3GDMA

Crystal structure of the k93r mutant of the orotidine 5'-monophosphate decarboxylase from saccharomyces cerevisiae
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
261
structure length
261
Chain Sequence
KATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELLELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRRFADIGNTVKLQYSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLATGEYTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDDVVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the K93R mutant of the orotidine 5'-monophosphate decarboxylase from Saccharomyces cerevisiae.
rcsb
source organism Saccharomyces cerevisiae
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 95
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3gdmA00
3DAQA 3LRLA 3EWUA 1VYSX 3R89A 1W56A 2H8ZA 4K8HA 2C13A 2HS8A 4XQ6A 3G3MA 2YW4A 3MYPA 2Z1BA 1TV5A 5LNRA 4GBUA 4MYXA 4YLWA 1K7XA 3BPWA 2QDHA 3GDMA 2ISWA 4JY9A 1VQTA 3L5LA 3UWVA 5D32A 4FXRA 4EVZA 5CSSA 5D2YA 4FHAA 1OX4A 2Y7FA 1HUVA 3G1DA 1QO2A 3LCWA 4NZFA 2FDSA 3DFTA 5D38A 3KHJA 3PULA 3Q2DA 2FPVA 4I7UA 2NXIA 3IIPA 2Z6IA 4UFIA 3O05A 2CLLA 1G7VA 1JULA 3S6DA 4RXGA 3I6RA 1SU5A 4LVGA 1H63A 4YXGA 3TQVA 1DL3A 3STFA 3TJXA 2VC6A 1GEQA 3Q58A 1TTJA 2W0UA 1KW1A 1KBJA 3STGA 1SZGA 1ZAIA 1H7NA 1SZFA 3G1FA 1K8YA 4R33A 4AVFA 2V2HA 3MI2A 1KFBA 2BLEA 2QJHA 3KAOA 3NXFA 3P7YA 2OZ0A 2QCHA 3QW3A 3JR2A 2E09A 1NAL1 4R34A 3NL6A 5FF0A 4JTKA 3W1UA 3PR2A 4MFEA 4NXSA 1EX5A 1FY6A 1ZFJA 2IQTA 3MMTA 3F03K 2ZA2A 5D2VA 3HG2A 4FIQA 5LNWA 3EWWA 3N2XA 4RLIA 1B9BA 4AWUA 1TTPA 4JS3A 4DXVA 1F74A 3W83A 4AHQA 3KRUA 5F2MA 1NSJA 4MY1A 1QOPA 3L21A 2NWSA 1JCLA 1TJPA 3B0PA 3W1TA 3ABSA 2OMAA 5LHFA 4UFKA 1EUNA 1TPFA 3ABOA 2CWNA 2ZRVA 4TU1A 1VRDA 3KRSA 3C4UA 3W2LA 3SGUA 3MP4A 1IIGA 1LYXA 4N4PA 3TC6A 3W1NA 2C14A 1A5SA 2XN0A 1ICSA 1P5BA 2Q3RA 1QDSA 1DVJA 1U83A 3CEUA 4WY0A 2I1OA 4UTIA 4BF9A 3TH6A 1JJKA 1Z42A 3W72A 4A2SA 2H8XA 1TPB1 4ZQMA 4AF0B 2WSYA 2V81A 2NUXA 3KVMA 5A5WA 1H7OA 4HHPA 4LRTA 3W7GA 1QMLA 3PS7A 5CG7A 1OVDA 4PC8A 3G1HA 4XTIA 4BR1A 3W7KA 3VE9A 2LLEA 1W31A 5EMUA 3STEA 4Z1DA 3O07A 1O60A 5C6MA 1UUMA 1HFBA 1G4EA 2PE4A 5DCBA 5MHBA 3C0JA 1J4EA 3LCXA 1XBVA 1TPDA 1F2JA 1ALDA 3DGRA 1LDCA 1IXPA 3W6YA 4JR5A 1K8ZA 1A53A 4DPPA 5AYXA 5D30A 4GFSA 3TU9A 1NEYA 4QJ1A 3ELFA 3S42A 3O06A 3B04A 4LU0A 2GVGA 4EIVA 1ZAJA 4QITA 1W5OA 1TQXA 2WKJA 1OFBA 2X16A 4UMBA 3DFSA 4JIQA 4M6QA 4KKXA 5DBUA 1UB3A 3QZEA 3W9ZA 1WXJA 2FIQA 3TJLA 3FFSA 3NDOA 1WBHA 1RV8A 1H7WA 1ZAHA 4RX0A 4PODA 4XUGA 4O12A 2R91A 1MO0A 4O0KA 4WZHA 1GVFA 5G5IA 2FB2A 4XBKA 2F7FA 3PAJA 3S0CA 1K7FA 1ADOA 1T0OA 4JXCA 3PG9A 1K7EA 3O16A 1LORA 1FXPA 3NM3A 4UTKA 4JX4A 4QNWA 5C5YA 4AMAA 1Z48A 2HS6A 3EX2A 4FNUA 2GUUA 2ZZ3A 2I9EA 3UNDA 3E0IA 3R13A 3HPSA 2ABAA 1YDVA 3QRHA 3W7NA 1THFD 1KM6A 3IIVA 5K9XA 5H2ZA 2E5DA 3HF3A 3EWXA 3PBUA 4DF2A 3TMQA 2GJNA 3UWYA 4UR7A 3A5VA 4AB4A 1YDOA 1WOBA 3P61A 3L65A 4AWTA 3EB2A 2NUWA 4JTJA 4WXZA 4NUWA 1ZHAA 3NM1A 1WYIA 4HNNA 5D2WA 3LBCA 4IMCA 2J24A 3IGXA 5SWUA 2C6QA 4JICA 4ADSA 1X1OA 2FLIA 1KBIA 3QPYA 3G24A 3PC0A 4NZJA 5KTLA 2ZRZA 3W07A 1YXDA 3EXSA 3CIWA 4N9BA 2ZZ2A 3FKKA 1WQ5A 3EWZA 5D2TA 3ATYA 5FESA 1SZNA 3DFOA 4H4IA 5HJLA 2Z6JA 4MZ1A 1RQHA 3GKAA 3WJSA 1I2OA 1SSDA 1PL9A 3CU2A 5DELA 3CT7A 1EUAA 4WQ6A 3O15A 1EP1A 3TUUA 2VEKA 1SPQA 3W1LA 3W7MA 4FNQA 3TSMA 3G3DA 4RR4A 3DKLA 4CCDA 1UJPA 2GQ9A 1SW7A 1ME8A 1KFCA 4UIOA 1GG1A 2C19A 1YLVA 1F5ZA 3QSTA 4GNJA 3I68A 3C56A 1S5VA 2ZRUA 3M41A 3TV8A 3WJWA 1SQ7A 4GE8A 3W70A 5EA9A 4BI6A 2V82A 1W8SA 3JS3A 2OJPA 1L9WA 3UPWA 3FJLA 3YPIA 1WA3A 3AJXA 5CPOA 1FX6A 1PHQA 3F1QA 2VOMA 1OABA 2NZLA 3M5ZA 2C15A 3W7IA 4LY8A 3C2RA 1F7BA 3SZ8A 1YADA 3T7VA 3TE9A 4XWUA 1XBYA 3MYOA 4RXFA 2ZA1A 3LI0A 4LW7A 3HGSA 3GDKA 3HGRA 3W7EA 1AW1A 1FCVA 3MO7A 2H90A 3MHFA 3TCEA 5EY5A 4NQ1A 5CPLA 2CLEA 4A29A 1B57A 1K03A 1JCYA 2CZFA 3KVKA 3PSVA 4K39A 4JY8A 4NT0A 1YXCA 3W76A 1W37A 3NO5A 5D33A 2C1HA 2Q8LA 2CZDA 4O19A 4OHQA 2I14A 4LV9A 5F1UA 4XBSA 1H50A 5DBTA 1I2RA 4A3UA 3S1UA 1SSGA 4ALDA 5C2XA 4GC4A 3EKLA 4E2DA 1A5AA 4M5PA 3TFCA 1LRQA 1T96A 2BWGA 4UXDA 3M47A 1M5WA 4QNEA 4UMAA 3THQA 3L0NA 3O6CA 3R12A 3B0VC 1H7XA 2P1FA 2JGQA 4NJJA 1U5JA 1GYLA 3L0GA 2B7OA 3LXBA 4E38A 1XFBA 4ICNA 3BO9A 2RDUA 2ZFAA 5D37A 3E12A 3NQ8A 4JTHA 5E1QA 4N02A 1LROA 2JBMA 3V1PA 1JRBA 4DO4A 2FB3A 4O4WA 3BARA 3HOJA 3QC3A 2Y6ZA 3HJZA 5U4NA 5LNVA 3CC1A 3DH7A 3MUXA 4KWVA 1XBZA 4ORMA 3S1VA 4OE7A 4IMEA 2YYTA 2NLIA 4N9CA 4A22A 5D03A 4FEZA 2RHGA 4ZL1A 4IX0A 3D0CA 3HIJA 1QPRA 5TQLA 1TREA 3TSBA 2A6NA 3LXAA 3GDLA 5CZJA 3M7WA 1YXYA 5CSRA 1LLWA 1W3TA 4UTMA 4HNUA 3LLFA 1L2UA 4JTSA 3G0UA 3SR7A 2A7PA 4O10A 3NQFA 5DY2A 5J5RA 3H55A 1G67A 2QCEA 1LRNA 3LRKA 1ME9A 2VENA 3DBPA 3N34A 4IMGA 1WBJA 3CPRA 4KWWA 3C2VA 4JTEA 1Z41A 3SGZA 1UASA 2FTPA 5LHEA 4AHPA 1GVSA 1DV7A 3R8RA 3ABQA 1M7OA 1OFQA 4KFNA 3S1WA 3TQ0A 1I2PA 4Z1BA 3TXZA 4N2YA 3P80A 3UYCA 2DZPA 4MJMA 3WK2A 1EB3A 3UY8A 3FYOA 1I4NA 2WNNA 1R46A 4HT3A 4GUGA 1XDLA 3T44A 2ZRWA 2NWRA 5I3GA 3WJZA 3TXVA 1S5TA 3M6YA 4JD4A 4JIPA 5I3KA 4WD0A 1XUUA 4M7SA 4WY0F 3BLIA 3IVTA 1OFAA 3QYQA 2ALDA 6ALDA 2YCEA 2HTMA 