3GDFA

Crystal structure of the nadp-dependent mannitol dehydrogenase from cladosporium herbarum.
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
267
structure length
267
Chain Sequence
b'MPGQQATKHESLLDQLSLKGKVVVVTGASGPKGMGIEAARGCAEMGAAVAITYASRAQGAEENVKELEKTYGIKAKAYKCQVDSYESCEKLVKDVVADFGQIDAFIANAGATADSGILDGSVEAWNHVVQVDLNGTFHCAKAVGHHFKERGTGSLVITASMSGHIANFPQEQTSYNVAKAGCIHMARSLANEWRDFARVNSISPGYIDTGLSDFVPKETQQLWHSMIPMGRDGLAKELKGAYVYFASDASTYTTGADLLIDGGYTTR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable NADP-dependent mannitol dehydrogenase
molecule tags Oxidoreductase
source organism Cladosporium herbarum
publication title Crystal structure of the NADP-dependent mannitol dehydrogenase from Cladosporium herbarum: Implications for oligomerisation and catalysis.
pubmed doi rcsb
total genus 92
structure length 267
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.138: Mannitol 2-dehydrogenase (NADP(+)).
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gdfA00
2GGSA 1O9BA 1UXGA 2GUGA 5DP2A 1O94A 5I7SA 4BMSA 3AFMA 4J2HA 2IDZA 1LLCA 5AYVA 4J7UA 1XYGA 4BO5A 3CH6A 2CVQA 5TJHA 2QRKA 2ZYAA 2GD1O 2I6TA 1ZEMA 3FBTA 3H3FA 3JCZA 5KKCA 1HSOA 4WLFA 4Q39A 4OKNA 1UXIA 2HU2A 3DHEA 3IAHA 2I67A 5IXYA 5IJZA 4AJJA 3IC5A 2B69A 1KEUA 3CIFA 4LISA 4UUMA 2Q2VA 3IOYA 3ZNOA 3RFVA 4XR4A 1GD1O 1PZHA 4M86A 4YXFA 5I9NA 2YY7A 4A26A 4G81A 3WFIA 3MJCA 5CPBA 2DQ4A 4D41A 4JK3A 1B2LA 2OFPA 4E21A 3RU7A 1GYPA 3B1KA 4M89A 3GMDA 1MC4A 2O7SA 4CQMB 1LRKA 1A7KA 1ZSYA 2WYVA 1VL0A 1QLJA 2ZB4A 4IJWA 1ZK0A 4PGFA 5EPOA 3GRPA 4CLHA 4UULA 4CM7A 2EGHA 4IDAA 5C7IO 1S6YA 2X5OA 3UUWA 4B8ZA 2A94A 3O4RA 1DFGA 1E7SA 1VLLA 1SZJG 3OJOA 4CM8A 5F1OA 5TT1A 4BGEA 4OKIA 3PXXA 5G0TA 5JPIA 4LVCA 3ZV4A 4II2A 1YO6A 3JD1A 5F3RA 3H9JA 3STHA 1ZCJA 4AJIA 5B4VA 3WWYA 3TZKA 5L7WA 3WGQA 1PEDA 1A5ZA 1LSUA 4UREA 4CMJA 4U5QA 4YAIA 1H94A 1PS0A 3RFTA 3HZZA 2FY8A 2FOIA 1N1GA 4JJFA 3HQ4O 1C0IA 2Y1DA 1GCOA 4YWJA 4L74A 4BNNA 1C0PA 4E2XA 4QUKA 3Q9UA 5LC1A 1HE5A 1ZSNA 3SLKA 3AU9A 2DC1A 2DTXA 2Y0CA 3F4LA 3M1LA 4IDGA 4ILKA 5JAIA 4GQAA 5FYDA 1Z7EA 2G82A 5B4UA 2H1SA 4FFPA 3HDHA 3DMTC 2XPCA 4QO7A 3WB9A 2AHRA 1SMKA 1Q2XA 2E37A 3KYCB 1L7EA 3PYXA 5A3VA 1R0LA 4FFLA 4AJNA 1PZFA 4RPLA 3LYLA 2NWQA 3ON5A 3GNSA 3L6OO 4XYMA 5JMWA 4BGVA 4ALIA 2E48A 1FF9A 3KLPX 4JX8A 4EJMA 4LVUA 4R41A 3RBZA 3LC1O 2WE7A 3RVDA 2PGJA 2HMSA 4H15A 3ZZNA 3OICA 5I8ZA 4FIZA 2VWPA 5A5EA 4ALLA 3FR8A 4BB6A 4CLXA 2NU8A 3OJFA 1SC6A 3I9JA 3KHUA 2WYUA 4BO3A 3DMYA 5KJCA 1PGQA 1GZ3A 1WLYA 5CDSA 4CR8A 3ETGA 4GI2A 1LLUA 4O59O 3ZWVA 4F46A 1RM0A 2R6JA 1K5HA 1O5IA 4O1MA 4GMFA 1PJBA 3ZW8A 5A03A 1C14A 2HMWA 3DBVO 3FNEA 3RUEA 3ANNA 1B0AA 1U2GA 2DPGA 4MVJA 2TMGA 4MKZA 2IODA 3GRKA 1I3LA 2O3QA 4GAEA 1MGOA 4DL9A 2HQ1A 1AHIA 3JYOA 2I76A 1P45A 4ZGWA 3WGYA 4NJMB 3BA1A 5A4DA 1PJTA 5A1TA 5L4LA 1T25A 5A9SB 2PZLA 3ZWMA 4DIFA 2FPPA 5AXBA 3RIHA 1M76A 4G2NA 2LDBA 1GEEA 3I9MA 2V6GA 3GVXA 4NFSA 5G4KA 3RBXA 4RVFA 5KVQA 2NV6A 2QX7A 4BNJA 3D5QA 1D4FA 1GQ2A 1WXDA 1TXGA 4QFCA 1OC4A 4NJMA 3TFQA 4E2ZA 3UICA 4M87A 4YJHA 3GG9A 5L7TA 4HFJA 3NDRA 4QO8A 3LZ6A 4XD2A 4MJLA 1NBOA 1Y8RB 1XQ1A 1CERA 3E18A 2A4KA 4HFRA 2DUUA 2CVZA 2RCYA 3DB2A 1YBMA 1XLTA 2JCXA 1LDEA 4PIVA 1NQ5A 3OQBA 3UH1A 5L95A 4NFYA 4C4OA 4O6VA 2JCYA 1I33A 4OH1A 1KOLA 1QRRA 3AW9A 3L9XA 4KDEA 4RV9A 2X5KO 1IPEA 4GGOA 5CDGA 4ITUA 4XJTA 3PHLA 5L51A 3ADPA 3EZYA 2GZ1A 2BI8A 4DPKA 4MPDA 3NT2A 2Z5LA 5KVVA 3ZHZA 5FEUA 1OMOA 1F06A 1X0XA 4EDFA 3JQGA 4DWVA 2W98A 1YS4A 4YEDA 4BNZA 4MVJG 1ADGA 1VSVA 3QQPA 9LDTA 1B8PA 1HLPA 2POQX 4L9RA 1NQAO 4WK6A 3WBFA 2VUUA 3VZPA 3DXFA 3DBRA 3JQEA 4MDHA 2HKIA 4YRDA 3H2SA 4EUHA 1NR7A 4J1SA 3R0IA 3E5MA 1HT0A 3I9OA 4FCCA 1XWFA 3HHPA 2D8AA 3GVCA 3PTZA 4KQWA 1EK5A 1B3BA 5IAAA 3UW3A 1HE2A 3BTVA 4TWRA 3WYEA 5TSDA 3V1YA 1UXKA 3K73O 1JKJA 4TVBA 5JFOA 3O8QB 4BL5A 1LDYA 4GLOA 4UVGA 2ZTUA 4FW8A 2PLAA 2DBZA 2Y66A 2EHDA 2ZB3A 5GZ3A 1F14A 5IF3A 3F6YA 3AUSA 3SX2A 3JYNA 4ZQBA 1IULA 1F0YA 4Y98A 2P4QA 3TZQA 2I3AA 4QEDA 5H81A 1V3UA 4ZRMA 2AG8A 4JBHA 3CZRA 2WJPA 4CL3A 5KKAA 3GDFA 3JQAD 3KYDB 1LQTA 3CXRA 4YBZA 4IGEA 1ZSVA 5IXSA 1HL3A 2B5WA 3HG7A 4IDEA 3NGLA 1HE3A 4RF4A 2Q99A 4WOJA 1R4NA 4EUFA 3I4FA 3N7UA 4J49A 4XYBA 3KM0A 4Z9FA 2VOEA 1MX3A 1CQIA 4HFNA 2IXBA 4DPMA 3NAQA 1ENPA 1ZO8A 5EJ2A 3SJUA 2PH5A 1HKUA 4L4RA 2OO5A 4BB5A 1E3WB 4OHUA 3O38A 5BNFA 5FFFA 4ALJA 1NR1A 1UP6A 4PLTA 1QMGA 4QXMA 4Z9YA 4GWGA 2Q3EA 5JMPA 2YV3A 1Y1PA 5JYDA 1IY8A 3WR5A 3GT0A 5T8KC 1SOVA 3CTMA 3I3OA 2NACA 4IGFA 4WNIA 3S2FA 4E31A 4HNHA 1J49A 2EW2A 4YJDA 3OMLA 1BW9A 1GFSA 4YQYA 1GUFA 2VYND 1B3RA 1RYEA 4XRGA 3QWBA 1PX0A 3D4OA 3ROMA 3FI9A 1LSSA 5AXCA 2OL4A 1H6CA 1I32A 3GZ4A 3PQEA 3KSZO 1TI7A 4D46A 1C1DA 4PLHA 5DULA 3DZHA 1PJQA 1D8AA 4RCVA 5COAA 2ZQYA 4AL4A 3I5MA 4DRYA 4MVJF 1W4ZA 3ZHBA 2GN4A 4DGSA 5G0VA 1AUPA 3U5TA 3MJTA 1T2FA 3WQQA 2Y1OA 2JFFA 3IQDB 4CPDA 3DZBA 4A73A 5F5NA 2BF7A 2Q1WA 2WMDA 2ET6A 1K6JA 3OSUA 4CR7A 1UDAA 2EXXA 3JYLA 1S7CA 4BO7A 3EK2A 3IUPA 1YBAA 3ONFA 4K6CA 3R3JA 3DAFA 2EP7A 5JLAA 1T4BA 5IDWA 3GDGA 3UAGA 1HYHA 4XGIA 1BTOA 1YOVB 4EZBA 2XOXA 3EGOA 2EKQA 1ZXBA 2B36A 5K6AA 1BXGA 4CM4A 3PEFA 3IIEA 