5A 1O9BA 3CUKA 1YS4A 2VTDA 1BG6A 2B4QA 3RUAA 1JN0A 5AOVA 5KVSA 3ONDA 4BKPA 2PH3A 4E0BA 4TKMA 2Y0EA 5G4LA 3KYCA 2VHVA 2EGHA 1SZJG 4KZPA 4DIBA 1CJCA 4J90A 5JMWA 5L40A 5TIIA 5I8ZA 3BTOA 1M6HA 1O5IA 4BMSA 1W8DA 1WXDA 2VZ9A 2JD0A 3W6ZA 3GNSA 2PKRA 4R3NA 1T2EA 2IODA 2EXXA 4YAGA 3FSRA 3S2FA 1V3TA 4OIMA 1VLLA 5H83A 1XELA 1UXHA 4GVLA 4N7RA 2V6GA 1XR3A 3C7AA 1BXGA 4FW8A 1MG5A 3DBRA 2W90A 1PQPA 4PVCA 1FXSA 4E30A 4UVIA 3ETEA 1GUYA 3GZNA 1LI4A 5A06A 1GQQA 3QWFA 3VAZA 2JKVA 3KXDA 4AFNA 2DC1A 2C0CA 2WYWA 3RAJA 2YHIA 5C7OO 3JQCA 4IZHA 2RHRA 4GWGA 5C37A 3KSUA 1LTHR 1NQAO 4Y6SA 2YHUA 2I5PO 4M87A 4J7UA 2C29D 4W9NC 4BO7A 2IZ1A 3NTRA 5I9LA 4UVGA 4FJ0A 4CJXA 1CIVA 3CEAA 3GZNB 3DZHA 3L07A 4DTIA 3D3WA 2GN8A 3DQPA 1LDYA 5JNLA 2B69A 4JIGA 4PFJA 4BQPA 3O4RA 4J4HA 1M66A 1KOLA 1NR1A 3AY7A 3PGXA 5JY6A 1M75A 4B7UA 4CM8B 2D5AA 3BMCB 3E5MA 5IDYA 1TA4A 1GEGA 1WW8A 2J3JA 4J4TA 2ZTMA 3WICA 4FC7A 1YB1A 3WTBA 4BO4A 2X5JO 1W6UA 2PWZA 3ZWAA 3NGXA 1Q1NA 3OJLA 4ND1A 3S2EA 2FR1A 1HDOA 1IZ9A 4DA9A 3DHNA 4RVFA 3JQAD 3ANNA 4RVSA 1PJQA 2HQ1A 3OJFA 3V8BA 1SNYA 4R16A 4RZIA 4YAEA 4R1NA 2EP7A 3WOHA 1R12A 4FOOA 2AE1A 1HT0A 3UKOA 1W0CA 3D7LA 3VKUA 4E5KA 1C0PA 1ZBQA 4HX5A 3FPLA 2O7SA 1NPTO 2E49A 1HE5A 1R37A 4IQ8A 3RSHA 1ZZEA 5A1TA 1YE3A 2DUUA 5BSFA 2CUKA 2DT5A 3E18A 4JBHA 4RVHA 4FR5A 1DIGA 3N7UA 5C7LO 1EBUA 5LDHA 4OM8A 3DBLA 4S3MA 3LT4A 4XQEA 2BHLA 3C7CB 1RM4A 1VSUA 3IUPA 4A7PA 1LSJA 3W8FA 4D45A 1ISIA 1U5CA 5CG1A 4MINA 3STHA 3OM9A 2O3TA 3E1KA 3VH1A 4CODB 1EUZA 3JYPA 3D1LA 1KETA 4YJDA 2D2IA 3H5RA 3QA9A 2AEJA 2J6IA 4HP8A 5JYEA 2GASA 2D59A 3F46A 3BMNA 1KY4A 4WASA 1AUPA 4RQTA 3V1UA 3DOCA 3QIVA 2W8ZA 4B7CA 4W7IA 3GVCA 4QECA 4FDAA 2EJVA 5KKAA 2XF8A 1GFSA 1B7GO 1K6JA 4Q3CA 3AI3A 3H8VA 4GH5A 2OO5A 1A9YA 3JQBC 3V2GA 1RYEA 2VCYA 4ND4A 3C85A 1Q0QA 4GMGA 4JGBA 3BMQA 3LC2O 1ENZA 2GR9A 4CUZA 1R6DA 2Z95A 3UN1A 4J2HA 2X8LA 3TDKA 3DWFA 3GDGA 2B4RO 3OP4A 4CLHA 1MC5A 3ZWMA 5CDSA 1ZW1A 1BRMA 4ALNA 4NK4A 1VJ0A 1OC2A 4XD2A 1BDBA 3HE3A 5LCXA 1JAYA 2OMEA 3OIGA 4QFDA 4AJNA 1YJQA 1HDCA 1TVEA 1K6IA 1I2ZA 1LLQA 1UJMA 4JBIA 3H4VA 5KVQA 3VZPA 1KVTA 2I6TA 1I3MA 3L77A 4PLYA 5DOVA 1VI2A 2ZJ1A 4DLAA 1SEVA 3W4KA 4LCEA 2WE7A 3TFOA 4ILKA 1P74A 5ITVA 2E37A 2XPCA 1GPJA 2FSSA 2W4QA 3R0IA 1CYDA 1VKOA 1NQOA 4Q39A 4GX2A 4OXYA 2NM0A 3K6JA 3RWBA 1ORRA 1R16A 1CDOA 4MPDA 2V65A 2Q46A 2Y1DA 2DBZA 1NTOA 3FR7A 3GVHA 2Q1TA 1D7OA 5KJFA 4GBJA 1DIRA 3MTJA 5T67A 3SX2A 4YT8A 4IIVA 3I9MA 1LLCA 5DCWA 1VJ1A 3S2GA 5K9ZA 4X54A 1DC6A 5G0VA 4RLHA 3VVCA 1Z75A 1LLUA 3K8ZA 2AQIA 2PA3A 4LN1A 4G81A 1EE2A 1NVMB 4TVOA 1KS9A 3CIFA 4O6VA 1DOHA 1E3WA 1DBVO 2GUGA 4MVJM 4QT0A 1DLIA 3W1VA 5IXSA 2O3QA 1V9LA 1RM0A 1EEHA 1PL8A 3I83A 3U0BA 1MV8A 1P1JA 2FZEA 4BS9A 3L6OO 2X0IA 3JQGB 3QVSA 3ON5A 2POQX 3UAGA 3SC4A 5K6AA 3GLQA 4MDHA 3WBFA 4UVHA 2GD1O 4RF3A 4CLOB 4EGFA 3DAPA 3D3EA 3ENNA 4LMPA 