3GDFA

Crystal structure of the nadp-dependent mannitol dehydrogenase from cladosporium herbarum.
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
267
structure length
267
Chain Sequence
b'MPGQQATKHESLLDQLSLKGKVVVVTGASGPKGMGIEAARGCAEMGAAVAITYASRAQGAEENVKELEKTYGIKAKAYKCQVDSYESCEKLVKDVVADFGQIDAFIANAGATADSGILDGSVEAWNHVVQVDLNGTFHCAKAVGHHFKERGTGSLVITASMSGHIANFPQEQTSYNVAKAGCIHMARSLANEWRDFARVNSISPGYIDTGLSDFVPKETQQLWHSMIPMGRDGLAKELKGAYVYFASDASTYTTGADLLIDGGYTTR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable NADP-dependent mannitol dehydrogenase
publication title Crystal structure of the NADP-dependent mannitol dehydrogenase from Cladosporium herbarum: Implications for oligomerisation and catalysis.
pubmed doi rcsb
source organism Cladosporium herbarum
molecule tags Oxidoreductase
total genus 92
structure length 267
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.138: Mannitol 2-dehydrogenase (NADP(+)).
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gdfA00
3OJLA 4ZJUA 1ISIA 1KEPA 5A9RA 1C0LA 4IZIA 1YOVA 2X6TA 5CG1A 3ANLA 5IZCC 4JQCA 1ONNA 1G1AA 1RJWA 4ND5A 1T24A 2WE8A 4CM8B 1ARZA 4H7PA 4RQTA 3GNTA 4DL9A 2P5YA 3NX4A 2GRAA 1GD1O 4LK3A 2C59A 5G0TA 1BW9B 4AG3A 5JDCA 2ZQYA 1Z6ZA 3D3WA 5ITWA 2QZZA 3F6YA 3IKTA 3RUAA 1HSZA 4TKLA 3ZNPA 4DBZA 2QX7A 4E3ZA 2PH5A 4CMAA 3DHYA 1GL3A 2W8ZA 4XX0A 4ZQFA 2C29D 1AE1A 2ZTLA 4FJ2A 4TROA 4XDZA 1R0LA 3L6EA 3VZPA 1VRWA 3MWEB 4F6LA 4RDIA 4NBRA 4NG5A 1Q7CA 4K1LA 4DYVA 2NQTA 4MVJG 1BW9A 2E48A 4AL4A 4XZ3A 4WEOA 4ZD6A 2TMGA 2VHYA 5COQA 3VPXA 1T4BA 1JAXA 2O23A 3WTBA 3G79A 3NGXA 3BXXA 1BDMA 2WDZA 3DHNA 4RLSA 4B8ZA 4WLEA 1D7OA 4E33A 3ETDA 2O7QA 4UVDA 4DGSA 2NVBA 1M2WA 3R6DA 3WS7A 3EZLA 2NV6A 2IXBA 3WXBA 1A9ZA 3BMQB 2JCVA 5EINA 3S8MA 1I36A 1B3BA 3G3EA 4B7CA 3BIOA 2QHXA 5CDSA 4J7UA 3K8ZA 2JFHA 2Y66A 4PZCA 5JS6A 5I7SA 1P0CA 4P4GA 4B8WA 1QYWA 1GDHA 3AY7A 3HQ4O 5JSFA 3DWFA 5TS3A 3AJRA 4MVJD 1U3UA 1O94A 2YQ4A 4BVAA 3C7DB 2UAGA 2V6BA 3JQDA 2O50A 3LF2A 4DC1A 2C5AA 5JY6A 4PG5A 3HDJA 1MFPA 3U0BA 1SOVA 1JDJA 1K5HA 2X86A 1VL8A 2DPGA 4L4RA 4S1VA 5JDCC 2HMTA 3BMQA 2YDXA 3K73O 3I23A 1KOLA 1NQOA 2V6FA 1GQQA 4M87A 4CV2A 5F1KA 4N7RA 2P91A 1H9AA 3LVFO 4FFLA 4BV9A 3KYDB 4DVJA 1X14A 1UZLA 3PZBA 3JQ6A 3IQDB 2Q3EA 3ZWMA 3TFOA 5FF9A 1D4FA 1I8TA 5ES3A 3QV1A 3WGZA 4BB6A 5T64A 1KETA 4O6VA 4NZ9A 1CETA 1PL7A 1T1RA 2P2SA 2Z1MA 3DBLB 4PGFA 2AE1A 2DBZA 4PRKA 4YT5A 4ZRMA 4CLXA 4ALMA 2W2LD 3E48A 1LI4A 3U3XA 5HA5A 3ABIA 5FYDA 3SLKA 2C2YA 1L1FA 4NU5A 4DRYA 3KYDA 4BO5A 4EBFA 1IB6A 1N2SA 3IJPA 2W4QA 3F5QA 3TSCA 4L74A 4X54A 2YFHA 3FPCA 4YQZA 1I32A 3I6IA 1QR6A 1E6WA 1ZMTA 3M6IA 4KP7A 4CM9D 1IPEA 5CAEA 4Z0HO 2PKRA 3HADA 1O6ZA 1ZCJA 3V2UA 1D8AA 3DBLA 3VPGA 3K96A 2GD1O 4PLYA 2JAPA 2GPTA 2B5WA 2AMFA 4BNLA 5LC1A 3RC1A 3L9XA 4II2A 2BGMA 4ZU3A 3ZI0A 1SNYA 1C0KA 1E6UA 4H3VA 3O38A 2PH3A 3G17A 4HFNA 1DJNA 3E8XA 3WIDA 4DREA 3QHAA 1O0SA 3COSA 1B8UA 2JL1A 4XQ9A 4IDEA 1PJBA 2FMUA 3GNSA 2Q99A 3PI7A 3WGOA 4BNYA 5A3VA 1PWXA 4FIZA 4OL9A 3NTRA 1I3NA 4YTEA 1KVUA 1X0XA 4CQMD 3BHIA 3FD8A 3W4JA 3X2FA 2NACA 1E92A 2DTXA 4IQGA 1CRWG 3GN2A 1SEVA 1E1LA 4B4OA 1DHRA 4I5FA 3FWNA 3SLGA 2PWZA 1ISFA 4OSPA 1JVSA 4AJPA 1PJ4A 2O48X 1CWUA 4GX5A 1C0PA 5KVSA 4YCAA 4C7KA 5K0ZA 3PHIA 4WOJA 1XYGA 1KEUA 3ULKA 1L7EA 2UYYA 3FHLA 4J4HA 1DOHA 2JKVA 4MVJP 4BNTA 4I5EA 2NM0A 1LDGA 3JQ7B 3FNFA 2YUTA 6LDHA 3EGOA 1RKXA 3FTPA 4BNFA 3RJ5A 2CMDA 5BSHA 3UCEA 2JD0A 4IXTA 2VOEA 2FY8A 3E03A 1IULA 7MDHA 1DEHA 1X7HA 1I3KA 4KTTE 1V6AA 4KUGA 4YT8A 5CG2A 1FDWA 3V2GA 2Y1OA 1PJCA 1IZ9A 1BXGB 3UUWA 1Y5MA 2FPPA 3L4BA 3ADOA 3QVWA 3LLSA 2GYYA 2RHCA 4IM7A 3VPFA 1MG5A 1GR0A 4LCEA 2CF6A 4LISA 3PK0A 4OH1A 2IZ1A 1N9GB 3SXPA 1AXEA 1F8FA 1FJHA 3UICA 2B83A 3RKUA 2GLXA 2RH4A 2XF8A 4BNGA 3F3SA 4A10A 2H6EA 3H3JA 4KQXA 4GVLA 4BKQA 5A5EA 1UDCA 1LQUA 5CDYA 3LQFA 2VZ8A 5KTKA 2LDXA 3DBVO 1BXGA 1E3SA 1TLTA 3PEFA 3JYPA 3WSWA 3P2YA 3WGGA 4PCVA 4L76A 1BXKA 1MXFA 4LRTB 4RPKA 4YXFA 3LF1A 2EWMA 2Y1GA 3GDFA 4UEOA 1N9GA 3R1IA 2D0IA 3KEQA 2HDHA 2O4CA 4WLOA 3KUXA 1LRLA 3H65A 1UXKA 3KYCB 4RVUA 2B4RO 4F6CA 1NQTA 3GH3A 4UUPA 2AQ8A 1UZMA 1EDOA 3WBFA 1U28A 4OQYA 1W73A 5B4VA 2BRUA 1Y9AA 3QA9A 1EBUA 3WIEA 4CMBA 4J3FA 4RVFA 4UEJA 3DEYX 1X15A 3DBHB 1PQPA 2VWPA 2ZJ1A 4UUMA 3KETA 3CMCO 1L7DA 1YS4A 4MIOA 1NHGA 2YDYA 2Y68A 3PZRA 3MOGA 1EVIA 2EW8A 3WLFA 4BO8A 3KYCA 3FR8A 1CQJA 4FBGA 4GLLA 1U3TA 5KJFA 2Y0EA 5B37A 5A04A 1U8XX 3L4BC 4EW6A 1NR7A 2Y0DA 3HUDA 5B4UA 1ZJYA 5I9NA 4WGGA 1YDWA 2H1SA 1YBAA 3AM5A 4EYEA 3K5PA 3H3FA 4EJ6A 4FW8A 3GOHA 3BMOA 4OAQA 3WX0A 3H7AA 4K26A 3DBHA 4BO3A 3KBOA 1RM5A 4R51A 3VKVA 4NFHA 3AWDA 3MWDB 5KKAA 4GGOA 3PYMA 1TI7A 1YH3A 2BFAA 1SEPA 2VQ3A 5JNLA 3BTSA 1BWSA 1LU9A 5KIAA 5BQFA 2AQHA 2CSUA 4RPLA 1EQ2A 4HY3A 2PGDA 4GSKA 3ZWCA 3KYBA 1NQAO 3VOSA 1KIFA 3WYCA 1JA9A 3QVOA 4WK6A 4ITUA 3OEWA 1DRVA 4L0QA 4AJKA 4NPCA 1DC6A 4AJNA 1ZJZA 3VC7A 1OFGA 4GL4A 3SC4A 4R1NA 1DIGA 3Q9NA 3IUPA 1Q1NA 4IMRA 3TPCA 1JW9B 3IP1A 4QX6A 5AXCA 1GV0A 5GZ1A 1RM3A 7ADHA 5DN9A 4AJIA 4E4YA 3GUCA 4TZKA 2I6TA 3Q1LA 4BO4A 4K6CA 2NU7A 3DB2A 4J2OA 3B6ZA 4YAKA 5G4KB 2O3SA 3X2EA 1B15A 1LTHR 3V1TC 4B3JA 4E5PA 4R5HA 