3GDMA

Crystal structure of the k93r mutant of the orotidine 5'-monophosphate decarboxylase from saccharomyces cerevisiae
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
261
structure length
261
Chain Sequence
b'KATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELLELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRRFADIGNTVKLQYSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLATGEYTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDDVVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRRC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
molecule tags Lyase
source organism Saccharomyces cerevisiae
publication title Crystal structure of the K93R mutant of the orotidine 5'-monophosphate decarboxylase from Saccharomyces cerevisiae.
rcsb
total genus 95
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3gdmA00
2Y62A 4P61A 2QCFA 4BF9A 3ABRA 5AHIA 1FDJA 1TV8A 1TQJA 1F7BA 2V0TA 2QKFA 3W7QA 5HNRA 4UFIA 3VE7A 2A85A 2VEPA 3L65A 4CNOA 4R33A 4ALDA 4JIPA 4PL1A 4JTKA 3U6WA 5EMUA 4UTLA 5ABTA 2ZCGA 5D2XA 4PL2A 3QSRA 2ATSA 2E1DA 1LBFA 3SSJA 1M7PA 3L0KA 3N14A 1YLVA 4PEKA 2DP3A 4TMCA 3MBFA 4JYEA 5K4XA 3DKJA 1H1YA 1R2RA 4LC6A 1E51A 2J9XA 3W7LA 4TU1A 4OHQA 1K7EA 4JTGA 3BK0A 2TPSA 2RDWA 4IGHA 4WUIA 2R14A 3KRZA 5HQEA 3BW3A 3S9YA 2YW4A 3P8IA 1RZMA 4FXSA 3QZEA 4UFHA 3DZ1A 3NXFA 5C2XA 2E6DA 4O28A 3S6DA 1FCVA 1TPH1 3A23A 3RLVA 2NV2A 2CLEA 3NOEA 2PE4A 4FNRA 4NT0A 2NXHA 1OX4A 3P5ZA 3W86A 2BXVA 3IVUA 3ZS4A 5C54A 1I2NA 5DY2A 1JCXA 1H7XA 1H1ZA 4MY9A 3SZ8A 4UCGA 3H53A 4A3UA 2X1TA 3NQ8A 4NX0A 4IMGA 1R30A 4AHPA 1W54A 4I7VA 2GJNA 1XC4A 4U28A 4XQ6A 1W3NA 3DFQA 3VI2A 3M5XA 4WY0B 4MIMA 4O16A 1SZEA 4GNJA 4ICNA 3W7MA 4BI7A 1KFKA 3W7KA 3NQGA 3M5ZA 4AF0A 4C1KA 4KFNA 3B06A 3CLMA 3QEZA 4FX8A 1H7OA 3G18A 3M43A 3O6DA 4UTMA 2Z6IA 2Y7DA 2Z0IA 4E2BA 4OQVA 1TRDA 3W7CA 3TW6A 3IIPA 2WQPA 1N7KA 4RCXA 3LTPA 4M6QA 5CSSA 3NR0A 5GVJA 3E49A 3GAKA 3TE9A 3OVQA 4JTSA 4OGZA 3O05A 2I1OA 5G4EA 1RPXA 4FF7A 2EGZA 4K7YA 3G3MA 1YDVA 3DHFA 1F76A 3GDLA 1FCUA 4ZQMA 4E0CA 5LSMA 4IUOA 1J2WA 3ABSA 1DV7A 1FCQA 3GVGA 1AG1O 2KZHA 1L6SA 4RZ6A 4I9AA 2E09A 3W22A 4JTLA 4M6PA 2ZFAA 2V2CA 1IIHA 4UFJA 1I2QA 3F4NA 5DXXA 3OG3A 4ZVJA 3UYCA 1A5AA 4A2RA 1VQTA 1KM2A 5K9CA 4A21A 2PURA 3B03A 4J9JA 3HG2A 1TIMA 4HKPA 3W1RA 1LOSA 3C0JA 1VHNA 3W7RA 2YSWA 5A8GA 5TQLA 2PRLA 1XXXA 4IMFA 5LGXA 4AEOA 5EA9A 5K9DA 4IMEA 3PY2A 5HULA 1Z44A 1TPDA 1G4SA 3GKAA 4JICA 1TPFA 2QJIA 4IXXA 3UQNA 2H8ZA 2QAFA 1WBHA 3GK0A 4JNMA 5DN1A 3P84A 4Q33A 2V81A 3W7HA 5F4XA 2V82A 5E1QA 4OT7A 2V8ZA 4MYAA 3LDVA 1HTIA 1ZAJA 3IIVA 3STCA 3CQ0A 3MHGA 4LV4A 2VFEA 3BW2A 3OHIA 1AW1A 3ATZA 2ZYFA 1MEWA 1EP3A 5G2HA 2HMCA 4OBTA 4UIOA 1KFBA 3FEMA 1EWEA 1YXDA 1R2TA 2EAWA 1I2OA 