1SOWA 3RIHA 4JQCA 2GYYA 4BV9A 2YYYA 4UUMA 2FMUA 3QVWA 4KQXA 2H63A 2B36A 2BGLA 4B79A 3IKVA 1I36A 3ZW9A 1QP8A 4FFNA 4FPXA 2QYTA 1MXHA 1SAYA 3U09A 1ZK3A 1B0AA 1RJWA 4QO8A 2VHXA 3RC2A 4XA8A 3D4NA 1GCOA 4ZD6A 1GZ6A 4E2WA 4CQMB 3H2SA 1UXGA 2VYNA 4MP8A 4E32A 3LC1O 5C7IO 3U9LA 3ZNNA 4GMFA 3FF4A 3PZBA 3X2EA 4J7XA 1SCUA 4CQMD 3DMTC 3I9LA 3IJPA 1E3LA 1HDYA 1HYEA 2D3TA 4NBVA 4BNYA 1E3IA 1DB3A 1VKNA 1ZCJA 3GMSA 3ZWXA 1X0XA 2UDPA 1M76A 3W4IA 4ZU3A 4CLXA 4Z9XA 3RJ5A 3AM4A 1I8TA 4KMSA 2EIHA 3ZWWA 1PS8A 1YBMA 2AEMA 3ETGA 3WJ7A 5JAZA 4OMUA 1PR3A 4OKIA 2JD1A 5TT1A 3WDSA 3R6DA 3NTOA 3PP8A 3K30A 4WEOA 5FEUA 3H3JA 4B3JA 2QRJA 4OQYA 1VPDA
chains in the Genus database with same CATH superfamily
3ONEA 4XWWA 4YA6A 2ZRKA 4Q3DA 4DPMA 2PV0A 1OZHA 3KEOA 2H54A 3NPMA 1NLMA 2AZ4A 1G3QA 2RC5A 3QWHA 3IAEA 1MTOA 2QX4A 2MR6A 4O4IF 3C3YA 3K31A 3WZ2A 1XT6A 4G67A 4CPDA 5LQNA 4H7FA 3FFBA 1YR7A 3OPYA 1JPUA 4POAA 4G1CA 2J5RA 3RV4A 1XQ6A 3LCRA 5B30A 1BX1A 1DXYA 4KVAA 1UANA 2I6SA 2OZLB 3OTWA 4EL5A 2QVCA 4KR0A 1ZR4A 3U0VA 4CL3A 1QAQA 3G9QA 4TQ9A 1XHEA 4K5QA 3DKRA 3M1YA 2CJFA 3O3OB 4EZIA 1O2DA 3ETJA 3K92A 2IUUA 1QF6A 4TTAA 3EAFA 3EVNA 1MC8A 1DC8A 1Z5UA 2PLAA 2FCRA 4O25A 3VV2A 3QE9Y 1WQ3A 1B41A 1MEEA 2DG2A 3CNEA 2QVGA 4WMLA 3K9FC 2ZYWX 1E64A 3MLBA 4DJAA 2AI2A 4QHYA 1OZ0A 2ZYDA 2CSXA 2C7BA 1L7EA 1X1BA 4EZEA 2RJOA 1VTKA 3GCWA 3N2YA 4XCXA 3ZBQA 1Q3TA 4TL6A 3ND7A 3Q8XB 5FI5A 3AUKA 4UPEA 1ULZA 1W4AA 2HQRA 3S0JA 4CCYA 2O57A 5IAAA 1HLPA 2E18A 1YI0A 2Q6TA 2QY9A 3JAWA 2FSUA 2OORC 1KZ4A 5FYDA 1M2OA 3H4IA 4MYCA 3TSWA 1IY1A 2VT6A 3HJHA 4NBLA 5EHZA 1GAEO 5FUXA 4U0JA 4BZPA 1VDMA 3MCWA 1TM7E 2JF0A 3O2JA 5E6UA 2TMYA 1JYFA 1XRRA 4UPVA 1KTIA 3RIGA 5JO0A 1X8JA 3DDWA 3C2QA 4Q6BA 3R3JA 1Z4LA 2F1KA 2QSZA 3S28A 3TR0A 1FSGA 1DX9A 4DDVA 1N4DA 1VJGA 1JFLA 5K3FB 5J47A 3UFXA 2FMTA 5B1SA 1VQ1A 1OW3B 3NTUA 4ZT5A 1ZVMA 2P1ZA 4MUNA 3AKZA 3DVLA 2HU2A 2WYHA 5IFKA 1FVHA 2W37A 1FQKA 4RXTA 3RARA 3TW8B 4TKUA 4DWJA 5U9CA 2OQRA 2YMLA 4WN9A 3GMDA 4B48A 2PUDA 1WTCA 2JFGA 5CM8B 1U8ZA 1KPHA 4IILA 3WGMA 4E33A 1A8UA 2VWGA 2BISA 4FINA 1UQUA 3HCDA 4FONA 3OU7A 2IYUA 3TH5A 4M8NE 1TT5B 2QRMA 1SXGA 2QLTA 1Z8DA 5KOHB 3K0SA 2KW5A 2GLTA 3H9GA 3UGTA 2QUIA 2X2FA 4KQ6A 4R3UC 4ZOCA 1KYYA 4YP7A 5JI3E 3BD6A 3OSZA 1RYMA 3GHHA 4ENRA 5DP1A 2VTBA 1II8B 3PRYA 4JI1B 4DEXA 4E7PA 2NPOA 2XXJA 1P75A 1L4KA 5A5FA 2A1TR 1QTIA 4A8JA 3VPHA 1NG1A 3LVBA 1TMOA 3GBPA 4F97A 5KAPA 2M32A 4UQOA 3NBKA 5KYXA 4QD3A 3SBOA 1F8UA 2BZ1A 3WG9A 2YZNA 5H02A 1SVWA 3I3SR 2R9VA 3QWAA 4U9HS 5LZ2A 3SMQA 3SJZA 4S35A 3VTAA 1P2FA 1JLKA 1YI8A 2TECE 2Q3DA 1VRWA 4KXVA 3SPXA 2CL0X 1SBYA 2FSHA 1U2DC 2Y76A 4XM0A 4JI2B 4RVGA 3V5NA 1F0YA 1U6IA 1WQ4A 1FLVA 4ARSA 3EEFA 1CUEA 1RKVA 4MR7A 3P45A 1DO0A 4OXKA 3WYDA 1FJGB 1JR3D 3D8RA 2VAPA 1F8GA 4EF5A 3BX1A 1DS6A 3AFHA 4C22A 1OJLA 4NAHA 3ASVA 4KB5A 4GKVA 3WL8A 