3GDFA

Crystal structure of the nadp-dependent mannitol dehydrogenase from cladosporium herbarum.
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
267
structure length
267
Chain Sequence
MPGQQATKHESLLDQLSLKGKVVVVTGASGPKGMGIEAARGCAEMGAAVAITYASRAQGAEENVKELEKTYGIKAKAYKCQVDSYESCEKLVKDVVADFGQIDAFIANAGATADSGILDGSVEAWNHVVQVDLNGTFHCAKAVGHHFKERGTGSLVITASMSGHIANFPQEQTSYNVAKAGCIHMARSLANEWRDFARVNSISPGYIDTGLSDFVPKETQQLWHSMIPMGRDGLAKELKGAYVYFASDASTYTTGADLLIDGGYTTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable NADP-dependent mannitol dehydrogenase
publication title Crystal structure of the NADP-dependent mannitol dehydrogenase from Cladosporium herbarum: Implications for oligomerisation and catalysis.
pubmed doi rcsb
source organism Cladosporium herbarum
molecule tags Oxidoreductase
total genus 92
structure length 267
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.138: Mannitol 2-dehydrogenase (NADP(+)).
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gdfA00
1VL0A 1NQTA 2YYYA 3QA9A 3GNQA 3BMQA 3QW2A 3U4HA 3Q9NA 1D1SA 5TRTA 3RC9A 3JYLA 1NXQA 1K2WA 3JD0A 2A35A 4UEJA 2NLOA 2YY7A 3GNSA 3DONA 4I5EA 3C24A 4PLYA 1AN9A 4ZICA 5I7FA 4JCOA 4R1TA 1UDAA 4IS2A 4JBHA 2O3SA 1WAMA 2G5CA 2WD7B 1LI4A 3HB4X 4YAJA 2EHDA 3L9WA 5EQFA 1I32A 4E2ZA 1E6UA 4UUOA 1A4UA 3IP1A 3JD2A 3WTCA 4AJ4A 4NK5A 3OQ1A 4ALMA 1I01A 1LDYA 3WOHA 5JDIC 5HTOA 3HZZA 5JCJA 1DO8A 4LSWA 3VTFA 4XCVA 2BFAA 4CMCA 3WB9A 3VH1A 3H2SA 3KV3O 3IS3A 1E7RA 3RC2A 1I2ZA 3RJ9A 3H4VA 3QVXA 3DFUA 1GFSA 4OO3A 5KJCA 5LC1A 3F47A 3UFXA 1P33A 3EMKA 4NBVA 3WJAA 4WLUA 4AJKA 2WM3A 2R00C 1I2CA 2P9CA 4NFYA 4OOEA 2PR2A 1AE1A 1P1JA 3VZSA 3INRA 2QZZA 2UVDA 1ISMA 3WMWA 4PN3A 3SX2A 3G1UA 3K2EA 3EVTA 3IOYA 4IMRA 1MFPA 5MDHA 1ZVMA 2I6TA 3INTA 4HFNA 4BMVA 4AJPA 3O8QB 3Q2IA 4FFRA 3DZBA 2Y0EA 3AM4A 2AE2A 2I65A 1P0CA 3AW9A 3OH8A 1TXGA 1ZUD1 1ZK2A 3FPLA 1R6DA 1XGKA 4YTEA 2NU6A 1V3TA 3JQFA 4BV9A 2W2KB 3ITKA 5T8KC 3LT4A 2HK9A 5I8WA 4UVDA 4BKRA 4XYLA 4D3FA 3EHEA 4ZHSA 1HLDA 2FN7A 2PZLA 3I9LA 3JQBA 3TFQA 1YO6A 4U7WA 5IDYA 1YKFA 4GMFA 3L4SO 2O3RA 5KVVA 5JBIA 1ZW1A 2X8LA 4PLFA 4CM4B 4NIMA 4W9NC 1SPXA 4ZGWA 4UAGA 1IE3A 4XJTA 2Q1SA 3Q11A 1HYGA 2NVUA 5AXAA 3IMFA 1OC2A 3D4NA 3GT0A 4PZDA 4KOAA 2WD8A 1KEVA 1BHSA 3H7AA 1JU9A 3HWRA 1W0CA 2ZATA 3F5SA 4MIYA 1DJQA 1UXIA 2WTBA 4BO6A 1CRWG 4J2OA 3GF4A 3KYCA 2PFGA 3PJGA 4WJZA 5ITWA 4QECA 5BR7A 1IZ9A 1DFGA 2C2YA 3D3WA 3H2ZA 1KETA 3K92A 4YAKA 1F0YA 1KEPA 2ZCVA 1DEHA 1Y9EA 3VVBA 2D8AA 4FPXA 3KBOA 1PGPA 4FQ8A 3WFIA 1GU7A 3ST7A 3QWAA 4YT5A 5I7EA 4TKMA 4MIEA 2O3JA 3M1LA 1SOVA 1M6WA 2VZ8A 1U28A 1MC4A 2PGDA 2BGKA 2SCUA 2QYSA 1YXMA 4J1TA 4K6FA 3AM5A 1KVQA 4ID9A 4B7CA 2GDZA 1Y8QA 1E3LA 1ZK0A 4IS3A 1HRDA 3TWOA 1AUPA 1G6KA 4RORA 4E5KA 3U4IA 1UJMA 1PEDA 1E77A 1CJCA 2OO5A 5AOVA 2DBZA 4JLWA 4TKLA 2ZJ1A 1L7EA 2RH8A 1YGYA 2XOXA 5IN4A 1U5CA 3C7DB 1LU9A 2X9NA 1IULA 1E6EA 5EQDA 5L45A 2D0IA 1HE5A 4ND1A 4AJLA 2FSSA 2Y1OA 3DBVO 3QLJA 4RO0A 4OH1A 4RVUA 3OF2A 4DMMA 3RI3A 3HDHA 4B3IA 5KKAA 3GVXA 3V8BA 4FFMA 1L1FA 3PP8A 1ONNA 2VNAA 1O5IA 3K6JA 4HBGA 2HKIA 5JO0A 3DWFA 3BHMA 3PJFA 4M49A 3RC7A 3VZQA 3ZWXA 4D3DA 4EUEA 5AQ1A 4OYRA 5B4VA 5ITVA 4MVJF 3GEDA 1SB9A 3I9MA 1A9YA 3GY0A 3KRTA 2ZB4A 3ZW8A 5BSGA 1DFHA 1BW9B 4KUHA 4UUPA 3V1YA 3LYLA 1NWHA 1ZFNA 4TVBA 2BF7A 4RZIA 3CTMA 1BGVA 3RKRA 4YB8A 3DHNA 1JA9A 3MJSA 5C37A 3OQ6A 3VH4A 4L0QA 3JYOA 4URFA 3TL3A 1P1IA 3K9QO 2P9EA 3UUWA 3WQRA 1E7MA 1IHYA 3PRJA 2FSVA 1C1DA 4Z0TA 1H94A 1C0LA 1DJNA 4ITUA 3NKLA 1KERA 2EKPA 5A05A 5L53A 2G0TA 1ONPA 2PV7A 1R16A 3O9ZA 4WPGA 2EP5A 2IYPA 1NPYA 1BG6A 1P0FA 1GZ3A 2CDAA 4GVXA 4YJHA 5JCXA 1WZEA 5DCWA 3R3JA 1DIGA 4HNGA 3UN1A 5IJZA 3H9UA 4YJDA 2IZ1A 2X4GA 2X0NA 3Q6IA 4RPLA 5BNIA 2DM6A 4DRYA 2QRKA 4W4TA 5JC8A 3FI9A 5IZ4A 4WUVA 4LRSB 3U3XA 1DIRA 2AMFA 3GVIA 5C7IO 3FBGA 1EMDA 5G4KB 1GV0A 3I1JA 4K26A 2VYVA 1FDSA 2GCGA 1CQJA 4MKZA 4TROA 1LRKA 3E9NA 2EJVA 1FDVA 1QSGA 4Y6PA 1F12A 2EWMA 2JD2A 2C0CA 1HDCA 4IJKA 4QX6A 5TS3A 1LSSA 1PL7A 4UUMA 2V6MA 1LLDA 3PVZA 4CMKA 4YQZA 3FD8A 2YW9A 4LGVA 3X2FA 3GK3A 4JBIA 1U1IA 4NBRA 4WNCA 3BHJA 3L4BC 3GR6A 1SZJG 1GCUA 1R4NB 3RU9A 4EJMA 4FB5A 4E0BA 1MUUA 2GR9A 1BSVA 1JAXA 4KTTE 2PZJA 2VYNA 3JD3A 4FS3A 1MV8A 3OICA 3GMDA 3JYQA 4UREA 4GAEA 4FR5A 1RKXA 4XQ9A 4O59O 4EEXA 3LLSA 1GQ2A 1NR1A 1X13A 2IZZA 1ZK3A 3FNEA 3GPDG 5A3VA 1ZJZA 5EJ2A 4B7XA 4F46A 5IG2A 5CG1A 5IZCC 1C14A 4DGSA 3WNVA 4XR9A 3WGYA 1ADFA 2EW8A 3GFBA 4L9RA 1IHXA 4PVCA 1CIVA 1NYTA 4XZ3A 3EUWA 1KVUA 1X7HA 1LSUA 4XD2A 1HE2A 2E4AA 3WLFA 1LDEA 3W8DA 2WYVA 3E6AA 4CMHA 4ESOA 1BXZA 1F14A 2H5LA 4XR4A 1NVTA 1JKFA 4CR7A 1EFKA 3D4PA 4RVDA 1D7OA 3L07A 4ZQBA 1OAAA 4WLVA 1AXGA 4MVJE 3OBBA 2VNSA 1PZFA 2Q99A 3ZN2A 3EZYA 3N58A 2Y67A 1VSUA 4FFLA 4I8XA 1PGJA 2VRBA 1UZNA 4HUJA 3DO5A 4OXNA 2AQHA 3OEWA 4WCFB 1GPJA 4R5HA 4NFHA 5CEJA 3IKVA 4NBTA 4OXKA 4E32A 2GZ3A 2DU8A 1SC6A 2HMVA 1DOHA 4AJHA 4CV2A 5L7WA 1OOEA 2QX7A 1YL5A 1LXCA 2FZEA 4DQUA 2WMDA 4FFPA 3ZGYA 3BTUA 4NBUA 3UCXA 1KS9A 1GADO 5KOIA 3WGIA 2HMUA 4BO0A 4N54A 4DBVO 2Q1UA 3ZWYA 1HDRA 4RGBA 4Q3DA 1MB4A 4OAQA 4YCAA 1DFIA 3GMSA 4IDBA 4YJHB 4HP8A 3DZHA 4KQWA 4I08A 2X6TA 3ETGA 3TZKA 