2QJGA 1QO2A 3G8EA 3GR7A 3ABOA 2NX1A 2NUWA 3TSDA 3R13A 3W7IA 3B0VC 4ADUA 1NF0A 5AC7A 4L4MA 1JRCA 2WO5A 3ZFHA 1SFLA 3BGJA 3G1SA 4YMZA 4S1FA 3T44A 5LHFA 1T96A 4JEQA 1DQXA 3LI1A 2Q8ZA 1XBYA 1XDLA 3NPUA 3IVSA 1I45A 4N4QA 4FIQA 4RXGA 4DPQA 2JBMA 2Y7FA 3GXTA 5I3HA 3GDRA 2AGKA 3C4UA 4LUIA 4K38A 3GXNA 3DFNA 4DO5A 1ONRA 3NO5A 5FF4A 4Z1DA 4QIUA 3VNDA 1RR2A 3M16A 4FEZA 2ZRYA 2ISVA 1GG0A 2ZRZA 4M7TA 4BI6A 4IPIA 4ZL1A 2FLIA 1ICSA 5LNRA 4QSHA 2NWRA 5CPOA 2GUUA 3R8RA 2VOMA 3LHYA 4GUGA 4WOZA 4CCEA 4D2JA 2Y61A 2B7QA 3NL5A 1S5WA 1AW5A 5U7SA 4NXKA 4Q4KA 1QCWA 4S2BA 4KKXA 4WZHA 5AN7A 2J9ZA 4UNLA 4HSOA 4IXHA 3E0IA 3PS7A 3LCXA 1UJPA 5CGQA 5LNUA 3B0PA 2J6XA 5D37A 4N9BA 2OCZA 4CNNA 1EA0A 1AL8A 5L9FA 3GAYA 3TUUA 1SSDA 2OT1A 5K9XA 2A7PA 3C2OA 3QJAA 1T0OA 1GJPA 4UTTC 4EOUA 4O1BA 5L6UA 1SQ7A 2NWSA 3OEXA 2EPHA 4N9DA 3SW6A 4YLWA 2A6NA 4N9EA 4O8RA 4UTWC 1O60A 1UCWA 5D30A 1KW1A 1QDSA 3LV6A 3LCWA 4HNUA 1XKYA 1NF7A 3R5EA 3UWWA 3UWQA 4Y9AA 1O4UA 1XFBA 1QWGA 2CZ5A 1LM1A 1S5VA 1K8XA 4HHPA 3TQ0A 3FS2A 4IQLA 3UWZA 3EWXA 1QAPA 1VC4A 4PTNA 3G0SA 2CWNA 1PHQA 1F6KA 3LTSA 4Z1CA 2YFOA 4MFDA 1EP1A 2ZTJA 3R2GA 5AHEA 3W2JA 5LGZA 2CLIA 3N34A 3W2UA 1ALDA 1I2PA 2DU2A 3EX3A 3NEVA 4Y8FA 1X1ZA 2ZRXA 1NSJA 4H3DA 4QAIA 3O6CA 3F4WA 1LLWA 5KITA 3TCEA 4O57A 4AWSA 1W5OA 1WA3A 1CI1A 1G4PA 5J5DA 1B9BA 1WAUA 1A5SA 3OVRA 1GVRA 3UWVA 1GVQA 2FIQA 3HGRA 2C13A 2F7FA 3P61A 1EB3A 1KFCA 3DH7A 1W3IA 3N2MA 2VC6A 4MZ1A 2ALDA 3I65A 3PUDA 1ZCOA 1K02A 3TSMA 4UR7A 1KM6A 4EIVA 2GQ8A 5HWMA 2ABAA 3RK8A 4WY0A 3RF9A 4O19A 3W1XA 3W2NA 1HO1A 5HMSA 2CZDA 3W7OA 2Y88A 2YR1A 4BWLC 3MHUA 3H54A 2IQTA 4TO8A 4KWVA 4DEFA 2B4GA 2W79A 1GYNA 4LVBA 3Q37A 3P60A 4M6VA 3HO8A 1SO4A 4MFEA 4UC5A 5I3KA 3A9IA 5F1VA 3QYQA 2ZA2A 4WXYA 4OWGA 3IGSA 1OX4B 2YYTA 2WJZA 2FJKA 1LBMA 3E02A 5D2TA 3LXAA 3WJZA 2NZLA 5G5IA 3QSTA 5D09A 3LCFA 4JY9A 5MHBA 3EX4A 2A2IA 1MEIA 3HPSA 1H50A 4JTUA 4MZ8A 1KV8A 2VFGA 4NQ1A 5F2LA 5FF7A 1W56A 2YX0A 2ZZ1A 3G1YA 2VEIA 5CPLA 3QW4B 5D2VA 1WX0A 1L6YA 1LRNA 4NZJA 3UXAA 3O16A 2V5BA 3PBVA 4K8HA 3DFPA 1YTEA 3U8GA 5G4WA 3LHVA 1TPUA 3CWNA 5BRBA 3QC3A 2XN1A 3C2VA 4POCA 1R46A 3F1QA 4XTDA 2E6FA 3CEPA 1W3TA 3OBKA 1I2RA 4G1KA 3S0CA 1D3GA 1AW2A 2HS6A 4ZMGA 4DBEA 4JXCA 3MI6A 1QO5A 3FJLA 3EWWA 4IPJA 3TNOA 5HR7A 3INPA 4GUHA 1WYIA 3I68A 1TPEA 3O6YX 1W0MA 4CLMA 4NNBA 2FPTA 1F73A 5D05A 1DORA 3HGSA 4ZQPA 2ZZ5A 2TSYA 4PODA 5IBXA 3UPWA 1ZAIA 4QNWA 3N9SA 3WK2A 1GWJA 1I4NA 1QNVA 4N4PA 2BSLA 1ZJIA 1A50A 1X6UA 5C55A 4YCOA 2V30A 1L9WA 1WBJA 4UTHA 4WJEA 1KA9F 2ZRUA 1QPOA 1FWTA 2DZTA 2ZZ4A 3DGRA 1WOAA 3TAOA 3WJWA 4QJ1A 2EF9A 2RDTA 2Y85A 3KRSA 4JD4A 1U83A 2DORA 4O54A 3O63A 4I7UA 4Q32A 1OFPA 3PBWA 3BLIA 4H4IA 4LNYA 1WXJA 2Y89A 3HF3A 3L5MA 4BWLA 1ZNNA 5EKYA 5KTLA 3CM4A 4FNPA 4IX2A 4Z1AA 