5KITA 1VS1A 3W1RA 1WV2A 3LGEA 3W22A 4X9SA 1DOSA 5T26A 3VCRA 2ZA3A 1FWTA 5CZ0A 1LOSA 4K38A 1VLIA 3LHZA 4OV4A 3K30A 2FJKA 2HMCA 3M5XA 1Q3NA 1SFLA 5K9DA 3SY5A 2TPSA 3TROA 3UWWA 1LM1A 3ATZA 3LOTA 2BX7A 4X3ZA 2FQIA 1TCDA 1P0KA 4O52A 3PBVA 2ZZ5A 3W7HA 2GQAA 5I3FA 2DZXA 3Q37A 4C1KA 1DJNA 2B7QA 4LRSA 3C52A 1GVOA 4TMBA 1KTBA 1R2SA 3BVJA 2OCZA 3CWNA 3MP5A 1W54A 3Q94A 2QCDA 5EBUA 4O28A 5LZLA 3MI3A 1GZGA 3H54A 4O1DA 3FOKA 5K4ZA 3P8JA 2W6RA 1QPOA 3W75A 3OVRA 2YSWA 3ZR4A 3BW4A 3GZ3A 3EEGA 4BWLC 1JUBA 1KM4A 2YR1A 4TMCA 2QCDB 1QOQA 1GG0A 3N14A 1LZOA 4IWWA 4UTUA 4LS2A 3W7DA 3DI0A 4RKAA 3IRDA 3B4UA 2WNQA 1KM2A 3A23A 4OU1A 1OJXA 3FKRA 3WFAA 1AL8A 7TIMA 1RVGA 3DHDA 4UTWA 2DZWA 3IVSA 3L2IA 3NOEA 1GWJA 4NX0A 3THAA 4JTLA 2ZTJA 2YW3A 4FXSA 4MLJA 3CM4A 4LOCA 3WK0A 3P5YA 4FF7A 4QISA 4DBEA 3C61A 3TMLA 4ONVA 3DKJA 2CLMA 1BKSA 2XFWA 1VJIA 3LHWA 1G4TA 1K3UA 1TSIA 1J5TA 4JN6A 2ZZ7A 1PE1A 3WJXA 3SIZA 1HO1A 1PCWA 2E77A 3TA6A 1RZMA 3O63A 3LHYA 3DI1A 3DZ1A 1KV5A 1GVRA 4P2VA 2QJIA 2ZZ1A 2DJLA 2EHHA 4GUJA 3W87A 2AAMA 1VH7A 1KFLA 2O7SA 4PFMA 4NX5A 3KX6A 4RV8A 5E0KA 2Y61A 1FCBA 2GOUA 1E51A 3HPXA 1RPXA 2EF9A 5IBXA 5G1YA 1YDNA 1A5CA 3VNDA 3UY7A 5LSMA 4HPXA 1YPFA 2CLFA 1O95A 1LBLA 3ZFHA 1HTIA 3T55A 5BNKA 3QQ0A 2QJGA 2WQPA 1XKYA 1QFEA 3OVQA 1L6SA 4BI7A 8TIMA 4I7VA 5AB3A 4BI5A 3RK8A 2G95A 4DPQA 4LVAA 3OIXA 3BK0A 2QUTA 3I7QA 3TK7A 3W85A 4GXMA 2V9DA 3L66A 5HULA 5KSWA 3S8HA 4K8EA 3HG5A 2DU2A 1YPIA 4LT9A 4MY9A 3OG3A 1KFKA 4UC5A 1RQBA 5F2LA 1G4SA 4R53A 3RLVA 3VE7A 1W5MA 4PEKA 2RDWA 1TRDA 2QDGA 2TSYA 1SZEA 4AH7A 2WNZA 2Q3OA 1LBFA 4UNLA 3SFKA 3EXRA 2OX1A 2V5BA 4O57A 4AXKA 2DZVA 4BWLA 4QQ3A 1TPEA 3BW3A 3F4NA 3OHIA 4JTFA 3DENA 3HQ1A 2G97A 4Q4KA 5AHLA 5LNSA 1T8XA 1ZENA 3A21A 2X2GA 4AF0A 4UFJA 5BMWA 4CCEA 3DHFA 4LC8A 3RU6A 1TYGA 1GOXA 3W71A 4UCGA 3M9YA 4FX8A 4GWEA 1FUYA 1L6YA 4UMCA 2TYSA 3GR8A 3NZRA 3BW2A 2QAFA 4FX6M 2DORA 3INPA 3NVTA 4LNYA 2PURA 4I7WA 3UXDA 3P67A 3TDFA 5J5DA 4UTTC 3NG3A 1VGAA 1UBSA 4N6FA 2Y88A 2QAPA 4PCFA 2Q8ZA 3FS2A 3TIMA 2X30A 3HB9A 3CLMA 4LTSA 3AO0A 4MVAA 3HG4A 1TPVA 1X1ZA 3FIGA 2JKPA 4EOUA 3G22A 2GPTA 3S5YA 4G1KA 3VI2A 4MY8A 5AHIA 4K37A 4O18A 1ZNNA 3PF3A 1GPWA 3A5FA 1P0NA 4MUZA 3IIOA 5U7SA 3EWYA 2B7NA 4GUIA 3PB0A 1IXNA 4E2BA 3JRKA 5F2IA 2QCGA 3STCA 1IXQA 3QEZA 4K36A 2O7QA 3A24A 4RCXA 1HG3A 2VFGA 1H51A 1ME7A 4I9AA 4CLMA 4JX6A 1XCFA 3NQDA 2A7NA 2GVJA 2CZ5A 4O14A 1VLWA 2R14A 1QPQA 3GNNA 4O1CA 4O15A 1ML1A 3H53A 2R94A 4NNAA 3W1XA 3C2OA 4K7VA 1K02A 4JGDA 2EGZA 4M6VA 3BG9A 5AHMA 3BV4A 3N2MA 2E6AA 1JCXA 3PY2A 2WOQA 3UWZA 4PL1A 5FI8A 3P8IA 4Q33A 1H61A 1XM3A 2ZZ4A 1VHCA 1H1ZA 2DJXA 4AHOA 3LI1A 2C16A 2GQ8A 3OVPA 2WO5A 4EF8A 4O1BA 5FEPA 3BGJA 1CW2A 5ABTA 3E49A 2QCCA 1TPH1 3ZWTA 5CZTA 2B0MA 1VCVA 3LDVA 2J27A 2YDAA 2A4AA 2UV8G 1GQNA 2PCQA 4POCA 1GT8A 3ZWSA 3I7SA 4IMFA 1TO3A 1JCJA 3MI6A 2Y63A 3G1YA 3N9SA 2G5WA 4FNTA 3LRMA 1O5KA 3LHTA 1KLZA 1VCFA 1VCGA 4ZQPA 1G7UA 3PVFA 3LCFA 1OG0A 1RR2A 2F84A 5HUPA 3QH2A 3QMTA 3HG3A 4JX5A 4AAJA 3FA5A 5C54A 3W2NA 1SUXA 2CLIA 1P1XA 3T78A 3HBLA 4CNOA 1DORA 3LM7A 2PC4A 4ZVJA 4HPJA 5F4SA 2X1SA 2NX9A 2V0TA 3NPXA 4O16A 2VEMA 1YTKA 1Q6OA 1NF0A 4O0ZA 3EX3A 1VZWA 5KMYA 1CI1A 4RZ6A 1WX0A 1SO5A 4L4LA 3UXAA 3LTPA 3LCIA 1TMHA 2A5HA 1F6PA 5BRBA 3G0XA 2FFCA 4TX9A 3I65A 2NX3A 5CPMA 1TJRA 3OEXA 4RJEA 4IGHA 1H7PA 3NQ2A 2E5BA 3W7CA 4GUHA 2E6DA 3W2UA 1VYPX 1S3HA 2A0NA 2J9XA 4JDBA 2PRMA 3A22A 5CPNA 4QIUA 1XC4A 3GR7A 3GXPA 4LVDA 2NV1A 1N55A 1RQEA 4N9EA 3GAYA 4RZ5A 5EYWA 5L6UA 3GLCA 5G4EA 4NXKA 4DBDA 4DO6A 3GXTA 5IM51 2X1RA 3LHUA 1F05A 2VELA 4OBTA 3M5VA 3HGJA 3LX9A 4UUIA 5EKYA 4MOZA 1TTQA 2G96A 3PUOA 1XDMA 2Y70A 4OT7A 1XBXA 1MEIA 2ZTKA 3F4WA 3P60A 4LS1A 1I2QA 2A6LA 4N4QA 3BGGA 1KM3A 2BSLA 4WUIA 4L4MA 3EXTA 1ZALA 1ZCOA 4QAIA 5HQEA 2QUUA 2TRSA 3G1AA 4MFDA 1LRTA 2YZRA 3B05A 3G8RA 5DCEA 3PWAA 3IIXA 3PG8A 4WXYA 3U8GA 1AW2A 1KFJA 1B3OA 1OYCA 2VEPA 5AFDA 2QCFA 3N3MA 4PH6A 2KZHA 1Q45A 1J2WA 1JR1A 1WDWA 4JEQA 4HNTA 3E02A 2CFFA 3NPWA 5TIMA 1QAPA 4M19A 3NR0A 3MWAA 3IEBA 3IGSA 5DCDA 4Q32A 1PIIA 2RFGA 3W23A 1LLZA 5E93A 2ABBA 1H1YA 2DZTA 4MKNA 3HPZA 1BWKA 1FWWA 2QUVA 1MEWA 4H3DA 2FPYA 5I3IA 1JVNA 3S1XA 3TFXA 1JCMP 2CLOA 3TW6A 2Y62A 5AOUA 1SW0A 4O53A 3GAKA 3L0KA 5C55A 1BWLA 3C8FA 3TW7A 3FYPA 4LUJA 3TX9A 4H6KA 3RF9A 3W7RA 3A9IA 1YTEA 2ISVA 3DXIA 3G1VA 5AN7A 4GUFA 4ZQRA 3IVUA 3SJ3A 3QQ1A 1LBMA 3WJYA 4CNPA 5DN1A 3HMJG 1SO4A 3NPVA 3W2KA 4WY0B 4HKPA 1FDYA 3LBMA 4ADTA 1MSSA 3WK3A 1JQXA 1IF2A 3CEPA 4O13A 1HO4A 1LTDA 1OFEA 2YPIA 2ATSA 4LWWA 4S1FA 2J6XA 1H60A 1EWEA 3EKZA 3W1PA 4IMDA 3ZS4A 4W9TA 3M16A 1N7KA 4UFHA 1JUEA 4CNNA 3SSJA 1ZY9A 1IIHA 2VFFA 2NXHA 2P10A 2Y7EA 3KOFA 1QNVA 5F1VA 1V7YA 2QR6A 4IPIA 5DXYA 5CGQA 2H3DA 2OT0A 5G2WA 4NNCA 2D73A 2RH9A 2Z0IA 4MPQA 5KZEA 3UD6A 4UR8A 3UPBA 3M5YA 4YWIA 1C9DA 1WOAA 4NJGA 3B8DA 3W3OA 2JKEA 3TQKA 2E6FA 3RMJA 1SW3A 1JRCA 3SECA 3N19B 3LXCA 3VKJA 2ATMA 4MZYA 2J9YA 5EPDA 2E5CA 3GDRA 1EIXA 2VEIA 3NA8A 2H3BA 4Y8FA 1B4KA 2WV8A 3G8EA 1D9EA 3LV5A 2VFDA 1IXOA 1O4UA 4YL2A 4O17A 3BG3A 1KTNA 5AYYA 3NL5A 4S2BA 4DEFA 3MJYA 3LV6A 2Y89A 3E9AA 1PHWA 4O4VA 5FEXA 2NV2A 4Z1CA 4JNMA 1KTCA 4R7JA 5AYZA 