1B7GO 3ZWPA 1NHWA 4FOSA 3PLNA 4YXFA 1KIFA 2EG9A 4ZVVA 2ZB7A 4DXHA 4FW8A 2UUPA 4PG6A 3GN1A 1P74A 3RROA 1U5AA 4MPDA 2DBVO 5DP2A 3VPSA 3GFGA 4DQVA 4R69A 1PGOA 2PZKA 1QV7A 1N2SA 3BXXA 3ENKA 4LISA 1Z45A 3I9NA 5FEUA 2YFQA 2Q49A 1TLTA 1LRLA 4QFDA 3VPHA 2A92A 4WOJA 1MXFA 3K73O 4P4LA 2VRCA 5TGDA 5GZ3A 3NX4A 4NU5A 2VRCD 1LLCA 2XAAA 4CMAA 1ZNQO 1B8VA 2I76A 3FNFA 4UVHA 1YH3A 3BMCA 2EGGA 3WGQA 1HLPA 1U2DA 4R54A 2GN6A 1B2LA 4MVJM 3A9WA 4BNIA 2HK7A 2V6BA 3UW3A 1GY8A 4LSMA 1PWZA 4R3WA 4JJFA 4ZRMA 4EUFA 3HQ4O 3PQDA 4W82A 2EKLA 2X5JO 1DRVA 1TA4A 4H7PA 4M87A 2D5CA 2R2GA 4OKIA 2DFVA 2PTGA 4OGWA 2Y1EA 3WDSA 4E6PA 4CQMA 1HT0A 5CPFA 1CF2O 4DPMA 1PL6A 2LDXA 1X7DA 3RSHA 4JQCA 3UICA 4GKVA 2C54A 3GRPA 4IGFA 1YRLA 4N5MA 5JFOA 4N5NA 1ZJYA 2NM0A 4CPDA 2EW2A 4YPOA 3ANLA 3FN4A 2W8ZA 1A72A 4PIVA 1EBUA 1UP6A 2BGMA 1LJ8A 3QV1A 4Y9DA 1Y7TA 1YQXA 5HS4A 4UEOA 3ZNNA 2VWHA 4ILKA 4RQTA 2IZ0A 1KVTA 4E2WA 1EK6A 1QP8A 4J1QA 1X0XA 4Z9XA 4BO7A 4E5MA 1M76A 3AFNA 1DC4A 4MKXA 2OMEA 1I8TA 3I6QA 4D79A 4R16A 8LDHA 4LN1A 1XCBA 3JQAB 4FJ1A 4A03A 4K9DA 4BKPA 1JN0A 1EE2A 1C0IA 3BZUA 2V6GA 1KC1A 2CD9A 3BMOA 5TJHA 4BO1A 4MP6A 4D7AA 4OIMA 3GC6A 4AJOA 3WSVA 4HX5A 4TSKA 5A1TA 4DYVA 4FSHA 5CDUA 2JAPA 4PRLA 3PHLA 1J49A 1O8CA 3O38A 4XRRA 1OFGA 3FSRA 2Y99A 2J5KA 2ZIZA 1T2CA 3NJ8A 2Y93A 3QP9A 4BGUA 1SOWA 1E92A 4QT0A 5I9MA 1UAYA 3ZDFA 1EVJA 4INAA 3RVDA 4CUJA 3DBHA 3Q1LA 5JAZA 3H9QA 1N92A 4J7XA 3ZCXA 3MZ0A 4F6CA 2FPGA 5DN9A 2YJZA 3CZMA 5CDTA 4RF3A 3GEGA 4XWYA 5DBFA 3NTOA 4ZRNA 5KTKA 5THQA 1I3NA 2UAGA 1ENYA 3B70A 1WWKA 2J3HA 1TT5A 3I9OA 2YFHA 1Q1NA 5IFLA 1U3WA 2C7GA 3GVCA 2HJRA 1A9ZA 3KOUA 3NDRA 3SBOA 3WQQA 1T24A 3EW7A 1R4MB 5JAQA 2ZYAA 5TT1A 1M75A 2HK8A 3DMYA 5JDIA 1HDYA 4G5HA 5A9RA 1FJHA 5DZSA 2HAEA 5ES3A 5B12A 4NZ9A 1JQBA 3X2EA 2P9GA 5ER9A 3OP4A 5JAMA 3SJ7A 4TZKA 1KVRA 1QXSA 4TRJA 3DTYA 3IUPA 5KIAA 4X54A 1V35A 5B4UA 3RFTA 5L95A 3WGHA 1AGNA 4BNFA 2R00A 1T2EA 2J5RA 2J3IA 4ZN6A 1D8AA 3KM0A 1RYEA 3WQSB 3WS7A 3VC7A 2C07A 3NYWA 2P4QA 5U9CA 3JYPA 2Y05A 1N1EA 2FZWA 2J8ZA 3OJ0A 4PZEA 3AUUA 3QJ5A 3S55A 5B37A 1ZSYA 4P4NA 4ND4A 1NAIA 3EGOA 3KXDA 1U7TA 2JCVA 3E5RA 1YWGO 1J5PA 4AJIA 2ZJ0A 3HUDA 4DLLA 2WYWA 1SMKA 5JDCC 1I30A 2BHLA 1E3JA 5T8KA 2DQ4A 1IB6A 2ZYGA 3KVOA 5C7OO 4WLFA 1M2WA 3QHAA 3F1LA 3PJEA 3ASVA 2OXIA 4DLAA 1D1TA 4BNVA 4RPKA 1UZLA 2X1HA 1BRMA 4YJFA 5A3JA 3TN7A 3W4KA 3H9JA 4W9NA 5FF9A 1I5RA 1PGQA 3C7AA 4RPJA 4FIZA 1UR5A 2RAFA 4FJ0A 2B83A 1YOVB 5IN5A 3UCFA 4WLNA 2D4AA 4QO7A 2GYYA 3ZHYA 1CETA 4L4RA 2RHRA 1HSZA 4LMRA 3MOIA 3INGA 4IIVA 3FWNA 3HG7A 3Q2KA 4ZD6A 3DXFA 5F5LA 4A27A 1YVEI 2JD1A 5I9NA 1PTJA 4FFNA 4KTVE 4EYEA 2BRUA 4Q3NA 1IPFA 4J16A 2EXXA 1FDWA 5AYVA 4BNJA 3WIEA 4GL4A 2YV1A 3UOGA 1IYZA 4YJGA 2V65A 1HE3A 3A4VA 3OJLA 1R66A 1I33A 2PY6A 1H93A 5KNLA 5G0TA 2OBYA 3DOCA 2FHSA 1BXGA 4HADA 1BDBA 2Z5LA 4YQYA 4ALJA 2PLAA 1BVUA 3ZU2A 1EUCA 5CDSA 2HCTA 1N7GA 1NVMB 3PDUA 5JE8A 3RWBA 4OSPA 3RUEA 2YV3A 4YAIA 1RM0A 1RM3A 3PHHA 1P3DA 4OHUA 2HMWA 4XA8A 3DAPA 1V3UA 3U5TA 3ZI0A 2JFGA 4BNTA 4XIYA 3R3SA 2QG4A 4RLHA 1PQWA 1JWBB 3DEYX 3JQ7A 4TRRA 3QY9A 3S2EA 1GPDG 5AXDA 4FD3A 3PYMA 4DMLA 4GPD1 2PD4A 1GR0A 3F1KA 1C1XA 1CDOA 1WZIA 1EE9A 4GVLA 1B8PA 1QYCA 1X1EA 2PK3A 3DBLB 2JHFA 1QYVA 4YBZA 3RD5A 3PHJA 2B35A 2F1KA 4Z6KA 5HM8A 4U8GA 1Z75A 2P91A 2VHXA 3HN2A 5JC1A 3E48A 5ILGA 2H9IA 2EJWA 1DXYA 2NUAA 4BNGA 1QYWA 4KP7A 1HDZA 3IL2A 3ONEA 4A26A 2CZCA 1OC4A 2PWZA 3U4CA 4BGVA 5L9AA 6ADHA 3F46A 3NAQA 4JK3A 5K6AC 1F8GA 4EDFA 1LQUA 1HTBA 4QEDA 1L7DA 2BD0A 2GN4A 3LU1A 1LUAA 2YDYA 3B6ZA 1LBEA 2CF6A 4NNJA 2X9VA 4Z3DA 1T1RA 4O63O 3KLMX 4CR6A 2AEMA 3B1FA 4CMBA 1TVEA 2QIOA 2DUWA 1NFQA 3A06A 3RCBA 1OBFO 4P38A 4IPTA 1CYDA 1ULSA 1Z73A 2HQ1A 3GZ4A 1WMAA 1DPGA 1EDZA 3H65A 1ZMTA 4U6QA 4YAEA 4J3FA 2FOIA 1XR3A 2BFPA 4HV4A 1LQTA 3I3OA 3F6YA 5TF4A 4BO9A 3ETDA 3ZV6A 2AQ8A 3D3EA 2PKQP 4ZQGA 1PJ3A 5FWNA 3SJUA 3SEFA 2WYUA 2NNLD 4HXYA 5MGBA 5T57A 4ALNA 3ICCA 3U4DA 6LDHA 4M89A 1N7HA 2BLLA 2PH5A 3RUDA 4BKOA 3MJCA 3D0OA 1DC5A 1P31A 3D5TA 2AHRA 1MC5A 3RFXA 1QLHA 2FPPA 4C4OA 3NDIA 4E30A 1MFZA 4JJGA 2VOJA 1NTOA 3BMNB 4KUGA 5A9SA 2BFOA 5KVQA 4R41A 5CAEA 3KYDB 3NV9A 3KHUA 3MTJA 4DC0A 1G0OA 2B69A 3WG9A 4GKBA 5JXWA 3WSWA 1E7SA 4E3ZA 3L4BA 5IF3A 2I66A 3JD4A 1B26A 3FHLA 4CMGA 3BMQB 1ZIDA 7ADHA 2WE7A 4XKJA 1BXGB 3LT0A 3PFWO 1PJTA 3ZU4A 3PK0A 3H6KA 2OUIA 2C5AA 4IQ0A 3S1LA 3R6DA 3I9JA 3LT2A 2YDXA 5BSHA 4IBOA 4E31A 4CLOA 3C3XA 3S2FA 3NT5A 3E18A 1ZMOA 3BIOA 3SLGA 3CKYA 4R51A 4HKTA 4QQRA 4CUKA 3NTQA 3ZWMA 3RBXA 4BV8A 4PG8A 5IZCA 1MA0A 4B4OA 2FMUA 3OM9A 2GO1A 5TC4A 5L7YA 1CERA 4N7RA 4J4BA 2YHUA 3T7CA 1NFRA 1WVGA 3TOZA 3N7UA 1HEUA 4J0FA 1D3AA 2VOEA 3JQ7B 4JBGA 2FP4A 3K8ZA 3I52A 4FC6A 4BIIA 2HMTA 1I2BA 4NQZA 2DKNA 1PZHA 3RUIA 4CLDA 3OECA 4XQGA 3JYNA 5A04A 5A4DA 5EMHA 4IDAA 4RF5A 1GYRA 3ZV4A 4CMIA 2B37A 3I9KA 3GDOA 4Y8VA 4CODB 1ADBA 3QSGA 4U5QA 2NQ8A 1HDOA 4M86A 3VVCA 1VJ1A 3FNHA 2E82A 1QLJA 2PA3A 3IUSA 3VKUA 3HADA 1AHHA 3GG2A 4BNKA 2Y1FA 3WMXA 4KWIA 4RVGA 4WASA 1T2AA 3AK4A 1PJSA 3OETA 4R68A 4HFRA 1ARZA 4YYZA 3HDYA 4NPCA 3N74A 4YRDA 1J4AA 4CM9D 3RUCA 3GN2A 2E37A 3KTDA 5DF1A 1WW8A 3PYLA 5JNLA 4YA6A 3W8EA 1PGNA 3AY6A 1X15A 