4JY8A 3NZRA 4O53A 5FEWA 3FKKA 4LT9A 1LRTA 3C6CA 1XI3A 4DXVA 3THAA 5H2ZA 4PC8A 1TPVA 4M5PA 2JK2A 4LW7A 3DI1A 3BG3A 1IGSA 1ZFJA 1LRQA 5AC6A 3EWZA 4NNCA 2QCHA 2XN0A 1W5PA 1TMHA 3CB8A 1K8ZA 5AHFA 2DZSA 3L66A 4YCPA 1Q6LA 5KINA 2FDSA 3S8HA 3G1HA 3EXSA 3GX9A 3P7YA 3UY7A 2I9EA 1VRDA 1LTDA 1JUEA 4GRSA 2C6QA 2ZZ2A 3PB0A 4MZYA 2GVGA 2H90A 2C16A 3IEBA 1WQ5A 1ZENA 5F2GA 1K8YA 5EBUA 5T26A 5KZEA 2HTMA 5AYXA 1NAL1 5AFDA 1MZHA 2CLHA 1UB3A 2V2DA 4HT3A 1JVNA 4K37A 7TIMA 3UZJA 1FQ0A 2W0UA 4UFLA 3LHWA 3QPYA 3W2KA 4AB4A 4NJJA 4GXMA 4NJKA 1A5CA 1VCVA 4WOQA 3S5YA 2YFNA 5KZMA 4MLJA 2A21A 2DJXA 5IBXC 2OZ0A 4EWND 2Z2UA 2O7SA 3OA3A 4GJ1A 3VFLA 2BTMA 1JCNA 1EEPA 3SGUA 2LLEA 3G1VA 5DCDA 4QQ3A 3T55A 1TPB1 2TMDA 3T78A 3NPWA 4MOZA 2WNNA 4GUFA 1ZHAA 1OVDA 3VCRA 4ONVA 4A29A 2XFWA 2AAMA 4ADSA 1W37A 1FWNA 3NQFA 5AHLA 1TTPA 3C2RA 2QUTA 5J5RA 3NZ1A 2BX7A 4B5NA 2VFFA 1OFQA 3EB2A 2V5LA 2H6RA 2R94A 4JX4A 1R2SA 2DZWA 1SSGA 4L4LA 3B0UX 3G24A 3M1ZA 3MW7A 4O50A 4HN4A 3GIYA 5CZJA 2QF7A 1H7PA 4JX6A 4MJZA 2PC4A 3HGOA 1W5QA 3BLEA 3HMJG 5AYYA 3W6YA 3EKZA 4ZZ9A 1M5WA 4DQWA 3P81A 2VEMA 4YXGA 1Q6OA 2OJPA 3BW4A 2GOUA 5BOOA 1OX6A 3EWYA 3BG5A 4LOCA 1DOSA 5FEPA 4NU7A 5EPDA 4XUGA 3W7EA 4N9CA 3QM3A 1PL9A 2Q8LA 5I3GA 3DKLA 3W71A 4NVTA 3C61A 3QPZA 3C2EA 5CZTA 1OABA 1SFJA 4O4VA 1TPC1 1SZGA 3BVJA 3LGEA 5TBOA 1OJXA 5HUPA 2ZDRA 4DO6A 1PE1A 3C52A 3WJYA 1X7FA 4CQ9A 5K3VA 4O13A 3G1FA 2QCGA 4UMCA 4LV9A 3C56A 1J4EA 3EEGA 3W88A 2CLLA 2UV8G 4LVAA 4ADTA 4R7JA 2X30A 4GE8A 1TSIA 1KLZA 1GZGA 2X1RA 3HG3A 2YW3A 1YPIA 3L21A 3EX2A 1P0KA 4NJGA 3R89A 3S1WA 4JTHA 1GG1A 2NXGA 1NVMA 4WD0A 4PCFA 4IWWA 4FO4A 1RV8A 3HG4A 4MLRA 3GLCA 3E9AA 1SO3A 3NL6A 4DPPA 2E6YA 4CQ8A 1NFBA 3UNDA 4JYDA 2VFHA 1C9DA 2CW6A 1GVFA 1YDOA 1YDNA 2Y7EA 4CQAA 1P1XA 4YL2A 1O95A 4O15A 1FXPA 4XTIA 3TAKA 3T7VA 3NQCA 4DF0A 3DHDA 3HG5A 1VYRA 3LRKA 4ZQNA 1OK6A 5HWJA 1K7FA 1JCLA 1QPNA 4HNNA 4LC8A 2A0NA 1KM4A 2JKEA 3T40A 3T4CA 1Z42A 1KTCA 1VS1A 4XKYA 4XKYB 1GVSA 3BO9A 2G5WA 3C2FA 1W1ZA 2BWGA 4HIBA 3B8DA 1U5JA 1AL7A 3KVJA 1GTEA 3CTLA 3L5LA 4UNKA 3PF3A 2ZZ6A 5A5WA 1YYAA 3NPXA 4TX9A 3GXPA 2Z6JA 1G4TA 4EF9A 1SW3A 2Y6ZA 1OK4A 1PHWA 3PUEA 5K2ZA 1MEHA 1TTQA 1GYLA 2WV8A 3L67A 4ZQCA 4XWUA 1TREA 4BFAA 1T8XA 3RNDA 3EXTA 4JDBA 3TFCA 1YADA 3PVFA 3KVLA 3NAVA 3LBMA 1F05A 1EIXA 3CC1A 3B05A 3SGZA 1XBVA 3ELFA 4LU0A 1K7XA 2G97A 3MP3A 1XBXA 1XL9A 3S1VA 2YDAA 4GC4A 3L0GA 3MP5A 3TH6A 3STFA 5LZLA 3GDKA 3NM1A 3EWBX 5AYZA 2GJLA 5CZ0A 5C5YA 3W07A 1KFEA 3CU2A 1EUAA 2QCDA 3W1TA 1TV5A 2C14A 2GVJA 3TFXA 3QMRA 3S1XA 3BPWA 1JR1A 1EX5A 1OFDA 2QCMA 4LVFA 2J88A 3TR2A 3E12A 2E77A 3LXCA 4MY1A 3TC7A 3NQ6A 4ZQOA 2PRMA 1TJPA 1EWDA 3LLDA 2Z1BA 1UBSA 5FF0A 1P5BA 1ML1A 5BW6A 1VCFA 1OFEA 4AHQA 1LLZA 1YPFA 1H60A 1A5BA 1S5TA 3TJLA 1YXCA 