3T5MA 2IF2A 4K6HA 1O6FA 2QP9X 5LL6P 1NBIA 3KKKA 4LJ7A 2E4XA 3AJAA 3ZQKA 4CU5A 1P4JA 1KAQA 1W9MA 1OXSC 1A82A 1XZQA 2J87A 4J29A 4WXEA 2BHSA 3PNOA 1VA5A 2IPXA 1H6BA 1XJQA 2OZEA 4PSVA 4GGMX 2FZLA 3FGOA 5C5IA 1TZ2A 1G8AA 1YQTA 4WZBA 1GYQA 1F3OA 1S8OA 1M34B 4NDNE 1XWIA 2ZDQA 2C0QA 4FT4A 1B0PA 1E0SA 4HN9A 3KZCA 1E69A 4ZQHA 2HK7A 1Q7CA 3FHTA 3EW7A 3P2EA 1RI3A 2QVXX 4C7KA 5B7PA 2BKVA 1YZ3A 2P4UA 2P67A 3LG2A 1M1YB 1JILA 1ZMRA 4KEAA 4L6CA 1O4WA 3QE4A 3LDFA 3Q5EA 3QSGA 4I14A 3GVPA 1L5HA 3SKYA 5JANA 2FWNA 2C82A 1OBCA 2FVYA 5AKLA 5GP1A 2VZLA 4EFDA 3VKWA 4E22A 2OV3A 3WGYA 2ACVA 3M3PA 3H9CA 5DTRA 3U4GA 1JLLB 3MJEA 2PZJA 1G21E 2I80A 2HA5A 4U2CA 1RLOA 5DLQC 1K86A 2J9XB 5AYVA 2GZ3A 5BN5A 4K7JA 1TUIA 2HSEA 2C3OA 2P3OA 3PL5A 2YFHA 4M8LA 5GWXA 1ZJWA 3IDAA 4X00A 2CXNA 2IL1A 3KEGA 2V8OA 5I48A 4TTSA 1OSNA 1UF9A 2ACEA 3JRNA 1Q17A 3LFHA 3W2EA 1ZUNB 4RMNA 1O9GA 1QM5A 1GCIA 4QKQA 5AVYA 1OB5A 2VUIB 2NZUG 3ENWA 3ZU5A 3ZQ6A 4DCMA 5IWAB 1M3SA 2ATIA 1C2YA 1HDRA 2ZVQX 3AJDA 4AUEA 4DW8A 3C3AA 1Y7LA 1MB9A 3O38A 4FVTA 2XVYA 2IYXA 4DLYA 3PDIA 2YV5A 1JDPA 3H1TA 5EXSA 2Q3LA 1PZFA 1FFXB 4CN9A 3UPUA 4WV3A 4JBGA 3TZ6A 4KYUA 5B4TA 2H4ZA 1IAVA 2NYAA 1II8A 3NHKA 2VHCA 1XZCA 1DV1A 2H65A 4NCHA 2OFFA 3PNVA 4WNYA 2O8BA 3BICA 4RTNA 2JVJA 3N7TA 5K99A 1H0HA 1N36B 2VG8A 2B8TA 4JWKA 4HHEA 3RHTA 3STTA 3RK4A 2VQFB 2I29A 2IYTA 4XQCA 1FDUA 3GC6A 4YV2A 1K7YA 3KV3O 2CXRA 3B9RA 2HRBA 4FHCA 4N40A 2HLPA 5HS4A 4U3JB 4ZJUA 3GDWA 1BFUA 1XJ0A 5LA6A 2R97A 3VC1A 1CY7A 1BEEA 2UV8A 3ZWVA 4BMYA 1P6QA 4MW0A 3TZHA 5KNCH 4R9SA 3TTUA 3R9KA 2CMGA 2ERYA 2J45A 3TUIC 4Q4LA 1O6ZA 3C98A 4G1UC 4MWBA 2FRDA 3EBPA 2ZAIA 3QLVA 4JYBA 1A2QA 4I3GA 2CJPA 4E13A 1JUDA 2XCRB 2XYHA 2ODTX 2HJRA 3IQZA 4FB5A 1UFQA 3RQIA 1G3MA 4OA5A 1G8KA 5ILOA 1N57A 3D8TA 2FW6A 4D4HA 4A10A 3HC7A 3IP5A 3UXEA 1DADA 1WLYA 2Q9BA 4YP6A 1RWMA 1O0CA 1KBQA 2Q5JA 3EZLA 2QW1A 3IUNA 1V71A 2D0DA 3FBTA 3L05A 2O2CA 3KJZA 5ELLA 1O8CA 2OP1A 1FOEB 4OGLA 3QV2A 2ZRNA 4DRXB 1HMYA 1KJWA 2ZWPA 4AMZA 2UYOA 1TIBA 1VMIA 4GYJA 2X5OA 2P9EA 2QL7A 1FNNA 4L5YA 4ZQCB 5AVOA 1L8XA 4ZEOA 4A9AA 3K94A 4CLOA 2NTJA 5ALWA 5FL7D 5H16A 2J3QA 4HCJA 4P4SA 3U6KA 1UP4A 2D5LA 2QPTA 1WW3A 1JHYA 1Z82A 1ZUIA 3N2LA 4MQEA 3KYBA 1IXZA 3JATB 5EYPA 1Y42X 3BD8A 5TQ2A 5TS3A 3PVZA 3CZ5A 4QBIA 3C6XA 4V0MA 3ZTTA 4DR7B 2IY9A 1PYDA 3KAPA 3RBVA 4NZPA 3L2OB 3IMGA 1G20B 4N49A 3L9WA 4DNXA 4EAQA 5ICMA 2P2GA 3KZNA 2Z09A 2WI8A 3QXJA 1YVDA 4RO0A 1DO2A 3JALB 4YCSA 2AWNA 1LW6E 3RYCB 4QDOA 5DW0A 3DAGA 1VLHA 2BFBA 1DJMA 1ZLYA 5KTKA 3WLLA 1L4LA 4I0WB 1DIBA 1UBUS 2PX4A 5IBPA 1JHRA 4JI6B 3WGHA 3WIDA 2NZVG 2PUJA 3RH0A 1I01A 1SQ5A 2J5BA 1T25A 2HHCA 2WLTA 2Z8YA 3MINA 4RC9A 4B4OA 5K0FA 1EG2A 1L8QA 4JXKA 3AR5A 3H11A 1H2HA 1OPXA 4FFOA 4R01A 5A05A 1L5GB 3UY4A 3FNIA 3CRZA 1GGNA 1TAQA 1UPBA 5H3CA 5I7WA 5DGHA 3ZHSA 1WNTA 2PGIA 4AZVA 5A3VA 2HHHB 1S4QA 