1W5QA 3KVJA 1JCNA 4IXHA 4NVTA 4Y9AA 1MZHA 4K6AA 1PV8A 3CQ0A 4JTTA 3GKFA 5BOOA 3NQ6A 4XKYA 4CQAA 1F73A 4TIMA 4Y96A 3ABRA 4FB7A 4UNKA 2WJZA 3QF0A 3S5ZA 1OX4B 2ZYFA 5LKYA 1K8XA 4WX2A 3P62A 2A85A 5D09A 2Z2UA 3W7OA 2X1TA 3VFLA 3UWQA 4CQ9A 5HNRA 2QEZA 4P61A 4N6EA 4B5NA 1SFJA 2QF7A 4XKYB 3PBWA 3G18A 3S5OA 1C29A 3PB2A 3W86A 2NUYA 1EPXA 3W1AA 1AW5A 1OK4A 5F2GA 2ZRXA 2ZQ0A 3BLFA 1NF7A 3O6DA 4PA8A 3DFQA 3EWBX 4OQVA 2V8ZA 3M43A 4HNVA 1FWNA 1OFRA 4CCCA 1OX6A 4JTGA 5L9FA 2YFOA 4UTLA 3NL2A 3NPUA 3OBKA 3W2JA 1P4CA 1OF8A 1UCWA 3UZ5A 1XUZA 2YGYA 4OV9A 2A2IA 1O5XA 3TNOA 1TQJA 3B03A 1X6UA 4UTHA 1IGSA 1R30A 3L5MA 5LGZA 5CKSA 4DF0A 5H91A 1AMKA 4PTNA 4TO8A 3LCHA 1PVNA 4WOZA 1MXSA 2V30A 3O1NA 5FF2A 1FXQA 1D3GA 1A5BA 4OWGA 5CZSA 5KZDA 1QWGA 3UZJA 2E68A 3W74A 1XL9A 1OYAA 1I8JA 4FNSA 1W1ZA 1H62A 2QCMA 2YX0A 4OGZA 1X8FA 5HR7A 3GX9A 2QCLA 1KM0A 2YYUA 1C8VA 3FEMA 3W7PA 3B0UX 1VR6A 3BLEA 4C1LA 2DZUA 3O6YX 3CB8A 5F4WA 1W5NA 3LTYA 3CTLA 1M7PA 1GTEA 1OFPA 1W5PA 3GVGA 3DFNA 1OFDA 3FJ6A 4FNPA 1Y0EA 1G6CA 3GYEA 5AC7A 1FDZA 4A21A 2EPHA 2QKFA 4NJIA 4JTUA 1G4PA 1LOQA 5TBOA 3M1ZA 2PRLA 2CLKA 3TC7A 3L67A 3FLUA 1NFBA 1FCUA 4JDYA 2WSRA 1DJQA 3G1XA 3V75A 5I3HA 3KVLA 4FIRA 4RZ4A 3QPZA 4RK8A 6TIMA 4JTIA 3W88A 1Q6LA 4KFOA 4LVFA 1F76A 2TMDA 1DQWA 1VC4A 5D2XA 5FF4A 4FX7A 2ZRYA 2VFEA 5K3VA 2JKAA 4EWND 4ZMGA 1OHLA 1S5WA 5HINA 4K7YA 2A7RA 4UTJA 1GVQA 2VFHA 3KXQA 4MJZA 1RD5A 3G1SA 3OA3A 4NU7A 4LV4A 5FEZA 2J9ZA 4ORIA 4WOQA 5EL1A 3MBDA 3WK1A 2AGKA 2OT1A 1EEPA 1AK5A 3QSRA 4M7TA 4O1AA 5AC8A 2ZDRA 5FEWA 3KRZA 5KZMA 3LCLA 1TIMA 1TB3A 4MYAA 5LNUA 2GVLA 3M0ZA 2P0OA 1ZJIA 3PSWA 5K2ZA 3DFPA 3LTSA 3IV3A 4O54A 1OYBA 4IJBA 4IUOA 1OFOA 4YCPA 1AG1O 3C3NA 3LCGA 1H7RA 3M44A 3UQNA 1R2RA 4NJHA 5GVJA 4ADUA 1VYRA 2CZEA 1KA9F 3NEVA 5HWJA 3NQMA 3BG5A 4DELA 1I2NA 2R8WA 3GXNA 1Q6QA 4JYDA 4Z08A 2ISSA 1AL7A 4XZ9A 3NYZA 1O94A 3G0SA 3W84A 3P82A 5AHNA 3ANYA 4MIMA 3I7RA 3QMSA 4TR9A 3U6WA 4UTWC 3HGOA 1KV8A 1UUOA 5K7JA 2V2CA 4BFAA 4FO4A 2A1YA 4HIBA 1FBAA 4Z1AA 4ZZ9A 3CHVA 3R5EA 4QM1A 4O11A 4S2CA 4YMZA 3NQAA 2EAWA 1WAUA 1OK6A 3RFAA 5A8GA 1LP6A 2B4GA 4MLRA 5G2IA 4LC6A 5FF3A 3B06A 5FF7A 4HSNA 3NZ1A 1KM1A 5HMSA 5I3JA 3USBA 2J88A 3UWUA 2VXNA 1TPUA 3P84A 2PRHA 4HN4A 3IIZA 5AHEA 2XN2A 2ZBTA 2BXVA 1DKWA 4HSOA 5IBXC 1EA0A 4N9DA 5K4XA 2X1UA 1F6KA 5BW6A 1T99A 1FWSA 1A50A 2E1DA 4QSHA 5HWNA 2C3ZA 1M6JA 1V5XA 1EWDA 3MBFA 3NL3A 1CX9A 1YTDA 3W7JA 3E96A 3QM3A 5G4WA 3SW6A 4ZQOA 4IXXA 4O50A 1LCOA 4IQLA 4WJEA 3TKFA 3P74A 4M6PA 4BK9A 2RKXA 5DY3A 4Z0JA 1KM5A 3C2EA 5AHFA 4X22A 4LS0A 1N8FA 4ML9A 1PS9A 1EP2A 3LLDA 2V2DA 3CWOX 3EX6A 4JYFA 4IX2A 4DF1A 4UTTA 1GYNA 3LHVA 1XXXA 2WSQA 2XN1A 2AQWA 5BMXA 2GJLA 1BTMA 1EP3A 2RDTA 3TAOA 4ZQNA 3PM6A 2B7PA 2Y7GA 1QCWA 4CQ8A 4KFPA 1OX5A 2ZCGA 5DXXA 1TV7A 3R2GA 3MW7A 1VHNA 2E6YA 2C18A 1OF6A 4IPJA 2CLHA 3S5NA 4NNBA 3HO8A 3GIYA 3NQVA 2Y7DA 3TAKA 1SO6A 1GTHA 2JK2A 1HL2A 1TPWA 1QO5A 2NXGA 2BTMA 2YFNA 1TRIA 4PL2A 3QMRA 2FPTA 3NQGA 2V5LA 3W1MA 3GDTA 4GRSA 3GB6A 1KLYA 2JGYA 1ICQA 1H5YA 4MZ8A 4YCOA 3S9YA 4X2RA 4JYEA 3NQCA 1L6WA 3T40A 1X7FA 3QW4B 3N9RA 1PCKA 3KFTA 2Y85A 4UFLA 2VFIA 3QJAA 3DU0A 3L68A 3C6CA 4NJKA 1I45A 3W7QA 3MHUA 3CIXA 3EX4A 3NQ7A 3P5ZA 3NNTA 4FNRA 4O8RA 4UFMA 4U4MA 3QFEA 3SI9A 1ICPA 1FCQA 1FQ0A 3RLUA 5LGXA 4D2JA 3W1QA 1W3IA 3GK0A 3L9CA 3U2OA 3EX1A 1W0MA 3TSDA 1SR9A 1QPNA 1W3NA 5AC6A 4J9JA 5KINA 1G69A 5D05A 2A21A 2VKZG 1NVMA 2YXGA 1DBTA 4DQWA 1DQXA 3O8AA 1KFEA 3L5AA 5K9CA 1FDJA 2HSAA 4Y90A 1R47A 3C2FA 1FWRA 2EKCA 4IOTA 4Z0SA 1VPXA 3MHGA 2DP3A 2C0AA 3MP3A 3LB0A 1JUKA 2ZZ6A 3T4CA 3PUDA 5DLCA 3N73A 3W7LA 3PBYA 3NAVA 4Y6GA 1XI3A 2QCNA 2DZSA 4A2RA 2BZNA 4XTDA 1ONRA 5D02A 1JQVA 3NGJA 3GNDA 4DO5A 4U28A 3TR2A 1Q6RA 1TTIA 5D04C 5G1TA 5HR6A 1Z44A 3IGUA 1R2TA 2H6RA 5G2HA 5HUOA 1YYAA 4EF9A 3PUEA 3W2MA 1TPC1 4AEOA 4E0CA 5F4XA 1BEUA 1QR7A 1DHPA 1GJPA 4LVBA 1TV8A 2CW6A 4AWSA 5HWMA 1B4EA 1LOLA 2WPBA 2CU0A 4LUIA 3W73A 3LERA 2W79A 3RNDA 2NX1A 3NQEA 4GJ1A 3P81A 1MEHA 4ZQCA 1SO3A 1D3HA
chains in the Genus database with same CATH superfamily
1J0YA 3SCTA 4GZIA 4K8HA 3CHCA 3KL3A 4C60A 4XQ6A 1MDRA 4XO7A 3K46A 3MYPA 2Z1BA 1TV5A 1R9YA 3B40A 2OLHA 3TJ4A 4JOMA 3KTXA 4UZSA 3UWVA 4FXRA 4H8HA 3UCQA 4AD2A 2OODA 4BF7A 1HJSA 4CN1A 1OX4A 4FR1A 1HUVA 3G1DA 4HN8A 3TLLA 4GQ0A 3Q2DA 2HQAA 2FPVA 4I7UA 3EDDA 3CPUA 2Z6IA 4UFIA 3POHA 4V27A 3B4YA 3S6DA 4RXGA 4UOQA 3QV7A 4GNKB 2IKJA 3TYDA 2R1PA 3ZYZA 3R1ZA 3TJXA 4EP8C 2HZGA 1KCKA 1M65A 3WENA 1XFCA 4O0QA 1SZFA 3ZJ6A 2W3ZA 4AIBA 2PTZA 3CASA 4Q4SA 4I8DA 1B3ZA 1EJSC 3NXFA 1EJWC 3T09A 3JR2A 5IXEA 5GNZA 5TD4A 3W1UA 2OTDA 4KH2A 3OB8A 2ACRA 2GZXA 1Q13A 1VFSA 1ZFJA 2WLYA 4DWDA 4RNIA 3F03K 2ZA2A 4M56A 3BQ6A 4CVUA 7ODCA 3EWWA 4IJCA 4X63A 1G94A 1B9BA 2AL1A 3GE7A 4AWUA 1I1WA 3ECQA 4AHQA 3KRUA 1NSJA 2NWSA 1JCLA 3D5HA 5C9UA 3GXDA 2ACQA 2OMAA 5CLTA 2CWNA 3GXFA 3KS5A 4PMRA 1OC5A 2VDGA 3MP4A 1UWTA 3E0WA 4HNCA 1LYXA 1KKOA 4PRWA 5AYBA 4J3ZA 3CEUA 4WY0A 3TH6A 1JJKA 4TV5A 4XAPA 3W72A 4A2SA 1JZ7A 3WD3A 2XVPA 3H4XA 4C5ZA 3W7GA 1CWYA 4B5XA 4HHPA 2GL5A 5CG7A 3VILA 1DWFM 3SUSA 4BR1A 2JQXA 4TUFA 4IT1A 2WMKA 1JD7A 3GVVA 5C6MA 1UUMA 3WBWA 1HFBA 