2B0MA 3C8FA 1JQVA 3WK3A 2W6RA 4Z0JA 3L0NA 1V7YA 3LRMA 5KSWA 1GQNA 3M9YA 3EX1A 4AVFA 3FFSA 1VCGA 4BI5A 1IXOA 1IXPA 1B3OA 3A21A 5CPMA 5LKYA 5SWUA 5D32A 3MO7A 1ICQA 3FOKA 1PIIA 1FCBA 2QCCA 2QCNA 2WSRA 3M47A 3PM6A 4NX5A 3TQKA 3CIWA 4NUWA 3SFKA 2NUXA 1DBTA 2QUUA 5F2MA 1JCYA 1RQEA 2X16A 4OV9A 3CIXA 3L2IA 3NDOA 2A5HA 4NJHA 2ZZ3A 1HFBA 4OE7A 4O17A 1I8JA 3HPZA 3W1MA 3M44A 1TB3A 1VH7A 3PAJA 2RHGA 2WNQA 2YXGA 3PBYA 4FNQA 2A7RA 3VE9A 3CHVA 3RFAA 2CZEA 1OG0A 1CX9A 1HL2A 4X3ZA 1HG3A 3UXDA 3BG9A 1VGAA 4JX5A 1H7NA 2H8XA 5I3IA 3M41A 3VKJA 5FESA 1VJIA 5DY3A 3B4UA 1JULA 1D9EA 2J27A 2C0AA 4YWIA 1DQWA 2E5BA 1VR6A 3IVTA 2QCEA 1FY6A 3G1DA 1MO0A 6TIMA 2QUVA 1ZALA 1SR9A 4WQ6A 2ZA1A 3IGUA 3HB9A 4RLIA 1QOQA 2JKAA 3FLUA 1THFD 3KXQA 3W1PA 3TU9A 5H91A 2J24A 3P62A 1OF6A 4GBUA 1Y0EA 2ZRWA 3P5YA 3USBA 4RZ5A 4C1LA 2R8WA 4UTJA 4K8EA 3HGJA 2JGQA 3QMSA 1JCMP 4MVAA 1LORA 4CNPA 1V5XA 3G8RA 3TIMA 2HSAA 4FIRA 1Z41A 3CWOX 3Q58A 3KFTA 3NPVA 3LCHA 3W1QA 1ADOA 4I7WA 4WXZA 1F5ZA 3SR7A 1H61A 2VXNA 5FF3A 2NXIA 2EKCA 5AB3A 2CLMA 2B7PA 3FIGA 3KHJA 5G1TA 4FB7A 2Y70A 1FWSA 3STGA 5KMYA 1GTHA 3JS3A 2TRSA 4N02A 3W1LA 2ATMA 3GKFA 2QEZA 3A5VA 3LERA 3QQ1A 5DBUA 1DKWA 2H3DA 4LRTA 3EX6A 3WFAA 5LNWA 4TMBA 1JUKA 1N8FA 3FKRA 3QH2A 3TK7A 3LCGA 4Y96A 4LS1A 3CPRA 4OV4A 1W8SA 4R34A 5LNSA 2ISWA 2ZZ7A 3IIZA 3U2OA 1BTMA 4ML9A 2QAPA 4LVGA 1KBJA 2J9YA 3QW3A 3S5ZA 3CT7A 1W31A 1K3UA 5IM51 4AHOA 2QCLA 3W72A 2E5DA 3G0XA 4HPXA 3P67A 2RKXA 3BLFA 1OYCA 5DLCA 2QJHA 4RZ4A 1JQXA 3TDFA 3TKFA 3W2LA 4FNSA 1SZNA 5I3FA 1P4CA 4FX6M 3M7WA 4GFSA 1PVNA 1ME7A 2NUYA 3W2MA 1FUYA 1DVJA 3N9RA 2E68A 2A7NA 1OFAA 3HQ1A 4Z0SA 4UTWA 2C15A 5DXYA 1RD5A 2BLEA 1RQBA 3L9CA 2Y7GA 1SW7A 2Q3OA 1OYAA 3IIXA 5D03A 3MMTA 4TIMA 4O0ZA 2VFIA 3D0CA 2CLOA 3SECA 4AWTA 3THQA 4DBDA 2CZFA 2DZXA 1LOLA 2P1FA 1UUOA 1Q6QA 2ZA3A 1H7WA 4A2SA 2BZNA 4XZ9A 1X1OA 1SZFA 4QISA 3G0UA 3NL2A 1W5MA 2D73A 3W7PA 3PSVA 3W1AA 3S5OA 2ZRVA 1HO4A 3BV4A 3LBCA 1D3HA 4JIQA 4AMAA 3P82A 3V75A 3G3DA 4ZQRA 2FB3A 2YYUA 4EF8A 5FI8A 3PR2A 1PCWA 2AQWA 4AAJA 3DFSA 1S3HA 3GNDA 2ISSA 3IIOA 3DENA 1FX6A 4NNAA 3NYZA 1ZY9A 4H6KA 3R12A 3TQVA 1F6PA 3MHFA 1EPXA 4LWWA 3LCIA 3PG8A 1IXQA 1VPXA 2DJLA 2G96A 3DBPA 1G69A 2RFGA 4X9SA 3I7SA 3OIXA 1R47A 1SO6A 1X8FA 1TQXA 4M19A 1ICPA 1QPRA 4JTTA 6ALDA 3S42A 2FQIA 2Q3RA 5F2IA 3ABQA 1KTBA 3TSBA 1XDMA 2H3BA 1HUVA 1VZWA 4O10A 1WDWA 4O1DA 3RU6A 4XBSA 3NNTA 3NQEA 1J5TA 5TIMA 1KM1A 4BR1A 1KFLA 3A5FA 4AH7A 4HPJA 4JYFA 2GQ9A 4CCCA 5DCEA 3QF0A 4S2CA 4RX0A 3TW7A 2C18A 3W3OA 1YTDA 1NEYA 3KRUA 1Q6RA 3HIJA 4JDYA 4W9TA 2JKPA 5HJLA 5HWNA 3LOTA 1TYGA 1TTIA 3TA6A 2YCEA 1LZOA 4LTSA 3NQ2A 4MJMA 5F4SA 2X1UA 2WSYA 3JR2A 1VLWA 4JS3A 3W7NA 3G1AA 2FTPA 3DFOA 1XM3A 3GR8A 2B7OA 4AWUA 3O07A 3GB6A 3PUOA 3UY8A 1MXSA 1OF8A 