3WJ1A 3HUUA 1U8CB 2C3YA 2QM0A 3VO2A 4R51A 2NADA 5E0KB 1IQRA 1V39A 3GJ6A 1KFKB 1Y4SA 3OQ1A 4M9UA 2HHLA 4ZARA 5EGSA 1UPCA 2AZDA 3D3JA 3GGCA 2IYOA 3HYCA 4FHDA 3TNFA 3ZZTA 4UNRA 3L0CA 4XAQA 5JYCA 1KYZA 5EMMA 1POXA 3G82C 4CBVA 4D3ZA 5BSGA 2LPMA 3F74A 1ZM7A 3DNPA 3U4IA 2R8PA 4M2LA 4NOLA 1ZIOA 4Q4CA 4M1EA 4MV0A 4B6QA 4MHSA 4EABA 1U3CA 2AXPA 1DZIA 3S2IA 3T5PA 1OXVA 2PDAA 4WL0A 4BNLA 1RAGA 2ANBA 4JUBA 3SP1A 2JIPA 2WHYA 3GV0A 3SYTA 1H0KA 5TXGA 1RZVA 3NIGB 3IIIA 3C6KA 4OREX 2HIHA 3P32A 3H75A 2X9NA 4EHKA 1XDUA 2O3RA 4GVXA 3U44B 3JVIA 4DMUB 3BREA 1RWXA 2B1JA 2IHKA 3ESQA 3AOGA 1MW9X 4QYXA 4ARZA 3FNGA 2CLHB 2P5TB 5F52A 2VNHA 2C03A 4MMYB 5CFLA 4CLEA 2NUPB 1BOFA 1YB2A 5C7YA 4HQFA 3S2SA 3LYUA 4I50F 4KR9A 5A71A 3A2KA 3FAZA 1N92A 1IBCA 2R1UA 4GPD1 2QYOA 1VM6A 4RH0A 3L82B 5J43A 5ADUS 2CB0A 4EPWA 4BVEA 2JA2A 4DR4B 5IBRA 4JLJA 2EFJA 4F3YA 1J2YA 1YMQA 2GKGA 5AK6A 1C0KA 4P33A 2AIRA 1U7TA 5IKEA 5JZOA 4UTVA 1DJNA 4QFCA 1UAGA 5D3ZA 4AJHA 2NU9A 3FHLA 4B76A 2YOHA 3A1DA 5CCXA 2J7KA 5CHEA 1BXZA 2AJTA 2WVHA 5F4BA 2DBYA 1VI6A 2IFTA 3HCNA 5DGDA 3BIJA 3W5CA 4DPKA 2MDTA 3LX8A 4GRAA 4ZVNA 1WXGA 1UK8A 4GC9A 1Q1ZA 1TOAA 1C5KA 1OZAA 2AMYA 2V6MA 1X15A 3GK3A 3I1IA 3PQCA 3QX9A 2GVDC 4IV8A 4MQUA 1ZD3A 3C6MA 2LTAA 3RVRA 3R8FA 4AU1A 2CKMA 2F3SA 4MIKA 1WL8A 4NG4A 4JXJA 2G1AA 2XZOA 4XGKA 2JLCA 1MW8X 4POOA 2Q6VA 1RXCA 1QQBA 3M49A 3RF6A 4LNAA 1S7GA 2QPLA 4RY2A 3CSUA 4MUIA 4BKQA 2IUYA 1BW9A 1NNUA 4ND7A 4K3UA 3AJEA 5A4DA 2XMRA 4YO8A 4YRRA 4C0BA 4D96A 3RLIA 4RS3A 2B25A 1Y5NA 3KSAC 5E4JA 1T9BA 1D6JA 2JNWA 1X0VA 1FDVA 1QO0A 1UBCA 4TKVA 2JARA 2OPHA 3GAAA 3H2HA 2FOIA 3RHZA 3WGTA 2X4GA 4UVEA 5MGNA 4X1KB 4AF7A 2F8SA 1C7QA 3ZHUA 3AXTA 3ZDRA 4NMHA 1R4NB 1SBIA 2WICA 3OT1B 5FPKA 1W49A 4UDYX 1OFIA 1AZWA 1KAMA 1KEEB 1TT5A 1NHGA 5KBYA 2OWEA 3BFJA 3E9QA 5JAMA 3GFRA 5BN4A 3ZHBA 4MZDA 3AF4A 3LLCA 3U80A 4BJ1A 1M8KA 3VTFA 1EU1A 3HKDB 1UQTA 3VDNB 1EESA 2Y1LA 1PEDA 2QN9A 3KXKA 1IJEA 5BW5A 1CT9A 2BDTA 2VUUA 1WULS 4NCXA 4D99A 4EKYA 3TSYA 4PAOA 1VGRA 3WKDA 2EP8A 2ZJZA 4B85A 3AGQA 4TMYA 1PUXA 4L15A 2Q3JA 3WBJA 2VPPA 4K6FA 1QKKA 4YXWA 4KDFA 1AXEA 3UUFA 1HQKA 2V03A 4HYEA 2OBBA 1JU4A 5EKUA 3NORA 4ZTBA 3VKVA 3W4JA 5I7OA 4DEVA 1NZFA 5KEIA 3L7JA 5GJCA 1M34E 2OHIA 2F64A 2PYDA 4GG1A 3W9UA 2MJLA 4K9SA 2IVFA 3O1HB 1QC5A 2PMDA 4HMQA 3OTOB 2KJQA 1FLDA 2R2GA 1D5WA 1NN5A 4N5DA 5EMNA 4FW9A 5DTQA 3GMTA 4XYEA 3ZX5A 1R6XA 3V4LA 1QRRA 1ZEJA 5ALKA 3TZBA 3VHLB 3L79A 2PKQP 5TS2A 2HF7A 3A9TA 4IJ6A 1TGYA 2AZMA 4RD3A 4E21A 2HW8A 4EPRA 2BR5A 4DLZA 4AAYA 2PUCA 4H6XA 2IHNA 2QM3A 4H2DA 4HVAA 4K9NA 4FD2A 2X22A 5THQA 4YRQA 2CXQA 1C0LA 1L5OA 3LWDA 1ORHA 2RGNC 3OE5A 4MKZA 1GPBA 2FWMX 3P9ZA 2BMFA 3ZIUA 2F3RA 4EY4A 3UJNA 2ZIWB 3LP6A 2YWGA 4J16A 4Y2GA 2F55A 3SHOA 4N5LA 1NIPA 1O4VA 5FPTA 1XRSB 3P97A 1C1XA 4ZZ1A 3GN2A 1GFWA 2VBIA 5FFNA 4GQBA 1EA5A 1RKUA 1KC3A 5KNCD 