3KOUA 4IM7A 3LT2A 4A0SA 3VPHA 1UP7A 4BUCA 2CNBA 3LC2O 3JQ9A 4CM6A 1NQTA 5L4NA 4J9UE 1K0UA 3A1NA 3ZV6A 1DHTA 4B3IA 3MJVA 5ENVA 5K9ZA 3INGA 1R0KA 1I24A 1HZJA 4KZPA 1E3SA 1LSJA 1TA4A 4Y6RA 3E9QA 3ICPA 4LRSB 1RYDA 3PHIA 5DDIP 1PS8A 2GF2A 5BSEA 1OAAA 4BNGA 5CDUA 5HS4A 1V6AA 1N1EA 4OO3A 3VKVA 3NV9A 1JQBA 3NYWA 2NLOA 1DPGA 3WS7A 2BD0A 2Y1EA 2ZIZA 3DEYX 1U7HA 3OECA 4HXYA 2C5AA 4L73A 4QX6A 2X0JA 3TNLA 4AJ2A 4HV4A 5CHEA 1ZK3A 3OEWA 3D3WA 2CFCA 1UR5A 5IN4A 4R5HA 3GAZA 3GNQA 3JD4A 4HY3A 4Y8VA 3TZHA 4XQCA 2PZKA 1UXHA 1HDCA 4ZRNA 3OFSA 3GA0A 3DBRB 4CLOB 3VTZA 2PGDA 2O2SA 3HB5X 4RPHA 3HFGA 1NAIA 1SO8A 4KOAA 5B4TA 3FTNA 4I9HA 4G5HA 4E4YA 4EYEA 2GASA 2AXQA 3WQRA 2V6BA 4ND1A 4NBVA 1WDLA 2ZK7A 3WLEA 2Q2WA 2FR0A 2OGUA 1FMCA 4J0FA 4PLFA 4K6FA 4Y6PA 3PIDA 5DN9A 4NNJA 3JQAA 3OA0A 4U7WA 1V3VA 1VPDA 2C82A 2UYYA 4RVGA 4W4TA 4CLOA 2D1YA 2O3RA 2JAHA 3L6EA 3P7MA 3PWZA 4PLCA 3C85A 3PQDA 5I9MA 1J4AA 3K2EA 2VHYA 4RLSA 3IS3A 3WG9A 4FSHA 2BRUA 2J3JA 1JAXA 3K5PA 4JQCA 2OORA 2GCGA 5BNTA 3QP9A 3WYCA 1UP4A 4TRMA 2GRAA 1PWZA 5T6BA 5KWEA 1R4NB 4TRJA 1K89A 1EBUA 3JQAB 1NHGA 5JS6A 2JCVA 3AUUA 4II3A 2BFMA 3A06A 5T5QA 1O95A 1CIVA 3MWEB 4WCFA 1YWGO 4CM9A 5IDQA 5LDHA 3EMKA 4L76A 1NWHA 3CMMA 3MEQA 1ZMTA 4WGGA 3OA2A 1KETA 3OJEA 3PZRA 4LW8A 3RBVA 1PJCA 1YONA 3ZGYA 4PZDA 5EQDA 5JAMA 1LDBA 3RSHA 4CQLA 2BMAA 4XCVA 1LQUA 4ND2A 1U3TA 1HDZA 2OP0A 2GN8A 2E82A 1Q1NA 3NGXA 1QG6A 3U09A 1ISIA 4J1TA 4MIYA 5JXWA 1E1KA 4W7HA 1HTBA 1Z75A 2D5AA 1ID1A 4BHTA 4WJZA 2X58A 2P5YA 3T4XA 5CEEA 2B4RO 4YYZA 3DZIA 3PWSA 1X7DA 4ZICA 2FSVA 3BMNA 1GADO 4N5LA 4IIVA 4L4SA 2EGGA 1BMDA 2IZ0A 4JP2A 2P4HX 1DC5A 3F9IA 3WMXA 1WNTA 2R00A 1NVMB 1NVGA 3PRJA 4R01A 2GYYA 4MVJH 5COQA 5DOVA 2EEZA 3TL3A 1R4MB 2YFHA 4K28A 4BNMA 1R12A 1E6WA 1HDYA 2J5RA 4W82A 4E12A 4WEQA 2BFPA 4QFDA 4BGUA 3PPIA 1KVRA 4OXYA 4YT4A 3JTMA 4PLZA 3W6ZA 3TPCA 2JFHA 2FPGA 3U3XA 1WP4A 4GH5A 1LRLA 3ROQA 2F00A 1DOHA 3R1IA 2QIOA 3I83A 4YAEA 1KBZA 2Q46A 1R0SA 2EKLA 4PZCA 4R68A 1D7OA 4DC1A 5A02A 3QY9A 1BVRA 1ZVMA 1X0VA 5JE8A 1U7TA 3S1LA 4LSWA 4NK4A 1L1FA 8ADHA 4BGIA 4BNYA 1MXHA 3TL2A 1E5LA 4IXWA 5JNLA 3CUKA 4RL6A 3DOOA 3GVPA 5IDXA 4AJPA 2AW5A 3WIEA 1H6BA 3JQ6A 1Z7BA 1U4SA 1BXZA 2ZYGA 3B6ZA 5DBGA 3E5RA 3S55A 2FHSA 3WLFA 1NNUA 2W8ZA 2Z1NA 3GFGA 4GWKA 5IFLA 3W4IA 2Y67A 4PG5A 1MXFA 3ZU4A 1PQUA 2ZYDA 3BHIA 1LX6A 4R9RA 3RC9A 1RPNA 4A7PA 4PG7A 2DPHA 1T26A 3RKUA 3RU9A 1VL6A 4GSKA 3PLNA 1E3LA 4JNKA 4GMGA 3KETA 4RPKA 2AQKA 4J1NA 3C7AA 4DUPA 2X9NA 2X9VA 3HUDA 3O03A 4CM8B 1ISFA 1X1EA 1WZIA 5TT0A 3L4BA 1QYVA 5KOIA 1ZH8A 3GF4A 1J6UA 1HETA 3VPGA 3BHMA 4N7RA 1O0SA 4G65A 4P4NA 3ICCA 1ENZA 1HSZA 3I4CA 3WXBA 2UUPA 1RM3A 2PV7A 4YT5A 1NPYA 4ONEA 4GSLA 4IQGA 3ZV3A 3KVOA 3ZHYA 4ZA2A 1FXSA 5DBIA 3DHNA 3VH3A 4BO2A 4B8WA 3TZ6A 2GLXA 1RM4A 4GGPA 1AGNA 1EUZA 2NU9A 1YB1A 4PG6A 1YGYA 3GPDG 2PY6A 2VHVA 3E8XA 3K9QO 4WPGA 4XGKA 1LJ8A 1UDBA 4CV1A 4DVJA 1HDOA 2X7HA 3OM9A 2AMFA 3BXXA 3IP3A 5CFZA 3IKTA 4QT0A 4U6SA 1KVUA 5DCWA 3AY6A 3GHYA 4CJXA 4FPXA 3SC6A 3QWIA 4Q3DA 3VZSA 1XQ6A 3ITDA 3V2UA 2DAPA 1JKIA 1HLDA 3GLQA 1PQPA 3BYZA 3GUYA 1LLDA 1GV1A 4BKQA 3KTDA 3PIIA 2SCUA 1B8UA 2Y99A 1YKFA 2DLDA 1ADBA 3I9LA 3Q1LA 4AFNA 4NIMA 1BGVA 5JDIA 4ZU3A 2PK3A 3IKVA 5L53A 3E48A 3E1KA 2CF5A 3GUCA 3JQGB 4LRTB 2DBQA 1ZXLA 3U4HA 5CEJA 1PWXA 3GEMA 4PVCA 1Q0QA 3I52A 1Y7TA 1A4IA 4NBRA 1P3DA 4MOWA 3BMCA 2NNLD 1PGPA 2WM3A 3GNTA 2I65A 5BSFA 4RVHA 3SVTA 3QHAA 1YB4A 4FJ1A 4XYEA 3M1AA 1YE3A 3I9NA 1NFFA 4RZHA 3FCOA 4L4XA 5DCUA 3H9UA 3WSWA 4EEXA 5THQA 2JFGA 1GYQA 3WTBA 2BH9A 2O3TA 1XEAA 3RUCA 3ZH2A 2E49A 3O9ZA 2ZB8A 2XF8A 3EVTA 5TLSA 5JBIA 1YVEI 1C0LA 4CMHA 4EGFA 1U5AA 2HRZA 1TEHA 3C7DB 1P77A 2WSBA 3JQ7A 3MZ0A 1HDXA 4CV3A 2J3IA 3CINA 5KVCA 4IDDA 2XAAA 3JD3A 3ZWOA 1GAEO 3INRA 5ILGA 3K2BA 2RHRA 1MC5A 3GZNA 5F21A 1LU9A 4IZHA 1JWBB 4DXHA 4PN3A 3ENKA 4TRRA 1R15A 3DAGA 1LI4A 3PJDA 3LQFA 3IJRA 3K31A 5I7EA 1E1NA 1AXGA 4TSKA 3COSA 4WECA 3WFJA 5GMOA 3JQ7B 1AXEA 4LN1A 4A5OA 4CLRA 3RJ9A 3KRTA 4FFRA 4J4TA 2HLPA 3W6UA 4BO9A 2I5PO 4BO6A 2ZCVA 3ZNPA 5ILOA 2DU8A 4M1QA 2BHLA 2CF6A 4GX1A 1FDVA 3JD0A 3WGHA 1SEPA 2EW8A 1CF2O 1NQOA 1G6KA 5HRUA 3ST7A 1PZGA 3NEPX 1DFIA 1TT5B 2C2YA 1BHSA 2JHGA 2GZ3A 3DONA 4XRRA 4CL8A 2AQHA 4K9DA 4XGNA 5TGDA 2YHIA 1E1LA 3NDIA 3L9WA 1YJQA 4AG3A 1C1DB 4Z3KA 2B83A 1RWBA 5HTOA 2VT3A 2NTJA 5THKA 2CD9A 1WDMA 2Q4EA 1PL7A 2QRJA 4IS2A 4E33A 4RLHA 4DYVA 1XG5A 4FB5A 4UUNA 2VUTA 1KVSA 3PJEA 1H6DA 5A05A 2NM0A 3TDKA 4R54A 2A92A 1V35A 1PTJA 2DBRA 3O8QA 2ILTA 2CY0A 4TKMA 3S2EA 1VJ1A 2QYSA 2I9PA 1DIBA 3DO5A 5TJ9A 1IZ0A 2YV1A 3EYWA 4KMSA 4GPD1 5T57A 4Z6KA 4TZTA 5C3MA 3U4CA 4BNLA 1E7MA 3ZWPA 4H3VA 4YB8A 1M66A 3ZWYA 5A3JA 2VWHA 3A28A 3Q11A 1DLIA 3UOGA 5JCJD 4NK5A 4XQEA 4Q3CA 4XEHA 4IY1A 4W99A 3VAZA 1DC3A 1GL3A 2X86A 2AA3A 4LSMA 1WW8A 3FHLA 4FOSA 4WLEA 1N92A 5G0UA 4HKTA 3ZWBA 1D1SA 1LDGA 2R2GA 4CM5A 1YRLA 3MJEA 1PGOA 1I36A 1JU9A 2NVUA 2BFAA 4D42A 3QVTA 5B12A 4JJGA 2D5CA 3GN1A 4U8GA 4BNXA 2IYPA 2H6EA 2OP1A 3LVFO 5DT9A 1FDUA 1DAPA 3DAPA 2VYNA 3M2TA 1KEVA 2IRWA 4YR9A 1E3IA 1ZK4A 1BG6A 2YDXA 1PGJA 4BV9A 1DIAA 4ND3A 3ZW9A 4AJOA 2YQ5A 4IJVA 1L7DA 4WLUA 1T2DA 1PQWA 3UCEA 3U62A 1QYWA 4R3WA 1XKQA 