3LB0A 1OHLA 3QQ0A 2GVLA 1TPWA 3TJXA 3PWAA 2QCDB 3NG3A 1KM3A 2C1HA 1VYSX 4HNVA 4LS2A 5EY5A 3YPIA 3O06A 1G7UA 3HBLA 4IX0A 3LTYA 5BMWA 3GNNA 3L5AA 1H62A 4ORMA 3W84A 5EYWA 3G22A 2E6AA 4Z08A 2DZUA 3GDMA 5U4NA 4FNTA 1EUNA 3DFTA 2VEKA 5I3JA 4A22A 3W23A 3LI0A 3TMLA 3A24A 3W83A 3TXVA 3LCLA 3NVTA 2NLIA 3JRKA 3ZWSA 2JGYA 2VKZG 1G7VA 4O52A 2R91A 4IJBA 3HPXA 3C3NA 2FPYA 5FEZA 4HNTA 3NQMA 3MYPA 4JN6A 4O14A 5D38A 4N6FA 1O5XA 5F1UA 3TX9A 1XUUA 3TC6A 1QR7A 1QOPA 2GPTA 4FNUA 1H5YA 2WPBA 8TIMA 3KAOA 5DBTA 2V9DA 3N73A 3NGJA 2A4AA 4X22A 5CPNA 3N2XA 4IMCA 4UTKA 4O4WA 1GT8A 1O5KA 3PB2A 1LROA 5BMXA 5D2WA 3I7QA 2A6LA 4N6EA 1G4EA 3NL3A 4TR9A 5K4ZA 1LDCA 1LCOA 4PA8A 3NM3A 1YTKA 4RV8A 1AK5A 3P74A 3NQDA 1KM0A 5AOUA 1QMLA 1BWKA 5HR6A 1JRBA 1JJKA 3UPBA 3PULA 1PS9A 2X2GA 2VELA 4UFKA 1DJNA 5CKSA 4UTTA 4XBKA 3L68A 3AJXA 1KV5A 3MJYA 5CG7A 3O1NA 3W7JA 1TRIA 3W9ZA 3OVPA 3N19B 3LHUA 5K7JA 5HUOA 1TTJA 2G95A 2QDHA 2DZVA 2OT0A 4O18A 3H55A 3TXZA 3GYEA 2OMAA 4FXRA 4UTUA 4O12A 2QR6A 1JCJA 3DU0A 3KVMA 3N3MA 1H63A 2CLKA 1XBZA 5LNVA 1IF2A 1BWLA 3W1NA 1ZAHA 2Y63A 4MYXA 2QDGA 1VHCA 1C29A 4K36A 3MWAA 1BKSA 5KZDA 3A22A 3LHZA 1VYPX 1SPQA 2I14A 1C8VA 4LUJA 5AHNA 4GWEA 1G6CA 4IOTA 3W70A 1WOBA 1DHPA 1DL3A 3MBDA 4UR8A 3WJXA 2C3ZA 3P8JA 3ZWTA 3NQVA 5EL1A 1KTNA 2RH9A 4PFMA 1ME8A 2WOQA 4JTEA 3O15A 1W5NA 1XUZA 4K7VA 1CW2A 4Z1BA 4U4MA 1AMKA 3IRDA 4UMBA 5D04C 3W73A 3O8AA 4IMDA 1Q3NA 3S5NA 1MSSA 3KOFA 3LX9A 1L6WA 3G1XA 4JTFA 3KX6A 2O7QA 2YZRA 1LOQA 1PCKA 1T99A 1OFOA 3W7DA 1LBLA 2PRHA 2ZQ0A 2P10A 4NZFA 1SU5A 4M7SA 3P80A 1L2UA 2YGYA 4E38A 4CCDA 3QRHA 1G67A 3M6YA 3W1UA 1FWWA 1H7RA 4FHAA 1IIGA 4UUIA 5D33A 4RR4A 2OX1A 4MPQA 1Q45A 2FB2A 5E93A 1TO3A 1M6JA 3QFEA 2WNZA 3PSWA 3PBUA 1QPQA 4N2YA 3FYOA 2VENA 5CSRA 4K39A 3M5YA 3MP4A 3NQ7A 1FDZA 4WX2A 5HINA 2E5CA 5AHMA 2A1YA 2EHHA 1KFJA 1OX5A 2PCQA 4LY8A 3ATYA 4NJIA 2HS8A 4UMAA 3UZ5A 2TYSA 3B04A 4P2VA 3UWYA 1F74A 4RK8A 1FDYA 5D2YA 4LVDA 3QMTA 3LM7A 3MYOA 2FPVA 3STEA 1UUMA 3MI2A 1YXYA 1UASA 2YPIA 3WK0A 4UXDA 1KM5A 1BEUA 4KFOA 4Y90A 4OU1A 3NQAA 3HOJA 2CLFA 3SIZA 1RQHA 4JTIA 1LYXA 4JR5A 5AC8A 3UWUA 1TV7A 3Q94A 5C6MA 2V2HA 1SO5A 4GUIA 1DJQA 2NX3A 4KFPA 4RJEA 1RVGA 5D02A 4GUJA 2P0OA 3M0ZA 3MI3A 4ORIA 4K6AA 1N55A 3W75A 1FBAA 3LHTA 4MUZA 3CEUA 1GOXA 5F4WA 3SY5A 1SW0A 3V1PA 3EWUA 2VFDA 1JUBA 3MUXA 1FXQA 1OFBA 4LS0A 1EP2A 3FJ6A 1KBIA 3E96A 4DF2A 3LXBA 3I7RA 4UFMA 3M5VA 3AO0A 3DI0A 3ZR4A 4MY8A 2B7NA 1B4KA 3W76A 4DELA 5BNKA 1KLYA 3SI9A 3UD6A 1P0NA 3DXIA 4WY0F 4KWWA 1O94A 4R53A 4AF0B 3SJ3A 3PG9A 1FWRA 2WKJA 3BGGA 4HSNA 1Z48A 5LHEA 1PV8A 4AXKA 3EKLA 5CZSA 4QITA 1OFRA 3I6RA 1GPWA 3TMQA 1B4EA 4QNEA 1TCDA 1VLIA 3GDTA 2CFFA 1H51A 3NA8A 3EXRA 3RLUA 1GVOA 4BK9A 5E0KA 3WK1A 3KVKA 3LLFA 2GQAA 4NXSA 3W74A 3RMJA 4EVZA 