4QBTA 1FFGA 2FKNA 4MI3A 4AXXA 1MGOA 4DGSA 2HFJA 1PTKA 4Q66C 3N0TA 5JNTA 3PFHA 4GGOA 2OC9A 2FPOA 4NF2A 5C32A 1HO3A 1E1LA 1IBRA 3OBIA 5FOWA 2QTWB 4L8LA 4F71A 3OLVA 4PZUA 2ZSJA 4UU7A 2P4EA 5IW8A 1LJ8A 1YR6A 2IV3A 1U7WA 4EO7A 3RC8A 2F1RA 3K6KA 3MUNA 1T2VA 2O8FB 4A8HA 1WOYA 1X7XB 3EAQA 3IPAA 4RPGA 5JE8A 5BUCA 4OB6A 5EP2A 5GGXA 4KE8A 3GH3A 4IYRA 2B5OA 1KI6A 2ZP1A 1Y3FE 2OE2A 2Q5HA 3IA7A 2VPZA 4CM5A 4DHEA 3R0ZA 6REQB 3FIJA 4JBWA 4F60A 3L7DA 1WPRA 2ICAA 3ETHA 2XB8A 3ZGNA 1I3OA 4HX2A 3FSGA 1KYWA 1UFVA 3CX8A 3ANSA 2ZJ4A 4LHZA 1WUKS 2FZVA 3TPCA 4AJ2A 4C7JA 1XJWA 1N2JA 3STVA 2PX8A 5AJWA 4LYDA 5BQOA 5E1OA 2BZGA 2C00A 3K53A 3JVDA 5DHRA 4BKRA 3IESA 3VZSA 1H5QA 5B1DA 4CMHA 4ERNA 3JWIA 2W2KB 1LGYA 2W2OA 3KB6A 1X8KA 4YT4A 1WSDA 2H07A 1D04A 1YRAA 3WMEA 4PG5A 4RGBA 5BRAA 2VDPB 2EFCB 1MEOA 2ZIEA 2LZ0A 3BUSA 3K6RA 5KNCA 3RSLA 3FPKA 5MFPA 4J1SA 1OT5A 1J0EA 1DQYA 3KUKA 1TYEB 2WT8A 3CO0S 3DG9A 1JG3A 1PU2A 3OHPA 4N0EA 2PCLA 1E98A 4ZKEA 5HQ3A 1G9TA 1QHFA 2OCXA 4M9XA 1G8YA 4PGGA 2GJ8A 4CM3A 3E9YA 3MJHA 3ISJA 4MVJD 4I9UA 3AEQA 1ELOA 2C2YA 3ADPA 3N0VA 5JYBA 3HUDA 1W5TA 1PLKA 2JIBA 3TE6A 2KLBA 4FEEA 4OGGA 1BO6A 3BL8A 3ISVA 3JYNA 3GFSA 4G5YA 5F5XA 2JJ1A 3VNSA 3RJMA 1D6SA 4BV8A 4Q3NA 4WZAE 2ZU6A 4NBNA 4I4TA 1HY3A 3THXA 4HQLA 1Z4IA 5KJCA 4N1AA 3G89A 5EKSA 3HVUA 1T29A 5T4FA 2ZI3A 1XZJA 1A8HA 3DEHA 4LHWA 2H8KA 13PKA 2CLIB 4OSOA 5DI3B 4DMMA 3S1AB 3B7WA 2VYVA 3CLRD 4WD3A 3JY6A 4N3GA 4O63O 4MROA 1Z2DA 1PEKE 2M6LA 4L5BA 2IDMA 3LQRA 2J3LA 1KSFX 2WWIA 3ZY6A 1QVRA 4PNPA 4EEZA 4GZLA 3UICA 3RVLA 2WIAA 4I19A 3NVKI 3D1VA 3X3HA 4HTFA 1RC1A 2GSDA 1KU6A 3UT5B 3OA0A 1G2PA 4GOLD 4IL5A 2XUJA 1SM4A 3QI7A 1DX6A 3DLAA 5HBRA 1KY2A 2NSYA 2QLLA 2GN4A 3QG5A 1SBCA 3GJYA 5ICGA 3D0OA 1QH8B 2A86A 1GJRA 4IVQA 4OF4A 1T8YA 1C3JA 2A5JA 3FIUA 2HMSA 3PWSA 3VVMA 1EFVB 2CT8A 3GJZA 4QDXA 4J2TA 1TJPB 4WY2A 1C8KA 2N0SA 2AFVA 1P61B 3C6YA 2WSIA 1PL0A 5EYPB 1GPMA 1B2LA 4WA7A 1MC4A 2XQKA 3L7OA 2Q28A 1IHYA 1SVOA 5AJUA 5ALSA 3VSDA 4F3TA 5IMSA 3L1HA 3RJZA 3JZFA 2QJWA 2J3KA 4RD2A 4I5EA 1G2OA 3V7FA 1YR3A 4GX0A 4Y6QA 1K3TA 1P2UA 4L4SA 4L74A 1NJFA 4JT2A 4ZI7B 4BZWA 2XD4A 3SJ7A 3OTQA 2B94A 2WM8A 2AG8A 4OGFA 2DFTA 3LPCA 3IQIX 2WC1A 3JQ7B 2JHGA 3FHOA 1YB4A 4XJXA 2QRZA 3LHKA 2B9VA 1V8FA 2PSHA 1FSZA 4P5DA 2QBYB 4FYIA 1I4OA 1NVUQ 3MINB 4WNAA 1IHUA 1MV5A 3HYTA 4HQKA 1L3IA 1FP7A 3OCCA 4M98A 4QQRA 4C4ZA 5FWNA 2HT1A 5E9WA 1U3TA 5G3YA 5B3JA 5BYKA 2JGKA 1YZNA 2ZUUA 2LXNA 3PGA1 2ZTLA 3OFSA 4O5OA 3GLFE 5K8LA 2XSZD 3S4YA 2I1QA 1AM4D 2ZRMA 3QPAA 1YCFA 4RVNA 2EGGA 1KMNA 3G1TA 4K9OA 5AP9A 4G5QA 3KQLA 1HYQA 1H2XA 2HPHA 3M4NA 2QYSA 1NFQA 3HNPA 3N8IA 4JJKA 3U26A 4AJPA 3FMGA 4S24A 3LXXA 2D8AA 2CSUA 3MGKA 2NUTA 4DREA 2Y99A 4MW4A 5CX4A 3GGPA 2PD3A 4ALIA 4TQAA 4YAOA 5I5GA 3FFAA 4Q9DA 1DELA 1QOZA 2WIDA 5KSOA 3IKMB 4XH9B 4MTCA 3JU3A 3RKUA 1Z2NX 1Z5VA 3MK31 4IDCA 1IK6A 