2E48A 3BAZA 4MVJI 3T7EA 3TPCA 2HJSA 2VT3A 2HRBA 3I6IA 1MXHA 3KYBA 1GQYA 2H1SA 5HRUA 3P2OA 3GZNA 5AXCA 4E33A 3FPCA 1UP4A 2P4HX 3DC2A 4XRGA 1WDKA 1WXDA 4ND3A 1U4OA 1ISFA 4CMEC 1YBMA 2ZK7A 4JP2A 1XHLA 4XGKA 1XEAA 5LDGA 2GN9A 3PDJA 4RV9A 5DT9A 1IUKA 1HSOA 2YQ4A 4B3JA 2NVUB 3E5MA 5DNAA 5I8ZA 3I5MA 5L4LA 3HDJA 1B16A 2DBRA 5G0VA 3WYCA 1GUYA 1GUFA 2JL1A 4FFOA 4Q3BA 1KYQA 3QE3A 3FTPA 2HMSA 3KYCB 1ZXLA 2VZ0A 2YHIA 2QRLA 5TLSA 4NR0A 3ITDA 3AI2A 5EIOA 3D3WB 4CQLA 2PD3A 4DIOA 3QWBA 4OOFA 3VZRA 1EEHA 4Q39A 3GDFA 3GRKA 5GZ1A 3SXPA 3W6UA 2Y66A 3PTZA 1VPDA 1LDMA 3AI1A 3E03A 4XQCA 1K89A 3GAZA 4LVCA 4PLZA 1R12A 4GX1A 3EK2A 3FWZA 1HETA 2IODA 1YL6A 5BSFA 3GNTA 2NTVA 1N9GA 3JCZA 4CLRA 1P44A 1R15A 2Z95A 2O4UX 2CNBA 3FR7A 3ZV5A 3TJRA 3RJ5A 5CEFA 1Y8QB 1RM4A 4OL9A 2GNAA 3QVOA 2PD6A 2ZKLA 1DLJA 3DBRA 5IXSA 1JKIA 3RUHA 1HYEA 3OSUA 3T4EA 4A2CA 4LVUA 3O03A 3KEOA 4A10A 1VKNA 1HKUA 3FNGA 3LC2O 5C3MA 2B5WA 4RPHA 3IC5A 3GHYA 3WWYA 3RUAA 5L40A 1RJWA 4L4XA 3KLPX 1ULUA 1I0ZA 4QXMA 5IAAA 5I9LA 2VUUA 1JVBA 5FI3A 5TSDA 4BNHA 5ENDA 4EJ0A 4XGNA 2BELA 4RPGA 1P1FA 1JVSA 2JKVA 3ADPA 4M8SA 1PX0A 4JGBA 2OL4A 3AY3A 4OSOA 1Q7BA 4M54A 1NQOA 4D46A 4WCFC 3M6IA 3DB2A 4FDAA 1NFFA 1YQDA 3JQAD 4I9NA 4CMIB 3L0DA 3QQPA 2GASA 3A14A 3OA0A 5T5QA 2G76A 4YR9A 2P5YA 1GTMA 1LLUA 5CPBA 5JMPA 1GYPA 3UVEA 1PQPA 4BGIA 4S1VA 4CM8A 4Z0HO 2HUNA 1C1DB 4GLLA 4E5NA 1YS4A 4E2YA 1DHRA 2NU7A 5TNXA 4H3VA 4QUKA 3BTVA 4O5OA 4PLHA 4XDYA 5KKCA 3ZWAA 1N8KA 5K9ZA 4BHTA 3WGGA 3PWZA 4JXKA 2IXBA 4Z9YA 4I5DA 4F45A 5A9TA 1PS0A 2OP0A 2YV2A 2DLDA 1XQ1A 1HDGO 3IQDB 5EERA 4AICA 4BMNA 1KVSA 1I36A 1DRUA 4TZTA 3OIGA 1ISGA 1FXSA 1Y9AA 3RUFA 1G0NA 1M66A 3TZHA 1F8FA 3GG9A 4JP3A 4XB1A 1EZ4A 4Y67A 1IPEA 1T25A 3OQBA 4Y6SA 3OIFA 2FWMX 1U2GA 3B20A 4O6VA 2ILTA 1O94A 5U1PA 3H9GA 2WWRA 2NU9A 3KO8A 3H5AA 2G82A 3JQ8A 3PWKA 5G2OA 2WSBA 1XU9A 1PJ2A 1Z6ZA 2IXAA 4HWKA 4IXTA 3AU8A 4PLCA 1PIWA 5F1OA 5T67A 3MEQA 2POQX 1E7QA 3T4XA 2DUUA 2AQKA 1LSJA 2WDZA 3CE6A 3COSA 2NADA 3MWDB 4MJLA 5DCYA 4J6FA 3OJOA 5TX7A 2Z1MA 3MCVA 3RQSA 3VPXA 1ENPA 1PWXA 1HF3A 2AQIA 4PLPA 4BO3A 4NBWA 3PLRA 1W4ZA 2VUTA 4IDDA 2J6IA 1YONA 1DDOA 3FRJA 4WE3A 3V1TC 1A27A 2C59A 3ANNA 1GZ4A 1K3TA 2V6FA 2VHVA 4YWJA 2YZ7A 5JDCA 4I5GA 3GVHA 5ILOA 3DR3A 3E8XA 4IQGA 3D5QA 1XLTA 4HY3A 1VM6A 1Q7GA 1JKJA 1VLLA 2D1YA 1NAHA 5ER6A 2TMGA 2CFCA 4RCVA 3WJ7A 3AOEC 1U3UA 4FJ2A 4XB2A 1P1HA 4XIJA 3KSDO 3VKVA 1NASA 3OMLA 4YT4A 5JYDA 3ZHBA 2Q2VA 4YAGA 5TIIA 5KVCA 4DYDA 3FCOA 1JLLA 1UP7A 3UHAA 5L51A 5A5EA 2C29D 1H2HA 2BFMA 1KC3A 3EVNA 2JFFA 1E5QA 2G1UA 1NVGA 5I7SA 2I67A 3A28A 4GWGA 1WP4A 4E13A 3PHIA 4Q3CA 1VRWA 3E9MA 1EQ2A 2GPTA 1LSOA 2X22A 4L75A 3VAZA 3WFJA 1ZCJA 2B4TO 2YQ5A 4YRBA 3A1NA 3UCEA 5JLAA 4ALKA 1EBFA 3KETA 1JWAB 3WLEA 1SEVA 1Q0QA 4XYMA 3GGOA 2FR1A 2AEFA 2ZTLA 1ENOA 2IDZA 4U0JA 3H5NA 1B8UA 2GD1O 2RHCA 3EY4A 4BKQA 1ZH8A 4WOKA 1E3SA 1O9BA 1V0JA 2Q2WA 1KBZA 1JDJA 2O3QA 3PIDA 3U0BA 3LT1A 4LCEA 3D7LA 3DDNA 4N18A 1LTHR 1PJ4A 2WD7A 4J9UE 4II3A 3PHGA 1H6CA 4YEDA 3ROQA 4D43A 4IJUA 1R0SA 2Q4EA 3ANMA 2X58A 1E7WA 4RF4A 4EZBA 4UEKA 5A02A 2AE1A 5IDWA 3ETEA 1C0PA 1DIBA 4J43A 9LDTA 1Z82A 3DQPA 3NTRA 2AXQA 1MLDA 1J6UA 3GGGA 5DOVA 4AJ1A 2DPGA 3RBZA 3W1VA 3H3FA 2NACA 1SAYA 1U9JA 3C1TA 3V2UA 2O7QA 3B1JA 2GN8A 4GQAA 1NX6A 4GBJA 2IEDA 2Q1WA 1Q2XA 2O48X 2X5OA 3DTTA 4GI2A 4NK4A 1BDMA 1C3VA 3K5PA 4RVSA 1I10A 3WIDA 2DBQA 3WXBA 4S3MA 1E1NA 2Q4BA 1E3IA 4IDFA 4J91A 4FBGA 2NWQA 2AG5A 2Z1NA 3BMCB 3DL2A 1HXHA 3QRWA 4WLEA 4WKGA 3LLVA 3O8QA 4RLSA 2VZ9A 2EP7A 1GCOA 2OZPA 3LSYA 4IZHA 1G1AA 3U49A 9LDBA 3M2PA 3RASA 3CINA 5KVSA 3IAHA 4XQEA 5K6AA 1OI7A 2H6EA 2Y0CA 4ZQHA 4JNKA 1XYGA 4BO4A 4CQMB 1QORA 2HRZA 3VHRA 2WEKA 2W2KA 2W2LD 4H16A 2J5QA 1TT7A 1N1GA 4ZJUA 2PKRA 1E3WA 2NQTA 1V6AA 4C7KA 2BI8A 1U3VA 1H6AA 4GSKA 5H83A 5I7VA 2FR0A 4BNUA 1QKIA 3ROPA 3C85A 4QO8A 3TF5A 2Q45A 3JQ6A 1Z74A 4XYEA 3W4JA 2FPIA 4DTIA 3JQ9C 3RC1A 4Z3KA 5DCUA 3ROMA 4JX8A 2BH9A 5JMWA 3Q0EA 4CM4A 2GF2A 3DZJA 4Q9NA 1GEGA 1SBYA 3PGJA 1H5QA 2FY8A 3OIDA 5EPOA 4C7JA 2X0JA 3JD1A 4LRTB 1EK5A 1LDBA 4D41A 3WNQA 4IINA 1KY4A 3O4RA 3BTOA 4FC7A 4CV0A 3GOHA 4LCJA 3NDJA 4QSMA 1QRRA 3OJEA 5L3ZA 4E21A 3VDRA 4E2XA 1YDEA 1KOLA 4R01A 1H0KA 1JW9B 1N5DA 2J3KA 3VTZA 1SNYA 4BO2A 4BS9A 3EYWA 4NFSA 3CEAA 4XDZA 3BMOB 4IJWA 5G4LA 5KCZA 3MTGA 3P5SA 1LLQA 3VPFA 3ULKA 3BYZA 3CZRA 4A73A 1H6DA 3PZRA 4EEZA 2VHYA 3K31A 4MKRA 4P22A 4CLEA 3TZCA 3HB5X 1S7CA 3AU9A 4BNNA 1RM5A 4BNMA 3VPGA 5AVOA 1FF9A 1DLIA 4RVHA 4BNLA 3W8FA 2ZTUA 4NJMA 3S8MA 4B4WA 4EGFA 2ZB3A 3H3JA 4XX0A 4NHEA 4H15A 3DBHB 3DMTC 4NDNE 4BNXA 2UDPA 5EESA 4G2NA 1VJTA 1OMOA 3BA1A 1W8DA 3QWHA 4OM8A 2ZTVA 5TQVA 4E4YA 1TT5B 4NMHA 2NVBA 2RIRA 3SVTA 4DREA 4QFCA 3MJVA 4PLWA 1NHGA 3PI7A 4AJ2A 1P1RA 1FMCA 3QVWA 1PQUA 3VDQA 1LEHA 4ZQFA 4GX5A 3FF4A 1NPTO 4R3NA 4IJVA 3C1OA 5KJEA 5EINA 5DBIA 4KMSA 1NQAO 2C7VA 4K1LA 1W6UA 4FOOA 4AJEA 5JCJD 2Q1TA 4KDFA 3TNLA 5DP1A 4CM6A 5HA5A 2OGUA 2ZB8A 4DUPA 5BNTA 1XG5A 3LDHA 2GUGA 4GX2A 3TL2A 1I3KA 1I3LA 1BW9A 5BQFA 1OZAA 4J90A 3C1AA 1T2DA 4KWHA 1XU7A 1U3TA 3TZ6A 2O7SA 2DFDA 1O6ZA 1VJ0A 3NT4A 4D0SA 4GH5A 1K6XA 1KEWA 2EERA 4AL4A 4BQRA 1O0SA 4GMGA 3DZIA 3GHHA 4J0EA 1FK8A 