1GUYA 3E03A 1EZ4A 4JLWA 1IUKA 3N58A 2P5UA 4Z0PA 4DPLA 4IDCA 2AQ8A 5J23A 3P2YA 2UAGA 4FFOA 3IDSA 4W9NC 1IPFA 2EG9A 3QWFA 4I9NA 3LLSA 4A03A 1LUAA 4GX5A 3VKUA 3MTJA 1KEPA 1YXMA 5JAQA 1GUZA 3RC7A 3JQBC 1I01A 1BDMA 3VDQA 4N5MA 4YRBA 1QV6A 2HCTA 3L07A 4KTTE 1UAYA 2NQ8A 3GMSA 3S2GA 4F3YA 4L0QA 1MFZA 2BELA 4HP8A 1H9BA 5G0WA 1N5DA 4NMHA 1U2DA 3JQ9C 1Z82A 1H2HA 1ULUA 5EL0A 5JDCA 3ZU2A 2Y05A 3EW7A 4FFNA 5CAEA 1DJQA 1X1TA 2OBYA 3F47A 2VHWA 1DB3A 2PD6A 1C1XA 1ISMA 2CDCA 2B35A 4EJ6A 3OJLA 4P8RA 4WLVA 4DIOA 1U3WA 2PZMA 3FTPA 3HN7A 3TF5A 1T1RA 5BT9A 1LC3A 5JY6A 5CPFA 3EVNA 2B4QA 2JHFA 3BMQA 3JYPA 3MOIA 2EP5A 1T2EA 3GPIA 4YJFA 4RPGA 1E7WA 2EKPA 1LA2A 4IMRA 4BNTA 4BKPA 3G79A 4J4HA 5EIOA 3WGIA 2GNAA 3GC6A 3D4PA 3ZWNA 5U9CA 3H9GA 2VRCA 5ITWA 3NJ8A 4NU6A 3QVSA 2PNFA 5BSGA 4PLGA 1ADFA 2EV9A 4UVDA 4WASA 7ADHA 1IL0A 1GR0A 1B7GO 1QORA 1R37A 2TMDA 2W4QA 4MIOA 4RF3A 1F8GA 3GK3A 5K0ZA 1W0CA 3PP8A 3KEQA 3MTGA 5JC8A 4BNIA 2PWZA 4J0EA 4J1QA 2Y0DA 5C37A 3QW2A 1LDMA 2W2LA 4IXTA 4X54A 2BGKA 3GEGA 5JO9A 3WQSB 4TRNA 4BS9A 3LK7A 2X4GA 5I7VA 1OZAA 2QZZA 1RJWA 4OQYA 4RF5A 3V8BA 1KY4A 4R1NA 4D45A 3A9WA 2HK9A 3M2PA 1E7YA 3D3EA 2VNAA 2IEBA 2QYTA 3FR7A 5HWSA 4NPCA 4RDHA 2J5KA 4I9UA 4OSOA 1BVUA 3IMFA 3TRIA 3WYBA 2O2YA 1PIWA 4GVLA 1N9GB 1U9JA 1FDTA 2ZJ1A 2YV2A 4H7PA 5AOVA 1U3VA 3UN1A 5L4SA 1F8FA 5HA5A 4IDFA 3BMOB 1M6WA 1LSOA 1VKOA 4MVJE 5DNAA 4ALKA 4DBVO 2Q2QA 2X22A 5U4QA 5EINA 1MLDA 2GPTA 5JYEA 2X9GA 3JV7A 4R1SA 3FF4A 3M6IA 4O0LA 4WLOA 3D64A 3KLMX 3GAFA 4R1TA 5ENDA 4CMIB 3GH3A 5DOZA 1PSDA 3VVCA 1YL5A 5KCZA 1AE1A 2X5JO 3W8FA 1ZEJA 3EAGA 2G5CA 4WNCA 1JKFA 1P31A 1SAYA 1SBYA 4CUKA 2OBNA 2NVBA 5DP1A 5B37A 1ML3A 4PFJA 3LC7O 4FC6A 1Y5MA 5C7LO 4XWYA 1FK8A 4CMEA 4MVJM 4C7KA 3MJ4A 4E5KA 2WD7B 2AE2A 2NVUB 3DQPA 2GDZA 4WCFB 4DBZA 3MOGA 3ASUA 3RROA 4B4VA 3H9EO 3UHAA 3KV3O 3OIFA 1X13A 2P9CA 4GVXA 1EFKA 1SOWA 3PDJA 3F5QA 3JQCA 1FDSA 4NFHA 4Q3EA 3VH4A 1B14A 2DM6A 3FN4A 4CQLB 4L75A 3KEOA 2OMEA 2FSSA 2HK8A 3B1FA 1GQYA 1T2AA 2D59A 2E6UX 3U0BA 4ZQFA 2PKQP 3GGPA 1MA0A 1BXKA 1GPDG 2YJZA 1M6HA 4BO1A 4CQMA 4I8XA 4P38A 4XR9A 2NU6A 3BMNB 1KC1A 3QV1A 3E9MA 1J0XO 4IJUA 4EI2A 4UUPA 3HDYA 5TX7A 3JQBA 4NR0A 1C3VA 3C1TA 2RAFA 4PCVA 2C07A 2X0NA 1ZUD1 1VJ0A 1SB8A 2HUNA 4B7UA 1ZJYA 1P1JA 1YQDA 3DBLB 2ZCUA 3QA9A 3OHSX 1PR9A 4U6QA 1Y5RA 3W4KA 3H65A 2BLLA 3ABIA 4RVUA 3EUWA 3W8DA 1JTVA 3D0OA 3P19A 1DRVA 4AICA 3FD8A 1UAGA 5I8WA 1UZMA 4E6PA 1OC2A 1ISHA 2FP4A 3DBHA 4MIEA 4PG4A 4BNWA 1KVTA 2DFVA 2W2LD 1I0ZA 2H5LA 5JC1A 4A10A 4WCFC 2WD8A 1BSVA 3GY0A 4D79A 4PG8A 2EJWA 5JCXA 1DO8A 1JWAB 4RVDA 5LCXA 2YQ4A 3LF1A 3UVEA 2Y93A 4ND5A 5TC4A 3I6IA 1XA0A 3TN7A 2FWMX 2CZCA 4P4GA 6ADHA 4XDYA 3C7CB 1IE3A 3MCVA 1VL8A 1GTMA 4M55A 1XCBA 2VQ3A 4M54A 2OOSA 3DZFA 4YJGB 3JQDA 4MVJI 1FJHA 1JN0A 2P91A 3PYMA 5IDYA 5JCJA 4J16A 4W6ZA 4OOFA 4S1VA 1I8TA 1YL7A 5G4LA 4JCOA 2GERA 1F12A 1XDWA 3UCFA 1KYQA 2W2KA 4BO8A 3SLGA 3NRCA 2P68A 4NJOA 2I3GA 2Q1SA 1H0KA 4RPJA 2UDPA 3PGJA 5FWNA 4YTEA 3T4EA 1JDJA 4LCEA 4CR6A 4CV0A 1GDHA 3VDRA 1W8DA 1Y8RA 3FBGA 1PU2A 1VKNA 3PJFA 3QIVA 4EW6A 1P1FA 1BXGB 3OH8A 4INAA 5G2OA 4CM4B 2J3HA 1KS9A 2W2KB 4D3SA 1UZNA 2RIRA 2HMVA 4DTIA 1JVSA 1QSGA 4FD3A 3DOJA 4MP8A 4KP7A 1QR6A 4XIYA 4FS3A 3DFUA 3VPFA 2YYYA 2EJVA 1H6AA 5IZ4A 4ZVVA 2JD2A 3AOEA 4CMCA 3INTA 4IQ8A 4FR5A 1EDZA 3A14A 2CUKA 5C7OO 5G4KB 1EK6A 4E13A 1EUCA 4OL9A 1U3UA 3KBOA 3OIDA 4MO2A 1B16A 1EEHA 2PH3A 1WDKA 1DC6A 1OFGA 3KYBA 4J43A 1HDGO 2Q50A 4KUEA 1Q0HA 1EMDA 2C2XA 4CLEA 1M67A 2YZ7A 4CV2A 5DZSA 5I7FA 2Y1FA 2O23A 1YQXA 1DSSG 1PL8A 4XB1A 3TOXA 4P22A 2B37A 2QRLA 3RAJA 1ZNQO 2C0CA 3WX0A 4YAGA 1HRDA 3HNPA 5IG2A 5G0SA 1ZK1A 1VC2A 3H4VA 1GU7A 5KIAA 1CRWG 2C20A 3BHJA 1X14A 4JGBA 1DRWA 3VPSA 1ORRA 2J6IA 3BTOA 3F4BA 4KWIA 4DLLA 2HJSA 3C24A 4QECA 1DIGA 5JDIC 4HBGA 1U8FO 3ZNNA 1GYRA 3F1LA 4BNVA 2OUIA 4ND4A 4NQZA 4OSPA 4K1LA 3RUIA 1SB9A 3WNVA 3I23A 2O7QA 8LDHA 4XJSA 3X2FA 1DLJA 4N18A 5ER9A 3V5NA 2X1HA 1N7HA 1VM6A 3NJ4A 5IZCA 1EVIA 1LBEA 3ZWWA 1EQUA 2WDZA 3RQSA 4JJIA 2WWRA 1DDOA 2Y68A 3QVXA 4ZD6A 4PLVA 1K3TA 4ZN6A 1Y8QB 3C1OA 1XU7A 4Y67A 5KNLA 3CPSA 1XR3A 4KTVE 1E6EA 5EQFA 3AFNA 3AI1A 3UKOA 1K6IA 4RZIA 1Q7BA 2CVOA 3BTUA 4OMUA 5FI3A 3HDJA 4NZ9A 2I66A 4BNHA 1MFPA 3PJGA 4PRLA 3FPLA 4E30A 4YA6A 1NFQA 3GVIA 2XXJA 1O6ZA 3DTTA 3KSUA 3LT1A 4DQUA 2V6MA 1BWSA 1I10A 5JW6A 2C59A 1PJLA 1ADCA 1V9LA 1TT7A 5EESA 4R5MA 3V2HA 4WCDA 3SBOA 2GSDA 4R3NA 2C29D 3LT4A 4CLRB 3GGGA 4YPOA 4GKBA 3HWRA 5KJ1A 1LXCA 3CMCO 3HJAA 5FF9A 2Q1UA 5LDGA 3UCXA 3VH2A 5CDTA 4I5FA 1E3EA 2D3TA 5KJ6A 3SXPA 3PYLA 3Q6IA 5EN4A 4IINA 4BMNA 5BR7A 4UEKA 1GQQA 3NT4A 2JL1A 4B4UA 2O4UX 3UXYA 3AI3A 3ZWXA 4UUOA 4IDBA 1E3WA 4ZJUA 2YHIB 1R4MA 1LRJA 4GKVA 5ER6A 4CQMD 4BQRA 3KSDO 3VZQA 1Q7CA 4ROSA 2NSDA 3QE3A 3RKRA 1ENOA 2G17A 3AJRA 3HDQA 4CUJA 3FNFA 1LTHR 4XQGA 2VRBA 3NTQA 4E32A 3CKYA 4S3MA 3HSKA 5K6AC 2BFOA 3WGGA 5A06A 1VE9A 4HWKA 3D7LA 4ZHSA 4XQ9A 3ETEA 3GVHA 4B4WA 3ULKA 3Q9NA 1WPQA 1MV8A 1WVGA 3WJAA 1A71A 1OOEA 1P33A 2V7PA 3PFFA 1PJSA 4UAGA 3AK4A 2Z95A 5A9RA 4H16A 2J3KA 1KC3A 3DR3A 4DC0A 4EBFA 1ZW1A 2F1KA 1CDOA 1C1XB 1NPTO 2NTNA 4BKRA 4BNUA 1HYGA 1WZEA 1KEWA 4JBGA 4XIJA 3GEDA 3IJPA 4WE3A 