2R0QC 2ZOSA 3Q9UA 3A05A 2NXWA 3A10A 1EQAA 2IE8A 3NC1C 2AF3C 3QITA 5TQJA 4C20A 2ZPTX 2XZPA 3KZXA 3QLTA 4XPZA 2Q4TA 3U44A 1GZ3A 2ASEA 3HVKA 2W6ZA 1HQYE 3AVVA 1C7EA 1VFNA 4DDTA 1H1LA 3T3MB 5K0ZA 3TZCA 1RBQA 2GNAA 5CJ2A 5H82A 1C7ZA 2OAEA 3WKAA 3HXLA 1ABEA 2J48A 4QJIA 1BRTA 5TJHA 3HY4A 3CYFA 3PJEA 4U7TB 3DZKA 2ZS7A 4MWEA 3TB6A 1LUAA 2OCGA 3I34X 4M0LA 4F9TA 3T94A 3HSYA 1JS1X 4RU1A 1E62A 1RLUA 1UXOA 3VNUA 2GEBA 1VMEA 2WINI 3FJ1A 4NBTA 1ESDA 4QJ5A 1V8PA 5KYGA 5HS6A 1RRCA 4OXQA 1XTIA 3C5HA 4DA8A 1GL9B 2AXQA 2QTHA 1HE4A 2WG1A 1UZNA 3K9HA 5CCEA 2XECA 4F21A 2R8XA 3RYHA 3LSYA 2J41A 4RVDA 2IPLA 1XFAA 2YVAA 4BX2A 1PK9A 5BQ3A 6LDHA 1B76A 3E82A 3A6GA 1GUBA 4DV3B 1LNSA 1PG5A 3KKZA 4I3HA 3E0XA 1Y81A 2CLDX 4M1OA 4RPKA 2CFOA 2BKEA 2DBRA 4F93B 3TQSA 2O8CB 4FFPA 3TRKA 4TM8A 3W5IA 4HDRB 2K7FA 4WH0A 1G7TA 4B6OA 3LXUX 1VPTA 4FFRA 3AR6A 4JV5B 2VBFA 1T0JB 3D3NA 4BE7B 3OA2A 2ADFA 1IVYA 1CB7A 3R0XA 4BWGA 4UE6A 3WWDA 5J4KA 1SB8A 5HIKA 3VPGA 1M6WA 4OYLA 5CVEA 1DRUA 3NGLA 4UHHA 4GKJB 1R0LA 3WAJA 4QIHA 4R1LA 3EULA 4H31A 4F2WA 1GA4A 1TZJA 3B52X 4IEIA 4X7BA 3KD2A 3H2KA 3H2YA 4JQZA 4RKEA 3KB8A 4YK7A 4ALKA 4LTNA 1IHPA 2I3BA 4QXRA 4RVCA 3WSTA 1NFFA 3TKYA 3ZCSA 2W2MA 2VRCA 721PA 1Q19A 2AR9A 4KU4A 4BL5A 1R00A 4IVPA 3LZCA 2PUTA 3ERCA 2JAQA 1Z6GA 3W3AA 1BEUB 1DLJA 3UIEA 3M34A 1JJIA 4CFSA 1FB5A 3P9YA 5INTA 5CMLA 3BK7A 4A92A 1L6IA 4AXBA 4GR9A 2UZ1B 4MB0A 2HDHA 1X74A 2PH7A 4G4IA 4JB2A 5GVRA 1N7IA 1EYZA 1MAWA 4L8GA 1T5TA 4W1RA 3W04A 4C0WA 4EBFA 2ZVPX 4QRIA 4B4UA 3P9XA 2PKYX 2YV1A 3DLIA 4TXHA 1SIUA 2GOYA 4KFUA 1VLJA 2HUPA 4C78A 2R60A 2B83A 3EEYA 3IILA 2EKBA 3IPLA 5CW2A 2L2QA 4RK7A 2IV7A 4FMCF 1PF7E 1XP8A 2ZJ0A 1ULBA 3EXFB 3IB3A 3HR4A 4L07A 3RTAA 3CLKA 4XSGA 2HX1A 3KKQA 1BCSB 1BHSA 5EMKA 5IF9A 1KRHA 3EQ8A 2NO5A 3A4MA 5C1OA 1JGTA 4G4GA 2WD7B 3OQIB 1U2ZA 4JYPA 4MWTA 4NIMA 2XY4A 3F2IA 3BGSA 3QPDA 5JAQA 3G0OA 2WG2A 3AVOA 2X3UA 3MHTA 3VKHA 2WP8J 1C1HA 3ROPA 4R8MA 3OJEA 3N8DA 1HSZA 4PZ0A 4E1VA 3X1KA 3BSSA 4FDVA 4FD3A 1R9MA 4FHZA 5HFAA 5EKTA 4ZHQA 4YQEA 1BS1A 3HXOA 2VN8A 1CHDA 2BTOA 2ZGVA 5EJ2A 2ZANA 3C1OA 4P31A 5G0WA 1YFJA 1SU8A 1U9CA 3EPJA 4D0RA 4WBNF 5AUNB 5F23A 3DGEC 1AHHA 3EEOA 3GLTA 4OLFA 4IIHA 1J8MF 4ZEXA 4W1QA 2PWYA 4MUBA 1EJ0A 3BMCA 4D9CA 3QVGB 5BMVB 3C8HA 1I4LD 4LPSA 3KX2A 3K4PA 2BUAA 3GFTA 1JKJA 3EB9A 3TEFA 5AM4A 2X1LA 4B80A 5C8DA 1E79A 2FW8A 2GHTA 3IURA 1FX0B 3LRXA 3MB5A 4Y0VA 2CWWA 1Q2UA 2XMZA 1VI5A 1ZU4A 1FFXA 3FTPA 1H1TA 3PUIA 4J8PA 4L72A 4Q16A 3SDZA 3H1AA 2WTEA 4QUEA 2PKWA 1G8SA 8ADHA 2CL7X 2WIFA 3HDYA 3C6ZA 1HYGA 2OGTA 4RIEA 4YP9A 3G1UA 1T2AA 3SOZA 3HU3A 4EPVA 3Q87B 1FMFA 1FDSA 1UMCA 2W58A 5AVSA 2BKAA 3RC7A 3CPJB 1M2KA 2J6CA 1GFZA 3L4BA 4JQOA 5FF9A 3NBMA 1F1JA 2VYQA 4LMRA 3WXBA 4U3JA 5CFPA 3ZVKA 1PSDA 3K0BA 4F3NA 2B8NA 1N2HA 3S2ZA 3KL2A 4EAAA 3SYRA 1T26A 3DV0A 3H2ZA 2AG1A 3H4TA 4JVOA 4ZO9A 