4YACA 1HDXA 1W73A 4IDGA 1Y6JA 3UGKA 1E6WA 4CL3A 3DFZA 4MOWA 3TFOA 4PFJA 2GSDA 1BVRA 2CF5A 1UDBA 5JYEA 2I5PO 1A4IA 1ADGA 2G17A 1Q0HA 2Y1GA 1R0LA 1CEQA 1MX3A 4L74A 5T6BA 4CM1A 4PLGA 4DQXA 2ZTMA 4PZCA 4JIGA 3FR8A 1E3WB 4J4HA 2VWQA 4B3HA 1P45A 2NTJA 3K96A 1Y81A 4PLTA 4DLBA 4GX0A 1DC3A 4MVJA 2DAPA 1E1KA 4YJFB 4CMEA 4ALLA 2IEBA 3ABIA 4MVJD 1U4SA 3DAFA 4ND5A 3STHA 4BUCA 4PCVA 5F1KA 2VTEA 5G4KA 3CH6A 2Y68A 1XSEA 3CMMA 3V1UA 3G3EA 5IDXA 1Y1PA 1RYDA 3CXRA 1K6JA 3F4LA 1SEPA 3RKUA 1UXJA 2I3AA 4BNZA 5ICMA 3HJAA 4O0LA 3GQVA 5HBRA 3JQCA 4LMPA 1WMBA 1ZBQA 1ORRA 1QG6A 2JD0A 3OHSX 4TVOA 5G0UA 3WTBA 4ALIA 4BNWA 1E0DA 1LRJA 5ICSA 3WGOA 2R6JA 5ADHA 3ONFA 1F06A 1SCUA 2QYTA 4O1MA 1WLYA 1YJQA 3MWEB 5A06A 1GQQA 1UUFA 4ONEA 1NQ5A 3WGZA 1UXGA 1B15A 4UVIA 4A7PA 3ONDA 1PS8A 4R9SA 5F21A 1YBAA 4I5FA 1NPDA 4IQ8A 1R4NA 2UYYA 3NGLA 4YJGB 4OQYA 3UF0A 1GL3A 1T4BA 4W6ZA 2VT2A 3DOJA 1MG5A 5T64A 4NI5A 3AUSA 4II2A 3LF1A 1YB5A 4OXYA 3ZHXA 1C0KA 2PNFA 1RPNA 4DBZA 1EFLA 1D4FA 4PGFA 2CVZA 3UAGA 4DA9A 1GV1A 3ASUA 3H5RA 4I9HA 2DPHA 3JQGA 4OMUA 4CLXA 1CWUA 1GD1O 3P7MA 2IE0A 2VWGA 4MO2A 1UXKA 3WYEA 1YDWA 4YVFA 4CJXA 1M67A 4NJMB 4J2HA 1XWFA 2HDHA 2VUSA 5KJ6A 3W4IA 2E49A 2DC1A 2GRAA 3OJFA 1DRWA 1T4DA 1LDGA 1VC2A 2JJYA 3AI3A 3GDGA 2J3JA 4L73A 4J9VA 2O4CA 2Y1CA 4I1IA 3DOOA 3E1KA 1P1KA 3LK7A 3M1AA 4BQPA 3OFSA 1NWCA 3KSZO 4JN6B 4OJNA 1ISHA 3JSAA 2C5EA 1C1XB 2BKAA 3IP3A 3ZHZA 1UZMA 5COAA 2B5VA 3CIFA 2ET6A 2RH4A 1M6HA 3P2YA 3IKTA 2EV9A 4J1SA 5HWSA 3RIHA 2I99A 4GSLA 3GA0A 1E1MA 4BNYA 3PPIA 4G65A 1FDUA 4LK3A 4ND2A 2NSDA 2LDBA 3RAJA 4WCFA 4L4SA 2FRDA 3ORFA 2B36A 1UH5A 2WJPA 3I23A 5JO9A 3ADOA 4CM9A 1QYXA 4QTZA 5CFZA 4DC1A 5CG2A 3AM3A 1QV6A 4Z0PA 2D3TA 4E5YA 1VSVA 4GLOA 1K6IA 2JCYA 4DIFA 4D42A 2VQ3A 4CL8A 4J49A 3JQDA 3C7CB 2A4KA 3PXXA 3JQFC 4TRNA 1XELA 1HWYA 1PR9A 2W98A 3JQEA 4NJOA 2O2YA 4EUHA 1Y8RA 4RF2A 3GUCA 1XA0A 1H2BA 1PJQA 4MVJP 1ISIA 3U62A 5LDHA 3JQBC 1F17A 1U8FO 1UXHA 5CP8A 4RQUA 2O3TA 2TMDA 4ZQEA 2P68A 2AA3A 2XXBA 2BI7A 1NBOA 3WICA 4LW8A 1PR3A 4J7UA 2DTEA 2WE8A 3L6EA 3G0OA 3JV7A 1KEUA 4MVJG 5ENVA 2RBEA 1E7YA 4MINA 5GZ6A 3HFSA 3I83A 2A9FA 3TDKA 4BB6A 1VE9A 4BKUA 2EIHA 4WEQA 1O89A 4B79A 2ZYDA 4GWKA 4KZPA 2VHWA 2VYVD 1EVZA 4XYGA 1PJBA 2D5AA 4XGIA 3ZV3A 4B4VA 4D45A 2PH3A 2I9PA 1GYQA 3F9IA 5A9SB 2EF1A 1RWBA 4WLOA 2W4QA 1B3BA 4YRAA 3GGPA 2DT5A 1X0VA 1PJLA 1YQGA 2GGSA 5A03A 1XQ6A 2X23A 3PEFA 4RVFA 3R1IA 5GMOA 4L8VA 2O3UA 1XKQA 2RCYA 3L6OO 5GY7A 4DVJA 4EJ6A 1V8BA 3CSDA 4IIUA 3FTNA 5TJ9A 1KY5A 5C7LO 3EZLA 3BHIA 3DZKA 2B4RO 4MP8A 3IIEA 3RFVA 1EUZA 1I3MA 2VYND 3QVSA 1NM5A 2EGHA 3AUAA 3L77A 3JTMA 4CLOB 2B4QA 3NT2A 5KJFA 3JQGB 4FGWA 3KSUA 2NU8A 1PS9A 1ZO8A 2C2XA 3VOSA 2BMAA 1E1LA 3AWDA 3LC7O 2PKQO 4TWRA 5C5IA 4AFNA 2W90A 1NP3A 1QMGA 4YDRA 3ZNQA 4EITA 3G17A 3I4FA 5A5FA 4KQXA 1P77A 5FYDA 1XIVA 1B0AA 5JPIA 3E9QA 2ZQYA 3V2HA 1MG0A 4XEHA 5G0SA 2IRWA 1BTOA 2Q2QA 3HSKA 1LX6A 3ICPA 3PYXA 3B1KA 5U4QA 4WNIA 3CPSA 3I4CA 1P9LA 3GVPA 4J4TA 1UDCA 3AOEA 4FCCA 3SLKA 1IZ0A 3GLQA 1VL8A 1HL3A 3WYBA 4W7IA 2HSDA 3R0IA 4AG3A 5CDYA 1EVYA 1BMDA 1Y5MA 1GZ6A 5IXYA 1QR6A 3JQAA 3DHEA 1YBVA 3PQEA 2OP1A 1GAEO 2QZ9A 4J7CA 1TEHA 3ZU3A 4YT2A 4B8WA 4RDIA 4ZA2A 1HYHA 1DHTA 3ROKA 1B14A 1A7AA 1GUZA 2O50A 3VH3A 4A0SA 5F5NA 3AY7A 1AHIA 1ZSVA 1A5ZA 4OQZA 5JAIA 4B7UA 5LCXA 1ML3A 3ZW9A 3D1LA 2GZ2A 4ROSA 1WNTA 2EKQA 2NVWA 2E6UX 3WBFA 3IDSA 5DDIP 4RZHA 4IXWA 4CMJA 1H6BA 2YUTA 2CDBA 4K28A 2HLPA 1YJ8A 1LC0A 3CUKA 3AFMA 1JTVA 5FFFA 2GLXA 2VHZA 1Y8RB 1YB1A 4B8ZA 5FI5A 5DOZA 4MIOA 1MGOA 4EBFA 3GZNB 4R5MA 3NGXA 3P19A 1PZGA 5COBA 4AVYA 4UVGA 5AXBA 5J23A 1X14A 4D3SA 4F6LA 4NG5A 4BVAA 3PZBA 1ENZA 5BNFA 3PIIA 5THKA 1WPQA 1T1SA 5IDQA 1R4MA 2Y1DA 4EW6A 2P5UA 3SC4A 3Q3CA 4JJIA 1EUDA 3NRCA 3ZWWA 2VN8A 5KJ1A 3HHPA 3F5QA 3UH1A 2CMDA 4MVJH 2NV6A 3LF2A 4M1QA 4RL6A 3K2BA 4BGEA 3TQHA 1VI2A 2BGLA 4TMFA 2YHIB 3ZWOA 1NR7A 4CQLB 1BXKA 2CY0A 1YB4A 4IY1A 1EQUA 3RU7A 4CV3A 2JCXA 3CMCO 5L4SA 1IOLA 2JHGA 1J0XO 4HFJA 4BMSA 7MDHA 1NNUA 3D64A 4BOYA 2XF8A 2JFHA 5CHEA 5EL0A 1DC6A 1DBVO 1LDNA 4IM7A 3QIVA 5H81A 5KWEA 3NUGA 3V2GA 1MP0A 4HNHA 1XDWA 2X0IA 3W6ZA 1N9GB 4KUEA 4CLRB 5B4TA 1CQIA 1V9LA 1TI7A 1HZZA 1ZK4A 2AW5A 3ZNPA 2XPCA 1R0KA 2HO5A 4RJTA 1WDMA 3E82A 3HN7A 2CSUA 3MOGA 1DAOA 3HFGA 2VWPA 3S2GA 5JY1A 3Q9UA 5BT9A 1B3RA 3GAFA 3DBRB 4CQMD 1EDOA 1YE3A 1A7KA 1IL0A 2IYOA 2O23A 2PZMA 3OA2A 3UKOA 8ADHA 2DVMA 2OHXA 1ZEJA 1H9AA 3U09A 1V3VA 2QRJA 3JQ9A 3RBVA 5H82A 1LC3A 4YT8A 1ZEMA 3GUYA 1E5LA 2QW8A 1K0UA 1TB4A 3F4BA 4CM5A 1SB8A 4PVDA 5DBGA 1YOVA 2PGLA 4GGPA 4R1UA 4E12A 2A94A 3S2IA 1ONOA 2VTDA 1IY8A 3EC7A 4IDEA 3PQFA 4R1SA 3KUXA 5CDGA 2OOSA 4Z9FA 4AJJA 1HZJA 2GZ1A 2NTNA 4IDCA 1PL8A 4U0KA 3G49A 2V7PA 3EDMA 2X86A 2ZQZA 4N5LA 3LQFA 4FN4A 3VH2A 4PLVA 4XJSA 3D4OA 5F3RA 1PZEA 1X1TA 3LVFO 4IZIA 3LZ6A 2DTXA 2I3GA 4WK6A 3AJRA 4MDHA 1WDLA 3PWSA 4OKNA 4CM8B 4D44A 4UUNA 5G0WA 4A5OA 1AXEA 4R9RA 4WCDA 4F3YA 5F1PA 2XXJA 3AUTA 3TRIA 4P4GA 3GPIA 3QWIA 1BWSA 1FDTA 5EN4A 3AOGA 4WGGA 3ZWNA 3M2TA 5JSFA 2GERA 3ZH2A 3DMTA 1VL6A 1PSDA 1Q7CA 5JS6A 4M55A 4KDEA 4WECA 2C20A 2DTDA 4G81A 4CV1A 2OORA 1A71A 2B0JA 2P2SA 4L76A 1R37A 2D59A 2FR8A 2QHXA 4PG4A 4DIBA 