4RORA 3CZMA 1A27A 2P9EA 4IIUA 3NUGA 1XIVA 2BGLA 1H2BA 3U4DA 3V1UA 1QYDA 3TQHA 3TSCA 4OM8A 2NU7A 1KY5A 1R16A 3U49A 4YT2A 3OJ0A 1M2WA 1DJNA 3LT0A 3V2GA 1EVYA 3DFZA 4XKJA 1X15A 3S2IA 5B1YA 3D3WB 4NU5A 5L45A 1PS9A 1GV0A 4DMMA 3IL2A 4LGVA 5IZCC 1I3NA 2DKNA 3K92A 3VH1A 4JROA 3QLJA 3WJ7A 2Q4BA 4FDAA 2PKQO 1E5QA 3RI3A 5TF4A 3DL2A 3ZU3A 5KVSA 3ZDFA 4WLNA 5F5LA 2UUOA 2EF1A 5CG1A 1EFLA 3JSAA 4BMVA 3BIOA 3FPCA 4R16A 4D3DA 2O3SA 3VVBA 4XB2A 3PHHA 4AJLA 2NADA 3WGZA 3NX4A 2WE8A 1C0KA 1I2BA 4OQZA 2VCYA 4RF2A 4D7AA 3WIDA 2J5QA 3OIGA 4WOKA 1UXJA 1JAYA 3G1TA 3X2EA 4KUGA 1KERA 2NUAA 4J6FA 1ZK2A 1CJCA 4F6LA 3H8VA 4CM3A 2C5EA 1Y9EA 1EE9A 1VSUA 3K8ZA 4FJ2A 1I3MA 3DC2A 4PLYA 3TJRA 1N9GA 4TZKA 1ULSA 3G49A 1NX6A 5JAZA 5FI5A 3EHEA 9LDBA 1HEUA 3OBBA 4N54A 5CG2A 3DHYA 3PDUA 4B7CA 2HMUA 3FRJA 2VNSA 1U4OA 1V8BA 4HADA 3KXDA 5HS6A 5A9TA 3T7CA 4Q3AA 1ONNA 4PRKA 4W7IA 4J3FA 3OQ6A 4Y6SA 1N2SA 3RUHA 1ZIDA 3LU1A 3QJ5A 3PK0A 5DCYA 4NBUA 5F1KA 4CM9D 4OYRA 3EDMA 4LMRA 5DBFA 4E5PA 3VC7A 3JQFA 1W6UA 2O4CA 1DBVO 3GGOA 1JW9B 2B4TO 1RM5A 4ZQGA 1SNYA 1CWUA 4UEJA 3GHHA 2GZ2A 2HSDA 2CDBA 2FR1A 3AM5A 4A2CA 4E5NA 1LC0A 3WDSA 1U8XX 5CEFA 1EVZA 2IZZA 3KZVA 2AEFA 3PVZA 4DMLA 3AWDA 2QW8A 3AOGA 3K96A 3LSYA 4DREA 3NKLA 3HN2A 4FBGA 4BIIA 4ALMA 5MGBA 2BKAA 4OXKA 3JQ8B 2ZTLA 4UVIA 1YBVA 4J90A 1Q7GA 1QKIA 4TQGA 2UV8A 2RBEA 3U9LA 1Z73A 5JY1A 1EUDA 4OJNA 4XYGA 1I3KA 4OAQA 1NTOA 3DDNA 2A35A 4J9VA 2DFDA 1NPDA 1QXSA 4K26A 1NWCA 1NASA 3VOSA 1P1IA 2WYWA 4U0JA 4AJ1A 5KTKA 3FWNA 4YQZA 1GZ6A 4Z3DA 3AY3A 3OETA 2AEMA 2D0IA 2IE0A 4R4JA 5KJEA 1U28A 3FNHA 1P9LA 3ITKA 1PJ2A 2O48X 1PGNA 3MWDB 4MP6A 4Q3BA 2IEDA 2PTGA 1DHRA 4I5GA 1MB4A 4BOYA 5GZ6A 4TROA 1X7GA 1GCUA 2G76A 3G17A 5JDCC 4TMFA 2AG5A 3ROPA 1A72A 2IXAA 2RH4A 5L40A 2OXIA 2Q49A 3ZU5A 2HJRA 2H9IA 3K6JA 4BKOA 3T7EA 1DIHA 3H7AA 3PGXA 3CSDA 3EZLA 5L9AA 4HFMA 2PGLA 1A4UA 4UVHA 3ZV5A 3KYCA 4B3JA 1EVJA 1HZZA 2J8ZA 2X6TA 3R3SA 5ICMA 4YRAA 3ANMA 2OZPA 1LNQA 5JSFA 2Q45A 1UH5A 1HXHA 2ZATA 3HADA 1EE2A 2QQ5A 5DF1A 4J91A 2PD3A 1DFHA 5TNXA 1IB6A 2VWGA 2VZ0A 2IYOA 1IYZA 5BSHA 1TB4A 3DZGA 4BNKA 4I5DA 3L77A 4JXKA 1U5CA 3PHGA 4PZEA 3L4SO 4UEOA 3D5TA 4HX5A 3WSVA 3PQFA 3F3SA 3GR6A 1GPJA 1E92A 1WAMA 4BQPA 4CMBA 1NP3A 4NI5A 1TT5A 2DBVO 1QP8A 4KDFA 2ZTMA 3Q0EA 3SC4A 3BZUA 4LCJA 1A9YA 1YQGA 4J4BA 4J7CA 4YAKA 3LF2A 1ZZEA 3WBBA 1NYTA 4E5YA 3RUDA 4BV8A 2VRCD 2VZ8A 3PLRA 4QTZA 3PI7A 5U1PA 3JQFC 1WMAA 3GG2A 3AM3A 4L8VA 1YOVA 1KVQA 4GX2A 2VYVD 3CEAA 2FPIA 1J5PA 3RFXA 1P74A 4CLDA 2C7GA 2JD0A 3OQ1A 3H5NA 4QQRA 1DIRA 4HUJA 1NXQA 3ZHXA 1SPXA 1JVBA 4NHEA 5L3ZA 1XSEA 4DLBA 1IOLA 4ID9A 1M75A 4F45A 1G1AA 2X0RA 1MG5A 3G3EA 1ARZA 4Z0TA 4Z9XA 3RJ5A 1NHWA 3ZWCA 3BAZA 1OBFO 5JO0A 2EERA 2BGMA 3AY7A 3KO8A 4IZIA 2PZJA 3SJ7A 2ZJ0A 4LMPA 1H5QA 1PJ3A 5BNIA 1MUUA 4QSMA 2DTDA 1UZLA 2RHCA 3LLVA 4D0SA 4PLPA 3H5AA 1DRUA 1F17A 1YDEA 1NVTA 3DMTA 4DQXA 1EQ2A 3ZN2A 1DEHA 1QYCA 5H82A 3VHRA 3H3JA 1NFRA 1SEVA 1HWYA 1VI2A 4RGBA 3ADOA 3Q2KA 5A04A 3GQVA 1UUFA 4Q3NA 1H9AA 2FRDA 1R66A 5A5FA 3B20A 3RUFA 4CUZA 4D3FA 3Q2IA 4MKRA 4IMPA 1HDRA 2CMDA 3JD2A 3O26A 4O63O 4PLWA 1JA9A 5H83A 4B4OA 1CEQA 2X23A 4OIMA 1AN9A 2UVDA 1B26A 1BDBA 4IJKA 2IZ1A 1I30A 2FMUA 3F1KA 2HK7A 3BMCB 2QG4A 5EERA 4E5MA 3ETDA 3D1LA 3E82A 3OF2A 2E4AA 4XX0A 4AJHA 1MG0A 2YHUA 3IUSA 1ENYA 5TS3A 4EUEA 4RQTA 1K6XA 3WWZA 1E7RA 1BRMA 2VHXA 1NAHA 3QRWA 4KWHA 1DC4A 2PKRA 2VHZA 4B3HA 4J2OA 4GL4A 3AM4A 3L4BC 1HE4A 2HMTA 1FDWA 1HYEA 1V0JA 3K30A 4NH4A 1QV7A 4XDZA 1A9ZA 4CMGA 4LK3A 2FZEA 3EC7A 5AQ1A 4FOOA 5CDYA 2JJYA 3HE3A 2W90A 4WEOA 3DOCA 2D4AA 3L6DA 2VYVA 4DQVA 3NTRA 3JQ8A 2QHXA 1P1KA 1IHXA 1CQJA 1ZFNA 2C7VA 3WOHA 2YFQA 1VRWA 2C54A 1YL6A 4OOEA 3AI2A 3B70A 3HFSA 3ASVA 4B7XA 1TLTA 2ZKLA 2VT2A 2V6FA 4B79A 4FJ0A 4BNFA 4CMEC 3E9NA 1G0NA 1HF3A 2B5VA 5IN5A 3RCBA 1ZKMA 2VTDA 2G0TA 2O3UA 4MINA 1E3JA 5ADHA 2WEKA 4OGWA 1GZ4A 2G1UA 3H6KA 1E77A 4I08A 3KYDA 1IZ9A 3TWOA 3UGKA 2GN9A 3I6QA 4URFA 5T67A 1ONOA 2AQIA 1VJTA 2GN6A 2JAPA 4JN6B 3CE6A 3C3XA 4KQXA 2H63A 1LLQA 1E1MA 3GFBA 3U4IA 4E2WA 1IHYA 4FGSA 3TZCA 1YDWA 2ZB7A 2ZTVA 4D0RA 2VZ9A 2YUTA 4AJKA 1Z6ZA 4R1UA 3DZKA 4F6CA 5BQFA 5HM8A 2CDAA 1YH3A 2O50A 2P9GA 4FC7A 4NBTA 4R51A 4Z0HO 5C5IA 1GEGA 2JD1A 1RKXA 2HRBA 4GX0A 3C8MA 1Y81A 4JIGA 1ISJA 4HNGA 4EEZA 3RD5A 1BW9B 3WGTA 1A7AA 3H5RA 1ZBQA 3ONEA 3TFOA 4DLAA 4MP3A 4YAJA 3VPXA 1I2ZA 1CYDA 4R9SA 3OEYA 4MVJD 4UVEA 1LEHA 2VOJA 3C1AA 4PVDA 3WTCA 1WMBA 5HBRA 4NBWA 1I5RA 1OI7A 3KB6A 3W1VA 1P0FA 2PFGA 4IBOA 3QVOA 2VN8A 4DIBA 3MJSA 4WUVA 4A27A 2NTVA 2PA3A 2HAEA 2ZQZA 3GOHA 4JBIA 1Q0LA 3D4NA 3ZNQA 1LDNA 5EMHA 3PFWO 3KUXA 2GO1A 3ZWAA 4YCAA 1ZMOA 2P2SA 4KUHA 2EWMA 2I99A 3L0DA 3BMOA 3AUAA 4XYLA 4WKGA 2Y0EA 2EIHA 3ONDA 4R69A 3UFXA 2PR2A 1T2CA 5CP8A 2WD7A 4IPTA 5AVOA 3V1TC 1I2CA 3OP4A 5I9LA 1Y8QA 4Q9NA 1P0CA 1X7HA 3EY4A 1Z45A 2Y1GA 1T4DA 4DYDA 4EITA 3WGOA 3PWKA 1N8KA 4P4LA 1G0OA 4MKXA 3Q3CA 1Z74A 3F5SA 2VUSA 4XZ3A 1YJ8A 3WICA 3I1JA 4MVJP 2BI7A 5MDHA 4GBJA 3RC1A 1EBFA 1W73A 3FSRA 2DTEA 1PZEA 3ZI0A 2NQTA 5T64A 4E0BA 2FR8A 3AOEC 2DUWA 1XELA 1PL6A 3RUAA 3A4VA 3B1JA 4CM1A 3AUTA 1AHHA 4CMAA 1UDCA 1B8VA 1WWKA 5TQVA 3IP1A 1YB5A 2NVWA 2AEJA 4BO0A 4E3ZA 5L7YA 