5FWNA 1YBMA 4EEZA 1IYZA 1JWAB 5L4LA 1U2GA 2P5UA 4BUCA 5A05A 3TN7A 3UAGA 3UHAA 2D5AA 1LLQA 1ZK1A 5TSDA 3D5QA 1H93A 1E1NA 1U4SA 5JLAA 4HFJA 3RUDA 3A14A 3PDUA 4HP8A 4HV4A 3H8VA 2HJSA 1P44A 2E49A 1D3AA 4FFMA 1QKIA 4FPXA 5G4KA 1LSUA 2QRKA 5KNLA 2VRBA 4Y6SA 2YHIB 5C37A 4ZN6A 1EFKA 2J3HA 3TNLA 3ZHZA 4UVIA 1OC4A 2DBVO 2ZB8A 4IPTA 4WASA 1M66A 3D1LA 1PGNA 2GNAA 2VZ9A 4YB8A 1YB5A 2Q2VA 1D1TA 2V6GA 5G2OA 3GF4A 3H5AA 1E3WB 4XD2A 3MTGA 5DBFA 4MJLA 2XPCA 4DLBA 1UXJA 3PGXA 3AI3A 3GG2A 5DOVA 5EJ2A 1IHYA 3WNVA 4CMGA 1H5QA 2YHIA 2RH8A 1UXIA 4Z0TA 3RROA 4KQWA 2R2GA 3H4VA 3BA1A 1LLDA 1E7QA 4D79A 2WM3A 2B4QA 3PJFA 1OZAA 2QG4A 3T7EA 2XXBA 2SCUA 2YYYA 4DQUA 1GUFA 4FSHA 4J4BA 3WNQA 1YB1A 3HDYA 3HN2A 2HKIA 1E3WA 1LJ8A 1CYDA 3S2IA 3OIDA 5AOVA 4GMFA 4P4NA 5C5IA 2WYVA 5TX7A 3VKUA 1WDKA 3AUSA 2ZTUA 1W0CA 4IINA 4PLVA 1QYDA 4U6QA 5DCUA 4FJ0A 3QVXA 5CFZA 3ZWNA 2Y1CA 4ND1A 3QQPA 4Q3DA 3DR3A 4WECA 3GEDA 1DAPA 3IIEA 1TB4A 3RD5A 3EVTA 4R3WA 1E7RA 4LW8A 1B2LA 4XDYA 3P19A 5G0UA 4YRDA 4Z9FA 4YPOA 1EE9A 1UUFA 2YY7A 4CM5A 1I5RA 4TVOA 5B12A 4Q9NA 5U1PA 3WG9A 4LN1A 1YO6A 2J5RA 5EQFA 1BVRA 3PWKA 4R9SA 1JLLA 3FF4A 4GI2A 3QP9A 3F5SA 1CIVA 3FPLA 2VHVA 3P5SA 3WJAA 5CDGA 5A4DA 3AI2A 2Q4BA 1N7GA 2ZYDA 4Y6RA 2EW2A 4PVCA 2Q49A 3NYWA 1QORA 2XXJA 4PLZA 3IKVA 4EI2A 1ZNQO 5CP8A 1VPDA 2IZ0A 5JPIA 1NPDA 1I10A 4K6FA 1P1KA 3H9QA 1WP4A 4IS3A 4MO2A 1DFGA 5AXAA 1J4AA 3RJ9A 4NFYA 5G0VA 1XU9A 3W4KA 1LC0A 2HMWA 4B7UA 4NBVA 3S55A 1FMCA 4B4WA 3HB4X 1SOWA 1LBEA 2PTGA 3DZKA 4GX1A 4I9NA 1DPGA 5TC4A 3LT2A 3FRJA 4QXMA 3ZWAA 1Q0QA 1P1IA 4J1TA 3H5RA 3C24A 1U7HA 3FBTA 2OUIA 1LNQA 3RUEA 1PZHA 1N1EA 2VYNA 3FN4A 1C1DB 3F46A 5HS6A 1WDLA 3N58A 3OIGA 1E3LA 2Y99A 3GGPA 5HM8A 4RF5A 1VJ1A 3I6QA 3TL3A 1SBYA 1K0UA 3DZJA 4NMHA 1I2CA 1HYHA 3PJDA 1NAIA 3QY9A 3S2FA 2NQ8A 2HRBA 4Z9YA 3V1UA 3GLQA 1CJCA 4PIVA 4OMUA 4ILKA 2YV3A 1PL6A 4R01A 1SC6A 3NJ8A 2TMDA 1SAYA 2Q1UA 3GGGA 5JW6A 1GQ2A 5ITVA 2B36A 3W6ZA 3OHSX 1C1DA 2VUSA 3IJRA 3I9LA 3INTA 4A26A 1F06A 2O3JA 4IDCA 5GZ6A 1H6BA 4ZGWA 3E9NA 5L40A 3ROMA 1WWKA 4NBUA 4ZA2A 4YA6A 4UREA 1UDBA 1NYTA 1YGYA 5BNIA 1HE4A 5KVQA 4R4JA 1JAYA 1T1SA 4DTIA 3MCVA 3WGHA 2NNLD 4CLDA 1A4IA 2QRLA 3OQ1A 1NASA 2VTEA 1R0SA 1K89A 5ER9A 2GCGA 1BSVA 3M2PA 3SJ7A 3SVTA 1BRMA 4AJ1A 2GZ3A 4EUEA 1P33A 3QWFA 3I4FA 4D46A 4DA9A 3TRIA 1YRLA 3GQVA 6ADHA 1ZEMA 4Z9XA 3C1OA 2CDAA 4K9DA 3WQRA 4XGKA 5I8ZA 1QYVA 2EG9A 2ZB7A 3I9JA 4GH5A 3LK7A 4D42A 3GFGA 3WB9A 3PPIA 2WD8A 3AI1A 1X1TA 4BQRA 1Z45A 1XQ6A 4JN6B 4HXYA 2OORA 3D3WB 2OL4A 5K6AA 1NQ5A 3EUWA 4G5HA 4YT2A 1YJQA 1H6DA 4L73A 1E1KA 4PG7A 4NNJA 2FOIA 2AA3A 2JFGA 4IBOA 4IDFA 1WMBA 3WYBA 1ENZA 3E9MA 1W6UA 3GEMA 4XJTA 3D4PA 2HK9A 2HO5A 4Z0PA 4E2XA 3OH8A 1NFFA 2JD2A 3OJOA 2Q1WA 1GV1A 3VTFA 3PFWO 3IP3A 4JBHA 1JU9A 4QECA 2ILTA 4MINA 4W7IA 4WLUA 2OGUA 3H6KA 5A1TA 2RIRA 4U8GA 3C85A 3A9WA 4YJFB 2WD7B 3KO8A 4RF2A 5ILGA 3EAGA 1RM0A 3AFNA 4YJDA 5JMWA 4DLAA 3KXDA 1A5ZA 9LDBA 3VHRA 4TSKA 3V1YA 4A03A 1R4MB 1PJ3A 4OXKA 1DLJA 4G2NA 1HDXA 5HBRA 2VYVA 1LRJA 3V8BA 4JJGA 2H9IA 1GPJA 1G6KA 1AHHA 2Y67A 5TNXA 4NQZA 4CMKA 4CLEA 3RAJA 1ML3A 1A7KA 4J1QA 4YJFA 2WD7A 3TZHA 3NDIA 2EXXA 3ZU5A 3ZU2A 1YB4A 4W9NA 1LDMA 2FWMX 3TDKA 8ADHA 2R00A 1YWGO 4CR6A 4U0JA 2ZTMA 3PFFA 3G49A 3Q2KA 5IFLA 3NTOA 1M67A 1EUZA 1R4MA 3SBOA 3QWBA 4ALNA 1YJ8A 1UR5A 2DLDA 5JC1A 3PTZA 2P9EA 2J3JA 2VHXA 5L3ZA 1GZ4A 3GVXA 3PIIA 3JYNA 1VE9A 3JQ9A 1I33A 3TWOA 5L7WA 5ICMA 1HE5A 4JP3A 4RVDA 5K6AC 1EEHA 1CF2O 3K9QO 1NM5A 4NU6A 3PHGA 4ND2A 5AXDA 4J49A 4D3DA 5CPFA 3WDSA 1Z73A 1LSJA 1NAHA 1QSGA 5FI3A 3T4XA 4RJTA 3L0DA 3KSUA 3KV3O 3NDRA 3GVHA 3DAPA 3HDQA 2IXAA 1HZZA 4IIVA 2X0NA 1WAMA 2NU9A 5IXSA 4ZQEA 2E82A 5ENVA 4DLLA 5JAZA 2D2IA 5L95A 4CLOB 3NEPX 3QW2A 4MP8A 4EEXA 1KEVA 3VZQA 4PN3A 2J3KA 4J7XA 1LDEA 3B1KA 2OXIA 3O4RA 4AJ2A 4BV8A 4DYDA 4XRGA 2VT3A 1DC5A 3PYXA 2P4QA 3E9QA 2AXQA 4EUFA 1PS0A 4WOKA 1ZK4A 4JJIA 1V3VA 1P0FA 2Q2QA 3ZCXA 3JD2A 4INAA 3NT5A 2C07A 1B8PA 4JK3A 4R41A 4FFPA 4DMMA 2C54A 4CLOA 1IZ0A 2JCXA 2ZK7A 2NTNA 1NPYA 3L4SO 5J23A 5FFFA 1GTMA 2NSDA 1MXHA 4MVJH 1BXZA 4B3HA 4H15A 5TF4A 1D1SA 3OF2A 1Y6JA 2HMSA 1C14A 5JO9A 5FI5A 3T7CA 4W9NC 1DB3A 3OIFA 1T2DA 3JSAA 4OO3A 3JQEA 2R00C 4W99A 3WFIA 2AG5A 3WMWA 3N74A 4HWKA 2VUTA 3S1LA 4KUHA 1X7DA 3JYLA 4Q3BA 5H82A 3W1VA 2OP1A 4O5OA 3UCXA 4P22A 4GWGA 1FK8A 2ZIZA 4ESOA 1AGNA 1LDBA 1NVTA 2PNFA 2FPIA 1HDCA 2RAFA 1VL0A 2QW8A 3K2EA 3ITDA 4CV3A 5ILOA 5CEEA 3JQ9C 3HB5X 5JBIA 1DO8A 4XRRA 1BHSA 5F5NA 1BDBA 4LVUA 5AXBA 5JE8A 2JJYA 2F1KA 5A5FA 4ZQGA 3F1LA 4CLHA 1GQYA 4NK4A 4BO2A 4L4SA 5CPBA 4WLVA 4IIUA 4MVJI 4U5QA 4EZBA 4ZQHA 2WJPA 3P2OA 4YRAA 5KVCA 5JYDA 4NI5A 2OFPA 5I7EA 3EC7A 1ZK2A 2PA3A 4Q3AA 1ORRA 4R5MA 3ZH2A 1IPFA 2QQ5A 4IGFA 5AVOA 4RO0A 4AVYA 5BSGA 2CF5A 4R9RA 4OHUA 4G81A 1PQUA 4CPDA 2XOXA 3ZWPA 3RUIA 3E82A 3OMLA 1PGOA 4JNKA 4WNIA 4J1NA 3ZN2A 3KLPX 2GUGA 5L53A 1X1EA 1K6XA 3PLRA 1Y5RA 3INRA 3JYOA 4FR5A 2C2XA 4GMGA 3IOYA 1GUZA 4LMPA 1Y8QB 1EZ4A 1XHLA 4Q3CA 4MKZA 5HS4A 4YQYA 3LSYA 4FC7A 1HZJA 3WGTA 1ADGA 2NTJA 1HYEA 3UF0A 1IOLA 1SZJG 3LYLA 4I5DA 4YACA 2GN8A 3TZ6A 2QYSA 2EP7A 4B79A 3GUYA 1U1IA 4D44A 4XQEA 2EV9A 1P1RA 3K30A 5KCZA 3A4VA 1B0AA 3IC5A 1PX0A 