4BL5A 4CR8A 1PU2A 4DL9A 3WWZA 4BO5A 1JAYA 2C82A 4I9UA 4P8RA 4E5PA 3WR5A 2F00A 3UXYA 2EEZA 3ZWBA 5B1YA 2Q3EA 4R1NA 4CM7A 1H9BA 3TZQA 3LC1O 4Y98A 4AJNA 5K0ZA 1ISJA 3KZVA 5JW6A 1UAGA 4HFMA 4CLHA 5BSEA 1GDHA 1ZZEA 3EAGA 3O26A 4PG7A 4UVEA 2AEJA 1ZK1A 3GH3A 3DBLA 1DAPA 2CUKA 1HE4A 2Q50A 3TSCA 1SO8A 2X0RA 3BTSA 1ZKMA 3C8MA 4UULA 3NEPX 4K6CA 3JQ8B 3PGXA 4NU6A 5HS6A 4B4UA 3IJRA 4IGEA 1DB3A 1Z7EA 3DZGA 4Q3EA 4ZU3A 5CEEA 4CUZA 4EI2A 1X7GA 2QQ5A 4BB5A 4IUYA 3DZFA 3K30A 3V5NA 1ID1A 2AG8A 3PJDA 2W2LA 3QWFA 4FGSA 3FBTA 5L4NA 3HE3A 1U7HA 2X5KO 5JY6A 1T2FA 1ZXBA 2HU2A 2O2SA 4PRKA 3MJEA 3PFFA 3ZWCA 3U9LA 2X9GA 3SC6A 2X7HA 1EVIA 4TRMA 4U6SA 3TOXA 1VKOA 2OBNA 1K5HA 2Y0DA 3H8VA 1E3EA 1LA2A 4WEOA 3F3SA 5TT0A 1O95A 1S6YA 3ON5A 3ENNA 4MP3A 2VCYA 4XYBA 4Y6RA 1Z7BA 2Q46A 2ZCUA 1U8XX 3DAGA 1QYDA 4BO8A 3G79A 2D2IA 1Y5RA 1DIAA 2CVOA 2JAHA 3OEYA 3ZZNA 3WGTA 1YL7A 3ZNOA 3ZU5A 2UUOA 5DULA 3VZPA 4GGOA 2UV8A 3HDQA 3ZWVA 3KB6A 1DIHA 4R4JA 3L9XA 4NH4A 5COQA 4DWVA 4W7HA 3HNPA 1GEEA 1I24A 4PG5A 1ZSNA 1DSSG 3H9EO 4W99A 3MJTA 3WX0A 3WBBA 3MJ4A 1T26A 4IMPA 4JROA 4Q3AA 4DPLA 3BMNA 3QVTA 4TQGA 3DHYA 3GEMA 3KYDA 1PJCA 2CDCA 2PGJA 1ADCA 5L7TA 4CM3A 3L6DA 4J1NA 4DPKA 1Q0LA 3KEQA 4RDHA 1LNQA 3NJ4A 3IJPA 3G1TA 4D0RA 2H63A 2OFPA 2CVQA
chains in the Genus database with same CATH superfamily
3M5WA 5KSWB 2DPMA 1PHRA 2C88A 4BPRA 3IT0A 3STXA 1RHQA 2B21A 4PC7A 1D1SA 1G21E 1N2CE 1VI5A 1XCGB 1XTBA 2DSTA 4YLGA 4FLEA 4AUNA 1IBCA 3TYXA 4UM8B 2OCYC 1SCKA 4HSGA 1KY2A 3KJXA 3E23A 3ZDQA 2EX4A 2BFDB 2OCKA 3DONA 3JQPA 3PUKA 4LVNA 4YBRA 1Q19A 3I0NA 2C95A 4L4UA 4ZICA 5EGNA 4JCOA 3L8ZA 4G9GA 1S96A 4R1TA 4CKZA 5BURA 4W5NA 1WAMA 2OLEA 1O54A 5AOBA 1G5PA 3DOUA 5HQ3B 4P82A 3FROA 5AHOA 1H0RA 3RREA 3V1MA 5EQFA 1YQQA 3PNQA 4DRZA 4MRMA 4E2ZA 1A4UA 3WTCA 2QUKA 5AHRA 4V1CB 4NK5A 1JIVA 3NBAA 2RKOA 1I01A 1LDYA 4PO1A 4YI3A 5AOCA 1GHTA 1L4BA 4I7EA 4AZWA 1IRIA 2O52A 4JYMA 5HP4A 3HZZA 5CFOA 1E9BA 4LSWA 4IILA 3VTFA 3SYKA 1DO0A 4MITA 3A26A 3KV3O 2ZFUA 1E7RA 1OWOA 5E9WA 4N39A 4JI6B 2VTVA 3TNYA 2PTHA 1W5SA 2QN6A 4N0DA 1F2UB 2V5UA 3B9RA 3DEKA 4D26A 2OB1A 4NBVA 1K8RA 3WJAA 4WLUA 1PLLA 3LL4A 4AJKA 2ZJ8A 3GJ8A 3T38A 2H7YA 3KVRA 1I2CA 1T0UA 2R1VB 2O1XA 2ZP1A 4OOEA 1RHRA 3VZSA 3INRA 2AC7A 2QZZA 1ISMA 1ZZGA 2HPVA 2YIJA 3WMWA 1TL7C 4MR7B 5BVGB 3SX2A 3CT4A 3WLSA 4TL9A 4WBNF 2Q9AA 2AGVA 1XPRA 3INTA 2PGIA 4BMVA 2P9TA 4WZ6A 5I47A 2GN0A 2HHJA 2Y0EA 3ZJUA 1P0CA 2EDAA 1T0BA 3OH8A 5LL6P 1ODCA 1XHFA 2WVHA 1IIBA 1TXGA 1VKZA 3HBLA 1CRQA 1P6UA 4YAFA 1KDPA 3FPLA 3U1TA 4AWAA 3KSAC 1W85A 3OPYI 3N2GA 2GI4A 1VHDA 2W2KB 3N2ZB 3NC1C 4X1YB 2VDNB 2HK9A 4H2DA 2VJAA 5K0NA 3NHSA 4QOGA 4XYLA 3MINA 2ID4A 3B9QA 2FN7A 1NF2A 3EPRA 1E2QA 2CVHA 4PW0A 1UINA 3I9LA 4WGFA 1YO6A 5IDYA 2GILA 2CMFA 3TFQA 1Y1RA 3TGWA 1K63A 3OZXA 3VKWA 2JG3A 5JBIA 2FFJA 4LY0A 1TUBA 2X8LA 1NLMA 4L2IB 1L6IA 3X1KA 4CM4B 5AW8A 2MTBA 5G02A 5IK2D 5E6SA 1SHKA 1YQEA 3AUXA 3ESXA 1QF7A 3L7NA 1Z4LA 3BD8A 3Q11A 4XJTA 4P98A 5LU9A 1R3DA 2IBSA 1MOZA 4MV9A 4RESA 2RHJA 2WQ7A 1RW4A 2HQSA 4WBNB 1QIHA 4FDLA 1D5WA 1KEVA 4CIAA 3HBAA 3R7DA 2OC4A 4MQMA 4D8UA 3C97A 1W0CA 2KB0A 1X1AA 4KO4S 3VSCA 5HKAA 2WTBA 5EFZA 1CRWG 2E7ZA 1UKEA 1IU9A 2OT3B 3A1VA 1WM1A 2E5FA 3GF4A 2PFGA 3HFRA 3LOPA 3PJGA 2ZRDA 4PF1A 4QECA 3DPIA 3NETA 1T3HA 1U31A 1DFGA 1C9YA 2BRUC 3NONA 5B7NA 1J1UA 1F60A 4YCNA 3MELA 4BQOA 1JHDA 1NATA 2FQXA 3GELA 2P40A 1UAAA 2CHFA 1Y9EA 5ELLA 5CEJA 7ABPA 5IVHA 3W5SA 3ST7A 5DN6D 1PT6A 1QGZA 4ZMRA 3ZOKA 5B3LA 4BN0A 5I7EA 4EPRA 4TKMA 2H0RA 1BAPA 3OC6A 4NYMQ 2JLWA 4OG2A 2ACKA 1M0EA 3ZXUB 5BYKA 1C3JA 1HFJA 4U7DA 4X61A 2N1MA 2Z3ZA 1NU6A 3LXUX 1HPLA 1RMQA 1T34A 4U7HA 1UBGA 2PLRA 2QYSA 4PC3A 4H1WA 1AMOA 4EB6B 2ZWMA 1GNSA 1F0KA 2YZ2A 1M54A 1Z5WA 1Y8QA 3QK7A 1HRDA 1REQA 1ZD5A 3U4IA 2GXUA 1PEDA 4MVWA 3T12A 4EA9A 4PAMA 4JLWA 3CCFA 3GAMA 4F4JA 1FP1D 1Z5PA 2ZJ1A 1W48A 2IU4A 5LU8A 2RH8A 3HU1A 4JQZA 4FOPA 1W9HA 2BKEA 3R6LA 4INZA 1AKWA 3HYLA 5EKXA 4ETNA 1U5CA 3C7DB 5IN4A 4DB2A 1SD5A 4TS1A 1IULA 2X6RA 3H1EA 1A1VA 2JGDA 4PONA 5FYQA 1EWTA 4QOJA 2JIZA 3VC1A 3FETA 1HE5A 2R7AA 3KNZA 4LJRA 3BSWA 4AJLA 2FSSA 2BDTA 2VTKA 3DBVO 3FM9A 4GR5A 1AZWA 4BFWA 3A9RA 1RTTA 2WHXA 5JVDF 2AH5A 3W8RA 3VYSB 3HDHA 3LBHA 4B3IA 1LV8A 3A2NA 3AIOA 3QE9Y 2BEKA 2WTXA 3GVXA 1DTSA 3C2QA 5F64A 2C2WA 4GBGA 4XGQA 3EFEA 2R4QA 1RLOA 1F1JA 4HDMA 1WZUA 3C6MA 4K5QA 4PX2A 3K6JA 4MS4A 5AK6A 4D80A 1TM7E 3DEFA 4HB3A 1TQ2A 1J23A 1XRJA 2OV8A 3ZWXA 5AQ1A 1N3LA 2FG6C 3EIFA 2Q7OE 4DCCA 5K4GA 2YXBA 3T15A 3I9MA 4RC9A 3IEPA 2B7BA 1A9YA 5F7OA 2NO7A 1G5HA 2R4TA 1DFHA 1XLVA 3C48A 3ZW8A 4D4HA 1KKUA 5BSGA 3L4KA 5DLYA 1U7PA 1UC8A 1JALA 1P0PA 2ERCA 1ZFNA 1JJAA 1WUKS 2ODTX 2IEYA 3LAWA 3V6MA 1V8ZA 4HGPA 5DM0A 1EJ2A 3RKRA 1RXSA 1AGRA 1G20E 1VLVA 1CZNA 2B82A 5HJ2A 4R8MA 1JA9A 3MJSA 4CTKA 2EP8A 4F3KA 4MQ6A 3MS4A 2NAPA 3P1JA 5C37A 3JYOA 4URFA 3TL3A 3SOZA 2PX2A 5K7SA 2Z9BA 2FJPA 1NBME 1E7MA 1IHYA 3WLQA 3TUIC 5KU1A 5K0GA 5LA6F 4AKEA 5A6SA 1YC5A 1KERA 4PZPA 4RMNA 1XDZA 1ONPA 2PV7A 4X6XA 5C4IA 3O9ZA 5TQ0B 2IYPA 1RJEA 2EL9A 1PLKA 2O0HA 3A6HA 5JVDB 4HVTA 4GVXA 3NBXX 1RJ9A 4U2BA 5HMMA 3PRYA 2JI9A 3PFIA 4B0PA 5LMNB 2ZVPX 3H9UA 2XZDA 4H1VA 1NJ2A 