3FYPA 3F03K 2ABBA 3W85A 4O0KA 2WSQA 4RKAA 2ZTKA 4FX7A 2RDUA 2ZBTA 3BARA 4DF1A 3PC0A 1XCFA 5FF2A 2C19A 3ANYA 5DCBA 4Y6GA 4JGDA 5G1YA 4RXFA 4X2RA 4DO4A 1GEQA 1IXNA 3HJZA 4O1CA 5FEXA 1SUXA 3IV3A 3Q2DA 1K03A 3LRLA 2X1SA 3IGXA 2NX9A 1B57A 5G2WA 4E2DA 4QM1A 2FFCA 4O11A 1M7OA 1A53A 4MKNA 1LP6A 3K30A 3S1UA 3GZ3A 3WJSA 4O1AA 5G2IA 3TV8A 3DAQA 2DZPA 1OYBA 4JTJA 4PH6A 4LRSA 1TJRA 1WV2A 3FA5A 3TROA 5DELA 3LV5A 1QFEA 4UTIA 3W7GA 1F2JA 2XN2A 2NV1A 3W87A 2F84A 1ME9A 2CU0A
chains in the Genus database with same CATH superfamily
4L9ZA 2JFEX 1CB7B 3ES7A 2QCFA 1TQJA 2V0TA 4GISA 3W7QA 4LAOA 4UFIA 2PD9A 1JYWA 4R33A 4EPKA 4JIPA 2PCEA 2V68A 3CYVA 3GU9A 3RJYA 1XLLA 3VAVA 4KMQA 5ABTA 3S2MA 1XS2A 4WGHA 4IPLA 3SSJA 1M7PA 3L0KA 4GYJA 4CN6A 2P8CA 3W53A 1VFFA 2CESA 4KF1A 3W27A 1R2RA 4LC6A 3RG6A 2BXYA 3F7JA 1K7EA 1PZ2A 2O9OA 2PFHA 2PP0A 2RDWA 2D0HA 3NJ3A 4IGHA 2CC0A 3LK6A 2GGEA 1AMYA 5HQEA 4PGLA 4FXSA 1UKSA 4F48A 1E0VA 2E6DA 1UZ4A 1TPH1 3DX5A 3RLVA 2NV2A 3NOEA 1GK8A 1JAKA 3P5ZA 3EA2A 1WXYA 2R1LA 2C8NA 4IGSA 3BAKA 1P48A 3F5JA 4CNUA 1FWEC 4HU3A 4WJXA 1S38A 2X1TA 4GC3A 3ITYA 3R0UA 2PWHA 5D4YA 5E9XA 1R30A 4B5WA 4C1NB 4QSFA 4I7VA 4U28A 3DFQA 1R0MA 3M5XA 2X7WA 1RK5A 2J4GA 2J7FA 4HNLA 1E4MM 2VO5A 3PTDA 3BSGA 1EHAA 1Q8JA 3W7KA 3M5ZA 1SJDA 5FD0A 4AF0A 4C1KA 1C92A 2GK1B 3VOGA 4KFNA 4QE4A 3B06A 5AECA 4FX8A 2F61A 3M43A 1FHVA 3H2CA 2Z6IA 1LWJA 4PTWA 1UD8A 1YPXA 1OZQA 3TW6A 1CNVA 3IIPA 1N7KA 4JNZA 3EBVA 1VJZA 5FA5A 1NOWA 3TE9A 3OVQA 4H00A 2I1OA 3QY6A 2EGZA 3SM0A 1O7AA 1HF6A 4G56A 4ZQMA 3VNZA 5E6ZA 3F2BA 1DV7A 3GVGA 1AG1O 2OKOA 4GIYA 2V63A 4QJ5B 4I9AA 3NDYA 4JTLA 4M6PA 4WSHA 5C70A 1EJXC 2DH2A 3XINA 3L4XA 1V8EA 5FJPA 1V6WA 2QNEA 3OG3A 3B9DA 4I6KA 3UYCA 1VQTA 1BQGA 2IKJA 4IQJA 2XM1A 4GH1A 4J9JA 5JH2A 3OBEA 1LOSA 2PWVA 1I9CB 5TQLA 4IF2A 1K8CA 5C9WA 3TZNA 3PZOA 5A6KA 5AY7A 5AZ1A 5K9DA 1UW9A 3UR2A 1Z44A 1JDEA 3GKAA 3S3GA 1B31A 3BLDA 1NY1A 4M1RA 2H8ZA 3UQNA 2OYMA 1ZJBA 1GOQA 3GK0A 1E73M 3CHCA 3P84A 4Q33A 4PUUA 2J13A 3GHSA 2V8ZA 1VFMA 2YIHA 3STCA 1VFLA 3K46A 4LV4A 1UPPA 2VFEA 3EOEA 3SUSA 3OHIA 3MUY1 2PGEA 3TJIA 1UH4A 1UPMB 3ZXWA 2ZYFA 1EP3A 2C79A 4IIEA 2HMCA 4UIOA 3RRAA 1EWEA 1KR0A 3QTGA 3VNMA 2EKGA 1UKTA 3IJLA 1QO2A 2NX1A 4PSRA 2I9UA 4FALA 3C3UA 2ACSA 1C7TA 5CPSA 1NF0A 4HA4A 2OQLA 1VRXA 4WDTA 5LYRA 2WO5A 1KFWA 2Z2BA 5HA7A 2NVDA 3S6TA 4Q6JA 1HP5A 1W9PA 1A0DA 4JEQA 3IK4A 4XD5A 1DQXA 4MG4A 4BJHA 3AXXA 2Q8ZA 1A5UA 1XBYA 1KD0A 2XVPA 3NPUA 3T4WA 4JHZA 4N4QA 4FIQA 1MNSA 1JPKA 4IP7A 3O9NA 2DIKA 4JQ3A 4DO5A 4R7WA 4P7QA 3AIBA 2REQA 3ISIX 2ZRYA 3PJUA 2ZRZA 2WZHA 4ZL1A 2FLIA 2UWFA 5LNRA 4QSHA 5C9ZA 5CPOA 3R8RA 3BH4A 3UJEA 1ONXA 4H9MA 1FWGC 2QMJA 4UQDA 2YB4A 4K68A 4UR9A 3NL5A 3B9NA 2JE8A 4CNSA 5C7VA 3NURA 4Q4KA 4S2BA 4KKXA 1J0YA 