2INEA 1CIUA 1IXPA 4M80A 2J7HA 2WVTA 2JFEX 3W6YA 4JR5A 4D8LA 1A53A 2X7VA 4MB1A 2PFHA 1W9PA 1HP5A 3BAXA 1XR2A 1GCYA 2F2HA 2P8CA 3ELFA 3LLXA 1IEQA 2WKJA 5MF5A 3DOPA 1F07A 4NYYA 3DFSA 4YN5A 4M6QA 1HGWA 5DBUA 1UB3A 2REQB 3ZSTA 2FIQA 5BCAA 3RO6A 2E4TA 2E9MA 3H2EA 4RX0A 3OTRA 1R9ZA 3C2YA 4O0KA 1NOUA 5A6BA 2VD8A 4K68A 1HN1A 2WAGA 1DXIA 2WQDA 4C7DA 3PG9A 3GR4A 2CYGA 1FXPA 5BXPA 4UTKA 1V79A 4QNWA 2KX9A 3EDKA 4F9DA 2JF7A 4LBRA 4DZHA 1Z48A 2HS6A 4D6CA 3H2MA 2JE8A 4WGXA 3R13A 3OBAA 1YDVA 4M3PA 3BCJA 1ZL1A 2GSEA 1KM6A 3IIVA 1BVNP 5K9XA 2MUCA 3HF3A 1NY1A 4CEXC 3TMQA 4UR7A 3A5VA 1ZJBA 4AB4A 4MJ4A 1YDOA 3BJSA 5IFPA 3O0KA 1OCBA 1BXCA 4QAWA 1ZHAA 3BAIA 1WYIA 4HU4A 5FIPA 1Z89A 3T4WA 2J24A 5SWUA 2DIEA 4JICA 4IJRA 2P5NA 2EBNA 3FCPA 5I7GA 2ZRZA 3CIWA 1DJHA 3FKKA 1WQ5A 4QP0A 5D2TA 1R85A 3B97A 3EEZA 5FSDC 2C8NA 1RQHA 1PKNA 3WJSA 3WH6A 1I2OA 2CESA 2PDGA 2VX4A 3LU2A 3AMCA 3FN9A 2I5QA 4JFUA 1EUAA 3TUUA 2WSKA 1UW9A 1SPQA 3W1LA 4D6EA 3TSMA 1P0EA 4W8LA 3MQTA 4RR4A 4QR6A 4CCDA 3BC9A 4UIOA 1GG1A 2BP1A 2YOCA 1HJUA 1U2YA 3M41A 3V0UA 2J6VA 1SGJA 3WJWA 2HVOA 2E28A 4Z2LA 3AUOA 4JCLA 1REQA 3GY1A 1E1CB 1V4YA 2OJPA 4FXFA 2F2KA 4P8XA 5E0FA 5HNUA 3AJXA 5A2AA 1EO5A 1PHQA 3F1QA 3VCCA 2VOMA 2C15A 3W28A 3W7IA 4LY8A 1TZZA 4FLRA 1YADA 4XWUA 3STPA 4LUYA 1A4MA 4W7VA 4LW7A 1FHVA 2H90A 3TCEA 3PZVA 1J8VA 3QN3A 1SMAA 1XYAA 3ORWA 4GQBA 1XSJA 3LY0A 3DEQA 1NIUA 3L4TA 2OKTA 3PSVA 4K39A 4JY8A 4NT0A 1YXCA 3H2CA 2Q8LA 5A95A 4KWUA 5F1UA 1H50A 5DBTA 1JYVA 4J3WA 3B8IA 5DT5A 4RNJA 3FK4A 1A5AA 3TFCA 1E4IA 1LRQA 1J01A 4QNEA 4UMAA 5HDRA 3UXKA 4HZ7A 3CPGA 5C2GA 1GOOA 1H7XA 4DI9A 4C65A 1US2A 3FDKA 2W4XA 4P7LA 4JTHA 4PRRA 3ZIZA 4BA0A 3HOJA 3GW0A 4HOXA 3HJZA 5FJPA 1IT7A 5LNVA 3DH7A 4OE7A 5JH1A 2XUCA 4DIAA 3BCFA 2BHYA 2YYTA 1YNPA 5CSUA 1B90A 1EJXC 3ARRA 2DUAA 2RHGA 3W25A 4ZL1A 4IX0A 3VIMA 3HIJA 3TSBA 5T8GA 3LXAA 3M7WA 3ABXA 2ZUMA 4HNUA 1L2UA 4JTSA 4F2TA 4O10A 5J5RA 3H55A 3GSMA 3N34A 1B2YA 2PC8A 3WLTA 3H22A 4J27A 3CPRA 1UP2A 5M2FX 2FTPA 3VOHA 3TZFA 5LHEA 3CZEA 4AHPA 4L9YA 1GVSA 5ABGA 3ABQA 1IQ8A 2PU0A 3S1WA 3VA8A 1HL9A 1G01A 4L9XA 4RUBA 3ZJ8A 4F0HA 3P80A 4AVNA 1DJGA 3UY8A 4UWMA 4RE2A 1I4NA 3PJTA 3GU2A 4HT3A 4GXWA 1XDLA 2QLYA 1LUCB 3KCOA 1F8MA 1E4LA 3M6YA 1VJSA 2BMBA 4JD4A 5I3KA 4WD0A 4H6EA 1SFTA 1XISA 1V3IA 3MVIA 3BLIA 5LA0A 2ALDA 6ALDA 2OG9A 4M1RA 1VS1A 3UZZA 3MCNA 1NH6A 3LGEA 3QGKC 3ARSA 4ZE4A 2RJGA 3RIKA 1FWTA 1HQTA 3VXGA 1LOSA 4K38A 1VLIA 3W38A 3LHZA 4UQAA 4OV4A 4YVPA 3M5XA 4IFRA 1Q3NA 3TP4A 1XS2A 1JGIA 5K9DA 3UA4A 2TPSA 4I8YA 3UWWA 5KETA 4TTUA 2BX7A 4N7QA 4X3ZA 4H9YA 1A5NC 3CYJA 4A8IA 3EPOA 2FQIA 4JKMA 3QHOA 3DG6A 4PSPA 1P0KA 4ZOBA 4Q7NA 3UG8A 1UBPC 5I3FA 1AODA 1XWYA 1LWHA 2DZXA 1XYFA 3CO8A 1RP8A 1DJNA 2B7QA 1R2SA 3BVJA 2AQVA 2INZA 4RZBA 2YB1A 3MP5A 4PCPA 2XINA 3H54A 2DT0A 4D71A 5K4ZA 2NQ5A 3KBMA 1QPOA 2KAUC 3BW4A 3EEGA 3W7DA 4Q4QA 4MJ2A 4HD5A 1XLLA 4TV6A 4M1BA 4V1XA 4NZCA 4PBFA 2J47A 1OJXA 2F38A 1DWJM 1NFGA 1JI2A 1RVGA 3DHDA 3NOEA 3SRFA 3BLDA 4JTLA 2ZTJA 2YW3A 3CM4A 2SFPA 3SN4A 3N2BA 4QISA 4DBEA 3AMGA 4NIRA 4JQ1A 3A13A 2CLMA 1BKSA 4GD0A 2D2JA 4XIAA 3RM4A 1G4TA 4CCZA 4IG2B 1J5TA 4JN6A 2ZZ7A 4M82A 3TA6A 3O63A 3V0TA 3DI1A 3DZ1A 4KGJA 4P2VA 5HMDA 1S2VA 3DUGA 2AAMA 3WMSA 2O7SA 4IP7A 2XH7A 3GTNA 2WNWA 4PFMA 4NX5A 3KX6A 4RV8A 1W9BM 3WDQA 2GOUA 4EPEC 2VC9A 1RPXA 2EF9A 5FOOA 5G1YA 1A5CA 3LYEA 4HPXA 3PZUA 4MB4A 1O95A 1CT5A 1HTIA 3U48A 3CV2A 1W1PA 4BI7A 1JYWA 1X1NA 4BI5A 3VIGA 3ONCA 4PMOA 5I23A 1J93A 3AUJA 1G1YA 2ZUNA 4K8EA 3HG5A 1YPIA 3OG3A 1KFKA 2X1IA 5I09A 2J25A 5H6HA 1PYFA 3VE7A 5A3HA 1EYEA 1LG2A 4L6DA 2O0TA 3LQLA 3QV8A 3RX2A 4Q7IA 3ZSSA 3UPMA 3WQ5A 3G5EA 3QY6A 4MDOA 1XHGA 5LNSA 2R24A 1ZENA 3A21A 2X2GA 4UFJA 3KWXA 3DHFA 4LC8A 1UWIA 4ERAA 4QCFA 3PBMA 4HHMA 4I9JA 1YBQB 2DZBA 1JPHA 1L6YA 4GWEA 3Q45A 3GO2A 1Q85A 3C3UA 1KGXA 1QHZA 3V4BA 4QROA 2AKZA 2DORA 5CJ5A 1C92A 2CKSA 3INPA 4NZ3A 3U5UA 4LNYA 1EJRC 4IQEA 2PURA 1GOMA 1KBKA 1TZ7A 2F8QA 1E6RA 3NG3A 2I5GA 1VGAA 2J7CA 2W91A 3AHZA 1ENUA 4LYQA 1X6NA 4ATDA 1GW1A 5ABFB 1YBQA 3M4HA 2EPKX 1WDSA 3N04A 1WKYA 2GPTA 3S5YA 4E8GA 1IZKA 2FZMA 4PMDA 3UXLA 3A5FA 1P0NA 1F3WA 5FJJA 3MDUA 5U7SA 1PAMA 1IXNA 3GYCA 3JRKA 3GXMA 2QCGA 3O2LA 3STCA 1IXQA 3WUFA 4K36A 2E9LA 2VFGA 1ME7A 1VJZA 3CUXA 4JX6A 3NQDA 1HKJA 1E6QM 3GNNA 1QPQA 1ML1A 4NNAA 3VDCA 1EIBA 2XWDA 4MTVA 3W1XA 3C2OA 4XZLX 1EEXA 2ZICA 2EGZA 4C90A 2NQJA 1XIHA 1PTDA 2VEGA 5BZAA 3OQEA 3BV4A 5C70A 2E6AA 1JCXA 3PY2A 4AD3A 4PL1A 7XIMA 4FMVA 3M0MA 4AHOA 3LI1A 4Q8VA 2GQ8A 4H41A 2BODX 3QFWA 4HJWA 5I0DA 1OINA 4QE5A 4GLEA 1BVZA 1YIXA 3ICJA 2E1WA 3TWBA 2VHLA 1UC4A 3T42A 3G1RA 2QCCA 2AAAA 4G7EA 2B0MA 2J27A 2WBKA 2UV8G 2D2OA 4AXNA 3GC4A 2PCQA 1OGSA 1GT8A 3BICA 3I7SA 4HNLA 2ICSA 1PEZA 5BWAA 1CGUA 4I5XA 1W32A 2G5WA 1O5KA 1KLZA 1US3A 1VCGA 3K1GA 2ZVIA 1G7UA 3PNZA 1OG0A 5HUPA 2DV0A 3W2NA 9XIMA 3T78A 4KGLA 2PC4A 3H8AA 4ZVJA 3LUTA 2VGFA 2QS8A 2X1SA 2HDJA 3AQUA 1YTKA 4UQBA 3NSNA 1WX0A 1SO5A 5CC3A 1FWBC 3VD9A 3ISIX 3OVGA 3UJSA 2WC4A 1TJRA 2EG7A 4HMNA 4HSHA 2EJAA 3OLEA 2NQZA 4PUEA 2E6DA 3WF3A 2A0NA 4DJDA 3AMLA 2W5FA 3CZKA 4CQCA 2H9AB 3A22A 4QIUA 2J8FA 2BVDA 4CD4A 4LVDA 4XD4A 