2OO5A 4O0LA 3WTCA 3ASVA 1EFLA 4LSWA 1MGOA 3QJ5A 2IODA 3RFTA 3UVEA 3HHPA 4URFA 2O4UX 4AJOA 1IL0A 3FWZA 3KSZO 1NNUA 3DO5A 5DDIP 2VNSA 2C7GA 1Y8QA 2YHUA 1HT0A 4YAJA 5CEFA 4KUEA 2C82A 2EKLA 3QWIA 5F1PA 4E5MA 2A9FA 3RQSA 2R6JA 4M86A 2VN8A 3PIDA 4ZQBA 2DU8A 4RQUA 4E13A 4QO8A 3CXRA 4XGNA 1NBOA 1T2CA 1MLDA 1PTJA 2AEFA 3GVIA 3K2BA 1LLCA 4LSMA 1OBFO 4C4OA 4PG8A 4JBIA 4CV1A 1PGQA 2EGHA 3QRWA 4FD3A 3AUTA 1ZH8A 1GCUA 3ANNA 5U9CA 4XR4A 3I9OA 1R4NB 3QE3A 1AHIA 1E3EA 3LDHA 4WLNA 4XA8A 5C7IO 2X5KO 4IZHA 4OKNA 3ENNA 4UVHA 4OM8A 4M1QA 3ZHBA 1TXGA 3NTQA 1GYQA 4UAGA 5LCXA 3PYLA 1EVZA 1DRUA 1Q0HA 1QYXA 2J5QA 4MIEA 4QEDA 4BB5A 3FR7A 1UP4A 3JQ8B 1EMDA 4XIYA 1CERA 1ISHA 4D0SA 3VDQA 4P8RA 3S2EA 3Q0EA 1EDZA 2ZCUA 2D59A 2RCYA 5EL0A 5HTOA 4N5LA 1P1JA 4E2YA 4PRLA 4I08A 4YJGB 4BOYA 5G4LA 3HSKA 1R4NA 4MP6A 4DIOA 3BMOB 1JVBA 2EP5A 4BMNA 1RM4A 3QWHA 2I3AA 3H9GA 3GRPA 4E2ZA 1E7WA 3WWZA 1E1MA 4KOAA 4J0EA 4Y98A 3BYZA 3PQEA 5EMHA 2Q50A 1LXCA 3JQAB 2H63A 3KEOA 4D3FA 4YBZA 4CUKA 3VH4A 3I83A 1T26A 1FDTA 4FGWA 2X0JA 3OEYA 3JQ8A 1AXGA 4XQGA 4NIMA 4GVXA 3RASA 5EESA 2CDBA 3WQQA 1F8GA 3OQ6A 3Q11A 3ZNOA 4BNJA 1GFSA 5MDHA 3TL2A 4YJGA 4L9RA 2G76A 1XCBA 2PZMA 3EYWA 3JV7A 4N18A 3B1FA 3O9ZA 4BNKA 2Y05A 1K3TA 1AUPA 3ETGA 5BR7A 3ZNQA 5JAMA 4N5MA 2CVQA 4YT4A 2Z95A 1ZK0A 3JQAA 1Z75A 1C3VA 3HG7A 3RU7A 1ZZEA 1KERA 5TIIA 3B20A 2EIHA 5TT0A 3TFQA 3DONA 3QVTA 1DC3A 3KVOA 4IDGA 4BKPA 1XQ1A 3D64A 3GVPA 3IL2A 2X8LA 1NPTO 2IYPA 3L77A 5ICSA 4YEDA 4Z3KA 4WJZA 3UKOA 1ZSYA 2PK3A 4QUKA 3F1KA 1UZNA 2O3QA 5KJ6A 1KVSA 3EW7A 3LC2O 1HDRA 1R12A 2BD0A 4BO7A 3DFZA 2BGKA 2PGJA 1B16A 3QLJA 5IXYA 3H2ZA 2I5PO 3OQBA 2C7VA 2I65A 5THQA 1SB8A 5IDYA 4DC0A 1V0JA 4QSMA 4R68A 1UJMA 3ONEA 5JXWA 3ZHYA 2E37A 4JCOA 3AY3A 1EUDA 4XR9A 3WGIA 4MPDA 2X5OA 4CMCA 1H2HA 2D8AA 2E4AA 3B70A 5COAA 3ICPA 1H6AA 1PEDA 5I7FA 4BMVA 4IJKA 1HXHA 4RZIA 2CD9A 3MZ0A 3GAZA 1F12A 3P7MA 1HETA 3PRJA 3INGA 1HDYA 1K6IA 4DMLA 2DC1A 1NP3A 2WYWA 5DT9A 2UDPA 4II3A 4CM7A 4E21A 2GR9A 2NWQA 2EEZA 1XEAA 2W2LA 1KS9A 4O1MA 4QTZA 4BHTA 3JQFA 1VM6A 1LEHA 3JD1A 1GYRA 3CMMA 4FC6A 2PD3A 1NVGA 2RHRA 1I24A 4GBJA 4JBGA 5C3MA 2VYVD 2FHSA 4CJXA 4U0KA 1HL3A 3DBRB 4AJJA 5HRUA 4NK5A 5F1OA 3GEGA 2YQ5A 2HCTA 2F00A 4WCFB 2HQ1A 2NUAA 2ZQZA 4M8SA 1N7HA 1Z7EA 1ZVMA 3CH6A 3LT0A 3RCBA 3A06A 1UAYA 3FTNA 1WVGA 1Y9EA 2JCYA 1R6DA 2WWRA 2I66A 4LMRA 1O95A 3MOIA 3H9UA 4FGSA 3JD0A 4Y67A 1N1GA 3G0OA 3LLVA 4NH4A 3DBRA 1MX3A 4HUJA 1PGJA 1P74A 4OQZA 3RWBA 1WXDA 3NKLA 3QVSA 1XSEA 2O3RA 2GSDA 3LT4A 3ZWVA 4WCFA 3VH2A 2Y1EA 4XB1A 4UUOA 3EDMA 1ZMOA 2DPHA 4HNGA 1ADCA 1EVJA 1PZEA 2NADA 4G65A 2QZ9A 1G0OA 3FCOA 2X9GA 3KRTA 1Q2XA 4MOWA 3VAZA 1TEHA 3T4EA 1C1XB 3ZV3A 4GKVA 1CQIA 1NVMB 2IEDA 5KJ1A 1ZXBA 1YONA 2FRDA 2IEBA 1U7TA 1JQBA 1Y7TA 2B69A 4UUNA 4XIJA 3WMXA 3PWZA 3BTUA 3NUGA 4AICA 2ZB4A 5EIOA 3EHEA 1DJQA 4I8XA 1PJ2A 1UDAA 4I5GA 3D7LA 4CUZA 1KEWA 3I9KA 2VZ0A 1E7MA 1GAEO 3PGJA 2PD6A 3JQFC 5DF1A 4QQRA 4TZTA 1Y8RB 1C1XA 1M75A 1ISGA 4HKTA 3LC1O 4CV0A 3VZRA 3D3EA 2A92A 2JHFA 4BS9A 3AU8A 1ZBQA 4DQXA 1PQWA 1YL6A 5KWEA 3GDOA 5A03A 1T25A 3H9EO 1Y1PA 2O7SA 1NHWA 3LZ6A 3KHUA 4R69A 5DZSA 5TRTA 1UP7A 1UP6A 3DOOA 4EJMA 3FNEA 3GC6A 4CM3A 3C8MA 1HE3A 4XYGA 2PZLA 4XYMA 3W8FA 1Y8RA 2DUWA 1Q7GA 4C7JA 4YJHB 1DIAA 1ULSA 3M1LA 1V35A 4XGIA 1XELA 5F3RA 4R1SA 3VVBA 4D0RA 4XCVA 4J7CA 4QFDA 3VTZA 3AOGA 1MFZA 4IUYA 3MJCA 4WCFC 3CKYA 4CMIB 3BHMA 2G5CA 2YV1A 1VKOA 3GMSA 3QWAA 3RIHA 4E5YA 3TQHA 3BMCA 1P9LA 4FJ1A 1E5QA 4YRBA 5L7TA 1V9LA 1VL6A 2GZ1A 5GMOA 4E0BA 4I1IA 4GX2A 2J5KA 3F9IA 2I3GA 1E7SA 3OA2A 1H6CA 3ZV6A 3RFVA 4YJHA 3VVCA 5IF3A 1B26A 1YL5A 1YBVA 2GZ2A 4KTVE 1J49A 3JD4A 5IAAA 1F17A 3HFSA 4IGEA 1YKFA 5A9TA 4CMIA 1W4ZA 2DAPA 4GLOA 4M49A 1HDOA 5KKCA 3ORFA 3Q2IA 1JTVA 4AJ4A 4TQGA 4PLHA 3PXXA 3Q6IA 1ONOA 3OFSA 3SX2A 4BMSA 5IG2A 5IZ4A 3GK3A 1V8BA 3K31A 4TRRA 3PHLA 3GRKA 4YAEA 1ADBA 2G17A 1EK6A 4JX8A 2G0TA 3CINA 1NTOA 3EY4A 3PDJA 4R54A 4KWIA 4MDHA 4ROSA 5DCWA 2EGGA 3JQCA 5BSFA 4NDNE 2EHDA 4TKMA 3NRCA 2VCYA 4P4LA 4MKRA 4WLFA 4RV9A 3TZCA 4B4UA 2X23A 1I3MA 3GPIA 1DSSG 4JJFA 4KZPA 3ENKA 3KM0A 1R16A 1PL8A 2A4KA 1R37A 2IDZA 1E6EA 3B1JA 3LT1A 1I3LA 2Y0CA 4W4TA 1DIBA 5IN5A 4A27A 1ZW1A 5IJZA 3AM3A 3VH3A 2NVUB 1JKIA 5TJ9A 1U8FO 3HZZA 4BGUA 1OI7A 3PJGA 2Q1TA 2EERA 3GPDG 4WKGA 4IMPA 4Q3NA 4W7HA 4J2HA 5AQ1A 2EF1A 1F14A 1V3UA 4OKIA 1PZFA 1LUAA 1P1HA 4RVSA 4YYZA 1TT5B 4CM4B 5I7VA 1GZ6A 1HLDA 3UXYA 1UH5A 4GX0A 3QIVA 3MJSA 4J9VA 2B0JA 4GAEA 3E18A 3ONFA 4RF3A 4D41A 3RI3A 3ZNNA 1OMOA 3OETA 5H81A 2FR1A 1ENPA 2NVUA 1SO8A 5DULA 3ROPA 1VSUA 1WW8A 4CMHA 1A7AA 2ZYAA 1PS9A 3OICA 3ROKA 1HDZA 4BO0A 4CMJA 2BKAA 3DZFA 1J0XO 4BO1A 3OM9A 4N54A 2C5EA 1BTOA 4OXYA 5AYVA 4AJLA 2ZTVA 3D4NA 1E7YA 3D5TA 3OJFA 5T6BA 1TT5A 2B35A 4CM4A 2P4HX 4D3SA 4QT0A 1M76A 1J5PA 3JCZA 2B4TO 5LDHA 3BAZA 1PJSA 2HLPA 3RBXA 1I0ZA 2AHRA 3WOHA 2HRZA 4CLRB 1SMKA 5IDWA 1V3TA 1QRRA 3C1AA 3ZU3A 1K2WA 3W8EA 1EVYA 1G0NA 3GAFA 1W8DA 3MJEA 1E77A 1U3VA 4CL3A 5ADHA 1HF3A 9LDTA 3TJRA 1PZGA 1R15A 4IJWA 3NJ4A 4BKRA 3CZRA 4CM8A 1GY8A 5CEJA 4M89A 4Y6PA 4CQLB 2WMDA 3OJEA 3O26A 2PY6A 3DXFA 4CLRA 3U4CA 3D0OA 3DHEA 3U4DA 1DIRA 2VRCA 4FN4A 3V2HA 4BNNA 1ENOA 3O03A 