3DGFC 4RETA 1Y1LA 4Z0PA 4R2LA 2CD9A 1E6MA 3JPWA 2BDEA 1TUGA 1HM5A 1ETHA 1S02A 1U28A 2AUTA 2FN7A 2P9JA 3OKFA 1K97A 1OI3A 4LQDA 5LVAA 4F1WA 4ZGGA 3F73A 1IUOA 2XB6A 3ZWOA 2ABWA 3KE8A 3Q8LA 3BULA 3PDCA 4O2AB 4D0GA 5I8WA 4LF8B 3BB1A 3ODGA 3C5EA 4YQFA 3OHSX 5AVKA 1MO3A 2YJNA 4UEJA 4RZ2A 4Z3DA 4M9QA 4PC6A 4AECA 5HQTA 2O2HA 4AO7A 4CMEC 1EVLA 2VRWA 3AC0A 4EB8A 1CR6A 3B6MA 3T4EA 4J9VA 4V0QA 2M6KA 4RANA 1I5RA 1QH9A 1SC9A 3H83A 5ALMA 3PRJA 5EIXA 2FUG6 1Z17A 5ALIA 5CR9A 4JLPA 2D4HA 3W2GA 2G4VA 1ZH0A 3M9LA 2XKKA 5E7JA 3WWOA 4RJKA 2Y1KA 1JIIA 5HIAA 1TZBA 1VXRA 1Y5MA 1DHRA 2FRVA 1U28C 3I92A 1KF0A 4LMAA 4R2KA 3K9WA 4Q3BA 1ONBA 5J2TF 2AJ8A 2Q3BA 3SZLA 3HACA 5A62A 1I13A 3U5ZB 4XM1A 3I8OA 4B8YA 2XKJE 4ZEMA 4G9GA 1L4BA 3IXLA 5L95A 1J9EA 2EDAA 3RU2A 3COSA 4P5EA 4I5FA 1SCAA 2XNDA 3NX4A 1UFRA 2L19A 3TD6A 4A0FA 2HJGA 5JVDB 1A7UA 2HPVA 4LDZA 4O1IA 4ZTUB 1YTLA 1RXWA 5CLHA 1GL3A 2BW0A 3F3SA 2A3NA 3HDTA 1QYWA 3QX7A 3GRCA 4HH1A 2ZCVA 4FMDB 2IYLD 4NVRA 2WU3A 5JQWA 5LP1A 1WXHA 4W8HA 1PVOA 4TTTS 1EP9A 3JQDA 3CSDA 2OLKA 1T5OA 2P2CA 2Q3FA 4KBYA 1P1KA 4YASA 5DGTA 3VBEA 4AYTA 4DIMA 4AQYB 1PNRA 3R3SA 2XMBA 4LSZA 1V35A 4MV5A 4A6PA 1HFEL 3TXAA 4N5NA 4O4HA 2DCUA 3VH4A 3N2NA 3OLWA 4LF9B 1F06A 3AF2A 5CU7A 3JWJA 1QH1A 1RAEA 3A70A 4DG5A 2O8DB 4BB6A 1OWNA 2O54A 2WHPA 1T8SA 3C3CA 3FPAA 3VH2A 5F9HA 2CMKA 3ZTWA 1Z2OX 2DVMA 4M0FA 2YIJA 3D6UA 1LWOA 4H7HA 2O7VA 1LNQA 1KYXA 3NTXA 3B3GA 2C0PA 1DHTA 1YGYA 3C3XA 1BXRA 3PGLA 3RS2A 3FM9A 3FFXA 3CW9A 3GCZA 3I73A 5E0OA 3UJAA 3IAAA 3BWVA 4X3PA 4U00A 3PTAA 1B6RA 3TQIA 2R86A 1Y8AA 3ER9A 1WCWA 1GZDA 2JS7A 4HYTA 1T4BA 3FWZA 4XWTA 1JZQA 1Q0ZA 1NFRA 1RWBA 5BQ5A 3RUCA 1AVTA 4P0QB 1UK7A 3DFMA 2W93A 1G17A 4TTRA 3L8DA 1EUCB 5HF5A 1SOVA 4KH0A 5JSHA 3FPHA 1NXWA 1QXSA 4UJ5A 1X14A 1I6MA 2IYFA 1E2LA 4EQ6B 1J0BA 4QWWA 1Q0PA 2YJ3A 3IS3A 3U7GA 1BKDR 4XX0B 5TMPA 1V16A 2GK4A 1CQJB 2H51A 3LUFA 5D1HA 1Y34E 5HE8A 4B81A 1XYVA 3FF1A 1YV9A 3P0EA 3T3EA 1HA3A 4OMDA 3M6WA 3OM8A 3JV7A 3AHCA 3KJIA 3T9FA 1FBNA 5M29A 2VC2B 1LF5A 1OX4B 4QUIA 4ARIA 1AT1A 4GLFA 2GM5A 2ID7A 3SEQA 4BAZA 4PPGA 3HG7A 4QJ3A 1O95A 3LQFA 4ABTA 1NW9B 3QA3E 3FUXA 1TVKB 2VXYA 4JGIA 10MHA 1C4OA 3REQA 1XIVA 3THSA 1UH5A 3RIEA 5A4FS 2P1DA 3KFLA 2Q3MA 3F7NA 1HORA 3DUWA 4EO9A 2JKZA 4M8SA 1YL7A 2I6GA 3OLCX 4G41A 1ZHOA 1BGVA 3FOWA 5HCUA 5EXPA 3VR2A 3ZHXA 2Y66A 1ZUHA 3KLPX 3WS7A 3D4PA 5HSGA 4ITUA 4FOSA 4IH9A 4LRYA 4UHJA 2DUMA 121PA 1NV9A 3R9WA 1CZHA 1GRVA 3AHHA 1XX6A 5KB3A 1ACJA 1CEQA 4FEYA 3AB7A 1P33A 1T6XA 2YJGA 1N6OA 2OPBA 1CR2A 3CF0A 3NTLA 3JD1A 2XJ4A 4P0TA 1R10A 4CWAA 5C1BA 4K8OA 2V3CC 2V9CA 4ZMSA 4PXSA 4B6SA 2O5EA 3BYZA 4R0VA 1ZI9A 1PT8A 3AUUA 1U0TA 4RA9B 1QIMA 5EUCA 1EWQA 4JI8B 4I1OA 1F4VA 4LQCA 3ZY5A 3O3CA 4KGVA 1LCIA 5L3SA 1UP7A 3ASZA 4KN9S 3O1LA 3UVEA 5A7FA 1OTXA 4HGNA 4EGJA 1MA0A 1ZN9A 2FF7A 1XK6A 421PA 4Q19A 3ZWBA 1ZXLA 