1VBRA 3R0DA 1N55A 4XIMA 3GHTA 3H6OA 3T8QA 3VX0A 2ZXBA 3VFCA 4N9EA 2OLSA 4QJ3B 1LT8A 1Z69A 5EYWA 4Q6XA 5L6UA 3SUUA 1AJ2A 5G4EA 4DBDA 4DO6A 4Q4RA 3GXTA 3KOZA 4UUIA 3LX9A 3OZOA 4PZVA 1ONEA 3F2BA 2ZTKA 4W5ZA 3RITA 2BOGX 3TEVA 3F4WA 4LS1A 1AZ2A 4N4QA 4QLKA 3HQOA 2G4JA 1Q6CA 3GNRA 2PDJA 1LRTA 2YZRA 3K8KA 4F0LA 3NIYA 3IIXA 1XYLA 4WXYA 1AW2A 3U8GA 1B3OA 1CGXA 3IK2A 2J79A 5AFDA 3ID7A 4Q8PA 4IPLA 4UQEA 4NAFB 3RCMA 4KIEA 1EHNA 4OZOA 1QAPA 4WKFA 3NR0A 3U2ZA 1IT0A 3MWAA 5CAKA 3IGSA 5DCDA 4Q32A 3W23A 1LLZA 5LIKX 2ABBA 1XRTA 1H1YA 3IANA 3MU7A 1FWWA 2BHZA 3QV9A 3S1XA 1ZU8A 3TFXA 3TW6A 4DN1A 1KNWA 3B8SA 4YTSA 1EZ2A 3GAKA 3EYPA 5CBJA 1M68A 1E40A 3LZ5A 3C8FA 3FYPA 4LUJA 3T05A 4H6KA 2W67A 3BAYA 1QWKA 1CDGA 1YTEA 2HBXA 1XX1A 4AISA 1ISXA 3DXIA 8A3HA 1A5UA 4XZWA 3SJ3A 1R5YA 1LBMA 1C8QA 3A9BA 1I6NA 1ECEA 2VUYA 3HMJG 1SO4A 3NPVA 3VX1A 4PTXA 2WMIB 3LBMA 1NARA 1MSSA 1E3ZA 1MYRA 4MUPA 3VZYA 3CEPA 3IUHA 4U2YA 4NF7A 2ZX7A 3ABZA 1EPVA 1LTDA 4DYKA 3BURA 3UU0A 2V3FA 4S1FA 3AXIA 3IAQA 4BY3A 3L7RA 1EWEA 2Y1HA 4ENLA 3QPEA 1EA9C 1ONWA 5JIWA 4KRZA 3SSJA 3ENLA 5FA5A 1BSIA 5F1VA 1V7YA 3B0XA 1TMQA 2H3DA 5G2WA 3PFRA 4GO8A 1ITQA 4Y9PA 5KZEA 3UD6A 4R27A 2ESCA 4BQ2A 3M5YA 4NJGA 2JKEA 3TQKA 1XRFA 2VZTA 2ZXQA 2DIJA 1ODZA 1VKFA 1EGMA 3LXCA 3VKJA 1CECA 2DT3A 2AKMA 2Z29A 1UD5A 1OGBA 1SJAA 2VEIA 3L4WA 3NA8A 4IP4A 4Q7BA 2CPUA 3PPFA 2H3BA 4Y8FA 1B4KA 2BXYA 4GIEA 3AIWA 3FHAA 4LXFA 3UZXA 5I78A 1ZRQA 1W2PA 3GTFA 1PKMA 3DBNA 1JCTA 2BS9A 3MJYA 3LV6A 2WZIA 5FEXA 1PDZA 3WLSA 1ISVA 4NVTA 1VBHA 3CQ0A 4IIFA 3W53A 1F73A 4TIMA 3ABRA 4UNKA 2OGJA 1PTAA 4HA0A 2QDDA 1OX4B 1W1B1 4PYSA 5LKYA 4DUOA 1FFQA 4IICA 2XU2A 4LANA 3DN5A 1DWGM 1RJQA 1DJZA 2E7FA 1MWOA 3TC3A 4PUUA 3VFLA 3P6LA 5HNRA 1R3WA 3NDYA 4N6EA 4B5NA 2QF7A 4XKYB 3G18A 1PBGA 3DFHA 2YZ5A 1M04A 3EA3A 3CZLA 3BGAA 4C6IA 2NSXA 5F2GA 2ZQ0A 2X42A 4G8TA 8RUCA 4LB3A 4PA8A 1DJXA 3N25A 4J5NA 3A4JA 4RW5A 4OQVA 3M43A 1FWNA 4MKSA 4CCCA 4GI9A 5FL0A 3RPMA 1GJWA 3NL2A 3W2JA 2TAAA 3CL8A 1P6CA 2JEPA 2V69A 1XUZA 2YGYA 3MJMA 1O5XA 1X6UA 3NJ3A 3E5PA 3OIHA 1IGSA 2Y8KA 1UH3A 4DF0A 3WQ4A 3QVQA 2FMOA 5BRQA 1PVNA 3WDIA 1V3HA 1MXSA 2HISA 1I75A 5FF2A 1FXQA 1D3GA 2J74A 2XH2A 1A5BA 3SFWA 2X0SA 2EPLX 2VL4A 3EWDA 3FSTA 3GUGA 1XW8A 4NZ5A 3UZJA 1OIFA 2E68A 1ZBWA 1B3YA 3M07A 3R4IA 4H83A 1H62A 3TONA 1GOWA 1IE7C 1JPIA 2YX0A 4OGZA 3SIMA 1HT6A 3L4YA 5HR7A 2PDWA 3GX9A 3EDFA 1C8VA 4W7UA 3MUZ1 3ZVHA 5JIPA 4C6EA 2QJNA 2ALRA 1W5NA 3LTYA 2V5JA 1EJTC 2J13A 1E3XA 4LY4A 3DFNA 1OFDA 2I7GA 2RDXA 3MSYA 1Y0EA 2P76A 3GYEA 3WH9A 2HNEA 9RUBA 1MFVA 1X96A 2EPHA 1TX2A 1QT1A 2NVDA 3H2OA 1C3FA 4JTUA 1LOQA 3CJPA 2PRLA 4ZOCA 3U4FA 2CLKA 1AFSA 1GVEA 3S2LA 4KIRA 4GIAA 1DIEA 3V75A 3G1XA 3SO7A 3BMVA 4C7FA 3KVLA 4KCVA 4RK8A 3W88A 4CN6A 1J0IA 1KFWA 4GYFA 1SFSA 4FX7A 3WUBA 3ZJ7A 1GGOA 4AWEA 1PDYA 2A79A 2VX6A 1K9FA 4AZCA 1PKYA 4H7ZA 1V03A 2QMJA 4EXBA 3N2OA 4X9YA 2VRJA 4MJZA 1V6VA 1BQGA 1W3LA 5FEZA 4WOQA 5EL1A 3CZ8A 4S3AA 4MADA 1E0UA 1PZ2A 3RJXA 2BG5A 2CC0A 3U3HA 3UFYA 2Z26A 5D9MA 5K2ZA 3BMXA 3WQPA 3IJ6A 4IJBA 2O9OA 2XGZA 5DANA 4U3AA 4S3CA 5KEZA 1CGWA 5HWJA 3NQMA 1FFRA 4YIWA 3GXNA 3HJEA 3Q65A 7REQA 1TWZA 1MRQA 2ONEA 4D8ZA 1AL7A 2VMFA 3FA3A 4XZ9A 3SURA 1IEVA 1PYMA 4MIMA 1KKRA 3QMSA 4GNVA 3HGOA 3V36A 4BQ5A 3KBNA 3THDA 3CQKA 4N0RA 2O56A 1UUOA 4RPQA 3ZVHB 4FO4A 2XFYA 2A1YA 1VP5A 1FBAA 1Z8AA 4JTQA 4QM1A 4WRHA 4BZYA 3PN8A 3CMJA 4YMZA 2F6XA 3ITVA 3K4WA 4MLRA 2G3JA 3D6NA 3WQGA 1ITUA 4B5SA 5I3JA 5IFTA 3USBA 3FJNA 1R6WA 2VXNA 3QY7A 1WO2A 3NWRA 2HCVA 1DKWA 1EA0A 1FWIC 1CLKA 1M6JA 2HBVA 1EWDA 1H2JA 1CX9A 2PDCA 5FKYA 3CHFA 1XV8A 3TA9A 4MNMA 4DWSC 4LSBA 2FTYA 4GIYA 3SW6A 5HANA 2A3CA 4O50A 4WJEA 2WB5A 3UT0A 3IRSA 3SB0A 2BY1A 1KM5A 5AHFA 4W85A 1TVNA 4LS0A 5D4YA 4HYVA 5ENLA 3LGGA 2V2DA 1W2VA 2Z1WA 3FXYA 3EX6A 2R82A 5CJMA 4DF1A 3I3EA 3LZ3A 2DSUA 4GY0A 1S2WA 2GJLA 3F7JA 1EP3A 3MY9A 4HU3A 3UWEA 2RDTA 2DVTA 1UD3A 1GOIA 4ZQNA 1IV8A 3MZ2A 5E09A 1EF3A 1UR8A 4JHOA 4ZO7A 2BY0A 1XGZA 3N1AA 1EC8A 4JIEA 3XISA 2CLHA 3S5NA 4QS5A 3HO8A 3GIYA 3NQVA 2QZRA 1TPWA 3BAWA 2NXGA 1UIPA 2BTMA 4PL2A 1PX4A 3EB3A 4WCJA 3NSMA 3GDTA 3GB6A 1TJ0A 3F5JA 4WLCA 2YLLA 3S9YA 2DT2A 4JYEA 1VPYA 3GG0A 3URNA 1HVQA 1PCKA 2XVKA 2PB1A 2VFIA 3QJAA 1H09A 4NJKA 3MHUA 4CGTA 2PLCA 4LAMA 4FNRA 4O8RA 4QLJA 1AVAA 4F0SA 1QI0A 4QX4A 3SI9A 1FCQA 3VMPA 1RHCA 1W9VA 1JZ5A 1IGWA 1W3IA 3L9CA 3U2OA 4HHLA 1R3RA 4HYRA 1KQYA 4DJDD 2Q8XA 2QULA 1W0MA 3WLOA 4DBSA 5KINA 3VVGA 1NVMA 4U31A 2QUMA 3KRBA 2VTFA 1FDJA 4Y90A 1R47A 3VNKA 4M8UA 5FJTA 4ZXLA 1K70A 3RAOA 3LB0A 3UVIA 5B80A 5DLCA 3NXLA 1GEHA 2DQXA 3NAVA 1XI3A 4YTTA 1M03A 3AS0A 1FTXA 2BZNA 1YRRA 3GHUA 4AQLA 1ONRA 1JFHA 5JVLA 3KOWA 3TR2A 5D04C 1EQCA 4MNLA 4WDTA 1Z44A 2PLKA 4XK2A 1AH0A 2H6RA 4MNKA 5G2HA 3UYIA 1MZRA 4EF9A 4DLMA 3MSRA 4M81A 4E0CA 4GK8A 3R8GA 5I5RA 1KGUA 1XD0A 1DHPA 4QCEA 4LVBA 1UR4A 2CW6A 3WQDA 3JZUA 5XINA 1E6NA 3AOFA 2IMRA 2WPBA 3W73A 2W79A 3HN3A 1LWJA 3WQWA 1ZCCA 3AS1A 3MV01 3P81A 1V02A 1D3HA 1QNOA 4C5YA 5EMLA 3NZPA 2H8ZA 1KCZA 2GVYA 4ACZB 1SJCA 2HS8A 5CPQA 2QGHA 3ZR6A 4HK5A 1O5RA 3UNTA 4FK9A 4X0NA 2XVGA 2O9RA 2QDHA 1ZTVA 4JY9A 1CYGA 1M41A 3WNLA 4EX4A 5CSSA 