1P44A 2XXBA 1KIFA 2JKVA 4ZQHA 4BKUA 4EJ0A 3W8EA 3ORFA 4IQ0A 4W9NA 1ISGA 2B0JA 1QLHA 2HDHA 2WTBA 3P2OA 2DVMA 3QSGA 4YACA 4ESOA 5COBA 3BTSA 3TOZA 3LDHA 4AJ4A 4I5EA 4RO0A 4YT8A 2LDXA 2DT5A 4FN4A 1QYXA 5ICSA 3QVWA 3DBHB 5TRTA 1SCUA 3ENNA 3G1UA 3HB4X 4ZQEA 2Y1CA 2X0IA 4YDRA 3H9QA 5GZ1A 7MDHA 4NG5A 2VTEA 3JYQA 4RQUA 1XGKA 1MP0A 2VWQA 1E6UA 1O89A 1R6DA 3DBLA 3ZCXA 1T24A 3GDOA 4IS3A 4TKLA 3RWBA 1PJ4A 3R6DA 3WNQA 2RH8A 4RJTA 1V3TA 3F46A 1GY8A 3PHJA 4J7XA 1B15A 1D1TA 3SEFA 4GLLA 5ES3A 5TIIA 1E0DA 2Z1MA 4DA9A 1DAOA 4I1IA 2GR9A 1TVEA 5KJFA 2O3JA 1EDOA 2PD4A 3VTFA 4D44A 2FZWA 2R00C 1XHLA 4FGWA 4YJGA 4AJEA 4JP3A 3NT5A 4Y9DA 4YJFB 1XU9A 4IUYA 3QWHA 1U1IA 4YVFA 5AXAA 1O8CA 4C7JA 1UJMA 3GN2A 3DWFA 3I9KA 1ONPA 3UF0A 5ITVA 1P1RA 1NM5A 2YDYA 4CMKA 4AVYA 2X8LA 3AU8A 1PR3A 2QZ9A 3W4JA 3FWZA 5F1PA 4NDNE 1DXYA 3VZRA 3GZNB 3PZBA 3DTYA 3WMWA 3QWAA 2V65A 3G0OA 2AE1A 5GY7A 1T1SA 2D2IA 4N5NA 4ALNA 1ZJZA 3N74A 3H2ZA 3NTOA 3ROKA 6LDHA 3DZJA 1N7GA 5A9SA 4FFMA 1P1HA 5AXDA 1CETA 3RASA 2HO5A 3RC2A 4BO4A 2FN7A 4RDIA 1D3AA 3S8MA 1Y6JA 4M49A 4OXNA 3E6AA 4FQ8A 3BMQB 4D43A 3P5SA 4XA8A 2YW9A 1K2WA 2OHXA 1JLLA 2CSUA 2Q1TA 3ANLA 4TVOA 4U0KA 1E7QA 4CODB 5T8KA 4BVAA 1H93A 4E2YA 3FNGA 4M8SA 4RVSA 2A9FA 3NDJA 4YJHB 1Y9AA 4CMIA 4O5OA
chains in the Genus database with same CATH superfamily
2ERCA 1M1YE 1BYUA 1UXGA 1ZUNB 3VOBA 5DP2A 1KXZA 1TAQA 1O94A 2WHYA 1T6NA 4RENA 2W6JD 5H7XA 4BMSA 2J46A 3K0BA 4TOIA 1WSBA 3KJZA 4LXXA 5ICGA 1L1EA 1HX7A 4NXNB 1XZAA 2PT9A 1SXQA 2Q0XA 2OAEA 4RD6A 2GK6A 4E1VA 3N2GB 4PR3A 2AJ8A 2W48A 3A6DA 3H3FA 3JCZA 4FKMA 4QUIA 4U3JA 5BO5A 1JV2B 4Q15A 4D8WA 4Q39A 1A8UA 3HKEA 4BN0A 3HFJA 2HU2A 3TIFA 3I2HA 3DHEA 4YREA 3BWEA 2Q9AA 5AHXA 3M6LA 5A3RA 3IAHA 4NDZA 2IC5A 5IJZA 5IXYA 4FZVA 1NUPA 2X4DA 4LISA 3RJTA 1K7XB 3D6HA 1JG2A 2Q2VA 4R2HA 2XT6A 4LTNA 1TJ4A 1A8PA 3ZNOA 3U5ZB 4XR4A 1PZHA 4M86A 3WRWA 4YXFA 5I9NA 3GLVA 1ZU4A 1UJCA 4P7FA 4QOHA 1HNWB 3IEUA 2DHCA 1FFDA 1Z88A 1ZL2A 3T5PA 4JK3A 4E21A 1OH8A 5FPHA 4JBNA 3DO8A 4M89A 1LFAA 2AMLA 3GMDA 1MC4A 2O7SA 3OZAA 1LRKA 3TAXA 2ZB4A 4IJWA 4KNVA 1JBEA 2RI6A 3GRPA 3CUWA 1R5JA 2HI0A 4IHJB 5C34B 4CLHA 4EFNA 2BGUA 2EGHA 4KZKA 1U8EA 4XGQA 5C8DA 4CCWA 3QQ5A 1S6YA 2B1IA 2X5OA 3HUTA 2A94A 3ZZMA 1DFGA 4C4RA 2WNSA 2WUVA 9GPBA 1PZNA 3FUXA 1KK2A 4WKBA 4JI3B 5F1OA 4OKIA 5JPIA 2FEOA 4X8HA 2E6KA 3C3CA 2BV3A 2IVFA 1PT7A 2DSTA 4II2A 4WZAE 2DFLA 5F3RA 5JRZA 4FMCB 4B17A 1XNQB 1JA1A 2RGAA 3W8NA 2XOEA 1GT6A 5EWMA 3LDUA 2GM9A 2H4XA 4CMJA 4U5QA 1KU0A 2FY8A 3TQFA 5SICE 3IQEA 1C0IA 1FL9A 2XVZA 3RK0A 3ZI4A 1QCZA 3MCTA 4L74A 4BNNA 2D74A 1VBMA 5LC1A 3LVQE 5K01A 1J2JA 2BL4A 4DF3A 2QN1A 4L9WA 3AU9A 4QYIA 2DC1A 2DTXA 4U2GA 2FFJA 3VSBA 4ILKA 5JAIA 1NATA 2QVGA 1KZHA 2OXTA 5FYDA 5GJVC 5BW6B 3ZK7A 1K2VN 2H1SA 4GUAA 5ESDA 1XD2B 1T29A 3HDHA 3Q0TA 2XPCA 2YWCA 1JHPA 3A2LA 2UZ0A 2FGKA 2ETXA 1SMKA 1CHDA 2H9YA 3OVMA 5TV2A 2B0CA 1CUWA 1KK3A 3URKA 4L9AA 3G0IA 1TYDE 5HUJA 3KXKA 1HO3A 1XZKA 2ZSIA 4QLOA 5ECYA 1I2MA 3KDAA 1XCLA 3OCWA 4XYMA 4KAXA 3TW8A 5IJ9A 4BGVA 4ALIA 4BLTA 5JAPA 1YF3A 3GJYA 1UKZA 3LC1O 1E1CA 1TPZA 1FNNA 2WE7A 4AURA 3RVDA 2PGJA 5KREA 4N3CA 4H15A 4AB1A 2ZEJA 5FWAA 3ZZNA 2GJKA 4DUZB 5I8ZA 2W83A 5C5DA 3TOVA 3FE2A 1Y42X 5AI9A 3UENA 4CLXA 5I01A 2NU8A 4TUYA 3BT7A 3TNJA 2OVBA 1V4BA 4OJQA 2NUPA 4QG7A 2PMKA 1PGQA 2CUTA 4HH0A 1WLYA 3T9CA 4LF4B 2O8EA 1U0NA 2EQBA 4ZDKA 4YI5A 3S1AB 3ETGA 4TMVA 4CR8A 4Q3OA 3K4PA 4O1HA 2C9OA 4YRKA 1C4KA 4F56A 4JB8A 2CE7A 3K6KA 1UKVY 1FPMA 3G0CA 3BWDD 2AVDA 2XCQA 4GMFA 4WFKA 5E38A 4GECA 1GTL1 5A03A 2OCDA 2QZSA 4ETIA 4HAYA 1SKMA 3TTYA 1F4VA 4XUEA 1E60A 2EKZA 3UFBA 3U48A 2TMGA 1NJ2A 3THXB 2XUPA 2BDEA 3B5IA 1I3LA 3G0GA 5AW9A 5CW2A 5JNVA 3ABOB 1MGOA 1BYIA 5BURA 4DL9A 1TK2A 2JAQA 3R5FA 4MKFA 4MWBA 4ZT3A 4AN0A 5C8XA 2CKDA 3FVQA 1MT0A 3FZYA 3W77A 2FW8A 2ROQA 5AVWA 3KAQA 3WZLA 1CUIA 2HSJA 2G4VA 4Z4GA 4ZYVA 4ZYYA 1G8JA 3ZJTA 3MTEA 3IDOA 1NNSA 1V4VA 3AINA 2VDVE 5L4LA 4MB2A 2V6IA 1TD1A 5P21A 4JC5A 2C00A 4YJ2B 2PN1A 3UK6A 5LDDC 3LQ1A 2QTNA 5AXBA 3EGCA 3T7TA 4ZCMA 5L3QB 1N4DA 2RHGB 4LYGA 2AOUA 1JQKA 2E1RA 1GEEA 2V6GA 1NVKA 1YV9A 3JU3A 1B1AA 1EINA 4XWGA 1YC5A 2B4AA 2PJZA 2HU8A 4RVFA 4WT7A 3I5YA 2NV6A 2QLBA 4BNJA 2Z04A 3D5QA 2IDMA 2VPZA 1DRKA 3TFQA 2YY5A 3ZVNA 4KQMA 2UXDB 3GV0A 4M87A 2ID7A 3FIUA 3GFQA 4UTZA 4YJHA 2PUEA 5KWVA 4HFJA 1UBHS 4ZCIA 2WP8J 4QO8A 4R81A 3LZ6A 1NBOA 2EAUA 1Y8RB 2J67A 3RPEA 1CERA 4BBAA 3W1EA 4C3OB 1GLNA 2A4KA 1QZTA 2WZDA 2GEFA 4HFRA 2CVZA 2QV0A 2RCYA 3TPZA 5IKPA 1YBMA 3FOZA 5BXYA 4U9UA 1XJ5A 1CVRA 4OP3A 4PIVA 2RJ3A 1XCJA 4GE3A 3WKAA 2Z6UA 5F5XA 4KYIB 4RKWA 2WINI 1TL7C 4O6VA 3RSQA 4OMFG 4U3JB 2JCYA 3DDWA 1I33A 2QQ0A 4HN4B 5DW0A 4DR7B 2PX2A 4V2IA 3FWPA 2GKSA 5FXMA 2X5KO 1GN9A 3I9FA 2HEGA 4ITUA 4ND8A 1FSSA 3PHLA 4CFSA 1O6BA 2GZ1A 3QBJA 5FP0A 2BI8A 3S81A 1VYVA 2Y2UA 2WJJA 4PFQA 4Z4IA 1P91A 2ZUDA 4P08A 1H42A 2NP7A 3WJ1A 4EDFA 1RYHA 4BNZA 1TIBA 4YEDA 1YTLA 1VSVA 4Q02A 1P0QA 4UTXA 1FJXA 4PS0A 2Y4NA 3SZMA 1B8PA 1BQ3A 1YRQA 2POQX 2UZ1B 4L9RA 4RGQA 1VBKA 1NQAO 3SQLA 2GLUA 4BX8A 4LZZA 2VUUA 1ZLXA 3LDGA 4W5WA 4YRDA 3VSDA 3H2SA 5CH8A 4QGHA 1T2NA 3R0IA 3AJ8A 3BD6A 3VUEA 3NG1A 2JBHA 3I9OA 4YMSA 