3PJEA 5EPOA 4GSLA 4BNXA 4L75A 1AN9A 3PQFA 1DAOA 4PLPA 5JMPA 3UN1A 5BSEA 1R0KA 2BFPA 3A28A 3ASUA 3EMKA 4M54A 2EJWA 3STHA 5FEUA 2PZJA 2AW5A 2QRJA 3RUHA 3NT2A 3DZHA 4NJOA 2UUPA 3H2SA 3RC7A 1PWZA 4CQLA 1WLYA 4I9UA 3CEAA 2OBNA 3JQAD 4J0FA 1ZIDA 3DOJA 2BGLA 4O59O 3RSHA 4YAIA 2X22A 4DPMA 3NV9A 1QP8A 1NFRA 1IY8A 1ZEJA 4MVJE 1PJQA 4YWJA 2UV8A 3AOEA 4OYRA 5IDXA 4XYEA 3VPSA 4Y9DA 3ZW9A 1LQTA 1UAGA 1DLIA 1LSOA 1VJ0A 1WNTA 1T2FA 2O2YA 3AM4A 3DTTA 3ICCA 1IUKA 3L6DA 1U5CA 3E5MA 1XLTA 1ZUD1 1NXQA 4DUPA 3TZQA 5L7YA 3GNQA 4UVEA 3GMDA 4AJHA 3OECA 4NR0A 3C3XA 4K28A 1XWFA 4J43A 2CVOA 1WMAA 4J91A 3NAQA 5G0SA 3ZU4A 3C1TA 4LGVA 4OJNA 5EERA 1P77A 5T5QA 4Z6KA 4QFCA 4WPGA 2PKQP 5DP1A 1NR1A 3RUFA 2POQX 4IDDA 3EK2A 4JXKA 4XB2A 2GASA 1EK5A 5CHEA 3ZWOA 3U5TA 5COBA 4IJUA 3ZW8A 3DMYA 1EQUA 1RYDA 3R3SA 4GGPA 2I99A 3V5NA 3PP8A 5MGBA 3DZIA 1ISMA 3WGYA 1DC4A 1FXSA 2PKQO 5ENDA 2GO1A 4XYLA 3TOXA 2X1HA 3IS3A 4YDRA 2DTDA 1DFHA 4J16A 4YAGA 4NJMB 4OSOA 2Q45A 1PJTA 1LDNA 1O5IA 2I76A 2O2SA 1CEQA 2GERA 3ANMA 4KDEA 3O8QB 1PSDA 1IE3A 3TZKA 3ITKA 2Y1FA 3ZDFA 4BQPA 3WGQA 3PVZA 2ZCVA 3CZMA 3L9WA 3GZ4A 4CODB 1RWBA 4J1SA 1SCUA 1ZSNA 3EVNA 2QYTA 3UOGA 1GZ3A 3N7UA 4OOFA 1YQGA 1WZEA 3UGKA 3I3OA 1H94A 1IHXA 4BGEA 4MP3A 4MVJM 4E12A 4B3IA 4NJMA 2X7HA 2I67A 4TRJA 1YQDA 2JFFA 4PLCA 3AOEC 3DOCA 3D4OA 1HRDA 2FSVA 4BGVA 4E30A 2VHWA 3VH1A 5CDTA 4UULA 2YZ7A 3O8QA 2V6MA 2Y93A 1KYQA 3CUKA 4NBTA 3U62A 3ZWWA 5JYEA 3GGOA 1Z74A 2A94A 4TVBA 3GG9A 4FCCA 1T4DA 1A9YA 3GHHA 5JAIA 3WLEA 3MTJA 4L4XA 1TVEA 5TLSA 1YVEI 4E2WA 1U5AA 2CZCA 2IYOA 3Q9UA 1XR3A 3DL2A 1GADO 2DT5A 1GCOA 2VUUA 4HADA 4BKOA 1N5DA 2E6UX 1ID1A 3ZZNA 5A9SB 1VC2A 2CY0A 2P9GA 3KLMX 3OP4A 4B4VA 1P3DA 2DM6A 5KVVA 3ZWBA 1P1FA 2RBEA 2YJZA 2YW9A 2FR0A 3GA0A 3RU9A 1WPQA 4CM6A 1QMGA 4IJVA 1YL7A 5DCYA 1B3RA 1X7GA 3I9NA 3W8DA 5K9ZA 1XIVA 4E31A 5JAQA 2BLLA 5L9AA 2C0CA 4M55A 3CIFA 4TMFA 1EUCA 1BG6A 1NWHA 4KMSA 1HYGA 4ND4A 3DZBA 4HFMA 1I2ZA 4MVJF 3NGLA 5T57A 5A9SA 4IQ0A 2I9PA 1H2BA 4L8VA 3DAFA 3ZGYA 2CNBA 4DWVA 4R1TA 4PZEA 4CM1A 2G82A 5JCJA 2GN4A 2PZKA 1HSOA 3ONDA 4H16A 4YVFA 5T8KA 3F4BA 2Q4EA 3EZYA 2VHZA 1NX6A 1B14A 4A2CA 1ZXLA 3IUSA 4E5NA 3PQDA 2AG8A 3JQ7A 4U6SA 4BIIA 3HFGA 3JQBA 1T2AA 1ENYA 1QLHA 2NTVA 2FZWA 4NBWA 1PR3A 3PHJA 4TWRA 5T67A 4CL8A 3AUAA 5BNFA 4PLTA 4QO7A 4TRMA 4BO6A 4DXHA 2CFCA 3RFXA 3DZGA 2HSDA 1FDVA 3GT0A 4UEKA 1EBFA 4OIMA 3UH1A 3WR5A 2BHLA 3GHYA 4BNUA 2HU2A 3ZV5A 4CMEA 4EJ0A 1U9JA 1F0YA 2VYND 3TF5A 3GDGA 3H9JA 3U9LA 2VT2A 4IDBA 1KVRA 1LA2A 2G1UA 2UUOA 2Z5LA 2ZJ0A 3GN1A 4KDFA 5A3JA 4OOEA 1MP0A 4Y8VA 2BH9A 3DAGA 4NHEA 3AU9A 5B1YA 4YR9A 1S6YA 4IY1A 1DDOA 2FZEA 3NT4A 4GPD1 1A27A 4N5NA 5JO0A 1U2DA 4RDHA 2B5VA 3KOUA 4DBVO 3NDJA 3AFMA 1ZSVA 4XQCA 1ULUA 2WYUA 4WEQA 8LDHA 3DTYA 3VZSA 2BMAA 2EKPA 1J6UA 3HJAA 2OP0A 1PU2A 4BNIA 4XYBA 4BNMA 2PFGA 2X0IA 1HTBA 3GR6A 3I5MA 3RBZA 4RPHA 2IRWA 1O8CA 4WCDA 1E3JA 2EKQA 2B37A 4ID9A 4BNHA 1HWYA 1HLPA 1YE3A 1JN0A 1K6JA 4RCVA 3K6JA 1GYPA 1X0VA 5C7OO 2W90A 2Q1SA 1S7CA 3I1JA 3SC6A 5CDUA 5B4TA 4FOSA 2OMEA 5A02A 2D1YA 2DFDA 2VNAA 5A06A 5T8KC 5TJHA 1RYEA 1VKNA 3F47A 3JTMA 2VWGA 1QG6A 2XAAA 5JDIA 4W82A 2HK8A 2OOSA 4Q39A 4P38A 3OA0A 4EITA 2WTBA 2BI8A 3MJTA 4E5KA 4FFRA 3JQBC 4HX5A 4O63O 3UCFA 3U49A 5EN4A 4BNZA 3U4HA 1I2BA 4IS2A 3AW9A 2JHGA 4MVJA 5DBIA 4XWYA 1Q7BA 2J3IA 3R3JA 3CSDA 5TGDA 1HKUA 1KC3A 3H5NA 3HN7A 2WSBA 3ST7A 3OBBA 1GEEA 2GF2A 4D43A 1ZKMA 3C7AA 3L07A 4PLFA 4AFNA 2OBYA 5F21A 4RVHA 2GN6A 4CMEC 1XA0A 4FFOA 2YFQA 3FI9A 2HK7A 3ON5A 1JKJA 2DBRA 4XEHA 1QV6A 4ONEA 2X4GA 1XKQA 2HMUA 3CTMA 2GN9A 4JROA 3R0IA 1ZK3A 1A71A 3BTOA 1ZFNA 4EUHA 2CDCA 4HBGA 4F3YA 3ETEA 3WWYA 3DQPA 2GDZA 1B8VA 1ZO8A 2DVMA 5F5LA 2JAHA 3FNHA 3F4LA 2W2KB 3PWSA 2VWQA 4A5OA 2LDBA 4MIYA 4GQAA 1Z82A 1FDSA 1H0KA 4UVGA 1LDYA 2BFOA 2ZB3A 2A35A 3MJ4A 1MC4A 5EQDA 1KY4A 2NLOA 4PG4A 2HUNA 1R66A 3RVDA 3WSVA 3M1AA 3ZHXA 2HJRA 2O3TA 4BGIA 2UVDA 5JY1A 1PS8A 1YDEA 3RBVA 1M6HA 4FFNA 1OAAA 4BO9A 5I8WA 3FSRA 3AK4A 3CE6A 4BNWA 2OZPA 4WE3A 1QYCA 1P45A 2W2KA 1KY5A 5BT9A 3A1NA 3PHHA 2ZYGA 4JLWA 2AEMA 1BGVA 1QV7A 4CM9A 1O9BA 5JDIC 3IMFA 2P68A 4GKBA 4CQMB 4PLWA 3WBBA 4IDAA 2V65A 5GZ3A 1FDUA 1PGPA 4PZDA 3HNPA 3WFJA 4RVGA 4J4TA 2JD1A 3VDRA 2VOJA 3WQSB 3ZV4A 1VI2A 3GZNB 3RC9A 3MJVA 4RF4A 1GEGA 4DQVA 2VRCD 3OJ0A 1VLLA 1WDMA 3DFUA 5ER6A 4PVDA 5H83A 4ALIA 4KWHA 1LRKA 4ALKA 5L45A 1Q0LA 1TT7A 4E32A 4CQMA 5L4NA 2BI7A 4FQ8A 2D5CA 1X13A 4F45A 2YV2A 4PFJA 3I52A 1LC3A 4FOOA 4Z3DA 1CDOA 5DNAA 2X9NA 4CR8A 1QXSA 3C7CB 1JWBB 3JQGB 1C0IA 1JKFA 3AUUA 2DUUA 2H5LA 4FDAA 5GY7A 3GZNA 1OOEA 3E1KA 2FN7A 3UW3A 5THKA 4OGWA 4ZICA 1MV8A 2FSSA 4CR7A 3RUCA 3ZWYA 3G1TA 3GY0A 3E6AA 2IZZA 4JGBA 1MG0A 4E6PA 2NU6A 1MUUA 1MB4A 3BZUA 1PJLA 1I30A 4BNVA 2HMVA 2X5JO 2OHXA 4IXWA 1MA0A 3HE3A 3ROQA 1BVUA 1GU7A 2PD4A 4DIBA 3WYEA 5JC8A 1O89A 2BF7A 1DXYA 3JQGA 4D45A 3CPSA 3KSDO 2BELA 1DFIA 3HWRA 1T2EA 3S2GA 1HEUA 1YXMA 2FR8A 3FBGA 2DKNA 1MC5A 1VSVA 4R16A 1XDWA 4JP2A 2NU8A 4A73A 1LX6A 4W6ZA 3BHJA 2Y1DA 4AJEA 4EGFA 4R3NA 4RZHA 4J9UE 5C7LO 1E5LA 1P31A 1TA4A 2PR2A 5U4QA 1A4UA 4RORA 2X0RA 3BMCB 1N8KA 3U09A 1GPDG 4XJSA 2O3UA 4F46A 2X58A 4LVCA 5G0WA 2J8ZA 4D7AA 1DBVO 3OSUA 