3ARUA 2Y7FA 3UJRA 1VBGA 3NZQA 3UR5A 4FI4A 3OA5A 4AD1A 3DFTA 3MDWA 5EU9A 1CBGA 3CZJA 3PULA 2WZEA 4RPPA 1S39A 3IIPA 2I17A 3O05A 2G41A 1J6PA 1VD6A 3OO2A 3QR0A 3AU2A 1SU5A 2X05A 4LVGA 1H63A 4AFYA 3TQVA 1DL3A 3VKAA 1MUCA 1KW1A 1KBJA 1F3XA 2P8BA 3VKDA 4QE1A 1ZS2A 3V5CA 4CU8A 2IQ0A 2V2HA 1MI3A 2BLEA 2ZVRA 3KAOA 2Z1KA 1UD6A 3QW3A 3JUGA 2L5HA 4R34A 3NL6A 1E0TA 1EFZA 4MFEA 1ZJAA 5TF0A 1TWSA 3CO4A 1W1IE 4ZB0A 5D2VA 4HMCA 4FIQA 3CIVA 4GFIA 3GH4A 3QR3A 1P6BA 2AQOA 4JS3A 2XIJA 1V8EA 3L21A 3B0PA 3W1TA 5LHFA 1BF6A 4UFKA 1F61A 2D22A 4B16A 2ZRVA 4RDZA 4NG3A 4QG9A 3W2LA 3N6QA 1UQYA 3M0XA 2Q71A 4E6MA 1EH9A 1RAKA 3BLPX 1PXGA 2C14A 2OVLA 3DGBA 4UB9A 3G77A 4IIEA 1U83A 7REQB 1Q6DA 4R5EA 4UTIA 5HNNA 4BF9A 1Z42A 2H8XA 3T0CA 3TTOA 1KD0A 4WDWA 4AF0B 1EOKA 2ZUWA 3CL6A 4PUKA 1W31A 5EMUA 2BBFA 4ROPA 7PTDA 3PHAA 4Z1DA 4D9PA 3O07A 2JEQA 1CGTA 2WJEA 2D69A 3FW6A 4IGSA 2YDSA 1TE1A 4NL1A 1TPDA 1ALDA 1XH1A 2BVTA 3DGRA 2VD9A 4H00A 3N6HA 4G6CA 5I06A 3QV6A 1ZBCA 2GDVA 4C6LA 4B2DD 4QJ1A 3S42A 1GORA 1OC7A 3B04A 3SUTA 4LU0A 1RCOB 1VAHA 1KRCC 4F8XA 4UMBA 2X16A 1NELA 2WMJA 4S3JA 4JIRA 4QG6A 1WXJA 4ZCWA 3NZGA 1UROA 3TJLA 1O68A 1WBHA 4J3TA 1XIEA 2PUZA 4L1XA 2PDNA 1H7WA 1F4HA 4PODA 4L65A 4XUGA 4O12A 3VINA 4ES4A 4R9OA 1MO0A 4WZHA 1GVFA 5G5IA 1Z6KA 3CLWA 3A12A 4JQ3A 1LG1A 2HXTA 4MB3A 4Y8EA 3S0CA 2JF6A 1K7FA 4QJ5B 1XRSA 1ADOA 2WKLA 1H4PA 4YVVA 3WD2A 2VZUA 1UR2A 3NM3A 3SQMA 5C5YA 4AMAA 1L6FA 2FGLA 3RUBL 3MO4A 3GHSA 1UMYA 3EX2A 3UJEA 2I9EA 3U9IA 2PWEA 3E0IA 1KXTA 2EQDA 3HPSA 1RBOB 1U22A 1UKTA 4F2BA 5E70A 4Y9OA 4YPJA 5H2ZA 2E5DA 1XLHA 4V1YA 1U1UA 1RUSA 3C5QA 4AUBA 1H5VA 1QOXA 1WOBA 3P61A 1H0GA 1FWFC 3L65A 1YKWA 2NUWA 3TQPA 5BROA 1X6LA 4WXZA 4NUWA 3NM1A 1JZ4A 2YCKX 2PEVA 2WLZA 1RCXB 4IMCA 4P7OA 4EWJA 5LA2A 3HA1A 2C6QA 4CEUC 4R3UA 4U3CA 3QOKA 2FLIA 3QPYA 6REQA 5TNVA 1BRLB 3MMWA 3PC0A 3W07A 2DPEA 2ZZ2A 2VR4A 3ANVA 4GMEA 3ATYA 1LL7A 2BGSA 5D8ZA 4GXPA 3T8LA 3I6EA 4MZ1A 1UZ4A 2Z1XA 4HZ6A 5DELA 3CHEA 3NUKA 2PZ0A 4US5A 3O15A 2UY4A 1O7AA 1K77A 3ZVIA 1BYAA 4LCRA 3RU8X 3RJYA 3VOGA 1XF0A 4XD6A 3NO1A 1EJ7L 3QGVA 2CKRA 3C56A 1S5VA 2VYOA 3AAMA 4R9XA 3TV8A 1KWKA 3VDGA 2V82A 1W8SA 3JS3A 1L9WA 4ACZA 1NDWA 4IH3A 3YPIA 1WA3A 1A0CA 1Q65A 4KERA 5C0QA 3LI0A 3HGSA 3GDKA 3W7EA 2XGBA 2A3EA 3MUY1 1FKWA 3VGHA 5HPOA 3A3WA 4A29A 1B57A 3EGJA 1JCYA 2CZFA 1RP9A 4NILA 3NO5A 5D33A 3BJFA 4OHQA 3W27A 3PJWA 3WUGA 4TXEA 1EDTA 1SSGA 1UR0A 4ALDA 4GC4A 2Y8UA 1BYDA 1UPMB 4E2DA 1CLXA 3BZJA 4IHCA 2BWGA 2YBVA 5T9BG 3M47A 3L0NA 1WXYA 4PMUA 2P1FA 1P43A 3RX3A 3GG8A 1RVKA 1V08A 3BO9A 3M64A 5D37A 3E12A 3NQ8A 1RD6A 5E1QA 1LROA 3V1PA 1JRBA 1IEXA 2FB3A 2EPOA 3BARA 3QC3A 2GVEA 3ES7A 1HKKA 1IWBA 2J7DA 4C7GA 2ZOXA 1MQPA 3HM7A 4A22A 1QNPA 1ZGDA 1AZ1A 1QU4A 3SUVA 5TQLA 1TREA 2A6NA 3BAJA 5BXSA 3LN3A 2OYMA 1DIKA 3EBVA 3CUIA 1W3TA 3LLFA 3G0UA 3SR7A 2A7PA 5AZ1A 5DY2A 3NQFA 1G67A 1LRNA 3BSGA 2GGEA 4IPPA 2XJ7A 3DBPA 2BFGA 4Q8TA 1FH7A 4Y9NA 2A3AA 4WSHA 1WBJA 1N2VA 3OYXA 3CHDA 1UASA 3VIFA 1MUWA 2IPFA 4PUMA 3LG3A 4PTDA 4IIHA 3R8RA 1M7OA 5DO8A 4Z1BA 1DXFA 1QPKA 4O1EA 2CITA 2DZAA 1EB3A 3U57A 2GOKA 2CLPA 4UQCA 1REQB 1E43A 1R46A 3OLDA 3WDRA 3T44A 1V3MA 3BSMA 3TXVA 4WY0F 5REQA 1OFAA 4YTQA 4M24A 2YCEA 5KITA 1B3VA 3AS2A 4X9SA 4ILSA 2GWNA 4ZFMA 2E3ZA 1E4MM 3VCRA 3CQJA 2ZA3A 3KEHA 3F5KA 1CZ1A 4H1ZA 5LIUX 1H3GA 2FJKA 2HMCA 3THUA 2DW6A 1BGGA 5JBEA 3SY5A 2ISDA 2PDBA 1LF1A 1LM1A 2DGAA 1XIDA 1S1RA 3VZXA 3E38A 3R6IA 3BH4A 3XIMA 3SBFA 3PBVA 5T9CE 6REQB 3H12A 2ZZ5A 3H4GA 3W7HA 4AZIA 4LRSA 2FHCA 1GUVA 3WQ6A 3MSDA 1KTBA 5A1AA 1W1YA 2OCZA 3MVTA 2ZUVA 5FJRA 1W54A 4Z2KA 1KXVA 3MI3A 4O1DA 4NI3A 5FL1A 4ZOEA 3P8JA 3ALGA 3ZR4A 3Q67A 1JUBA 1AD4A 4EPKA 2QCDB 1QOQA 1GG0A 4HU0A 3SQLA 3GTIA 5CH9A 4HQVA 4UTUA 4RKAA 3B4UA 1HP4A 1KM2A 3COTA 4GGBA 4OUIA 1AL8A 3W02A 3C0SA 1KCXA 4NX0A 4L61A 4LOCA 4DNHA 3WK0A 4FF7A 3BOLA 1XYBA 4J28A 2EPNA 3C61A 3TMLA 2E9BA 1XJBA 2E77A 1RZMA 3CUGA 3RHGA 2ZZ1A 2DJLA 4I6VA 2E40A 4JL1A 1M53A 3WLRA 1KFLA 2DQWA 4GH3A 5E0KA 5A6BD 1E51A 4G7EB 3L2MA 4PN2A 1B3WA 2CLFA 4R88A 1XCXA 1LBLA 4PB3A 3WQOA 1XYZA 1OADA 2Z1VA 3OHMB 4U5KA 4ZOAA 3RK8A 5CSYA 3VOFA 4XAYA 4IFOA 3U5YA 2V3EA 3BK0A 3WEOA 2QUTA 6CGTA 4HHHA 2NT0A 3W85A 4GXMA 2V9DA 2RGLA 3L66A 3S8HA 3P0WA 3S9IA 4EAMA 4LT9A 3LPGA 5EMJA 3RLVA 3QQWA 5CC7A 2ZDSA 3GUWA 5HATA 2QDGA 2Y5EA 3SRDA 2OO0A 3SCOA 1V3KA 4JN7A 4X60A 4AH7A 1R86A 1A3XA 4QBXA 4UNLA 3SFKA 1MNSA 4AXKA 2XG9A 1QUMA 4BWLA 1KR1A 4NY2A 3W24A 3GS6A 1OM0A 2G97A 1PWMA 3HQ1A 4H8UA 4AD0A 3MS8A 2AMGA 3W00A 5AHLA 3DYMA 5HMEA 4AF0A 1EF2A 1NWUA 4WR3A 2VX7A 4XD5A 3W71A 4I6KA 2PDFA 2PP0A 1CXLA 1UR9A 4UMCA 5FACA 1RXOB 3D47A 2TYSA 3H24A 1TX0A 3NZRA 3BW2A 4FX6M 1PSCA 4I7WA 3TDFA 4FZIA 1GQLA 4FXJA 4HU8A 4N6FA 2Y88A 2QAPA 4PCFA 5CLWA 3TIMA 3CXOA 5ABHA 3GM8A 4LTSA 4AEFA 4Z2GA 5EMMA 3B0YA 3VI2A 4AG0A 1PUDA 4O18A 1GPWA 2ADAA 3EWYA 2B7NA 1OEPA 3UG5A 1PX3A 2O7QA 3VNMA 4RCXA 1P1MA 1H51A 4CLMA 1SMDA 1XCFA 3E5BA 3KE0A 3NCOA 2XDFA 1CXKA 1XD1A 4GVGA 1J11A 3SQSA 4AY7A 4M6VA 1XPGA 2WANA 3TYCA 3N2MA 1BYCA 3UWZA 5FI8A 3P8IA 2ZZ4A 1XLJA 1VHCA 4L4OA 3OVPA 2WO5A 4O1BA 1XLBA 2P88A 5FEPA 3SN1A 2CXEA 1GNXA 4Q3MA 1CW2A 