1HL9A 4ZTYA 3E0IA 4G7EA 4DRSA 1E6SM 2J6XA 3ZJ7A 3EZ4A 1EJRC 1SSDA 2OT1A 5K9XA 4WDXA 5HDRA 4O1BA 1AVAA 3OEXA 1R9YA 3SW6A 4YLWA 1W2PA 2A6NA 2ZE3A 4N9EA 2WLYA 4UTWC 5ABFB 4C6NA 1UCWA 3SB0A 5JXQA 3DESA 4HNUA 1NF7A 1VEPA 3WF3A 2EO7A 2X0SA 1O4UA 2OEMA 2Y5SA 3ARXA 1ZPTA 1QWGA 3ZZ1A 3GFYA 4H9XA 1ZBVA 1TV3A 1IQ8A 4PTNA 3G0SA 1E5JA 1PHQA 3APGA 2YFOA 4KEUA 2FZMA 5AHEA 3EDFA 1OC6A 2YKKA 3N34A 3W2UA 1ALDA 3GHUA 4C6CA 2OGJA 1JYNA 2JIWA 1CGVA 1J0ZA 1SFSA 3F4WA 3TN3A 1GKPA 3LU2A 4AWSA 4NZ5A 3S2JA 2YL5A 1G4PA 3NYDA 1B9BA 3QV9A 5T91A 3R8HA 3OVRA 3G77A 4GX8A 2C13A 1DJXA 4TVDA 3UW6A 3DH7A 1EGZA 3KP1A 2ALDA 3PUDA 3GWQA 3QGKC 4S3AA 4DBUA 3EOOA 4A3HA 1MXGA 3ONCA 3A4JA 4EIVA 5HWMA 2ABAA 3DHPA 2QDEA 4WY0A 4C65A 3RF9A 4O19A 3WENA 1TX2A 1Z32X 3W2NA 4A6GA 3L4UA 2OR2A 4Q4QA 2PWUA 5AC4A 4QG8A 2Z1XA 4GYFA 2BGNE 2IQTA 3R0DA 4LVBA 4F0HA 4DJEC 1GKQA 1E6QM 4KBXA 4XUYA 3AUJA 5F1VA 4GK8A 2W62A 1OX4B 2YYTA 2PBOA 2WJZA 1E70M 2FJKA 3E02A 3WJZA 3PPFA 3N11A 3BJFA 5D09A 1XYAA 3FVDA 9XIAA 1RH9A 3EX4A 2A2IA 3WH6A 3VXGA 1MEIA 1E5NA 3WQPA 1KV8A 1RSCA 4HU0A 1IZKA 5F2LA 5FF7A 4HNCA 3G1YA 3QW4B 3ME3A 2WMIA 5HOSA 4NZJA 3IUDA 3GO2A 1YQ2A 2W63A 2J78A 3U8GA 2WBGA 1IV8A 5G4WA 3LMYA 2ZDSA 1R46A 3KRBA 4MWAC 4XTDA 3SCWA 4AG0A 1W3TA 3GH4A 1Q2SA 3THUA 1I2RA 4G1KA 4XZNX 4DBEA 1QTWA 1ESWA 2NT1A 3MVIA 4WKAA 3WLIA 3UESA 4IPJA 3TNOA 4TV6A 4GUHA 3BCDA 6A3HA 1WYIA 2QV5A 3O6YX 4CLMA 2EXOA 1ZB5A 5MF5A 1GYMA 1XIHA 8RUCA 1QK0A 4PODA 4ZTXA 4PUJA 4QLKA 3PZGA 3I6EA 3RYSA 1MWOA 5CC5A 2P76A 4QNWA 4WVXA 3O2LA 2XZ7A 1ZJIA 2HVOA 2V30A 3VDAA 1KA9F 1QPOA 1CBGA 3DGRA 4CU8A 3TAOA 2WMKA 3ZJ6A 1XH1A 2CBIA 2XH4A 2DORA 4B3KA 5C0QA 2XM2A 3GUWA 4HPNA 3V35A 4LNYA 1WXJA 3HF3A 2XIJA 4BWLA 3GC2A 4DWSD 3G1RA 1WCGA 3CM4A 4Z1AA 1UD2A 3BSMA 2OEJA 5FEWA 1LRTA 3BOLA 2ALRA 4BCEA 1S2TA 1RBLA 3DEQA 2Z29A 2CHOA 2PU0A 1MI3A 5I06A 2JK2A 3SDOA 1OCBA 1OGSA 2OX4A 4IICA 4Q7BA 2XDFA 4AY1A 3MDUA 1KBKA 1S5MA 1GOKA 1TJ1A 4JPGA 3ZJKA 4HPGA 3G1HA 5FAGA 3P7YA 4PMXA 1WKFA 2POTA 3CL6A 3WF4A 3URAA 1VRDA 4GRSA 4UQAA 1V6YA 3PB0A 1PZ0A 4MZYA 2GVGA 2C16A 3QHMA 4WK9A 2XGBA 3T07A 5T26A 5KZEA 1D2KA 5AYXA 5C9XA 2C1GA 4GQGA 5AFDA 2CLHA 1XD0A 1O6IA 7TIMA 4H7ZA 4PMUA 1ZBKA 2F38A 4NJKA 2GSJA 4I5UA 3I3BA 3KL3A 4BKNA 4ZO9A 4D8LA 3WNOA 4OOUA 1EQPA 2OZ0A 1CT5A 1BLIA 2QW5A 4LF2A 1BYBA 2AL2A 1XIGA 3OA3A 3QY8A 4ATDA 2J7CA 1FRBA 3RITA 2BTMA 3F5LA 2PLCA 4E3TA 1M9HA 4AYGA 1F3WA 1E6XM 3KTSA 2YOCA 4DZHA 1E6PA 2V3EA 4MOZA 1OC7A 4R9XA 4ONVA 1W37A 2X1IA 1TE1A 4PRRA 4ZCWA 1VEMA 4JCMA 3MVTA 1KB3A 4GVFA 2R94A 4OBSA 5I07A 4JX4A 1R2SA 1JXJA 4L4LA 3RO6A 2A3HA 3B0UX 1QASA 1MRQA 3AMLA 2AQVA 1GW1A 3NOYA 2VWTA 3WDJA 5BU9A 4G9PA 1FVPA 3MUZ1 2A3CA 3HGOA 1RALA 4S3FA 4KS0A 1XLFA 2VZUA 3UA3A 4IFKA 4E8CA 5AYYA 4RE2A 4YXGA 1VBHA 