4UFPA 1WIWA 2CVOA 5JDCC 2V9ZA 3MXTA 4M49A 3HDHA 2OHHA 5EKXA 3V4OA 4Q3KA 3VU9A 2D8MA 1HE3A 2ARKA 2IF0A 3GJ4A 3CLSD 2J5QA 3WYNA 2JLXA 2RGUA 2GZSA 1QVWA 2Q6KA 1LBQA 4JYMA 4Q4HA 4ZT3A 5JJCA 2CHUA 5BR4A 4AK9A 1PFQA 5LP6F 4F06A 3MIIA 1USUA 5E7IA 2VDUE 1OFUX 1M5UA 2BUCA 1E2JA 1HTBA 2GCOA 1ISJA 3HVJA 2MIIA 3PPYA 3CV3A 4F6LA 1Z34A 4MR9B 1RXEA 4LZJA 1RWPA 2FX5A 3GF4A 4YT2A 5JDIC 4HZIA 4N7BA 1U90A 5T3YA 3ZE0B 5BWLA 5CFRA 1IZYA 2ZSDA 2QAGA 3D81A 4XIIA 1E7SA 4X66B 2AOVA 1LFDB 2C9OA 4D79A 2C7GA 1WBDA 4WN3A 1OOEA 3RYIB 2AZTA 3UW3A 2BT4A 3FZGA 3E03A 2B1RA 1C0EA 2DSNA 1GDDA 1CQIA 2B4YA 2R3SA 3ZCPA 1OASA 4YIHA 4G2TA 1NUSA 1XF1A 5DTMA 3Q7RA 4G24A 1SCDA 4AJKA 4DAEA 1P0IA 5AM1A 4CMAA 5ANRB 4PLTA 3OWOA 3G8YA 1WUIS 4QPZA 2FGJA 4E08A 3HKCA 4Q48A 4YR7A 3O91A 4N18A 4KIJA 4D8TA 2RH4A 1V7QA 1NC1A 2IHZA 3BTUA 4N9QA 1E3EA 2ZJ7A 4PO8A 5H59A 4N0MA 1Q74A 1C3OB 1SURA 2GZ1A 3I0MA 4ND6A 3DHVA 4ZPXA 3TIGA 5A1JA 3P19A 4XB2A 2FX3A 3IX7A 4XUCA 4I1IA 4PQFA 5P8WA 4N39A 4BFYA 2D0OB 3PPWA 1T4CB 2XOKA 4PONA 3KOUA 1T3GA 3MCTA 3ROQA 1SKMA 4KOAA 2G63A 2PK3A 2CDRA 3DEFA 4MWGA 3DWEX 1TJYA 4L50A 1C9EA 2HTEA 2SKEA 2BBOA 5BSMA 3MMSA 4JB8A 1C1XB 1R9JA 1GAQA 4II7A 3A3PA 1D2GA 1F5SA 1R3UA 2AMVA 4JQYA 5BMVF 5CEJA 4BEVA 1RXVA 1Y4ZA 2NQ8A 2MU1A 1TB4A 3AL3A 4IDHA 4OUDB 4KVFA 1NJ8A 3CKLA 3VHXA 3GLRA 4BMCA 5BPHA 4C0AC 3EOBI 5JD4A 4WBNB 3F6YA 3L41A 5L6MB 3LF2A 5BORA 1F2DA 1ZK2A 3SC6A 2XTAA 1ML3A 1UWLA 4DLRA 2IITA 4WKGA 4P4LA 4B2PA 5AVTA 4L9AA 4P84A 4P8RA 5FWAA 3SR3A 3WL7A 3GJRA 4DJTA 1KK2A 5C81A 2AI1A 1KDYA 4D0NA 4INAA 3E35A 3OT5A 3AYXB 3EH1A 3EOAI 3H16A 3CUYA 5T4BA 3TLBA 1KI6B 4Q9LA 2WNHA 1HNNA 4LKRA 4DCUA 5BWBA 2AUNA 2D1RA 2VDMB 2ZI4A 3BH0A 4OJQA 4RZSA 4TRNA 4C4SA 4WTOA 5JS7A 1KJNA 4M0PA 4P3PA 1WU8A 1AA6A 4AN1A 3EIFA 3NHFA 3N2KA 2J0SA 1NMQA 4YI3A 3HEAA 2VPYA 5DOZA 5DYIA 4EP1A 3NJ4A 4DL9A 3BXGA 5BSTA 1UC5B 3A9VA 3O82A 4MUFA 4ESEA 3W9YA 1Q0SA 5K8UA 3KD3A 4JVSB 3U81A 2YHSA 2HADA 3IT1A 4S12A 3EQ7A 2W11A 4RKRA 4YJGA 3SJCA 2G5TA 4A2PA 5AVUA 3NONA 4CEIA 1FX0A 2D6FA 4Y1RB 4XDYA 1SG0A 3MILA 1DBIA 3UGQA 5K0SA 2XVMA 3S68A 4EPYA 1A7AA 5CT8A 3L5OA 3SVLA 1T24A 4ZANA 1I5EA 2FV8A 1GSHA 3LLSA 4KQHA 3V46A 4B47A 2H5LA 4DKJA 1YJ5A 1IEWA 2AFIB 2OV8A 3V4FA 4OHWA 1CIPA 1OAAA 3GCGA 5DRYA 1PZMA 3ITDA 4NX2A 2EX4A 3D6JA 3NVDA 5DN6A 3HO1A 5HUJA 2HU5A 2GPNA 4MRVA 4D25A 1AKQA 4OHXA 3HKCB 1GY8A 2WPDD 3R9IA 4FEAA 4IG4A 2QL5A 1G8PA 2F1OA 3A58B 5JSKA 4CU2A 4MSUA 4MWCA 3ZIAD 1TEXA 3IA2A 4LY6A 1NOKA 1PNQA 1G66A 1FDWA 3HUTA 3CZ4A 3L4BC 5IARA 3IQXA 2OQVA 3T12A 3AHIA 2GZRA 1VLQA 3O9VA 2O0LA 4CM1A 2FHSA 1KYQA 1Z45A 3HN6A 4K6CA 5IUKC 1XQYA 4NV1A 1L5ZA 5CK4A 4TYWA 4JUDX 2EYQA 2W43A 1PUJA 4DARA 3BXHA 4DOMA 2QMZA 4QYIA 1LVUA 1UWKA 5EN4A 2ZETA 5H0IA 3DBHB 3K3PA 1LFAA 1EP2B 3ZDXB 5LB2A 2Y0CA 2Q45A 2ZR8A 3CXRA 4Q7MB 3RTGA 5LQJA 3I61A 1FP4A 4CF3A 3PDUA 1JAXA