5ABTA 4X0VA 5CZTA 2HEJA 3LDVA 3VPLA 3VGBA 4W88A 1BGAA 2YDAA 2G3MA 4LAOA 4POCA 1XDJA 6ENLA 1RBAA 3NGFA 3VIPA 3FGCB 2XVLA 1TO3A 1JCJA 3N9SA 2YXXA 3LRMA 1VCFA 4ZQPA 3G6MA 3T2QA 4AW7A 2F84A 3QH2A 1M01A 5C54A 3IJLA 2PMQA 1DORA 3LM7A 2NX9A 4KEMA 4O16A 3EX3A 1CI1A 1X38A 4L4LA 3A64A 3UXAA 4GC3A 3LTPA 2OLAA 2OKOA 3QZAA 3N9KA 5BRBA 2FFCA 3WDJA 3ZM8A 3I65A 4FP1A 4RJEA 4I9TA 2WK2A 3NQ2A 3H21A 4GUHA 3ITTA 1VYPX 1E6XM 2WM1A 2WYSA 3SADA 1TELA 5LIYX 3L12A 4RDWA 4KS0A 2ZXAA 4INFA 3WY1A 3A4WA 2DEPA 2D24A 3RR4A 3GAYA 4RZ5A 1Q6EA 1A3WA 5JH2A 2Y8VA 5HMFA 1F05A 4C6OA 1J0JA 1TTQA 1Q7QA 2G96A 1BKHA 1XBXA 2C79A 4L1WA 4MPKA 2IPJA 2BSLA 4Q8UA 4L4MA 3EXTA 4IM4A 2QUUA 4MFDA 3W26A 1ZBVA 5ECVA 3B05A 2XZ9A 1PB0A 1TFVA 2ZC8A 1J5SA 4RNFA 1QNRA 1JAKA 2PD5A 5A2CA 3MCMA 2QCFA 4PH6A 1XLDA 1KRMA 1Q45A 1WDWA 3AS3A 4HNTA 3IAPA 2CFFA 3UEQA 4M19A 4W86A 1PIIA 5HPCA 1JXKA 1FWDC 2PCEA 3R25A 5I02A 2DZTA 1A5MC 2XIMA 4M29A 1EC9A 1XIBA 4AYSA 4AZCB 1JVNA 4DWSB 2CLOA 1BRLA 3MCOA 2PLMA 4O53A 5C55A 1BWLA 3TW7A 1NP0A 3RF9A 2XIIA 3AIVA 3W7RA 1RBLA 5CEWA 1CEOA 5I79A 3G1VA 2VDHA 3HPAA 4ZQRA 3IVUA 2XGIA 1Y5VA 2ZUSA 4IFKB 5DN1A 6XIAA 3W2KA 4UQDA 4ADTA 3WK3A 1JPMA 2ISFA 4LNCA 4O13A 3F5LA 1W8GA 3RO8A 2OX4A 4MB5A 2YPIA 2ATSA 2UBPC 5FAJA 2J6XA 1H60A 5CQ1A 3W1PA 3M16A 3E74A 2WVUA 3WQEA 1N7KA 1E6SM 1JUEA 1IIHA 4MDPA 3RRXA 3JU2A 3JZEA 4JKKA 2VWTA 3C8NA 4W8BA 5DXYA 3WFLA 2OT0A 2D73A 1UJQA 1CB2A 1JNDA 1GKQA 3UPBA 4XKMA 4YWIA 1C9DA 1WOAA 1A4LA 3W3OA 2BASA 2E6FA 4HOWA 2V3DA 3A6OA 3VGDA 3N19B 1CPUA 4MZYA 3R7MA 5IDZA 2GJPA 4B3KA 3G8EA 1D9EA 4XZMX 5IOBA 2VFDA 1V3LA 1X98A 1XIGA 4MG4A 4YL2A 4JQAA 3WLIA 3M6DA 1S1PA 4WJ8A 4DUWA 3GDBA 4JHMA 4DEFA 2ACSA 2FVLA 4OVXA 2GWGA 3H23A 1CXIA 1MMFA 1PHWA 1TVLA 4PTMA 2VP8A 4JNMA 4LUSB 2GJXB 2FYMA 3KBVA 3OJGA 2Q02A 1JCNA 4OUEA 4Y9AA 1MZHA 4GI8A 1PV8A 4PCTA 4EANA 2GDQA 5BOOA 3EA2A 2AGTA 4Y96A 3QF0A 3SY8A 3ARYA 2CBVA 4WX2A 4GYPC 3P62A 5D09A 3GH5A 1XH2A 2X1TA 3R11A 3BSHA 1CXEA 4P61A 3ARVA 3BLOA 3EKGA 1SFJA 2A3BA 4QDPA 3VIOA 3GG1A 3NVDA 1C29A 2J66A 2MANA 1UP0A 4GINA 3R10A 3W1AA 4C91A 4WJXA 1OK4A 4DVOA 3DFQA 4DJFC 3AHXA 2V8ZA 2OEKA 3PWGA 4RDYA 5PTDA 4D6DA 1OX6A 3OBEA 3WMCA 1FH8A 4JTGA 1NU5A 4GACA 5L9FA 4ROQA 3VC6A 3NPUA 1US0A 4V15A 1NQKA 3OZMA 4NRRA 5HXMA 2CERA 2D20A 4PMXA 3B03A 4QLLA 5HQLA 2O9TA 5CKSA 2J4GA 4MWAD 1QW7A 2FH6A 4H9VA 3SRHA 4ERIA 1ODUA 3LCHA 4L4PA 3BLLA 5JU6A 1QXLA 4WOZA 2GLKA 3IUDA 4HZ8A 2BOEX 1K9DA 1PTGA 1HJQA 5KZDA 1L0PA 1V0LA 2Y24A 1OYAA 1I8JA 1W1ZA 5D9NA 1XIFA 2ZUTA 1X8FA 2J77A 2QCLA 1KM0A 4J3XA 2YYUA 3FEMA 4W7WA 1VR6A 5CBIA 3I4KA 4E8DA 2NSOA 1OSEA 3O6YX 3WG6A 4YTUA 1T7LA 5CPTA 1M7PA 2PPGA 3S9ZA 1GTEA 2PWVA 1XSIA 1OFPA 1WZMA 3FJ6A 3WN6A 1M1BA 5A8OA 5AC7A 3WMLA 4A21A 4PB4A 4H9MA 3GFYA 3H4WA 3L4UA 1GK8A 2PD9A 2WCAA 2QKFA 3HU7A 3LA4A 1F9CA 2PF0A 3VKBA 5TBOA 3BUVA 2W27A 5REQB 3FLUA 1NFBA 2VDIA 4A8NA 2WSRA 5I3HA 4FIRA 4RZ4A 3QPZA 6TIMA 4JTIA 3W29A 1F76A 1VC4A 5FF4A 4H19A 1WP6A 2ZRYA 2VFEA 4EWND 2VCCA 4ZMGA 4N42A 1OHLA 1E70M 1QHPA 3CTTA 4PFHA 3G1SA 3FJ4A 4NU7A 3UJ2A 3EDEA 4PRTA 3GWQA 2PGFA 4ORIA 3O6AA 3DDMA 1V6TA 1EEPA 2ZDRA 4Q22A 3AWOA 5FEWA 3KRZA 4LAKA 4LX4A 1WCGA 3MUAA 1W3JA 3KW3A 5LNUA 2OQHA 3M0ZA 1E6ZA 1ZJIA 1ZQ5A 3UR7A 3DFPA 3LTSA 3IV3A 4O54A 1OYBA 1Q2RA 4YCPA 1AG1O 1R3VA 3D3FA 3C3NA 3M44A 3N4FA 4B91A 4AZ7A 4G56A 2CZEA 1KA9F 3RILA 2WC3A 3MKCA 1I2NA 2CEQA 1Q6QA 4JYDA 1GONA 2VCAA 2BHUA 4BQ3A 3DYOA 4S3EA 3AIRA 3CAKA 3G0SA 3W84A 2HE8A 3WSUA 3ANYA 3U6WA 4UTWC 1KV8A 2YL8A 1CLVA 2V2CA 5M1TA 2ZWZA 4S3BA 4ZZ9A 3PPHA 3R5EA 5E0CA 2B31A 1OG6A 3NQAA 2EAWA 1WAUA 1OK6A 5A8GA 1LP6A 5G2IA 1YX1A 1SVDA 5FF7A 5HMSA 1T41A 2EO7A 2J88A 4D6GA 2WBGA 1HNYA 1FOBA 2PRHA 2VZSA 1H11A 2ANUA 4QDWA 4LPCA 3OU8A 4F0MA 3UG3A 1VEPA 1W9XA 2X1UA 4A35A 1NDZA 2WPGA 1T99A 5C7HA 4BQ4A 4QSHA 5HWNA 2WVSA 2C3ZA 3V5OA 2VZVA 1XP3A 3WLJA 1EX1A 1W1VA 1YTDA 3OLGA 4ZTYA 3W7JA 2J75A 3QM3A 5G4WA 2PDXA 3LMYA 4WSJA 1UOZA 3QC0A 3UF9A 3L4VA 3V1HA 4BK9A 2RKXA 5DY3A 4Z0JA 1K4GA 4OFCA 1EP2A 4L56A 1E9YB 3LLDA 2E25A 2WKGA 3CWOX 3URQA 4JYFA 4IX2A 5JUVA 3N2CA 1XXXA 5BXTA 1JGMA 1JIBA 5BMXA 1WPCA 4G2DA 2B7PA 3UW6A 1H1NA 3RG6A 4LAUA 1ISYA 4BEQA 2ZCGA 1TV7A 1VHNA 3WBXA 5AKQA 4C6JA 1OF6A 2E8ZA 4IPJA 3MUCA 4NNBA 1VFTA 2WC7A 4AIOA 1XLGA 2V3GA 2NQHA 1E71M 1QO5A 1MFUA 3E0LA 3QMRA 2V5LA 4LUSA 4GRSA 1NWRA 1JDFA 3KBSA 1GQIA 3GIQA 1ICQA 1H5YA 3AFBA 4YCOA 2GGIA 3TN6A 2PDHA 1SM9A 1L6WA 5EFFA 1X7FA 3QW4B 4JNYA 3KFTA 1QBAA 2IKHA 3B8VA 4EXQA 4TVDA 3CIXA 2PS2A 3EX4A 2XYLA 1MNZA 4JTDA 3QTPA 1QRQA 1L2QA 4W8AA 1D8WA 3U2EA 3QFEA 3VYLA 1FQ0A 5LGXA 1D8CA 3CQIA 3GK0A 4HPNA 2OPJA 1SR9A 1QPNA 4EACA 3OYZA 3MWCA 4LJ3A 1YEYA 5D05A 2VKZG 3VDHA 5XIAA 3O8AA 1YNYA 1KFEA 3LPPA 2DUZA 2GUYA 5H8PA 2IPGA 3C2FA 2OZ8A 5CG0A 1VPXA 3MHGA 2AMXA 3AI0A 2CWXA 4AZ6A 3D3AA 5M03A 2ZZ6A 1MW2A 3URBA 4BCEA 3PBYA 2XSXA 2OFJA 3L23A 4B5WA 3IPWA 4S3DA 4WDXA 1OC6A 4J3SA 2GDUA 1QK0A 3WQCA 3ITOA 4U28A 4DO5A 5G1MA 1TTIA 5G1TA 5DX7A 3ZJKA 3W0KA 5I07A 1M9HA 2X0YA 3E2RA 1YYAA 3W2MA 3BANA 1NOWA 3ZT7A 2GGGA 4GVIA 3R94A 1DP0A 1GJPA 3S6TA 3WF1A 5HWMA 4HA3A 1B4EA 4DLFA 4IUGA 3OZYA 2CU0A 3RNDA 1JI1A 4ZXOA 4GJ1A 4HCDA 