3DMTA 3AY6A 4J6FA 1KBZA 1HE2A 3LU1A 3MEQA 3U4IA 5I9MA 3PLNA 2ZATA 5DOZA 1ISJA 5TQVA 5JCXA 4RGBA 3JYQA 5JFOA 4I9HA 3ZWXA 3UFXA 4ALLA 5DP2A 5L4SA 2FP4A 2C20A 1DHTA 3G1UA 1H9BA 4DIFA 4WUVA 4CUJA 3BTVA 3DDNA 2IE0A 2VWHA 1KVQA 3GVCA 2W98A 4R1UA 1U3WA 5KJCA 1PIWA 1VJTA 4DPKA 3SJUA 1UXHA 1KC1A 3I9MA 4HNHA 4EDFA 3LC7O 5LDGA 5IZCA 4WNCA 3QSGA 1Y81A 1U4OA 2DBQA 3DC2A 1N92A 2ZKLA 1SB9A 4J90A 3RKRA 4RLHA 2AE2A 3KTDA 1E3IA 3I4CA 4A0SA 4S3MA 4A7PA 1QLJA 1UXGA 1B7GO 2CUKA 2VTDA 4MKXA 5L51A 1E0DA 2AQKA 4HFRA 3L6OO 3RC2A 4Q3EA 5KJEA 2Q2WA 3W4IA 1XG5A 2EJVA 3HDHA 4BKUA 4LRSB 3BMNB 1I01A 1WZIA 2Z1NA 1YQXA 3E5RA 4OXNA 2PV7A 5HWSA 1A72A 1LSSA 4B7XA 4DPLA 3FNGA 4FS3A 3Q3CA 4IQ8A 4GWKA 5I9LA 2WEKA 2BFMA 2ET6A 4RPJA 5KOIA 5IDQA 2V7PA 3WJ7A 1EE2A 1Z7BA 2D3TA 1DIHA 2CVZA 1BMDA 3SEFA 3TOZA 2HAEA 3ADPA 4LCJA 4PLGA 4FB5A 1XU7A 1ADFA 3JD3A 3K92A 1XGKA 1HDGO 2P9CA 1NFQA 1NWCA 2QIOA 3DMTC 4RL6A 3BMNA 1DRWA 3M2TA 2AQIA 4JIGA 1GUYA 3VPHA 3KB6A 2X9VA 1YOVB 3KZVA 3WICA 3IDSA 4PG6A 2PGLA 4U7WA 4ZRNA 1OC2A 1M6WA 1RPNA 2DFVA 2J6IA 4TRNA 1PR9A 5BNTA 4ZVVA 5IN4A 3W6UA 4NFSA 3GFBA 5JCJD 2Q46A 1FF9A 2DTEA 2PLAA 4RPGA 2WE7A 2D4AA 4ND3A 5DBGA 4BL5A 2FPGA 3IAHA 2AEJA 2GGSA 4XKJA 2DQ4A 1LLUA 1KVTA 4ZHSA 5TT1A 2NVWA 1SPXA 4ALJA 1ONPA
chains in the Genus database with same CATH superfamily
3IULA 2I33A 4GEGA 4PGHA 1UBLS 1C0LA 3DEAA 2IOYA 4IZIA 4KNYA 2IOQA 1FTQA 3KE8A 3IERA 2JLSA 4PZYA 1YK0A 1IUPA 5CG1A 1PT6A 5EI5A 3ANLA 5JD6A 1ONNA 4O5AA 1G1AA 4O2BA 3WL7A 4ZOQI 3K9BA 1T24A 1W0KD 3MFYA 2GETA 1Z16A 3IAM1 1F0KA 4GRDA 1T13A 4ZI7F 4CEIB 3CR7A 4WESB 1UT6A 1YQEA 4EY3A 4C4TA 2CJXA 5LD2B 1BW9B 1L4MA 4AG3A 4D9BA 2HF9A 6REQB 1G5HA 2AX4A 1MQAA 1OIWA 2C2BA 4INZA 4MLZA 3D3WA 1KJ8A 3F6YA 1NBME 2R5WA 4KL8S 2NPFA 1HSZA 2QTLA 3STTA 3FIJA 1GVNB 4R1MA 3NFYA 5FEMA 2C2WA 3L01A 2Q2NA 4TXNA 4HC4A 4AECA 4CMAA 1XTPA 1GL3A 1YFKA 2W8ZA 3CBQA 3R3XA 4C0QC 2LV8A 5BQ5A 3BXZA 1AE1A 3AHDA 4ZT6A 1EJ6A 3JSXA 3TXAA 5ISMA 3O3CA 1VRWA 1TNDA 2PBRA 2FSPA 3PNQA 3QY0A 4RDIA 5AKGA 1Q7CA 1W581 4I1UA 4K1LA 5A4AA 5I6DA 1XA4A 1TUIA 2QSUA 3C15C 3PQ3A 1G8YA 2O8FB 4AL4A 2E48A 2J5BA 3NM5A 4JVOA 1R0XA 2HC9A 5FI1B 1V47A 2IP4A 2HU5A 2DULA 4TQ9A 4GE0A 2YNMC 1Q6ZA 3T9AA 2I4TA 1TYBE 2DF8A 2JC3A 3RQIA 2O23A 4QBTA 2OE2A 2EF0A 3WTBA 3O95A 1F2DA 5AJWA 1DWQA 1NRIA 3BBPA 4V0NA 3A2LA 3K72B 1FMJA 4RLSA 5EMKA 4CDMA 2RB4A 2WOOA 4ZREA 1Z3CA 4WXEA 2CXSA 3RGWS 4AYXA 3O8DA 2O7QA 4UVDA 4DGSA 4PPFA 4XWAA 5FNVB 3UMSA 1QGDA 5SV2A 1XNHA 1XO1A 1O2DA 1N7IA 3GFQA 2NP7A 1EU1A 5EXDA 1T3ZA 2ENWA 2ZIXB 5JS1A 2LVBA 1I36A 2ZBDA 3ESBA 1EB9A 2GPNA 1E59A 3R5HA 3T0IA 1RXVA 4J03A 1QTRA 2JLBA 5GV8A 4EA7A 2JFHA 4PZCA 4B09A 3JPWA 3MAJA 1QYWA 3GI1A 1FVXA 4KU4A 4YALA 3AJAA 4FD2A 4L8WB 5T3YA 1B6GA 4DBLC 3HWWA 4BVAA 4QICA 2MSCB 2FU5C 3IAM6 2R6CA 1HQDA 2UAGA 2V6BA 3JQDA 4IZOA 2O50A 3LF2A 1P7YA 3RYFB 2C5AA 4JZYA 2Q9CA 1KQOA 2NO1A 1DAFA 3SP1A 3U0BA 3ADDA 5JFTA 4W5TA 2WAMA 1VL8A 2WPDA 4L4RA 4OLJA 5ALHA 5ERGB 2OFWA 3RRFA 1VE7A 1JG3A 1XTZA 2UZ3A 2XITA 2WF9A 1WOMA 2WILA 4UUBA 3A9VA 2CNLA 4CT4B 3C2QA 1IVSA 3MM4A 5DYWA 3R5XA 3WLSA 3A11A 1FTWA 2P8JA 1Z83A 2ZJ6A 1S2DA 2XCSB 5DXFA 1J42A 4O4HA 1XJQA 3R5KA 3OBIA 1FW8A 4N7BA 4ZWNA 3S2SA 4TGLA 2A14A 3J81A 1X14A 1G55A 2J33A 2V6IA 2CE7A 3JQ6A 4WFKA 1XD2A 3IQDB 1BWQA 5KWSA 3G2NA 2NX2A 4PCAA 3N7TA 3ZWMA 5H3CA 3PGKA 2C04A 4YXWD 1D4FA 4O25A 3VVMA 3QV1A 4MARA 1IDN1 1R8YA 1R8SA 2I3DA 2PA0A 3DWEX 4S1NA 1CETA 5CAEB 3UWDA 3L6CA 1T1RA 5BUZA 4PGFA 1WABA 2AE1A 2DBZA 3HSYA 1X38A 1RWVA 3H83A 4ZRMA 4LKRA 2CJFA 2YJNA 1PBTA 3PXEA 1TZCA 4ALMA 3E48A 3KBBA 1LI4A 4BRSA 1AQJA 4EP1A 3SLKA 2XJ9A 1GQSA 5K0SA 4JLDA 1JAZA 2Q4TA 3TSZA 4W1PA 3KR1A 4BO5A 1N2SA 2BFBB 3IILA 5H3LA 4X54A 5KREA 4S1TA 4J2TA 4JLJA 2YFHA 1T0JB 1TLLA 3TD6A 1ZVQA 3NUZA 2KS6A 1YIOA 3IYLW 4YQZA 2X19A 1JFFB 3T35A 3I6IA 3M6IA 1YT5A 1ZL0A 4HAIA 2CXNA 1USUA 2FWAA 1XDGA 2W2PA 3GLIA 1HT2E 1O6ZA 3F71A 3AZPA 5AVQA 4QXAA 2CKMA 2C1XA 4J0DA 5LU9A 2GD1O 2NSHA 2GUWA 4ZAYA 3E53A 5TEVA 2B5WA 2EIXA 4LYHA 1U63A 1F2VA 3KZ1E 2BGMA 2CMKA 4MMZB 1VHLA 2L2QA 1C0KA 2VYQA 1E6UA 1OTHA 1XZMA 2P9JA 4OBBA 3DEJA 2PH3A 1DJNA 3ESCA 1V8PA 2KMLA 5TPWA 4IOJA 4DRZA 4ZO6A 1B8UA 4TYYA 3PNYA 1R0CA 4KLNA 4XQ9A 4DA8A 1IVNA 1CJMA 3PI7A 4IDEA 3DYVA 2DJIA 3PUKA 3B5EA 4NCKA 2CLFB 3NTRA 3R0XA 1XUOA 1JQ3A 1I3NA 2PEZA 2CVPA 4MZDA 2YWBA 4YTEA 5KTMA 2OHOA 1X0XA 3ELDA 4WXYB 3ISTA 4NNPA 4NMMA 2E7ZA 4HQOA 4KACA 1KEEA 2YHBA 1CRWG 5AKXA 1NXWA 3LCVB 4OLFA 1Y3AA 3CHYA 3DMNA 3FWNA 5DT2A 2BMWA 3RS8A 4CFZA 5IYZA 1UC8A 1PJ4A 4UAUA 2O48X 3V32A 3BL8A 3CUEF 4RA6A 1Y8CA 5F64A 4F2WA 5DYTA 4F8EA 3EFEA 4YCAA 3S70A 4C7KA 3J7TA 3IESA 2W4IA 4BDTA 1PEKE 5JH7F 3FDXA 4JKIA 5KQLA 1A1VA 1EX1A 4TS4A 1SUAA 2HF2A 2RHHA 4KE8A 4L0MA 1L7EA 1PR0A 3KZKA 1U6IA 5AKHA 3U9SA 4DAEA 3GLFE 2P2ZA 1WXIA 3N9IA 4DLRA 3IB6A 3FHLA 2A1IA 1CZLA 4B5LA 1C9YA 4I5EA 5A71A 1LDGA 3L8FA 2G70A 2K2WA 3FNFA 1GNVA 2DSNA 1TYAE 3FTCA 1MT3A 2H2DA 4H77A 4A3SA 1RKXA 3YASA 1HM5A 3OQVA 3RVPA 5DNUA 2CMDA 1STOA 3UCEA 1LK7A 1WXHA 3BK2A 2X8JB 1VE6A 3CRMA 4M38A 3HB0A 1IULA 2Q8NA 3NVMB 4LAFA 1YQWA 3KK0A 4WZBB 4EMBA 1JHUA 1XRSB 1OXTA 1T9HA 2I3BA 2NOAA 1K08A 4KHPB 4KTTE 