3B38A 5E95A 1OX4A 3D0KA 3MINB 4ZVMA 3B9BA 3I1FA 3FUWA 3HVKA 3WE7A 4RPLA 3GLGB 1KH1A 1RYFA 3GOQA 1JB9A 3NR2A 4NU0A 4IAOA 3T9EA 2CMHA 3ZY6A 3O2JA 4DBLE 1D5CA 1Z83A 2IYVA 2W48A 1QH1A 3OPNA 2WP8J 4MLCA 3PEUA 3U3XA 3WRVA 4JLJA 4K26A 5L3SA 2CV2A 3BDIA 4L57A 1T5IA 3NOOA 1TCUA 3URKA 3CUVA 3DC7A 4AKGA 2D00A 1HYBA 3OQPA 3FTFA 2EJVA 3LXXA 4IEEA 4LBYA 4Y6PA 1F12A 5EC8A 1YHYA 2GEDA 1COWD 3HC7A 4IJKA 2FFRA 4QX6A 2R65A 5BV8A 1X7XB 2PSSA 2XI4A 3PVZA 4YJ3F 2MSCB 3ODPA 3MTAA 5LA6B 3U9TA 4CMKA 4BKMA 4WK2B 4KRGA 2DQYA 4GO1A 3UC9A 4JBIA 3X2FA 1U1IA 1USGA 1C2TA 1E99A 3KQMA 3L4BC 3GR6A 5JJKA 3D2LA 3AVTA 2C5GA 4IIDA 3RU9A 5DYGA 1WY5A 1TYBE 2Q8NA 4WXEA 4ZAGA 4CDNA 1O4WA 1X38A 3HCCA 5A7FA 2IPOA 1JAXA 2C4WA 2WAMA 1NXSA 2PZJA 1XNRB 1KHTA 5C80A 1E62A 2MSLA 2QUJA 3KSBC 2WK1A 4FS3A 1P5HA 1I0IA 2CLFB 2FSFA 2ZAMA 3AFIA 4MO9A 5C18A 4PHTA 5JJ5A 2OHFA 4GAEA 1EK2A 4UPVA 2O2XA 1QKKA 2QRMA 3OJXA 4PIPA 3UHJA 1QU2A 2OESA 1SUBA 2PGAA 3QFRA 4WZBE 2WICA 2OV4A 3M6XA 3GLIE 1IVSA 4JXZA 1TE2A 4DLNA 3RFVA 2Y1WA 3UJ8A 2CHUA 4S35A 3MIZA 5H7XA 4ZOEA 5CG1A 2OZLA 3M4YA 3PDCA 4QBFA 4F2GA 3GRAA 5IZCC 3OLCX 5J4HA 2FZKA 2LKCA 2X3FA 4Z7OB 3EARA 2PH7A 2D74A 1VP9A 2IUFA 2QA5A 3GROA 4PVCA 4N6OA 1I7DA 1N25A 3U3JA 1KVUA 1OZHA 1T0JB 2JAUA 2JJ8A 2VDOB 5SYAA 1HE2A 2E4AA 2HK6A 3H5TA 4YJ3B 3E3AA 2FVXA 3E6AA 3C3PA 4ZVNA 4UTRA 5IJ0A 1BXZA 1XVTA 2RC5A 1BVHA 4OV6B 1HNXB 1DWUA 1R0XA 1QO9A 4MWDA 2AOXA 4B74A 3W5CA 3D4PA 2O0MA 4N0PA 4ASUD 4ZQBA 1T5TA 4WLVA 5E7QA 3E27A 1U8UA 5DTMA 3OBBA 3C3DA 2P7HA 2Q99A 3ZN2A 2Y27A 4C1NA 3N58A 3KVVA 1XD9A 2Y67A 3H2BA 1IY9A 4NV0A 2OA0A 2JFWA 5JS2A 4I8XA 1Y42X 1EXVA 1QCCA 1YR1A 2FSHA 3BB1A 1ESDA 1G7RA 3HVUA 5DLPA 1UZNA 2PUEA 3OEWA 4FFBB 4WCFB 1E2LA 3A6ZA 3R8XA 3VU0A 3VI3B 1Y7PA 4HLNA 4WA7A 3IAM6 3H5OA 4UHCA 3PXEA 5DWDA 1UKCA 4V3BA 3EWIA 1XZBA 2C94A 3U3RA 5K8JB 4OXKA 3OPQA 4OHXA 2GZ3A 5FHQA 5CFQA 3GB9A 5I7OA 1KFBB 4Q4LA 5T4FA 3A6EA 4AKHA 3BL8A 4LYDA 2DPYA 4OP2A 3PJRA 3IGFA 2WMDA 1ZGBA 3FYHA 4KQCA 4NNPA 5B6PA 1CUUA 2NPFA 4Q03A 2RGNA 3V4OA 5JI3E 4Z3OA 4D25A 5LP6F 1OVGA 5HQJA 1GADO 1TZMA 3WYGA 1CB0A 4LSZA 4QUJA 2I2AA 1W4LA 4N54A 3A1DA 4RA9A 1T5SA 4TS3A 3TDNA 3ZWYA 1HDRA 5DLQC 2C97A 4ZCSA 4HWPA 1H8EA 2AJ8A 1MB4A 1YIAA 2YBDA 4MUXA 4M9ZA 4RYLA 4TT3D 1DFIA 5DGTA 5LQJA 4KQWA 3KBBA 5JBNA 4D8VA 3ZWPA 3MT9A 4FOSA 1CE8A 4EMTA 4JJEA 4BEBA 1E3DA 1KIFA 1IAVA 1V7PC 4LHXA 1F7VA 2HGZA 3EQ9A 4ZVVA 2IYSA 1JAHA 1YQWA 2ZYIA 3GN1A 3QEJA 1U5AA 3CRVA 1YR7A 2DBVO 4RV4A 1I6LA 2A9RA 3AJAA 5DP2A 4AF6A 2VZEA 4DQVA 1PGOA 1Y3FE 2K2WA 1Z3IX 4YYEA 3M5CA 1QV7A 3TJMA 1GGFA 5JCPA 5JZ9A 1U8TA 1T4GA 3WA6A 4D4MA 3I9FA 1R8JA 3B2NA 5BPFA 3KELA 3FKSD 4B6FA 2VAPA 1Z0IA 5E2BA 4F9FA 1OI3A 3CGGA 3P26A 2Y2VA 5KYVA 5CM2Z 1LRLA 4QFDA 3QU5A 4DIMA 5KC9A 5LSAA 3UXEA 4PPNA 2K87A 5JEDA 5GZ3A 1G6HA 2VRCD 4E03A 3WB1A 1SURA 4CMAA 1XCMA 2VLIA 1R9MA 3IHLA 1V2GA 2DWCA 1CRZA 4FDTA 3C5CA 2WWVD 4M7PA 5TR9A 3BMCA 2M1ZA 3WGQA 5LP6B 2VHCA 4BXOB 1NR5A 5EA2A 5JFGA 2L0XA 4B2YA 1VPLA 2GN6A 1WLSA 1JDBB 3GJ5A 3LRPA 1U1EA 1B2LA 1N2OA 4MVJM 4PZLA 2D5IA 4JP1A 4DF3A 2HK7A 2G07A 4PRYA 1GY8A 1Q84A 1S2MA 1CNFA 4R3WA 4WIAA 5I51A 2ZYSA 3HQ4O 4I6EA 1E5TA 2EKLA 1ORWA 2IF2A 1DRVA 2WAYA 2WYOA 5BW4A 2B1IA 2R2GA 4GE0A 2PTGA 4E6PA 2AKAB 1E3TA 5A3RA 3OCCA 5HOQA 3EXFB 1CF2O 3DVAA 4URYR 3ZZTA 1SBNE 4J0QA 4B6SA 2OV1A 4W1RA 1DKQA 5B1HA 1ZR2A 2H17A 2FG7C 3UICA 3U4MA 2I1VB 1XD8A 1JB1A 4IZ6A 3ZTTA 4IGFA 4GRIA 4N5MA 4E94A 5IAOA 4N5NA 1JR3A 4RQAA 4GI3A 1ZI8A 4W1PA 4FBMA 1RYZA 3FN4A 3VSDA 1H8HA 2PUVA 3T3PB 3OD1A 3UWSA 4UBJA 4AJ9A 2BGMA 2J4FA 1XBTA 2OZLB 2DYKA 4DWWA 4TQUS 3KZNA 3ZNNA 2VWHA 1YAHA 4ILKA 4NVRA 4MW6A 2IZ0A 1KVTA 3WL4A 1CY4A 2G6TA 4NEHB 2JGEA 1UBRS 4PAWA 1WF3A 4EPYA 1B73A 4WXRA 4JJ6A 3HK2A 3KTFA 2QDKA 1Z6TA 2QYOA 5J2UA 3FCXA 3W0LB 3IPYA 4E5MA 4HWTA 4KXMA 1M76A 1VCOA 1NVVR 1Z4PX 2OMEA 3AFNA 3NYRA 4LNHA 5D8DA 1HNNA 2H1FA 5IJ0B 1CUSA 4R16A 1KTVA 1T5BA 8LDHA 1D6JA 4QE3A 3T95A 3N28A 1OZFA 3VISA 3O4FA 3GRFA 1EE2A 4Q7LA 5DNWA 4XOIA 4NL4H 1ZM4A 3FWKA 3SZGA 3ZY2A 1KZ6A 2V6GA 4TTPA 4UDXX 3O0TA 1ZM7A 4MP6A 1MR3F 4KV9A 3ROPA 4CNBA 2G77B 4NYJR 1XL1A 2JGFA 4RKWA 3U7QA 4DYVA 4FSHA 4AXBA 3A6KA 3L1IA 5CDUA 2JAPA 4TTAA 4G5OA 4QYXA 3G88A 3I2IA 1L5RA 2ORYA 2X7JA 5L3RA 1N2BA 3IIJA 2H5IA 3CWZA 4XRRA 1OFGA 3FSRA 2J5KA 3D7RA 3R0JA 1V43A 3CF6R 5HILA 3WDKA 3PL5A 3IVCA 1L1QA 5KTNA 1VG0B 3IURA 4IJ5A 3MBKA 1MJGM 1E92A 3ADBA 4E5DA 3THXB 2PS1A 3ZDFA 3RSFA 4PO3X 1GUAA 1LF5A 2G5GX 4HQNA 3JWGA 5EXDA 3M34A 2AMJA 5DN9A 3G0BA 1THTA 3SE7A 4ARAA 3SMQA 2IUYA 5DBFA 4O5AA 5KTKA 4ZAYA 1I3NA 3B70A 1ENYA 3PUIA 1GQFA 1QOZA 4V39A 2NUTB 1TT5A 3I9OA 5AM0A 4WKOA 4ZMSA 4YUZA 3AP1A 5A2GA 1VMEA 2DHQA 4F2WA 4KIJA 4X8MA 3EBLA 3IV6A 4C03A 1U3WA 2C7GA 1NBAA 1N6HA 2FWRA 2MYNA 3GVCA 1A9ZA 3NDRA 3C98A 3UAOA 3WQQA 5KTOA 3LWNA 1O9HA 5GJCA 1TDJA 4RVNA 2GYWA 2XQVA 1E32A 1YRHA 2POCA 2QORA 5TT1A 1M75A 1QQBA 4LF6B 1KO7A 2H2GA 3GWZA 3LG2A 4J03A 1FJHA 4XLZA 2HAEA 1KMQA 5DZSA 3ABRB 4BYMA 2VAVA 4FMCF 4NZ9A 5D85A 1DCFA 2BFCA 4KR2A 3V4PB 3SS8A 2WJWA 3SJ7A 4TZKA 3QW4B 1KTIA 3UWDA 4X54A 3DLIA 2X0EA 1V35A 4BLUA 3KKQA 3C8UA 5B4UA 2JEOA 3WGHA 1AGNA 5BYJA 2BSQA 1T2EA 3FX2A 3AVYA 4WXPA 4DCSA 