1MEHA 1DEDA 1Q4NX 5LA1A 1KBIA 1CGVA 3LRLA 4GHRA 3EWUA 3R89A 1W56A 3FV9A 2VRQA 2CZVA 4ZEPA 1XKJA 4GBUA 4AZGA 4MWAE 2OSYA 3BPWA 3GDMA 2ISWA 5C2CA 1VQTA 1IR1A 2G8ZA 5D32A 4EVZA 5D2YA 4FHAA 3SCNA 5AVHA 1CXHA 1JL8A 3CMGA 1B0IA 1QO2A 4NZFA 2FDSA 5D38A 3E1F1 2PDMA 1Y7VA 2NXIA 3SCPA 5BRPA 5HJYA 3VDBA 2CLLA 1G7VA 1JULA 1ADDA 3M0VA 3ITLA 3I6RA 3U7BA 1MRAA 4YXGA 1N82A 3STFA 2JIEA 2VC6A 4MSSA 3Q58A 1TTJA 2W0UA 3O0FA 4PUJA 3STGA 1BXNA 1SZGA 1T5AA 3G2GA 3K4AA 4FS9A 2NW0A 3G1FA 1K8YA 3Q4DA 1HIZA 1E9LA 3MI2A 1KFBA 1HL8A 3SAZA 3SM0A 2QPXA 2OZ0A 3HZ3A 2QCHA 3MKVA 2E09A 1NAL1 3AYVA 4D6IA 1V0NA 5FF0A 4F4RA 4E4UA 4P5UA 1D2KA 4RE3A 1DTNA 3PR2A 1XINA 1EX5A 4XVDA 3WF4A 2DFAA 3MMTA 3HG2A 4AEEA 1TE6A 5LNWA 2CIPA 1FWJC 4Z42C 3UCDA 2EJ1A 1TTPA 1F74A 1UA7A 3KUMA 3W83A 1O6IA 5F2MA 3WBAA 2P3EA 4MY1A 4GZJA 5I6SA 1TJPA 1V6UA 3ABSA 4ZSTA 3VNIA 2BOFX 3WO8A 1V6XA 4TU1A 5GJNA 3KRSA 5BOEA 3C4UA 2OO6A 1Z7AA 1XCWA 4IGMA 1SJDA 2WXDM 4N4PA 3TC6A 3W1NA 2XN0A 4WGHA 3LPFA 1P5BA 2WCGA 3SSZA 2Q3RA 1L6GA 3QY8A 4E4FA 1NWSA 4IFKA 3P2VA 3N12A 1TPB1 4ZQMA 3FGCA 2WSYA 1E0XA 2NUXA 5A5WA 4CKQA 1QMLA 1HJXA 3G1HA 4GYJA 1GZ1A 3W7KA 2LLEA 3AJ7A 3P14A 4QJ4B 2CBJA 6XIMA 3A4AA 1NOFA 4J1OA 2PE4A 1G4EA 3LQGA 5MHBA 3C0JA 2YA2A 4XV0A 1EBHA 1XBVA 2D0HA 1GHRA 1LDCA 2YCIX 4RE0A 5A6AA 4RE4A 4AZHA 3T0BA 3UJFA 4XO6A 4REQB 3WNPA 2VCBA 3EOLA 2W61A 1UPPA 3E2SA 3O06A 3K1DA 2YIHA 1WUFA 2JALA 2GVGA 1PX8A 4EIVA 4A3HA 1ZAJA 4QITA 1W5OA 1TQXA 2HRWA 1OFBA 3S1GA 4D72A 4CNUA 4JIQA 3IK4A 4KKXA 4QGCA 3WH8A 3QZEA 5DEZA 3W9ZA 1FA2A 1POKA 3NDOA 4ICMA 4XAGA 1RV8A 3S47A 2R91A 4MWAC 1NDYA 2FB2A 1W1A1 2PI6A 3NYDA 1XYMA 3K2GA 1T0OA 4OOZA 4LALA 1DJWA 3VU2A 1K7EA 3O16A 2NV9A 1DJIA 4XSMA 2FZ8A 4JX4A 4Z2HA 2OOFA 1NP2A 3MV11 2JIWA 4XZIA 3MTWA 4DB7A 4ZO6A 1QW9A 2ABAA 1XSKA 4FOKA 2YL9A 1F3TA 4I3GA 3VOCA 3W7NA 1THFD 1UUQA 3PBUA 2DH2A 2ZX5A 1LWIA 4AWTA 3KTCA 6TAAA 1GVYA 3EB2A 4PMYA 1GVIA 4GH1A 3ZLGA 3VZZA 5CAHA 4KCWA 3VD5A 5D2WA 3TTYA 3PTQA 4HPGA 3LNMA 1G5AA 2PWGA 3IGXA 4I5RA 3OLIA 3GU9A 2QIWA 1XC6A 4AY8A 5M17A 4HOZA 1C91A 3QLLA 4E4PA 3AIUA 3G24A 4BEUA 3I4EA 4N9BA 3T0DA 3FX4A 1AMYA 1SZNA 2OZTA 3DFOA 4H4IA 4HK6A 5HJLA 3RGTA 4K3ZA 3VCNA 1FVPA 2Z6JA 4TTGA 4GI4A 2R1NA 3AZSA 1SSDA 4ZFCA 4G5DA 1J79A 4WQ6A 4LUTB 1EP1A 1QTWA 3GFXA 3W7MA 4FNQA 3AHVA 1C8XA 1YPXA 1Q4WA 2GQ9A 4PBEA 1SW7A 4LUTA 1KFCA 4H8NA 1P6WA 2C19A 1ZUAX 1F5ZA 3QSTA 3WUEA 3I68A 2ZRUA 4BS0A 1QI2A 3POCA 1SQ7A 4GE8A 3W70A 4S23A 5EA9A 4HGXA 4XZHA 1UZHA 4BI6A 1AUSL 2PWHA 3QZ6A 2I16A 1XIJA 4FF5A 1J6OA 3V0SA 1JDEA 3FJLA 4L80A 4V2XA 3WNMA 2NZLA 3M5ZA 1XLIA 1F7BA 3SZ8A 3E3HA 3TE9A 4NKCA 1EXBA 1XBYA 3MYOA 2ZA1A 3UESA 1P7TA 3KS6A 4C6KA 3HGRA 1AW1A 3MO7A 3MHFA 1QW8A 4EPDC 2XTKA 4ASTA 1VBUA 3V5FA 1K03A 2HK1A 3KVKA 4XISA 5AZ0A 3W76A 4DJDC 3XINA 4TX6A 2INFA 2I14A 3ALFA 4MWAA 4OJYA 2GK1A 5MKGA 1I2RA 3S1UA 5C2XA 1JF5A 1R87A 2VURA 2DDXA 5CGTA 4M5PA 1M7XA 4UXDA 3THQA 1M5WA 1OT2A 4MAZA 1GKPA 2HVNA 1EXPA 3T08A 2JGQA 4NJJA 1U5JA 3L0GA 4E38A 2B7OA 3AZTA 2IS7A 3DG7A 4DO7A 2RDUA 2ZFAA 3W6LA 4AIUA 4B5TA 2JBMA 2WHJA 1JNEA 4DO4A 4O4WA 4C1NA 4F66A 1OCJA 3CC1A 3MUXA 4ORMA 1XBZA 2V38A 1A5KC 2Z27A 1Y8BA 4N9CA 5D03A 3QTGA 1FP9A 4FEZA 3OQ8A 3D0CA 3ZT6A 2FGBA 3RX4A 5CZJA 1Z3NA 2REQA 1LLWA 4UTMA 1TWDA 5A6JA 2QCEA 3AIQA 1Q63A 1RY8A 3LRKA 1UD8A 1YNQA 1OZMA 2VENA 1TZ9A 4IMGA 1BD0A 1D7KA 1C8YA 5E9XA 4OBRA 3M0KA 4DJFA 2D3LA 3AXXA 3HPFA 4KWWA 3C2VA 4JTEA 3BZGA 4KWOA 2V6AA 1VFOA 3TTSA 4YHGA 4KFNA 3CUJA 1QI3A 4N2YA 3MSGA 2C0HA 3RM9A 2CHOA 2DZPA 4MJMA 3WK2A 5AC4A 4FAMA 1EGVA 1V0MA 2ZRWA 4DHGA 5I3GA 3WJZA 1OCNA 1S5TA 4J3UA 2PP3A 4H2HA 4M7SA 3BXWA 4IIBA 3DHPA 2FKPA 4HPHA 4XVEA 5H1WA 2HTMA 1VFHA 3W1RA 1EBGA 4W84A 1DOSA 5T26A 1EGZA 5CZ0A 1GZJA 3BQ5A 2RAGA 1QI5A 4K2SA 3T2OA 3VD4A 4M6UA 1SFLA 6PTDA 3GC2A 1LQAA 4JN8A 2Y0FA 4HA1A 3ATZA 3LOTA 4QSFA 5LYRA 4UR9A 3PZTA 4KF1A 1TA3B 4GZEA 4C1NB 4O52A 2DY3A 1A47A 4AZ5A 1K9EA 4G9PA 2XIBA 2YL5A 3PZQA 4HBKA 3DESA 4C1KA 4WHBA 1A0DA 2ZC1A 1OWQA 5GPRA 3EDJA 1YMYA 3Q94A 2QCDA 3CL7A 4ECLA 4K1WA 4O28A 3U2CA 5LZLA 1GZGA 3DC0A 3CYVA 3OVRA 4DZAA 3GZ3A 2YR1A 5I00A 3OP2A 3R8HA 4P7QA 8CGTA 2O9PA 1LZOA 3U4AA 5AYIA 4IWWA 1RY0A 4LS2A 3DI0A 4W4QA 3SJNA 1YDYA 3MPGA 4U10A 3A23A 3FKRA 3WFAA 1WDQA 3QKZA 1UA3A 1IYXA 3AYSA 5HJXA 4MAVA 4UTWA 2DZWA 4YYFA 1GWJA 4FXSA 3P5YA 3R58A 4LF1A 1PZ3A 1RA5A 4ONVA 1MDLA 2HK0A 2XFWA 1VJIA 7A3HA 1K3UA 2OSXA 1TSIA 1HO1A 1PCWA 3K8MA 3LHYA 1E1CA 1KV5A 1U30A 3CH0A 3N11A 2PBOA 3GXIA 3QGAC 1J0KA 1CCWB 4GUJA 3W87A 2BB0A 1VH7A 2QW5A 3GH7A 4GX8A 4H2CA 3VMOA 3CZGA 2Y61A 4S3GA 2WMHA 3CUFA 5IBXA 3UY7A 1YPFA 3ZFHA 3T55A 1N8IA 5A2BA 2QJGA 1TUFA 3QOMA 1X7IA 1XKYA 1QFEA 3EMCA 1L6SA 8TIMA 4PSRA 5AB3A 2J8GA 1WDPA 2EPMX 4HYWA 5KZ6A 4DPQA 4LVAA 3I7QA 3TK7A 2GSHA 3CAWA 4QXIA 1UD4A 4XAZA 4MY9A 4GQRA 1RQBA 1CNVA 3MT1A 1A5LC 1ZBKA 4PEKA 1UKSA 1TRDA 2WHMA 2P53A 2TSYA 3TN3A 5I03A 1WKEA 1LBFA 4AZBA 3UZYA 2V5BA 4O57A 2DZVA 4QQ3A 3F4NA 4JTFA 3DENA 3ZOAA 1A5OC 4B9ZA 4Q4KA 1XH0A 3N29A 2ACUA 5C9WA 3RU6A 1TYGA 1GOXA 4LYKA 3EOEA 1I60A 3M9YA 3KOYA 1FUYA 2OB3A 1Y5XA 1N8WA 3VNJA 1RALA 1V3JA 3VNLA 1FH9A 1IEWA 2RUSA 3HURA 3P67A 2G3NA 5J5DA