1XWFA 3HRHA 5CJ2A 3ZLTA 3GVCA 1IEXA 4IHJA 3PTZA 4KRXA 3VTKA 1EK5A 3W7AA 2ZYIA 3WB9A 4ACAA 821PA 5ADWA 5IAAA 5JADA 2ZYHA 2FW6A 3E61A 2PQ6A 3MSXA 2H4FA 3DYIA 4MW4A 1XDZA 5K4GA 4YASA 5CFMA 4DIOA 1PK9A 3O8QB 1OB5A 4YCCA 1LDYA 2G88A 3FUUA 1TUGA 1ZQ9A 4MHOA 4XGRA 3PTLA 4IIJA 1K0FA 3VYSB 2WA2A 2ZTUA 2QL7A 3WV5A 1IZ8A 1IQPA 2ZWVA 3WRYC 4CG1A 2NT4A 3IBFA 3SZUA 1HR0B 2P8SA 5IF3A 3OLYA 3DC7A 4BMPB 3QYFA 4QDKA 4F3NA 5I9SA 3BXHA 4JB3A 1E6LA 1J90A 3KQWA 3MWEA 3O73A 2DP4E 3IOEA 2BN4A 4GC9A 4NAHA 1V3UA 1H85A 2QRVB 4JBHA 4TSFA 3A32A 2L82A 5LKAA 1TAHA 4X84A 4LIPD 3GDFA 3KHKA 5CIYA 4JUIA 3WL4A 4YRCA 1XJQA 3RE1A 1ZSVA 4PX3A 5IXSA 2EKBA 2WWIA 3IV7A 3HG7A 1Q95A 3NGLA 1HE3A 4EUFA 2Q99A 1MMFB 3AP1A 2I54A 4IIJB 1CSEE 4D43A 3K71B 5D87A 5BSTA 1E4VA 3T1HB 1DCFA 2OBFA 4MCJA 3MXTA 4Z9FA 5K0NA 4BVFA 1CQIA 1XZJA 1JILA 2JLRA 2NSLA 2BSXA 3MWLA 4HFNA 4OKSA 5LZ5A 3U4AA 3WO0A 2QGZA 5D7BA 1ENPA 2QRVA 2DHQA 3SJUA 2PH5A 5DM0A 1G8SA 1MEEA 2W37A 5CNIA 3HLKA 4L4RA 1K88A 2ON6A 3FYUA 2QX9A 2E55A 3O38A 4FMDF 4MWEA 4HQFA 4PHHA 3DKRA 5LQRA 3FDZB 3VHQA 4PLTA 1KIMA 5HSGA 3NTVA 5CNMA 4GWGA 4DSTA 5IASA 5DSXA 2CJYA 2YV3A 1YA4A 2BZ0A 3O1IC 4H4EA 1GRRA 3LZCA 2WMNB 3CTMA 1QO9A 3I3OA 3VDNB 3KPVA 3Q5EA 3N0XA 1P0PA 3CF6R 1VXOA 2EW2A 1GUFA 2CJWA 1IAQA 2VYND 4XRGA 2MWMA 4DMKA 4I50A 2OKGA 4E7OA 4OG2A 4OLHA 1BA2A 3CFYA 4NESA 1TJ5A 1T9HA 2JGMA 2QR5A 2VAPA 3OOYA 1XCPA 4KYVA 1TI7A 1TDJA 1YCGA 4ZDWA 4D46A 1JIKA 1NVDA 1RWQA 1MB3A 4YCBA 2R1VB 5KYUB 4ZT5A 2DFTA 3FFAA 2ZQYA 4AL4A 3I5MA 1W4ZA 3ZHBA 4P4TA 4GYJA 2HWXA 1N5IA 2W70A 2JIOA 3RODA 2Y1OA 5AVQA 5AK0A 4J7AA 3VR6A 2A84A 3NIDB 3MRVA 3MBKA 1Q44A 3RUPA 2LCFA 2PRZA 3GLTA 2BF7A 4EI7A 3U17A 1XEWY 2IZ5A 3PX7A 3OSUA 2VT7A 3RSZA 1A88A 1KJJA 2YVUA 4ARBA 5AW0A 1JDZA 3NYQA 3LY8A 1CZRA 1J9EA 2X5XA 2XXAA 4MUEA 3EK2A 4MR8A 5K0BA 1DUVG 2A5LA 5CX1A 2ZZNA 3L6CA 3ONFA 4TMTA 2F3RA 4EQZA 1YCDA 2CNOA 2R84A 1EP9A 1NBMA 4BQOA 1T4BA 2R66A 3P2MA 4FEAA 2H92A 1WB4A 3WYAA 4EZBA 5HRCA 1AO3A 1X70A 2F1HA 2VP3A 2W2VA 3EGOA 2EKQA 2BUBA 1L8XA 2B36A 1KR2A 1T3TA 3WDKA 2O1XA 3PEFA 3OPVA 3KOUA 1CZNA 4IM7A 2A5DA 3JPWA 5BV1A 4ZAFA 3M6MD 4S04A 4IDHA 5LMUB 2OV3A 3QFHA 4MGIR 4Q1VA 1OI3A 3VR2A 1WG8A 3K2IA 3ZEIA 1Q6ZA 3O91A 4CM6A 3OX4A 5KEIA 2ZAMA 1JQ5A 4IYRA 1K0UA 1KJIA 3ZV6A 1QP0A 2ECOA 3MJVA 1MVOA 1ZESA 1Y3FE 1M6VA 2X13A 1R0KA 4NL4H 5I7SA 4F7DA 4JHXA 4DR1B 2YJ3A 3D7NA 2ZJ2A 1OGYA 4KZPA 5AIBA 4RETA 1WCIB 1LNSA 3I9V1 2KS6A 3K72B 4MQ4A 2BHNA 3ICPA 2XOKD 5D3KA 3SCZA 2D5IA 5FBRB 2E21A 1PS8A 2EF0A 1IK6A 2GBLA 4CETA 1OAAA 4P36A 1PQYA 4FKBA 5CDUA 1N1EA 1JJFA 1ZRHA 3G8CA 3K1TA 1MR3F 1G21B 1AQUA 1J25A 5BMVB 2F1IA 4IO1A 2ODAA 1H0SA 5IT0A 3RAEC 1CQWA 4TX1A 4WNAB 2BD0A 2D1RA 3QYPA 4YH1A 2AWOA 4KQGA 2JHCA 4TM7A 2X0JA 1BWRA 4JASB 2ZCJA 4Y0NA 4HV4A 5CHEA 4C0QC 3HB0A 2AFHB 3N70A 4DSAA 2ZJ7A 2OQRA 4FZ5A 2ONKA 1SC3A 2RHWA 1OX4B 4Y8VA 4DA0A 3QTLA 1AGPA 2PHZA 1DCKA 1UXHA 3BGVA 4QRIA 1CR4A 3VTZA 3NTXA 2JIZA 2L2QA 3LUPA 3LY7A 1SO8A 1OLSA 2AZDA 3ECAA 5DHUA 3W5VA 3ESZA 1XQXA 3ER6A 3UWOA 4EYEA 4F9GA 2AYZA 1WVMA 1V8FA 4FGLA 2VP4A 4NBVA 2VPXA 2XDAA 5EZ6B 2OKCA 3LL4A 1I3CA 1T5BA 4LTDA 2M6KA 4EL0A 3COZA 4UAUA 3SIXA 4O4JA 1FMCA 4PLFA 5BQ5A 4K6FA 1KP3A 3IODA 1N3BA 1G7SA 2SKDA 5DN9A 3ZE2B 2C82A 2UYYA 4FEYA 1YDMA 2QDKA 4EG4A 3R9XB 1W9MA 4CLOA 4GL2A 3L7KA 3F8TA 5HRAA 4ECAA 3A6JA 3C3PA 4S2EA 4OHCA 3FY4A 1FRVA 3VV3A 2VHYA 2GYWA 3OM8A 5LYYA 4B2PA 4L6IA 2J3JA 3E1SA 3HB7A 1JAXA 1R74A 3K5PA 5DYNA 3OKFA 4XWWA 5B6PA 1NV9A 2YZGA 2ZR7A 3LUJA 3QP9A 7MHTA 4BP9A 4REQB 5JPDA 2IWHA 3WYCA 3HBNA 4DNXA 3HP1A 4LE1A 4TRMA 4CTJA 4RX1A 2GRAA 2JFPA 5SV2A 1RT9A 2JGLA 4LJAA 1Z0SA 4HDNA 3UUGA 1VRVA 1H1DA 2OXCA 4WZBA 2QAGA 4EOGA 3R3YA 2FW1A 3VMFA 1NHGA 3EH1A 1UBUS 5T5QA 2BFMA 2MINB 3AUYA 5BQOA 1O95A 2PANA 1RZUA 2QL9A 4KMRA 5T4EA 3E9EA 4KXUA 2IHJA 3CMMA 4L76A 3DE0X 4JYCA 1U1FA 3OJEA 1C9YA 1K68A 3PZRA 3RBVA 1YONA 3ZGYA 3FB4A 3Q72A 4K40A 2Q5JA 4CQLA 4ZHQA 1LQUA 1U3TA 5CK4A 1R00A 1ACJA 1XZ8A 2OP0A 5LXTA 4FBLA 5ULLA 1ISIA 1WD7A 1E2DA 1NBAA 4MIYA 5FT9A 2ZI7A 5JXWA 1YKSA 2QV7A 5JCOC 1E1KA 3C5EA 3LVRE 1L4HA 4KIFA 3Q85A 4OFWA 3ZOZA 2WNHA 1Z75A 3UK7A 2OC9A 3UJ7A 1YR3A 1VI5A 1TYAE 2FHPA 3T4XA 4M9CA 2FUCA 2VS1A 2ZBVA 1O94C 3PWSA 1X7DA 1CY6A 3QELB 2FSVA 2RG7A 2VP0A 3OJWA 3ID6C 4IG9A 2QI9C 4YP5A 3FKSD 4EPVA 1I2AA 1UWLA 2Q3CA 2PRIA 2ZRFA 1X7WA 2P4HX 2X4IA 1KZ7B 4AF8A 4D98A 3V7UA 1FXWA 3OU7A 1V8DA 1UJ6A 1NVMB 3PRJA 2PBRA 3AG5A 5COQA 3AHEA 4MVJH 1E9DA 2AEEA 2BBSA 3K70D 1R4MB 4BNMA 4AUMA 4HXGA 3DKIA 5BT8A 4BNDA 3E3OA 4LFAB 2V5VA 2J5RA 4W82A 1T9AA 3HKDA 3HYNA 5D86A 4AYWA 4DMCA 2RHBA 4UARA 1A77A 4Z7QB 1C9EA 4BGUA 2YBEA 3LTNC 4XTCS 4YT4A 1ECJA 1TZJA 2AMJA 2GA9A 4YROA 1E94E 3D6NB 3L1IA 4OXIA 1UT5A 1YVDA 4CQNA 4ES6A 1J09A 1V47A 1X77A 2FPGA 2BR4A 4LNAA 1P9RA 3D3NA 1QVZA 5TIIA 3GEHA 4KJXA 1KI2A 1NRJB 3HV0A 1DOHA 5DMHA 3KWFA 4PBSA 2PSEA 5AKIA 5DHTA 5GPBA 4EA6A 4ZOBA 4GP7A 5LD2C 3CR8A 1KPIA 1JHUA 3B60A 4CIBA 5KWSA 3N2GA 1AOXA 1VLJA 3TVDA 4UM9B 3MCAA 2VXCA 4PZCA 4JLJA 1CX9B 4PCAA 1M2NA 4Z1OA 3K09C 2DERA 1MKYA 4TWBA 4X94A 3ESAA 2PRYA 3T9EA 3UC9A 1E2FA 1FC0A 2X9QA 5JE8A 1RKUA 1PKXA 2F9MA 3EXAA 3MJFA 1RQLA 1VGVA 2G1JA 2W58A 3L7LA 