2QM7A 3UV7A 1ZJ5A 1ZC4A 5CG2A 3AXSA 4JITA 3TLGB 4R0VA 3BJEA 3V4OA 1FDWA 4AM8A 4M7OA 1IRXA 1M2JA 1Q0ZA 2Y1OA 4TT3D 2A7XA 1WRBA 4D1YA 1DXHA 4F9GA 1N6IA 1QZ3A 1R0RE 2AKAB 3OIUA 1Q77A 3VNRA 3TXYA 2WIDA 4F4UA 2IP2A 3P96A 2HZBA 3I6YA 2QZ4A 1DQZA 4IM7A 5CX1B 1MG5A 1BEEA 5AR1A 2BIFA 5F9MA 3VPFA 5AM2A 1J0BA 1GR0A 1Z0FA 4TLMB 2XMSA 3HI6A 2V0GA 1G5RA 2CF6A 4LCEA 2BGWA 5AJHA 5H8WA 1OROA 1AXEA 1VHWA 1XTIA 1SKUA 1F8FA 3KCNA 1Y1LA 3HPRA 3L8HA 3Q7QA 3UICA 4HS4A 1WV1A 4IKEA 5JXHA 1C4KA 2EARA 3D31A 2BTEA 4A10A 2H6EA 4HQFA 4BJ1A 3N3BC 3G0IA 3BOSA 4H7EA 1LQUA 1ZU4A 2ZXEA 4YN3A 3PHBE 4AP5A 3NIWA 3BCRA 2BISA 2DFPA 2HLDA 2JATA 4PBRA 2C5LA 3C8ZA 4I4TF 3RSLA 4EZIA 1P75A 1B1CA 3P2YA 3KVNA 4HVAA 4PHGA 2GD2A 3BJMA 1JEDA 4YRTA 1IBLB 2GFQA 1BXKA 4LRTB 4RPKA 2W2MA 1JDSA 2JZOA 4B3MB 4EW2A 2GDJA 3L6RA 1L4LA 4I55F 4Q4DA 5EYPB 2EWMA 2IPOA 3W5SA 4FWBA 5F98A 1SQSA 3ISJA 3LX4A 4MS1A 2VBFA 3R1IA 2D0IA 3PIRA 2W43A 1ECLA 4LBVA 5EKXA 4WLOA 3T06B 3DYIA 1UXKA 3KYCB 4BB9A 1LI5A 2NZ2A 3DJFA 4PQGA 1CQJB 1NW4A 1U0HC 4WA8A 1XAIA 2IV2X 2ZPUA 2NO5A 2AQ8A 1QFZA 4HH3C 4Z1OA 5JH7B 4OQYA 3HB7A 1ULBA 1BU8A 2QTWB 4EPTA 4L85A 4CMBA 2D1SA 1W5FA 4J3FA 1K8QA 2HIHA 1NBEA 2P35A 3CO0S 4UEJA 3DEYX 5LN1A 1KJJA 1WF6A 1PN3A 1KDOA 1WB4A 2DKFA 4UTRA 5AVTA 2ZJ1A 2XTAA 4UUMA 3KL4A 5DLEA 1VJ5A 2HCBA 1YS4A 1AUVA 3OZVA 2I22A 1W48A 2XD4A 2YDYA 4P1ZA 2A30A 3PZRA 3MOGA 1L5LA 2EW8A 3TX2A 3TW4A 2QX6A 1ZD3A 3QYAA 2P4SA 1BQ3A 3FR8A 4BX9A 4H1TA 2V9CA 4AKHA 1XAHA 5CU7A 3R9WA 1FFHA 3PSHA 2ZUSA 4IICA 5KJFA 1EVEA 5JZOA 2GTIA 1XK7A 2ONCA 4FGUA 4PC2A 5A04A 4URXR 1LPAB 1NX9A 1E2DA 3A32A 4WN9B 1E69A 1NR7A 3QELB 1ZJYA 3AESA 1UBGA 4WGGA 1Z37A 4MRMB 3DM5A 4UBMA 1O4VA 3I2HA 4FGLA 4YJ2A 1FFXB 1PV4A 2WG0A 4FW8A 3BMOA 3NHBA 2HA4A 4BO3A 3R7BA 1Z5WA 4R51A 1DBRA 3EFOA 5KCMA 3DHVA 1JZSA 1TJYA 4N6OA 4NFHA 4BRWA 5AM1A 2VA8A 4YASA 5KKAA 1X2EA 2VPYA 5FUQA 1E0JA 4MYRA 2ZIGA 1M1YA 3SZRA 2JI8A 2OV2A 2ZKIA 4G56A 1U0BB 4S1PA 5GQSA 5JNLA 2UYHA 2DQZA 5ABPA 1BWSA 3LL7A 4LXIA 3VZCA 2BTOA 4IXMA 2B0CA 3T7IA 5DEOA 2JNWA 1DKRA 1EQ2A 3E27A 2NU7B 3B36A 4B3DA 1WBDA 4HYEA 3ZWCA 1QUEA 3TEFA 5HM6A 3LKZA 5FUWA 1KIFA 4FI3F 3D7KA 4HDRB 4KO8A 2HXYA 4NAUA 5IKEA 4WK6A 4B48A 4DNQA 5J4VA 1SUCA 4I4TB 2QQEA 4AJKA 2H7CA 3FJYA 1A88A 1R0BA 3MJDA 2FAXA 5B7QA 2V7TA 3BH6A 5HIIA 4AJNA 3FKSD 1ZJZA 1SRQA 3MWDA 4UDXX 1DIGA 2CWDA 4I55B 3IUPA 4IMRA 1F38A 3TPCA 3NTUA 1RKQA 1IHPA 3ER6A 2CNWD 3IP1A 5BUSA 1Y5LA 3O8CA 4RZSA 1CF9A 1CS0B 1IWOA 1RM3A 3EC1A 3LECA 1QCDA 1BKYA 3P4YA 4JVMA 4N65A 4BV2A 3HJNA 1XP8A 5AW4A 3DB2A 3KQLA 3RVNA 3ZJUA 4YAKA 1ZHFA 3MTEA 4V0MA 2OQIA 2O3SA 2V98A 3T1VA 1B15A 3V1TC 3W9SA 1GPAA 3DDWA 4JB0A 4COOA 3T6KA 4H7HA 3SBEA 3WADA 6Q21A 4RMIA 1EXWA 2BGIA 1U2GA 2P5UA 3TEJA 3QLVA 1CT9A 2O8CB 4K2HA 1U0JA 3B7PA 1D4AA 1XF1A 1T9GR 2KE5A 3R77A 4N40A 1ZHHA 5TSDA 1OBCA 1H93A 1E1NA 3A1WA 3QKRA 5E2AA 2R96A 4F1KA 1H65A 1EFVA 2AVNA 1W5TA 4PAOA 4FCTA 5HILA 4OP3A 3A14A 3IMCA 1RP7A 1VZ3A 4HV4A 2Q3CA 2UVPB 1XZJA 2WVJA 4FFMA 4JWKA 2A78A 3KKZA 3KU4A 3COJA 1IQUA 1Z0ZA 4KH1A 3HACA 4OBEA 5KNLA 1E9DA 5C37A 3PC3A 1V9SA 2G07A 2JLYA 1QX3A 2F48A 1P3JA 2A5FA 5LXTF 3UJHA 3TNLA 2FWIA 3QEOA 5K3FB 2WDPA 4HN4B 1OC4A 1RMYA 2ZIWB 4C20A 4IPTA 4HAWA 3WLOA 3D1LA 5D01A 4EK9A 2GNAA 4ZYXA 4BAGA 1D1TA 2WA2A 5DM4A 5DEIA 4MCAA 4XDGA 2XNJA 1IBSA 2HQSA 2V6GA 3DKKA 3H1PA 2OC9A 3WIBA 4XD2A 2NTEA 1U1DA 4XVUA 1HMPA 3MTGA 5DBFA 2FPKA 2XPCA 1UXJA 3AI3A 3GA7A 2Q5IA 3GG2A 3FOAA 1YU6A 3WNVA 1FFGA 3LY5A 3X3HA 4B47A 2YHIA 2J9FA 3AGQA 3DQQA 3T34A 4QQNA 2RHJA 3NHKA 2R2GA 3LCCA 1KJZA 2HEGA 3BB3A 2NO0A 4EG7A 3A2KA 2FEAA 3S2YA 3V1MA 4UOZA 2DR0A 4G9GA 3PJFA 1OZAA 3AEQA 5AUQA 2J7PD 1A3CA 3JALA 1JJBA 1JQJC 2FMTA 5I5EA 4FSHA 5BR4A 1JTEA 3BXOA 3VSDA 4MWDA 2WM9B 4OHFA 5BWNA 3HDYA 2ZULA 3AF6A 3T3NA 4M6WA 3O4HA 3DLPX 1EVKA 3OIDA 4KR6A 4GMFA 1MQSA 2WYVA 1JI0A 4LJKA 2VXBA 2P5TB 1GA1A 2IWHA 1TRHA 4NAHA 2ASEA 4KQJA 1GRRA 4TVKA 3T5TA 2WJAA 4KBYA 5JAUA 1JDVA 4XD7A 1Y9JA 1KF0A 4PYLA 4PLVA 3S99A 4Q15A 1U2GC 3B85A 4MRVA 4NRDA 3LKDA 1ESMA 3WA6A 4RU1A 3PE3A 3ZWNA 4EGSA 3LV8A 1DADA 2OCAA 4JLSA 3QQPA 4EHFA 4WECA 4W5NA 4ZVTA 5TB5A 1DAPA 1CE8B 4WWHA 3IIEA 4WJLA 1TB4A 3PFHA 3EVTA 2D13A 4RTJA 4LW8A 1B2LA 4ZRDA 1CD5A 5CNKA 4Z9FA 4CM5A 2YY7A 4DLTA 3IAUA 5C8ZA 4NYJR 4L2IB 4Q93A 3LHDA 1XK6A 4YBRA 1E64A 4MI6A 5FBQB 3OUUA 1WLSA 3SYTA 1XZQA 5HW0A 1YO6A 2J5RA 1MENA 1PEYA 1NMZA 1BVRA 2QUHA 3PWKA 4PY2A 4WTOA 3A04A 4Z8YA 4E46A 1G21B 1RYHA 4JODA 5BN3A 1MEEA 1BZYA 3GFOA 1FMFA 1GSOA 1DEXA 4KGDA 4QDTA 3RANA 1QRTA 3AEXA 2WIBA 4L9SA 5LXTB 2D1RA 1NVEA 2PWAA 4TWZA 1X3LA 3BX1A 1KY2A 1V96A 1JX6A 2EW2A 1PAUA 2AG6A 3FZNA 4KO3S 4PVCA 2O8EA 4NENB 1HYBA 1QORA 1BVHA 4EI2A 3V6MA 1TYCA 3E7DA 2OHHA 3WDMA 2IZ0A 4KB5A 3DDSA 5JPIA 1I10A 2AGVA 5K45A 2BFNA 3H9QA 4H9GA 3IBGA 1QQ5A 3CA8A 3MINA 4IS3A 4MO2A 3K5WA 3NXSA 3OCWA 1GKIA 4KLZA 4QQKA 3HZHA 1P9NA 4NFYA 1XU9A 3W4KA 3OZEA 2P5SA 4B4WA 1N57A 3JW8A 5KYWA 3DZKA 4I9NA 3OFND 4IFEA 4EL0A 2GEUA 3FRJA 4C03A 1QANA 3BXHA 1Q0QA 4KXNA 3ZWAA 4U2GA 3PC2A 3C24A 4LJ5A 4KAXA 5HMMA 3KFXA 3DSRA 3NWJA 1W4BA 1ND5A 2LIVA 3NH9A 5DSTA 1OIXA 1WR8A 3I2GA 5ESDA 1TLFA 1WU8A 3WHIA 4ZT3A 4BAUA 5IABA 2EKZA 1VJ1A 