3VU9A 4NBLA 3TM5A 4DDUA 3LE8A 1D8AA 1NN5A 4OQNA 4X62B 1Q3TA 1YR9A 3NH6A 2C07A 1TYAE 3EWNA 2QP4A 3JSXA 4JJ4A 5U9CA 1L7MA 5K2OA 3KE9A 4NOKA 1QWOA 3NH9A 4PZEA 1SBIA 2QENA 1AHNA 2ZKIA 4ICIA 2VP3A 1JHQA 1ZSYA 1XTZA 3O4IA 1UBFA 5B37A 3S55A 1RJGA 2YV4A 4BMDA 1V1RA 4ND4A 3KXDA 3MWKA 4YCJA 4DLSA 3D6UA 2JCVA 1TJ3A 4LRXA 4J8PA 3RDPA 5AVYA 2CL5A 3MUOA 1V5WA 2GVDC 4RKYA 4UJ3A 1FMFA 2PO7A 3D8RA 1YB2A 2MSNA 4MQEB 3PGA1 2H1OA 3CXUA 3KU4A 2BHLA 2OBFA 1PVDA 2VYQA 3ESCA 1VYVA 3SG0A 2DQ4A 3DVAB 2ZYGA 4HQLA 2QRZA 1VMAA 2UKDA 1XZQA 4FMCB 4WLFA 3QNUA 2H2AA 1J2RA 3R9WA 4JKYA 1S1MA 3ASVA 2AN5A 4Q19A 5FTWA 1GP2A 3SE0A 3R3XA 4FFDA 1Z16A 1L4NA 1GRVA 1PWYE 3IBSA 4AW9A 1HEYA 1Q6ZA 1BRMA 2QTAA 1AM4D 1FRQA 2OB2A 3W4KA 1I5RA 4WOCA 5T4EA 2RAFA 2YOFA 2AR7A 4L0CA 1HOXA 3I72A 3UCFA 4WLNA 4BLQA 1P81A 4HXFB 4BQFA 4YMVA 4MV1A 3LYUA 3OUTA 1SG0A 2D4AA 4QO7A 1D03A 1YZUA 2FX2A 3IEIA 4I66A 4UZSA 3UK1A 1CETA 4L4RA 1R4AA 2RHRA 3WK8A 4KO1S 4B8YA 4DM4A 3MOIA 3QMWA 3TKAA 2ZWOA 2V59A 3ZGXA 4TPKA 3VGJA 1FZQA 4EL5A 5F5LA 3F67A 4BO5A 1YVEI 4RULA 4KTVE 3L1VA 3OFJA 5BT8A 1UMBB 3Q7TA 2BRUA 3Q7SA 4I50F 4A6XA 3PXDA 3HBMA 4X63A 3PD7A 2ZDHA 4FWBA 5AYVA 1GPMA 4NCXA 1KYVA 3E4CA 3G59A 4JKIA 3DTVD 1OH6A 4OF4A 4QATA 3UOGA 3V8NA 3A4VA 3G5AA 4O2RA 4HB4A 3TXXA 2X8AA 3KJEA 1I33A 2G71A 5FL3A 4PC1A 2OBYA 1UMCA 4LCBA 2GPNA 1BDBA 1TM1E 1TOAA 2ZJAA 4FZVA 4RGVA 3T9FA 4ALJA 3G5LA 5BQXA 1VLZA 1WQ4A 2RI1A 4WN9A 5ETJA 4EHDA 1EUCA 5CDSA 2HCTA 4YCBA 3PDUA 3RWBA 1LFAA 4ACBA 3E61A 3NI2A 1O8BA 4OXQA 3PGLA 1TCAA 3P0HA 4RMGA 2EJUA 1GZ7A 3H18A 4V1CI 1P3DA 1LPSA 2QAGB 3UOWA 3FVWA 5L6LB 1G8KA 1NKVA 5TQ2A 2JFGA 2F43B 2FRXA 3ICVA 4XIYA 1WKVA 2HA3A 1H2WA 3L7JA 2YN2A 3B3QA 1PQWA 1HUQA 1WD7A 1TZ2A 1M8FA 2WHPB 2PLFA 3OY7A 4RMJA 1EPUA 4OQ4A 4TRRA 3OOEA 3WWCA 1GPDG 3HCDA 4H77A 1CFJA 3PYMA 3PRHA 2HPAA 4DMLA 5JAHA 2AKEA 1EK1A 2WM8A 4I50B 4M38A 1PK8A 5FO1A 1C1XA 3GLTA 1WZIA 3L4EA 4GVLA 3TEJA 1GPWB 5LYJA 4GEKA 2XB4A 2HWXA 2WJJA 4B5KA 1X1EA 4TLDA 3UENA 3RUPA 3O8CA 3MYYA 1M2HA 2Y1XA 3TX6A 1O6GA 4JDPA 3CB2A 4F2PA 1L4LA 1HYQA 5JG7A 1QYVA 1VECA 3PHJA 4RKQA 5BN4B 1P7CA 3PPWA 3PQ8A 5J5AA 4ZCRA 3RLFA 4Z6KA 5GADl 2AOVA 1EKXA 2L17A 4HAIA 5B58T 4CCYA 3C6ZA 5IARA 2VHXA 2VHJA 4B48A 1SRRA 4G0XA 3E48A 3DO6A 3BB4A 1J0BA 2NUAA 3F5MA 1DADA 1FC0A 3G5TA 1E6KA 2WUEA 4KP7A 5CX4A 4WL0A 3ONEA 5JSYA 1R6XA 1ICIA 3ANYB 3WKBA 3TW0A 1OC4A 2PWZA 1GCIA 1UOOA 3FCEA 5EUQB 4UHHA 3U4CA 3VU9B 4JK3A 3X1JA 6ADHA 3F8SA 4YP9A 4LJAA 4QEDA 2GN4A 1NTRA 4K6KA 5L8VA 3C74A 4PSUA 4NNJA 3KLMX 2QN9A 4C29A 2AEMA 3GP3A 4CR6A 4L8LA 3TTXA 1YTUA 3QLEA 2IJGX 4GR4A 4EQ6A 1CIJA 1XU4A 2HT6A 3CO5A 2XMBA 2O2HA 2DUWA 4WH0A 4EW1A 3A06A 2QD2A 3N8KA 4IPTA 1YE5A 5DXJA 2CNWA 1Z73A 4UAJA 3GZ4A 3M1IA 3PRKE 4C21A 3D8BA 3WWEA 4PZYA 1SC9A 4QTYA 2BBOA 2BFPA 2BUAA 1EFTA 5TF4A 3F6YA 2NTYC 2A6PA 3UAZA 2XVXA 4D99A 4E08A 3ETDA 3USZA 5EEGA 2AQ8A 3ZV6A 1PW7A 5LQNA 1QHGA 4ESVA 2EWVA 5K0JA 2ZT6A 1DRJA 4MQ5A 4M1ZA 3OLXA 2YXLA 2C9YA 3GP5A 1N1DA 6LDHA 4M89A 2R7NA 4AN1A 3DLBA 4L8YA 4BKOA 2A0WA 3RUDA 2BDUA 1DC5A 1P31A 4KREA 2FX3A 3BK1A 4LG1A 5CMLA 3L18A 4D8XA 5BWOA 3WIOA 2DKOA 2VPQA 4JJGA 3MGGA 4F86A 2PJZA 4C04A 1EP3B 1HMPA 4ZEXA 4R41A 5KVQA 4Z5XA 2WNHA 3NV9A 2C8KA 5REQA 2E4XA 2FEOA 4DC0A 1UOEA 2VJKA 5MN5A 2B69A 4KX5A 3VO9A 1U5BB 3WSWA 4QGSA 1GU1A 2JLRA 3N0WA 3L4BA 3QI2A 1XHEA 2AC4A 1VBFA 3D6NB 4PX5A 3I4LA 4HGOA 4YJKA 5B2EA 3PE3A 3BMQB 1ZIDA 1ZC3A 3VPCA 2UZIR 2RAVA 4G8JA 4XKJA 3MWYW 4G5GA 1JL3A 4JA0A 3PFWO 4XEUA 4UBIA 4G0UA 3PK0A 4OHYA 3HA2A 4GEGA 1QGDA 3I9JA 2YDXA 2XRYA 1BHO1 5FTJA 4DBLC 1Y4AE 4JUDX 1UBLS 3AERA 5CURA 3C6YA 3SY8A 4A8PA 3C3XA 4CLOA 1WZNA 1N0IA 2P0EA 4U39A 2WWYA 3AEQB 3NBQA 1KR5A 2OQRA 4DXAA 1HK7A 1HQYE 1ZMOA 2W6QA 3CKYA 4N9QA 1QCZA 1UXOA 3I6YA 3NTQA 3IFSA 5IZCA 5DI9A 1MA0A 4B4OA 2FMUA 2FP3A 2RGGA 2FLKA 1RZVA 3OM9A 2H7VA 1HFKA 1EBBA 4INPA 4LEIA 5L7YA 3B5IA 1ZRSA 3ETHA 4XAQA 2YHUA 3G7NA 2VP5A 1H3EA 1E2BA 5KYGA 3VR4D 3AILA 3QPCA 1I7PA 1SBTA 2HRCA 2VOEA 1MC8A 2H2WA 3DF9A 1GFWA 5HUQA 4JBGA 4P4TA 4ZEWA 4BIIA 3UJCA 5SZIA 1T6NA 2VT7A 4YC7A 3C4JA 1KYZA 1PO7A 2DKNA 1PZHA 3IV7A 4CLDA 4C7VA 2EX0A 1RXUA 2BDEA 4XQGA 1V5IA 2TSYB 4GZ5A 4DSNA 2PUFA 5A4DA 3B6MA 3CZ9A 2QW0X 2HYIC 2C7PA 1N33B 4JL5A 2XCTB 3D3QA 3AVUA 3C3KA 3I9V1 3PNBA 3GRUA 1EVKA 3GDOA 4Y8VA 3UFBA 1ADBA 4BV3A 4U5QA 4NS4A 3GD5A 1HDOA 3MK31 1PFKA 1SXJE 3VVCA 5T7BA 1R3UA 2H92A 2IYNA 4MKIA 4DZTA 2Q0HA 4D9CA 4ES6A 1KL7A 1YB7A 1QLJA 2YXDA 2ZUVA 3VKUA 4BNKA 3UMGA 3G8AA 2VXOA 5JS1A 2HA4A 3ZJ4A 3TRDA 1XD2B 2JK0A 4RFSB 1PJSA 1ZG3A 2PUAA 2ZBVA 5CDFE 3GLRA 3PWTA 4TKVA 4YYZA 4NPCA 1KMCA 1CUVA 1Z5ZA 3RRYA 3AL2A 3A1UA 4CHGA 3RUCA 1EA5A 1TQ4A 1JHVA 1Z6YA 3GN2A 5DF1A 1NQVA 1GZ5A 2IYUA 4EO4A 2Q3CA 4FKBA 1SHTX 1CU1A 1LPBB 1Z0JA 2NO1A 5TMBA 3VHXB 2H4JA 3T7EA 5LQCA 5JNVA 3A7DA 1EFPB 3IPCA 4H18A 5EQJB 2GBCA 2HJSA 2VT3A 3KYBA 3ND5A 4XTRA 4EQ6B 1GQYA 2H1SA 3CPEA 4ED9A 4OATA 5AXCA 1NXXA 4E33A 4OK3A 1UP4A 2P4HX 3DC2A 2KM1A 4TL6A 1ISFA 2YWBA 4BMXA 5DB4A 4IFTA 2M2IA 4DMKA 4JP2A 4KHPB 4XGKA 2ONKA 3KDAA 2EZ8A 1ZQ1A 1U0SY 3QBVA 1ZXXA 4GPTA 4TXNA 5K3OA 4RTPA 1K2VN 1FU4A 1JDUA 1WUYA 1ZGHA 3ILHA 3O3MB 2BM1A 3DP9A 3LCJA 1TM5E 5H9VA 1COWA 