4KQIA 2NU8B 1NG1A 1ODKA 5JHHB 2HHAA 4BNYA 1HM5A 1RLMA 1SFRA 5JNLA 5DNUA 4ZVOA 3MPUA 1BAPA 1JFFB 1USVA 1VXRA 3DOOA 3R74A 3GVPA 2IW3A 2YIVX 1RXYA 3WIEA 1H6BA 4G5XA 2DCMA 1FYVA 1NDHA 2G5TA 1CUBA 1U4SA 1BXZA 1V71A 1O3YA 2IHZA 5HOQA 3T54A 1HE1C 4RADA 1HYBA 5DBGA 2O7VA 3E5RA 2V45A 2FHSA 3ILHA 2UUAB 1NNUA 2QK4A 1QNLA 2GAOA 2W8ZA 4GWKA 2Z4TA 3M89A 1QZ3A 4PG5A 2QLTA 1IH8A 3CJQA 4A7PA 4PG7A 1E8MA 2DPHA 2XA2A 3IULA 3NTUA 1PEYA 1GFWA 1VL6A 4WXMA 2Z30A 1NVWQ 1WE2A 3D4BA 1NUSA 4GMGA 4BMYA 4R0MA 3PCRB 1PVVA 3NIBA 3TD2A 2FUG1 1N5OX 1X8LA 1J00A 2X9NA 1W30A 2YMQA 3AR9A 3V7WA 1ZX1A 3DO6A 5TDHA 1U2PA 1KTVA 3IDQA 2JGAA 3K0FB 4EIWA 1YAJA 3U26A 1G5QA 2MYPA 4RY9A 3OQIA 3O1LA 1J6UA 4AP5A 5IAJA 1QHGA 1YI1A 3DE3X 3OWHA 3KV1A 4N7RA 1ODIA 5E9JA 1CP3A 4LOLA 1P0MA 3F8WA 1RM3A 1EJBA 1CUDA 2AOUB 4GMXA 3HSYA 2RHTA 4DCUA 4ZV4A 1Z3IX 1YULA 2JCSA 2VPWA 4IQGA 5BWNA 1U4NA 3A37A 3WNDA 4TN1A 4Y6LA 1RHQA 3VH3A 3DHNA 1KNQA 2V74B 3DVQX 4MV4A 3H2IA 1SA0B 4F3RA 4IOJA 1YKGA 1V11B 4EGQA 1YB1A 2LRHA 6AT1A 1H69A 4IWYA 4PG6A 2E18A 2CVPA 2PS1A 2R8PA 3A4TA 4WPGA 1AZLA 5CYPA 3KQUA 3IAAA 2Z8YA 2FUG6 3H11B 1COWA 2FN3A 2HLNA 4O5AA 2FWNA 5IM5A 4GOJA 9ABPA 1HDOA 4KPFC 4IHQA 2WFZA 4GP6A 1O6GA 3IP3A 1XVLA 2AVNA 4L57A 3L84A 4LK2A 5CFZA 4N5DA 4QBHA 1MGPA 2OBBA 1G3MA 3AY6A 3EDCA 1T4MA 3IOCA 3L82B 3OOHA 1MJ5A 4CJXA 3CUVA 5I47A 3QWIA 3VZSA 1B6TA 1XQ6A 3ITDA 3KELA 5AW3A 1JKIA 3GLQA 2IYLD 1J07A 2PU5A 2QPTA 1LLDA 1RXSA 2XHEA 3KQVA 4LZLA 3SIWA 3J81k 3CVYA 3EXIB 2IV3A 1NXPA 2AGVA 3V4OA 4GKJB 4D9KA 3TIIA 4DB2A 4GBMA 4ZU3A 4RWZA 4AMYA 2PK3A 3TLMA 2FJPA 3GUCA 1XKTA 3JAKA 5ADVA 4LAFA 1F2VA 4EYSA 4K2HA 4IIHA 4G25A 3ZOKA 3U4HA 1PWXA 1FMTA 2NZ8A 4HDNB 4IIJF 4PAWA 3I2KA 2YMMA 3OCXA 5E4TA 5H16A 4F2WA 1DRJA 4N47A 2HGSA 2P1DA 3ADCA 1XRPA 1L4NA 3FFTA 4GR4A 4MO9A 1ACLA 4L7QA 4DCOA 3H1GA 1NJ8A 4OEHA 2ECFA 3BSYA 4QPZA 4U5XA 3MRTA 1U8AA 3PL5A 2P5SA 2WV7A 4KR7A 1G6Q1 2I65A 4RVHA 2XUHA 4FJ1A 1YB4A 2GESA 4H59A 2EX4A 1R6VA 3O84A 4B0OA 3TZLA 4YWHA 3DUFA 3M1AA 2JIBA 1FJ2A 4RZUA 4WZAA 4HTFA 4HGZA 4L4XA 3IO5A 1Z12A 4CZ2A 5KNCH 1W0JA 5THQA 3TRFA 1TZMA 1Y7LA 2O3TA 5LD2B 5FNVB 2AMVA 3FJYA 1X74A 2A3NA 3R6GA 3ZH2A 5JJLA 2E49A 1AVTA 5HJEA 3HTXA 5JBIA 1C0LA 3CT6A 3SKXA 3DVAB 3R5SA 3QELA 3HZOA 2XE6A 3LPDA 2VJKA 1TEHA 2HIMA 3C7DB 3ELYA 3A6ZA 5FWYA 1LJLA 1Z68A 2ZJ5A 3JQ7A 2O54A 1HDXA 3B3QA 5DTIA 1I1OA 2WJHA 4MQ5A 2HWUA 4G23A 3BERA 3LBAA 3AF3A 4CFYA 4BMOB 2IH5A 2R7NA 2G1AA 3RYCB 2WWVD 3ZWOA 3INRA 4YJ2F 2RHRA 1WKVA 5F21A 3FVWA 4KSYA 4IZHA 1EVQA 1E5DA 3DAGA 1IB0A 3BRSA 2F2TA 2HLDA 3EDQA 3F90A 4HH3C 2W8BB 3EC1A 2OUKA 4QBTA 1XCGB 4HZGA 5FBHA 5BWLA 2BP7A 4EYQA 2JLCA 5FNZA 3CZAA 3S0JA 1HQYE 3L7NA 3L7YA 4LN1A 1GPUA 4S2UA 3IAS6 4QU9A 4MUAA 4I50F 4D82A 4BUJA 4K6GA 4ND6A 1P5RA 2O0HA 2QD2A 3PQCA 2GT1A 2HSGA 4OQXA 4WA8A 2I5PO 3ZHVA 4J3JA 3G85A 2ZUCA 3KIPA 5EP3A 4M1QA 2BHLA 2GAFA 4GX1A 3M5CA 3VBCA 1EJ2A 2X8JA 3SF8B 4ZAXA 2CL5A 1P19A 4LWPA 1UBKS 3NVDA 1GILA 1SHLA 1SKBA 2XDQA 1CDDA 2W8BA 2KLHA 4F7WA 3PQ6A 3PRKE 2BOVA 1PDOA 3AF5A 2H4WA 3HRKA 2JHGA 5CCDA 4BASA 2IYNA 1CR1A 5ALOA 4MKHA 1SCJA 3OOWA 3HBMA 4K9DA 5KYYB 3H84A 2V7QD 4WDRA 5AESA 2PSDA 4DVGA 1P6UA 1P7PA 2ODNA 1N4AA 2G1PA 1YJQA 2IOYA 3HFRA 2O8CB 4Z3KA 5K4AA 5H4GA 4KO1S 5HTOA 2VT3A 4E5UA 4MPTA 3OLXA 1WDMA 1KU6A 2Q4EA 2WOJA 3ZJ4A 4CT5A 4M1WA 4L5JA 4DYVA 4E33A 3GZJA 1OKKA 4J8PA 1BO6A 4Y1EA 2VUTA 3U9TA 4XM0A 3VVLA 4OFXA 3TMYA 4LHSA 4MW9A 1NJ5A 1W93A 2BWJA 4WINA 4BFTA 2F1RA 3O8QA 1PTJA 5EQTA 3U3KA 3EMBA 3AZOA 4TKMA 3AV0B 2N0SA 4QREA 2XGMA 5FORA 1CVLA 4TMWA 2I9PA 2FPRA 1OASA 2QTVB 1FP2A 2GZAA 3RS2A 1IZ0A 5FWDA 2ONCA 5K8IA 3RRFA 4Y2YA 4TZTA 5C3MA 4B35A 3UHPA 4Q4AB 3U4CA 5GV7A 5TARA 1E7MA 3N39C 1D4ZA 3NHPA 4H3VA 1M66A 1XMVA 4O1IA 5LU8A 3A28A 2HH9A 1DLIA 3IA7A 3Q11A 3TX6A 1KP2A 3EXHA 3BRWA 3WK5A 4EZIA 4IY1A 4W99A 1X3LA 1NLMA 2HQRA 3AR4A 4KQ9A 4P35A 3BXOA 3BEOA 3CNOA 3LMKA 2AA3A 5DHPA 3RF7A 1WW8A 4N3GA 1CJSA 1WUJS 4RTMA 3U2QA 3C15C 3JWGA 1XZQA 1N92A 1Y3CE 4HKTA 1D1SA 2AFRA 3EJWA 3ENWA 1M74A 1N8TA 3UW1A 1XK7A 2NVUA 2PX4A 5EJFA 1G8YA 4J03A 2LPMA 2BFAA 4ZVQA 3QVTA 3X1JA 4A8HA 4D42A 3AIMA 5DGTA 1ST2A 3O8CA 1QZZA 5ITZB 1UFOA 3JR3A 2KHZA 4TQ9A 3LVFO 1Q1GA 3D1JA 4K46A 4D9FA 3V8PA 1YRHA 3F96A 5JAUA 1KTIA 1XLUA 1DAPA 3TQQA 2P5TB 3IVXA 3NETA 3O8RA 4PNPA 5IPFA 5FLEX 2P30A 4V0QA 4DCCA 1FA9A 1WSDA 2GBCA 1BG6A 2NZVG 2YDXA 1CR2A 1JBQA 3P71T 1WS6A 4ND3A 5H4HA 3NHZA 3SYLA 3FSGD 2PZAA 4LYJA 4YO7A 4QA9A 1MHTA 1JDBC 2NZXA 3EXIA 4WLUA 5F9MA 3WGMA 2JJ8A 2H31A 5JQGF 3U62A 1QYWA 3PQ5A 3ZDYB 1GUYA 4N8EA 2P5UA 3Q0IA 4MLPA 1F2TB 1BKDR 1UQRA 3V33A 4DPLA 6REQB 4K88A 2NG1A 4NS1A 1SD5A 2X2FA 2CL0X 4MGEA 2SICE 3K1ZA 3P2YA 1E96A 5F33A 1SUWA 3ZJYA 4G0VA 1QK5A 2Z5FA 4A03A 3IE1A 3QWFA 1LUAA 3A1VA 1LPSA 2ZS9A 1PTKA 2GSWA 2Q41A 4G1VA 2VBIA 5DMXA 2HO4A 1YXMA 4JYAB 1TQ8A 3T61A 1BDMA 2RAVA 2OGSA 3P4XA 1G17A 4IO0A 4N5MA 3VDQA 3U80A 5KQRA 4HDSB 1AV7A 4PHFA 2PL9A 4QYTA 4F3YA 1Z6AA 4QQNA 4M2LA 5HG0A 1D9ZA 3VKHA 5G0WA 1PR4A 4EHNA 5I9BA 5K0CA 1ZWKA 1ZXXA 3MMXA 2IY8A 2JC3A 4NMHA 4X6UA 2QTAA 5C8YA 3DXXA 5ALRA 3SM9A 5A7FA 3S1AA 1J9GA 1MOQA 2OBLA 3BGWA 4O4IA 2ZBUA 3RT7A 2QN2A 4F1WA 4P5EA 1UEXC 3ZU2A 3EW7A 