3I6QA 4YI5A 4MUAA 5DASA 3K20A 2A9OA 2ATIA 1I2CA 3KB8A 5HJ5A 1PJAA 4YRCA 5FKJA 3ZDZB 2JIMA 3QY9A 2OWEA 2C4MA 5K6RA 1K68A 3V4RA 4INPA 5TQ0B 3U4QA 4ILKA 4IV8A 3O4GA 1PL6A 3EFHA 2EQBA 1UKAA 5GGYA 1K5PA 2XCUA 1SAYA 4FYIA 2Q1UA 4QLOA 4V0SA 3LUKA 4MS4B 1SR8A 5ARDA 1QHNA 1CY2A 3RKSA 1WCIA 4PQYA 3A6HA 5E6RB 1RAHA 3RS4A 2QP9X 3T61A 5DCYA 5AHRA 4A26A 2MCFA 1F06A 4RK7A 2L18A 5C0OE 2NXJA 4K05A 2IXFA 1W85B 4RANA 3UJCA 2WTUA 2XOEA 2ROQA 4ZA2A 2XXAA 4Y7DA 3O4VA 4UREA 3TZEA 3KKNA 1NYTA 3OZAA 4A8TA 3T7JA 4Q48A 4FNGA 4FBMA 4R4JA 1H0RA 3MCVA 1MJHA 3LSTA 5EG5A 4IIXA 1QIDA 2YXNA 1NN1A 1Q5PA 2ZR7A 4QPCA 2HF7A 1LKZA 5K0NA 1EFAA 1R0SA 1KKLA 5ED4A 2Q6OA 3M2PA 3SJ7A 3SVTA 3KHSA 5EHIA 4AJ1A 2C0PA 4WVFA 4C5AA 2A5YB 3KALA 3EPHA 2CNKA 3DMFA 3TRIA 1FDOA 3GQVA 4WSOA 4RH3A 5CLGA 4Z9XA 1DVRA 3ZHVA 3M5CA 3SYLA 4ZYUA 2QJFA 2J07A 5CT6A 1C7ZA 2BR5A 3HFRA 5I8ZA 4BPBA 4MRSA 3NC4A 5LB4A 5TVKA 3R7AA 3UV3A 1SHLA 1M6YA 1N25A 1TIKA 1L5GB 5LQCA 3FVWA 4R9NA 2HTFA 5GV7A 4D42A 1E96A 2YUIA 3PPIA 3TXXA 1JPUA 4OUKX 2F1HA 1A97A 2FLKA 3ZE6A 4H7DA 3EEBA 3EDCA 4MV3A 2ECPA 5D2CA 3TSOA 2VDJA 3TNDA 4QUGA 1H6DA 5EFZA 1QJCA 4NNJA 2JFGA 4K3VA 2QY6A 5H7XA 2RI1A 1R6AA 1Z0IA 3KJIA 4BMPB 1DAEA 3GEMA 3PGA1 3QU5A 3D4PA 4Z0PA 3AF3A 4TN5A 2ONYA 4E2XA 4EO7A 1NFFA 3STUA 1MQ9A 3OJOA 4UTZA 4LYAA 1FFYA 3CYFA 5FORA 4MB2A 4PO1A 4P2BA 4JBHA 2FXVA 5LQNA 5CURA 2B6HA 1LTQA 3H6KA 3C85A 1FS4A 3PB3A 3IE2A 4XM2A 4G63A 4RE6A 4A0FA 1B1AA 1RM0A 2PLFA 1T4MA 3B1XA 4DLAA 4C4YA 5AW5A 4Z3OA 1NMSA 4ZVPA 5I7HA 4HGYA 1A5ZA 1P81A 1SHZA 3GJ0A 3WIVA 1FSPA 4CNBA 2D7CA 2GQ0A 1NSYA 1Z17A 2GEBA 4NATA 2FN4A 3OZCA 1V71A 1Z0AA 1NRJB 4G2NA 1HDXA 3KJQA 3VUEA 4C1BA 2GJ4A 2AJCA 3LOQA 5IBPA 3AL0C 2EQ5A 1RQRA 3CZ4A 4LHXA 5HBRA 1LRJA 4DCMA 4JJGA 3WL3A 4QXRA 1UBKS 4OSEA 1YRBA 4NQZA 4MK4A 4RFVA 1E2EA 2I4RA 1CUCA 3AEUB 2WZQA 3ILYA 4WZAB 5BV8A 1KGDA 1L7QA 2AUNA 4YRIA 4Q34A 2EGUA 4I46A 4OYHA 1LDMA 2B9VA 4J0GA 3TDKA 4QAQA 4ER5A 3KQNA 4IF6A 1SVOA 3DQZA 2Q5EA 2B21A 2BFDA 3PHCA 3PFFA 2BI4A 1V5FA 1ZC3A 1GRQA 1GG2A 4HGRA 1EFPB 1EKXA 3MCAA 4NHOA 2HMYB 4NWIA 3RYIB 3HGMA 3SBOA 5DGTA 1THZA 2UZ4A 1YHNA 4C04A 2NU9B 1UR5A 4IX9A 4MS3B 1A8QA 4LCBA 5JC1A 4BNDA 1KO7A 2HFKA 3PUWA 2H5EA 2R84A 2VHXA 4NYMQ 4OUDA 5H3HA 5L3ZA 5LYJA 5LOVB 3GVXA 1T2NA 4MEAA 2VDVE 3WO1A 2XB2A 3H8SA 5DNDA 3MMPA 3CVVA 4LDRA 4DSUA 4JP3A 4G86A 1L5KA 2G0NA 4XWKA 3QKWA 4MR9A 4Q4CA 1NM5A 3GJQA 3M5DA 3PD1A 2WLTA 3SSMA 1PNQA 1M1YE 2PRJA 5K0LA 4LDPA 4LRWA 4J49A 3DL4A 3TYXA 1GRVA 1E66A 1Z73A 1QIJA 3WDSA 3BGVA 1LI7A 1W88A 3KSUA 3MSCA 4Q1BA 1RLTA 5BQPA 3LJKA 5EHNA 3NNSA 2V4ZA 4M1MA 5HRAA 1G18A 1BMFA 2IC5A 2JAUA 4IIVA 4MQEB 5LA6F 1AQ6A 4ZQEA 5ENVA 3RTGA 2UYOA 1E98A 3K9HA 1I9CA 4FYJA 5JCPA 2DQKA 4CLOB 2EW1A 5AP9A 1P9WA 1RZRD 2F3UA 4UHEA 4MP8A 1G7TA 4EEXA 2IOFK 1A2BA 1K1EA 3CX6A 5LLSA 3M89A 4ZVRA 3LFUA 3QIAA 4WVLA 1RKBA 3SIXA 4JOBA 4NU8X 5FOWA 3TO5A 2N1MA 1H4QA 2QR5A 2IPLA 3B1KA 1I1OA 3F9RA 2OXIA 4HNVA 3TSYA 2VT3A 4OXRA 2O0MA 1W0JD 2WUFA 1QOPB 2P4QA 1JR3D 3E9QA 3QEMB 4G5GA 3V4VB 4XFDA 4WOKA 3ZJTA 2Y4NA 3EGIA 5EP4A 4G5RA 4AU1A 1W5BA 3NAZA 1WS6A 3QH4A 4K88A 3REQB 3ZCXA 4MO9A 4BMCA 4CIYA 1DQRA 1W5AA 2C07A 4V0ME 3TQTA 4R41A 3JATB 2ZQ5A 3KQTA 3L0ZA 1UXOA 5D6OA 2XDYA 4TV8F 2B30A 4K6HA 2I8CA 3T7AA 3TH5A 5F1YA 2C54A 1IZ0A 2X9QA 3IDAA 2NTNA 2W6JA 2Y2UA 3L4SO 3BQMB 4RMNA 5IT5A 1L4GA 2WHPA 4GC5A 5TF4A 3QE9Y 4IV5A 1Y6JA 4GQIA 1UBMS 4D9NA 1KS2A 5HUQA 1C14A 1UT8A 5FI5A 5IAKA 3EASA 3AHJA 1JKXA 4S04A 3ROGA 1SQ5A 5E2BA 2AG5A 3WMWA 1KJWA 3FZYA 4A15A 4RY9A 5IHPA 3ZXIA 1Z0JA 1M1NA 1F8YA 3B51X 4PW0A 2C7QA 1IQPA 3FF1A 3IKMB 2HRQA 1E2IA 3QQ5A 1E4VA 2PT7A 4O5OA 1ODIA 4H3KB 1UM9B 4TLEA 3UCXA 1FK8A 1Z4PX 1AKTA 5E6UA 1NVTA 2PNFA 3V4PB 2PLWA 2WU8A 2FPIA 3OY2A 4EJSB 4F6RA 2EZTA 1MVNA 5F52A 1UBRS 4FCWA 4Y0VA 5IARA 1I1QB 2QW0X 3TJZA 2D5BA 4MMYB 4BMYA 4H6XA 5C8XA 4BRUA 1BDBA 5JADA 1RHRA 1N2GA 5JE8A 2H1HA 1FX0B 1V11B 2Y1WA 1NM5C 3QXSA 3F1LA 4ODIA 4ZQGA 2YIJA 2GNOA 1X1SA 2VRNA 3IKLA 4WFIA 4XH9B 4KPFC 1WSAA 4U00A 4CCSA 4CLHA 1GQYA 2NZUG 4WD3A 4BO2A 3AMVA 3RADC 1G19A 4WLVA 4IIEA 1OKKD 3NRJA 4EGCB 2ORVA 4QAJA 1VIMA 1N2CA 1IK4A 1B74A 2IEZA 3MPUA 4S2UA 5EGSA 3TW8B 3A36A 4NI5A 2VP4A 2OFPA 1X7WB 1ZX1A 2QN6A 4MGZR 2ZZKA 4Q37A 2D74A 5A6SB 3Q40A 4D98A 2JGIA 4G84A 5EJ7A 3BD8A 1M8JA 1TDJA 4LXGA 2OCBA 3MWGA 5ILQA 1K97A 2XT6A 3RK4A 1IPFA 1RAIA 4IGFA 4Q66C 1KFCB 1UBNA 5CVEA 2JG3A 4ZYWA 5BQXA 2Q6KA 2PU7A 4MAAA 4FFDA 4AVYA 2Z5VA 4JR0A 4PX9A 5BSGA 5JNSA 3C8UA 1XL0A 3K1TA 4R9RA 3SJZA 1E8DA 2YASA 4ND8A 5FA6A 1NI4A 3UMFA 4G81A 1QIEA 1SCIA 4Q1AA 6ABPA 3ZDQA 3TINA 4TTQA 1DJPA 2WF8A 3KYIB 4JNKA 1M8KA 2PL1A 2AJTA 1Y37A 2VAPA 1A69A 4UAVA 2X4DA 4V0QA 3ZN2A 4OFBA 2GUGA 2QQGA 1Q20A 2RHTA 3R6WA 3THWB 3LHIA 1Y5RA 3INRA 1A1SA 1I5EA 1YTLA 2J7KA 2QTHA 3CJQA 4YCLA 3MS4A 5FTLA 4AY3A 3IOYA 4TV8B 4LMPA 3PR2B 4P4UA 1XHLA 3HH8A 4JJZA 4A0GA 3TDNA 3TRJA 4HGOA 1FVFA 1P6QA 1UIMA 4B1FA 1HZJA 1ADGA 4BVJA 4JI1B 1BE8A 4YX9A 2PXHA 1HYEA 1TMKA 3TRHA 3VU9B 4HH1A 2FMIA 3MUEA 4I5DA 3HP4A 2GN8A 2RGEA 4JH0A 3EODA 4QXOA 2EP7A 4UW9A 4YACA 3WNZA 4B79A 2RAVA 4D44A 4MDFA 3SEZA 5LKRA 1WXXA 3K1AA 1N6RA 4ETIA 1KOLA 4O0LA 3WTCA 1PX0A 1RW4A 2QDXA 1DWOA 