3KX2A 1IEQA 3GFTA 1VG9B 3RT1A 2X1MA 5A4IS 1GRQA 1ZD8A 4FFOA 3QE3A 5K4AA 1MX9A 4I3FA 1K1EA 3UMVA 2F8SA 1OXBB 2E21A 1XPUA 2IPAB 1ZXLA 2QRLA 3BL6A 4LJLA 3KPVA 2QD4A 3ITDA 4NDZA 4NR0A 4HNQA 4X20A 2PD3A 3QWBA 4OOFA 2DT8A 5C8YA 3COVA 4OFBA 2X14A 1WULS 3D6JA 3GRKA 1K5DA 5GZ1A 1DGQA 2OBMA 1NN0A 1C3XA 4F93B 2GM5A 2WV9A 4KXQA 1VPDA 1LDMA 1OAKA 1XN1A 2HFKA 3T4UA 4BVLA 4XQCA 2BAGA 4P3OA 4LVCA 3FNQA 1EE1A 2EVWX 5LZ8A 5HHTA 3H9BA 2EGUA 3HBJA 3FWZA 4XLTA 2C5SA 5DVZA 2FU5C 5JRDS 1Q0TA 1YL6A 1X7YA 2EFHB 4GNKA 3M70A 5K3BA 1N9GA 3IA7A 1YB6A 3W3AH 1JBKA 1RWWA 1NNLA 4FNMA 4F56A 2Q5JA 1SBQA 1RAFA 3D3KA 1QB8A 3HCRA 4HS4A 3ZV5A 2NTEA 4FS8A 3C0KA 5C53B 2IX9A 2P3QA 2RGAA 2V4ZA 4QREA 1V11A 4ARSA 5CEFA 1Z63A 2PD6A 1EAYA 1O7JA 1L7NA 2PFKA 4UD6A 4IHAA 2D5BA 2PCLA 4MGYR 4Q12A 1OT5A 1Z0ZA 1E1CA 2GOYA 3N0VA 2GFIA 5IXSA 5LQDA 3GNLA 4N8EA 1HYEA 3OSUA 4UHDA 3UT5A 2N75A 4E14A 2WSMA 2X9QA 3O03A 1IQUA 1JEAA 5HZMA 4EAAA 4A10A 3AERB 3G8DA 1VKNA 4CL2A 1N9ZA 2JIBA 3LC2O 5CB4F 2B5WA 2KSQA 1YA8A 4IIBA 4ZDIA 3IC5A 3GHYA 2WTEA 3WWYA 2C8VA 2OY0A 1GG2A 1FP4A 2HA5A 2ZBQA 4PSAA 1VBNA 3KLPX 4ENWA 1NNSA 9ABPA 5IAAA 1GXSA 2QD1A 3E0XA 1RACA 4C4RA 1SUCA 2KW5A 4KFTA 4LRYA 1NBHA 2QMZA 1K7XB 1YNSA 3K0EA 1L5WA 1YRWA 1T8RA 4GOND 2WWHA 5FPTA 3CJTA 3L7LA 2ADFA 4XGNA 4RPGA 2MINB 3RLIA 4EKNB 4URXR 1PSWA 1R88A 2LGJA 4RDXA 2H2FA 4JUBA 3C70A 3N2LA 2F8LA 2HWUA 1GFZA 5KAMA 1MW9X 3AY3A 4PYKA 2A67A 2WTNA 2C3OA 5EHZA 2O8CB 4M54A 1B00A 1CY6A 1NQOA 4FMDF 1PK7A 4FDAA 4EKYA 1D2GA 4GDMA 4B45A 1M1YB 2G3YA 3LWDA 3JQAD 1KYYA 4WOPA 2J0SA 5HDBB 1OH7A 3RHTA 4OQLA 4HH0A 4MKGA 1O87A 1OLUA 2QVCA 3DE2X 3HB0A 3I01M 4MWCA 3MXOA 5IVIA 1YULA 5HUJA 1JWLA 3CF0A 4XM1A 3TDMA 1QP4A 4YR9A 4LZOA 3CJQA 1TC1A 1H1TA 2EJTA 2OYRA 2ZTSA 3R75A 3V4RA 2B92A 3H16A 3IMEA 3DAHA 4GQBA 3WNCA 3WKEA 4UNIA 4BGIA 1NKTA 1AA9A 1U7OA 3QH4A 3QUBA 4Z0HO 5I7HA 1C1DB 5CB4B 3E35A 2HBZA 4N5DA 4AX8A 2NZJA 2JEYA 4E5NA 3W9SA 4E2YA 4KHZA 1H4VB 4GPEA 2L19A 3FPFA 4BZQA 5HZHA 1ABBA 1MQAA 3VR6A 4RIGA 2HRDA 2H2HA 4TT3A 3LX4A 3PWZA 3REQB 4CTJA 3SQLA 1PS0A 1QIMA 5C46F 4Z9BA 3AP2A 3HJCA 2I6SA 1XQ1A 2L42A 3GGSA 3IQDB 2J9GA 4FW9A 2NV2B 4U2EA 3U3KA 4Q4HA 5F7XA 1BC5A 1GPKA 1EGVB 5HCUA 4U1RA 3KQLA 1QR2A 1I36A 4CEHA 2DCUA 1MV5A 1Y9AA 3OIGA 3NXKA 4FMDB 3RUFA 1YZYA 3P2IA 5INTA 3PXAA 2AN4A 3FKSA 4XB1A 4AS1A 2H65A 4Y67A 3FG9A 1IPEA 1L4UA 2HTEA 2F4VB 1CQJB 1G1MA 1UDWA 1EFVA 4ND7A 3AB7A 2REOA 2ECKA 3MUEA 4EQZA 3KQWA 4RTKA 4EUSA 4P34A 1IN6A 3BJIC 3CNNA 1E58A 1XKXA 3H2YA 3KHKA 4XJXA 2HWKA 3KO8A 5IKMA 4MHSA 2O7RA 3GBVA 7REQB 2GLTA 4WDQA 2V98A 1DXQA 3GPBA 5ITZA 3LRTA 3V7NA 1XU9A 1Z6ZA 3G1WA 4X7MA 2WTUA 3GAAA 4RABA 5HK9A 3AU8A 2AB0A 1Z4OA 5F1OA 4M9QA 4ETIA 4YV7A 1DOAA 4B71A 1G21A 1K66A 1N2CA 2ICAA 3MCAA 4AZ0A 4RLFA 3I42A 1S4MA 4CL0A 2VXBA 2AQKA 2QY6A 2WDZA 1OXXK 4OU4A 3CE6A 2I22A 3IDAA 2WI8A 4KW7A 2GS9A 3N1UA 1Z0UA 1AG9A 4NY1A 5TX7A 4D82A 1UEJA 2I6UA 3PQ6A 4RSMA 4CCSA 1ATIA 3VPXA 4U2KA 2O6LA 1C3OA 5K09A 3C6QA 4PLPA 3HRHA 1S2LA 1YS7A 2ECPA 4G9EA 4BO3A 4KIGA 4CEJA 1YONA 3QX3A 2CVPA 3D31A 2OD2A 2XAUA 2Y9PB 1WHTA 3BQ9A 3V1TC 2Q5IA 1A27A 1N6IA 4HGNA 2MYTA 3ANNA 4L9AA 4V38A 3FYDA 5FOXA 2H85A 5E7IA 5HDQA 4OI1A 2IS2A 3EZ9A 1V11B 1LTQA 2I29A 2NO9A 2DXIA 2FZ5A 2Q0SA 2B3DA 4AY2A 4OHBA 3T5AA 3JRWA 1V96A 4KQIA 3DV0A 3OQVA 3UMCA 1GSAA 1G8JA 1L7VC 1VM6A 3TUJC 3W9YA 6GPBA 2UUAB 3Q40A 1JKJA 2HQOA 2D1YA 4EGAA 5HGXA 2BEJA 2VG8A 3O6VA 1X39A 1UMDB 1QC5A 2CFCA 4RCVA 1W36D 1OYVA 4FJ2A 3E15A 4LX0A 3SF8B 4XPZA 3OQNA 4OLFA 2FE4A 4IOJA 2AK3A 4XIJA 2KS6A 4YRZA 1FP4B 1KAHA 2OFWA 3B9PA 4CKEA 1II9A 3ZHBA 2Q2VA 4EG8A 4ZI7A 3MRVA 1DJOA 1UQUA 5KVCA 4DYDA 3FCOA 2G8NA 4BU0A 1L7OA 3R6TA 2QSZA 4TSFA 5A5EA 1LK7A 5L51A 2HW8A 3OTHA 4CEHB 1E5XA 2NOAA 1UWLA 1PDWA 5AK4A 3VHQA 1E5QA 1NVGA 3A28A 3K1ZA 1WP4A 4PANA 5FI0B 3WV4A 2V5AA 4YDSA 1JNYA 3E9MA 1LSOA 2A5FA 4LGMA 1JGTA 2WT9A 4LE1A 5AI6A 4BNDB 4YRBA 3A1NA 4D1YA 4ALKA 1UPBA 5HKBA 5IJ9A 3T06B 3R8CA 3MJDA 1VDZA 3WLEA 1YZTA 3SSNA 3UM9A 5DM1A 1J99A 1T9CA 3OZEA 4FT4A 5AJYA 4K1XA 4BMOB 4XM0A 1M2KA 4UHEA 4XSGA 2GYUA 3T1YB 2P6RA 3ZBUA 4DR2B 1XXHE 4CWAA 5KX5A 4CW7A 1ACMA 1UPTA 1XNQB 2I2XB 2IY8A 2RHCA 3EY4A 1EWKA 1L5VA 3QJYA 1E6MA 1O9BA 2F17A 4L72A 3OEED 1W5FA 1L7BA 5CNMA 1JEEA 4BC1A 5A62A 1OB5A 4GI7A 2RK4A 5TGTA 1DBWA 2VCHA 1WV1A 2H1RA 5C8DA 3D7LA 4F3NA 1QE0A 2C1ZA 1NMQA 3E05A 2NUPA 1NULA 1M7GA 5EP1A 1WUIS 4IJUA 1CTQA 4M7RA 4MLDA 5JD3A 1Q21A 1EM6A 1CLUA 3A4IA 3R40A 4UEKA 4WFKA 1HTTA 3HNRA 4EZBA 4TV9F 2VK2A 1DIBA 1FFDA 2ORED 1Z82A 3DQPA 4D9HA 3RRXA 2AXQA 4M7OA 4I4TA 1J6UA 1SQSA 5TVKA 3ZIAD 4QG3A 3GGGA 3H4IA 3ZE1B 3ONNA 5ALFA 1NXWA 3FSJX 4IHQA 4FYXA 3W1VA 2NACA 4HC4A 1U9JA 3N2EA 4HAXA 3V2UA 1QZUA 4ZK2A 1JDPA 1M2VA 1UPXA 3B1JA 4K3UA 4EUNA 4FX2A 4KRXA 1B6GA 1NX6A 2Q1WA 4J3FA 1BYIA 2O48X 2WU3A 2X5OA 2Y71A 3DTTA 1PYDA 3LL7A 3PNPA 4B80A 4NCAA 1K0FA 2ZRMA 2YWGA 2I8CA 2QBYA 1UZAA 3L6CA 2YYZA 1AGXA 3MC1A 3PI6A 1E3IA 4CFZA 4J91A 3LFUA 1IBSA 4JU8A 4FBGA 4M37A 2Z1NA 2FUG6 2RJNA 3FZYA 3PITA 3ROFA 4LZJA 2OBBA 3TTSA 3LLVA 1ZQ9A 4OJQA 1SKUA 3O8QA 4RLSA 1QAMA 2R8XA 5MGNA 2OZPA 1M34B 1W47A 2ZJYA 3B51X 4JOQA 4OHPA 3L0OA 4ZI7F 1P7PA 4W5HA 3WK9A 1HZZC 3RASA