4FFNA 1V9SA 5CAEA 5JNWA 3U6KA 1PWHA 4X3PA 3HO8A 4U63A 2IYRA 1X80B 3QZUA 4OHMA 3VKGA 2HD4A 3OE1A 2E4VA 3FTDA 2RJNA 4IRXA 1QGOA 2AHOA 5BQXA 3MYYA 2QD4A 3L1KA 3OHMA 4EF5A 4EJ6A 3U7FB 4WLVA 1EUQA 3G7NA 1RXVA 2WWWA 5AR1A 4NICA 1E4OA 2PZMA 1UKCA 3EGEA 3JWJA 3QF4A 4W5HA 2BAGA 3TF5A 3JQPA 1LC3A 4XW2A 2GLTA 5D3QA 5CBPA 1JQEA 3EVNA 3L5OA 4O4IB 2B4QA 1JI0A 2Q0QA 4X3OA 4TL8A 3GPIA 1ZAKA 3V00A 3QJGA 3ZHOA 4F4UA 1E7WA 3B5JA 8OHMA 3OPQA 3DTVB 3SS7X 4QUJA 5LA6A 3G79A 4J4HA 4F9TA 4ZZ0A 2HBZA 1DELA 2V3WA 4D3YA 2XGJA 3ZWDA 1XDBA 2JGDA 3D4PA 4LTMA 16PKA 3ZWNA 8GPBA 1UMCB 3NJ8A 5E1DA 5HOEA 4EY5A 5B2FA 3F9CA 4IFIA 1UOQA 1J8FA 2AOTA 5LXTB 2ZI3A 4WASA 3WAGA 4JV5B 1YSCA 1K63A 3QMWA 5ALJA 1B7GO 2XIQA 1PWYE 3CXUA 2W4QA 1VSTA 1F8GA 3TQCA 3A1CA 1P7VA 2JEZA 4DUGA 5K0ZA 3HA5A 3THWB 1R0CA 3AUXA 3QEKA 1CU1A 3GX1A 1WUYA 3DHWC 3FIJA 1YASA 3MTGA 5A2GA 1CHNA 1L4MA 1XTBA 2R47A 2B8NA 2Y0DA 2WC1A 3H97A 3SYNA 1VP3A 4UMFA 5MN5A 1TQ4A 1J0EA 1CUJA 4IXTA 1W2GA 4KB5A 5KYWA 4Q21A 2VJNA 2X4GA 1FCJA 5I7VA 1G8GA 1OZAA 1RJWA 4RF5A 1XPUA 5GQSA 3PEVA 3BULA 4C87A 1IQ0A 3F6BX 1YT5A 2AN1A 3KKQA 5JAHA 3COWA 4Q3KA 3M2PA 1E7YA 2VNAA 2IEBA 2QYTA 2R97A 1I6LA 4RSMA 4J75A 5HWSA 2JIZD 3RK1A 3HXQA 1EB8A 4V3BA 3TRIA 3OOSA 3WYBA 1II9A 2UYQA 2O7NA 4UCXA 1PIWA 3KJIA 4G5GA 4YLEA 4GLBA 4GVLA 1EX1A 2PXCA 4BUZA 5AK4A 1R0XA 1U9JA 3G9XA 4ZVNA 3ZLBA 3QEOA 2IBMA 3P0EA 3SJAA 2X15A 4DUGD 4H7PA 3T34A 5IVPA 5M29A 3UN1A 1TZBA 1F8FA 1XRLA 1NBHA 2XSZD 2I2WA 3Q8MA 4IDFA 4ZDIA 3BMOB 1M6WA 1LSOA 2UZ1A 2VZLA 5K09A 4TN5A 4V0ME 2HFKA 1N2CE 1NONA 3OE5A 3UIEA 3W04A 4DBVO 4Y2HA 5A7HA 1XCMA 1MLDA 2WABA 3GD5A 4Y2VA 1TKAA 3JV7A 4ZVUA 5U4QA 1GAQA 2CLMB 1KL7A 5BVHA 5JYEA 4OX9Y 3KKEA 3DYVA 3KLMX 5FR1A 2F9FA 5CB8A 2VT6A 2VPTA 3PU6A 2O2EA 3BWYA 3ZXYA 2BSAA 2J41A 3T3DA 1SOAA 4AN1A 1ZPDA 1RJEA 4B31A 4EECA 1I7SB 1ZEJA 2WIJA 2G5CA 1GA1A 1JKFA 3BGIA 1T5OA 2XR1A 3O8NA 2BGWA 1AQ6A 3FDJA 4CUKA 1AIPA 2NVBA 1GZHB 4RKQA 5DP1A 1T5SA 2KI5A 1ML3A 4YRPA 1W85A 3TVYA 4CL0A 5I45A 5C7LO 3RIYA 3HV2A 4LF9B 5KSWB 5EC8A 1NR5A 1SXIA 2XRMA 3MJ4A 3Q7IA 1ULHA 2CLDX 2P7IA 1TUBB 3EQ2A 3IYLW 1MOSA 3HJUA 3R6LA 4HX2A 2NVUB 3X1WA 3MOGA 3F73A 3MJRA 1SUPA 3RROA 3UHAA 1IBRA 3ZVRA 4C5BA 5DTMA 2FE4A 3PL1A 1PCXA 2P9CA 2Z57A 3F5QA 4Q3EA 1FDSA 1GXSA 1KI7A 2O7RA 1B14A 4A3SA 4N0EA 4CQLB 4GC5A 4FYPA 4X62B 4YUXA 5DLYA 4K87A 5EJ7A 1GTRA 3HVKA 1M1NB 3UANA 5BYKA 5KYGA 3B1FA 1GQYA 1FSPA 1DTWA 1II8A 1XTSA 2VDLB 2YR0A 3U0BA 1P39A 1PVOA 2VNKA 4EZEA 1BXKA 2R6DA 1QQBA 3OQIB 3WDLA 2A9QA 4W9MC 4LF5B 1UIRA 4I8XA 4ZEVA 5EIEA 3N75A 4P38A 2QF7A 3AUJB 1J20A 3E9MA 1JQJC 4GXNA 4OBWA 1S9HA 2R7LA 1OWNA 4HYYA 4L07A 4UE3S 4UUPA 3HDYA 3JQBA 2COUA 1F2TA 3CH4B 4FVTA 4ZARA 3CUSA 2X6RA 4ZEMA 2X0NA 4BCCA 1JL3A 1H2RS 4Y1RA 4PPQA 1TKCA 2QZPA 4OX9B 2PRJA 2H2FA 1ZJYA 4CL2A 1P1JA 1YQDA 2ZCUA 3IAFA 5D51S 3EA5A 1PR9A 2QTGA 2REBA 1Y5RA 3FWYA 5JNTA 2ZYRA 1QJ4A 3X2SA 3TBFA 3FCEA 2Q2OA 3D0OA 1SCDA 4AICA 1TCVA 1O96B 5EWMB 2QQGA 2QVBA 2C4VA 1JQDA 3H8WA 4MDYA 3DMHA 5F2OA 2FP4A 3AKCA 3MB8A 4OQFA 2NN3C 3O92A 1I0ZA 4I6GA 3AVQA 1TYBE 3R7WB 3W3AD 1P5ZB 1FP4A 3H4TA 2WD8A 1DBWA 1KGSA 3IHKA 4EFDA 1NUTA 4D79A 2YOHA 3CLTC 3W0LB 1RZRD 1DO8A 4DLZA 1LW7A 4YUYA 3TTXA 2VRNA 2JFQA 2YQZA 1DDIA 3C8ZA 3CF4A 3LF1A 3ROTA 3PUWA 3CC8A 3GROA 4IJQA 2F8LA 4MCAA 5TC4A 5IJ0A 5TGTA 4QUEA 1V6CA 3FPGA 4RY8A 4DLTA 5AVYA 4XDYA 4EMTA 2AX3A 4U6NA 3CB2A 3F7MA 5ERYA 2RGUA 3O9MA 5LZ8A 1SM4A 4B6JA 1XCBA 2VQ3A 4J3NA 3TW8B 4JELA 3T3GA 3DZ8A 4DM3A 3W9YA 1CFJA 2BE7A 4MVJI 4WESB 1XWIA 1JN0A 4FW9A 1ODSA 3WMEA 2BMVA 4CF3A 2BPOA 5EIFA 2XDYA 2RGWA 3ELWA 2OY0A 4QUBA 3AF4A 4AMUA 5JIBA 4S1VA 1E62A 2IIBA 3MINB 1D6NA 5ARDA 2LW7A 3S8EA 1KFKB 3UJBA 5FA5A 2GERA 3N5KA 5D5QA 4B76A 4OL0A 1Q0UA 2D2VA 2HWKA 2W2KA 5EJMA 3SLGA 3V3KA 1OGJA 1MPTA 3C97A 4A92A 5P8WA 2OZLA 2VDMB 3VSAA 2PGOA 2WTNA 4IIFA 4LRYA 1GUAA 2NO7A 3EB9A 2N46A 2ID9A 4YTEA 3DPUA 3IPCA 4CKCA 1QE3A 3UMMA 1U7OA 1W8DA 3NU1A 1R9GA 3U7RA 4DLSA 3ZE8A 1D2EA 2GAJA 3C87A 4TTAA 3VGPA 4CM4B 4DY4A 5G2OA 3M9LA 2YWBA 4LSGA 3LT5A 3VOAA 1NMYA 4IOLA 4KKXB 3DFIA 4O2BA 2OZLB 5GADl 2GKOA 1C4XA 1HE8B 2XUZA 1EAMA 1JLRA 2RIRA 4UHCA 5FAXA 4DTIA 3EMVA 3RGGA 3RV4A 4Z7JA 1J2TA 5C53B 5JLJA 1J06A 1EM8B 4MP8A 2XH8A 1P72A 3QM1A 4XIYA 1RBYA 4KN9S 4CKCB 4U7FA 2AS0A 1ODLA 1RYNA 2YYYA 2GN2A 5IZ4A 1QDEA 3AOEA 3QEMB 2V9PA 4N7JA 3ZCUA 1LX7A 4F93B 4IQ8A 1AKTA 1EDZA 3A14A 1YZKA 1J8YF 3JVDA 4PRZA 5AJWA 1EK6A 3LOUA 5KCMA 2HC9A 4UHBA 1K4YA 3TRKA 3TRHA 5BN5B 2ZSBA 3KLBA 5E0OA 1NI5A 2C9ZA 4OL9A 4XARA 1KMCA 3HKEB 4MO2A 2PH3A 5A62A 4OUDA 1KKMA 3VR0A 4I7EA 2PLRA 3V4FA 1OLSB 2HJGA 2YASA 2ZYUX 4CV2A 4AMVA 2N9UA 5DZSA 3L0BA 5I7FA 2Y1FA 1X8KA 3L79A 1JXOA 4BU1A 1YMQA 3AYZB 3NWOA 3RAJA 1EK2A 4YRJA 2QE7A 3I01A 5AM1A 1XMQB 1ZK1A 4OM7A 4F5EA 5KOJA 1QVAA 2C20A 3UPUA 3B3FA 1DP4A 2WJYA 5ERXA 2Q3BA 5DK4A 2J6IA 3AGPA 3BTOA 4WHMA 4P33A 3T1NA 3NBQA 1P5JA 4ND8B 5JS7A 5JAOA 2C03A 3ZNNA 1O5TA 3R7BA 5KC8A 3HACA 5HTKA 4BNVA 3LCMA 4OSPA 5LVAA 3AERA 3ROFA 1IDOA 1RHRA 4K1LA 3GLHB 2ATEA 4Y0AA 4KWTA 3B12A 4R1QA 4LBWA 1Y8CA 5CDFE 4O2LA 4BXOA 4N18A 1NZFA 1BJTA 1ABEA 4QARA 4MI3A 1N7HA 2JEYA 4L6CA 5KMGA 1Z2CA 2AFVA 3ZJ5A 3ZWWA 3B38A 1VL2A