3PRYA 3L7CA 3NASA 3Q7EA 5EWLA 3SAJA 3LNCA 2JRLA 4ZCRA 5CT8A 5FOQA 1BCRB 3PC8A 4BE4A 2ZIAA 4CG2A 4DDMA 3VR3D 3AIIA 1IL0A 1KE1A 2E5FA 3P45A 2ZAIA 1KRWA 1TM1E 3H0KA 2YHUA 4FLMA 4L8GA 5CEFA 2I62A 4FYXA 3FYUB 4KUEA 3VX3A 2EKLA 4JEIA 5FPQA 2MSWA 3RVRA 1K7XB 5F12A 3MMXA 4KPYA 1W4LA 2NO6A 5DNWA 1OXVA 1FYDA 1V8DA 2XB6A 4XGNA 5AHXA 2G25A 2HWKA 1PTJA 4FXPA 3GVIA 3TGPA 3IOEA 5ELMA 1LLCA 2EYUA 4LSMA 4V3BA 3TRKA 4D8WA 4CKZA 5KS2A 1L4FA 1Y0BA 4YDHB 1IN8A 2H0RA 4YCSA 4NVRA 1KHTA 1VSQA 3Q0IA 2H1VA 2A88A 3QRWA 5CXSA 3GRRA 1ZH8A 4LY6A 4HGZA 4ZOEA 3RIGA 2Q5CA 1AK9A 1W76A 3K1JA 4XR4A 5CA0B 3I9OA 5LIPA 2PR7A 3OPYI 3IAFA 3H8JA 2IGTA 4ZCMA 3E5NA 1WCV1 1E3EA 1AKRA 1KHHA 3AEZA 4WLNA 4BFZA 4KXVA 1J20A 5FV4A 4M1QA 2NZXA 1GXSB 4OD0A 4FTWA 4KAAA 2LCFA 3PICA 4ZC1A 5JNUA 1TEZA 3PYLA 1OJLA 1OLUA 4QEDA 4BB5A 3D81A 4EKEA 4DB4A 1Z2PX 3A1CA 2ZT8A 3DCIA 3JQ8B 3V4LA 2YFYA 2QL6A 3P2IA 3VDQA 2JW5A 1EDZA 4BRZA 1H2YA 5HTOA 4N5LA 1VXOA 2XI4A 2M6KA 4I2VA 1JDUA 4I08A 1VBKA 3L1KA 4JMPA 4UDNA 2DWCA 1R4NA 2GBIA 2QPLA 4KITB 4OX9B 1JEOA 2XRZA 2YVLA 5DHUA 2WI8A 3EVFA 1KO5A 1MZVA 1RXYA 3HVKA 4LC1A 2AR7A 4KOAA 4U02A 1J9GA 2QR2A 2YJ6A 1OPXA 3PQEA 4Y98A 5EMHA 4Z4EA 1EJBA 2FETA 2H1WA 3O4FA 2I6XA 1E89A 3KEOA 3NU1A 3WGJA 4D3FA 5AW3A 4DG8A 2JGKA 4CUKA 3FWYA 3RW9A 2F62A 3OHPA 3VH4A 2C4TA 1FDTA 2BAGA 3Q7RA 4IYJA 5CFPA 1Y34E 5H59A 2FPOA 3WNCA 3I1YA 2X0JA 1Q74A 3EEYA 5IVPA 1IWBB 3PC8C 4YFYA 3G0GA 4MV8A 3CLUD 5EESA 2CDBA 3WQQA 3OQ6A 1TKCA 1GFSA 5MDHA 3TL2A 5L3SA 1ZU5A 4YJGA 1LPPA 1E6LA 1XCBA 2PZMA 4N18A 3U44B 3TMAA 4BNKA 1OH6A 1EDDA 3EJ6A 3E4DA 3ETGA 4MW9A 5JAMA 3DEZA 4EVSA 3NAMA 2GN2A 3BSYA 1DKQA 1ZK0A 1V6SA 3JQAA 3Q85A 4OHRA 4X1YB 4QWMA 3SSAA 5BWCA 8OHMA 1R0ZA 1PTJC 2WWVD 1CK4A 3UENA 2C7OA 1TJ3A 2WV7A 1VSTA 3UQZA 1W36B 5LMNB 5TT0A 1CEEA 3TFQA 1KAMA 2EFHB 3MTQA 4ZARA 2RARA 4CU5A 4KXUA 3S2UA 4IDGA 3OCVA 3D64A 1NYRA 2ZS9A 3KOMA 2ZDGA 3AUKA 3LLMA 2X8LA 3F73A 1T0UA 3AO0B 1ZIOA 1ULTA 3L77A 4YEDA 4Z3KA 1IZYA 2ZOSA 1JG7A 2PT6A 1UZNA 1FZQA 1NMXA 4BO7A 1USWA 2B82A 3HUUA 1C50A 1SVMA 2XKJE 2ZITA 3UATA 1JIUA 3A1TA 3OIWA 5CA0F 3E84A 4EG8A 3H2ZA 3UV6A 4B3XA 4BEBA 4NU0A 5CH5A 4WJKB 4J75A 5D3MA 1J70A 2B4KA 4YIHA 1ZRHA 3VVLA 5THQA 1SB8A 2NO9A 4KPUA 1G59A 4LF7B 4ENTA 1HG1A 4R71A 2I6SA 3GB9A 4GP9A 1SU6A 2ODQA 4KHZA 3AY3A 2CXQA 3W04A 3OQIB 5GONA 1OFTA 2OHGA 4PXSA 2OZEA 4EHHA 2QJTA 4XR9A 3WGIA 2ZS8A 4ZT2A 4MPDA 2N75A 1D1QA 2X5OA 1YVUA 2NAFA 4JD5A 3T0GA 1RQXA 5BOSA 2ODAA 4OJKA 1JBKA 1PEDA 4IJKA 1HXHA 3HR7A 3D8SA 5HDBB 2B8WA 3TR0A 1DAHA 3GAZA 3PU6A 3WLJA 3NJRA 1HETA 5K4GA 1OX6A 5J47A 1FFCA 1H05A 1KNXA 1ZI6A 5DYGA 3LQ1A 4FM9A 5IJ0B 3E0QA 2H1FA 5DM0A 1DV2A 1HE8B 2UDPA 2QNIA 3G6WA 3D6MA 4JFRA 4E21A 5EHZA 2IEIA 3V7UA 3CQ9A 2PQMA 1J0AA 1TK9A 1KS9A 1A50B 5BV0A 821PA 1KA9H 3JQFA 1VM6A 1Z4JA 5AVJA 1CR1A 2IKSA 4AUMA 1UF9A 2PD3A 3TJMA 3L3BA 1VLMA 5K8IA 1I24A 1C3JA 1F9AA 1ABBA 2GRJA 1CUXA 2VYVD 4GFDA 1C4XA 4I19A 3S5JA 4U0KA 3H4MA 1HL3A 2IU3A 1FRQA 4QL3A 1RWKA 4MV6A 5JCZA 2AJLI 2YQ5A 4MWEA 2NUBA 3IBTA 4P35A 4OREX 1Z6QA 4WCFB 1WHSB 4HX9A 1V7QA 3HCPA 2I03A 3O9MA 1OUMA 5JQGB 1Z7EA 5IC5A 4JA2A 5IMBA 3PL5A 4IVPA 3OHMA 3VYSB 3FTNA 1WVGA 5A5VA 2HSGA 4KQEA 2FV8A 3LGSA 3HMKA 5HBGA 1T6XA 4LDNA 3TPZA 4WIAA 4YJ3B 1FS6A 2C92A 2BE9A 2ZP1A 3AT1A 3H9UA 4YUVA 1TF2A 3CW2A 3I2KA 4P80A 4RHCA 1KH1A 3HY6A 3MCUA 1CQIB 1OFUX 4NH4A 4C7VA 4DV1B 3BAFA 2NO4A 4A91A 2R86A 3RT7A 4N7JA 4B9AA 4D4MA 2H7XA 1CZRA 1K8XB 1L4KA 4E5UA 4AUKA 5ICEA 2XGJA 3RT9A 3VH2A 1US8B 5AHOA 2D4HA 2H4FA 1YCDA 2VJOA 3C39A 4C0JA 2Y1EA 4UCWA 4UUOA 4IIYA 3CRRA 4TTIA 2J3EA 1A2KC 1ADCA 1S2IA 2OFOA 1HK7A 3SPXA 3UG6A 1TMGE 3FCOA 3KRTA 4KKVA 4MOWA 4D9KA 5FL7D 5IPFA 2P9ZA 2IEDA 1Z88A 1PSWA 4XLTA 1TAQA 2JFUA 1U7TA 3QU4A 3VISA 1K6MA 4MUIA 4W5OA 2O2EA 4LZJA 4UZSA 3I9V6 4MR8B 1A5BB 5KAMA 2VNJA 3NTLA 1KYWA 1OZHA 5KINB 3K9WA 3O1JC 2G9ZA 3AR3A 1P73A 1VCOA 4I8XA 5EIOA 4ZAVA 2Z2KA 5FHRA 1UDAA 5AW1A 2FZ4A 3O90A 4KSYA 3UHFA 3IHLA 1I5OA 2W48A 3EE6A 1HC7A 5F4BA 3CIOA 3JQFC 4KN6A 5DF1A 2JFNA 4A2WA 4TZTA 2RGUA 1Y8RB 4YFVA 2PQ2A 1C1XA 1UKZA 3FTDA 5G1OA 1R0YA 6NULA 4XPIA 3P27A 4MB0A 2WY2D 4ZVLA 2F8LA 1QH1B 1YIDA 4TV9A 1G8AA 1K86A 4NEQA 1QLWA 4LYDA 2BR4A 2R66A 5IF9A 4DQXA 3HFJA 1SVKA 1GU0A 5D8DA 1GZHB 5A03A 2A33A 3H9EO 1AZSC 3L2OB 4RJ2A 2DPXA 4JQZA 1Y1PA 3T5DA 1WMSA 3C97A 1XA3A 2IZ6A 3MWJA 3O75A 2MTBA 3LZ6A 2FCRA 1FTGA 2ODNA 1UP7A 2QMEA 3GAMA 3ESDA 2X8WA 1KQNA 3FNEA 2R6GA 3GXOA 4Y1FA 5BMVF 3B9BA 3C8MA 1XTJA 1I6LA 1I0IA 1OYWA 2JBAB 3D0KA 1PD1A 4KVZA 4XYGA 5FCDA 3M34A 3F6PA 3IIIA 1M0SA 1DIAA 3DHWC 3ODGA 4NCAA 2G4VA 2G5GX 1VGRA 1P2FA 3U7QA 2BC9A 3MGCA 4DYHA 1G4UR 4MQ6A 5CTJA 3IT0A 1XZNA 2ZJ5A 5LPNA 4R1SA 4D0RA 1EUQA 2GOYA 3L8EA 4C2BA 1RQPA 3RRNA 4IUYA 1MFZA 4RMJA 4I7EA 3MJCA 3K1YA 1U6KA 4ZT5A 4PWYA 1N2CE 4KYTA 3VR6D 1BOFA 1U8ZA 4PCLA 1V41E 2V3WA 4I6EA 4HNQA 4UBJA 1XQ9A 5D7BA 3RIHA 3WZ2A 4C7XA 3DO8A 2ZUDA 1R8JA 3BDVA 4URZR 3KDAA 2OV8A 1LS1A 1E5QA 1VL6A 3HBLA 4E0BA 5B36A 1P61B 4I1IA 4JBYA 2IH5A 2XDQB 5BORA 2I3GA 1N78A 3HEBA 2ZS7A 4PZ9A 5BRNA 3IAXA 3RFVA 3WWDA 1PTKA 5BWOA 1QU3A 3VVCA 1GSAA 1OLOA 3P5BA 4D5GA 2AXNA 1X6VA 1RMQA 421PA 4B3GA 3OM0A 1D09A 1OU4A 2GZ2A 4ARAA