2GOUA 4BEUA 3S5SA 1OX6A 5EPDA 3WQGA 3VIJA 1V0NA 1D7FA 4N0RA 4NP7A 1DJIA 3VD9A 3W71A 2PGFA 2EG7A 3C2EA 4PRWA 2WNWA 4O4VA 2NSXA 1EOKA 3LGEA 4MJ2A 3U5UA 1UKOA 3WJYA 1X7FA 4CQ9A 2BOGX 4GD0A 5C9UA 2DSKA 1J4EA 2PDXA 3W88A 4QCEA 2UV8G 4PUKA 4B5TA 1LUCB 3GTHA 4OOZA 3SY8A 2X30A 4GE8A 1KLZA 2OB3A 3WMBA 4O8AA 3SIMA 1Q7MA 1UMYA 3WZ0E 4MB4A 3H26A 1JCTA 1GG1A 4WD0A 1FWDC 4PCFA 4IWWA 3V3WA 4FO4A 4B90A 1KGXA 3WH5A 3MB9A 2W61A 1E3ZA 2D1ZA 4DPPA 4PE8A 4AVOA 5HJXA 3V0TA 4ERIA 2VFHA 1C9DA 2CW6A 3AISA 4CQAA 1P1XA 3UVIA 1O95A 3J7HA 4CCZA 2VZVA 3TP4A 3NQCA 3WD0A 3DHDA 1K7FA 4HOZA 4BQ5A 3C0QA 5CBIA 1RP9A 1Z42A 1KTCA 5BYWA 5CCZA 3ARUA 2P8BA 1GVSA 1W1ZA 2BWGA 4PCTA 1XYLA 1AL7A 3QZAA 1OIMA 4P5UA 4ZGYA 1CTNA 2Y24A 3FXYA 3NPXA 4TX9A 3GXPA 2Z6JA 1XLEA 2FZNA 3PUEA 4ZOEA 1TTQA 4HVXA 3U0HA 1R9XA 1M53A 1C3FA 3W6LA 1UP2A 4XWUA 3N4AA 5BROA 1YADA 1RHCA 4V27A 2BHYA 1VFOA 3CO4A 3NVDA 1EIXA 3HFYA 4B4FA 1K7XA 3MP3A 2FKPA 3VGFA 4C5YA 3TH6A 3MP5A 3K8MA 4YVPA 3VIMA 3B0XA 4PMZA 5AYZA 2YA1A 1LUCA 3K1DA 1EJVC 3B8IA 3W07A 3ENLA 1JZ2A 1MQPA 2J7BA 4WR3A 4XIMA 2GVJA 3P6LA 3QMRA 4AX6A 2QVHA 4FR1A 1OM0A 4UOJA 2C0HA 3TC7A 3NQ6A 3LLDA 3N2CA 4ZE5A 4UWMA 1VCFA 1OFEA 7CGTA 3ZLHA 4G5DA 2W6RA 1G5AA 2PDLA 1GOOA 2VR5A 3M9YA 3IJIA 1XH2A 2GWNA 3FFSA 4H01A 1IXPA 1B3OA 1XPGA 5LKYA 8CGTA 4GVGA 5I6SA 3GHTA 4XZLX 4XX6A 3MSDA 1J0HA 1K6AA 3TQKA 3VFCA 3GG8A 4NUWA 1PTAA 4TV5A 5I3DA 1E55A 5JH1A 1EF2A 4HPHA 5LIKX 4FK9A 3R1ZA 4NJHA 2ZZ3A 1XF0A 3BICA 3MCNA 3D5HA 4OE7A 3RM4A 1I8JA 3KZSA 1J79A 1BF2A 1TB3A 1ITCA 4IHCA 3W4RA 4YTTA 4F0RA 4ECLA 4UQEA 3VE9A 3IJ6A 4D6HA 3PZIA 1KO0A 4X3ZA 1HG3A 2GL5A 1QI2A 1H7NA 4NZ3A 4GQ0A 3PK7A 1VJIA 9CGTA 1F9CA 4M82A 1DIDA 2PODA 3IANA 1D9EA 3AXMA 5HQLA 4L6DA 2I5QA 3RRXA 4AIBA 1SR9A 4WQ6A 3IGUA 4S38A 3SQMA 4JN8A 3WBWA 3WNPA 1JPMA 3E6EA 5H91A 1Q85A 4CQBA 2P3ZA 2IKIA 2ZRWA 1KC7A 1JAEA 4C1LA 4HZ7A 4ACZB 1X6LA 2RJGA 2GZXA 3QMSA 4MVAA 4CNPA 1V5XA 3G8RA 3EOLA 5ABEA 3UZZA 3W82A 4J3XA 3P0WA 5HNUA 3BLKA 3Q58A 2PPGA 3LCHA 3E5PA 3WMCA 1EX1A 3HFTA 1ADOA 3O0FA 1XR2A 2OYLA 2QXWA 2BY0A 1QBAA 1PO9A 5G1TA 4FB7A 4XO7A 5KMYA 1GTHA 3FSUA 4YIWA 3QQ1A 1NARA 1EBGA 2GJXA 1S46A 1H0GA 4TMBA 3MKVA 3FKRA 4LS1A 3CPRA 3SCVA 4R34A 1E9YB 3IIZA 3H70A 1BTMA 3MC5A 4ML9A 4U3AA 5AVHA 3S5ZA 2NSOA 1W31A 1K3UA 2BVWA 1P7TA 2G50A 3STPA 4HPXA 3BLFA 5C9RA 3PPGA 3RLGA 4RZ4A 1WZAA 3O6AA 3TDFA 4NZ1A 3W2LA 5CGMA 3OG2A 3EPNA 4MDPA 1PVNA 3GE7A 3W2MA 1FUYA 4M81A 1B3YA 2CBUA 5DXYA 3GRIA 4QEEA 3RR4A 2Y7GA 2Q3OA 1OYAA 3IIXA 5D03A 4O0ZA 1WO2A 3QLDA 3IK2A 4FMVA 3WNLA 4HMDA 2YCLB 3AIQA 4AD0A 3THQA 3VMPA 2CZFA 4W8AA 2O55A 5A2BA 2I16A 3MV01 4YN5A 1Q6QA 3UPMA 4A2SA 1A5LC 3RHGA 1BVZA 1TZZA 3T8QA 1W5MA 2D73A 4GGBA 3W7PA 3W1AA 3S5OA 2OG9A 3CQKA 3W29A 3C0LA 4HOWA 2VZOA 3AHYA 3NEHA 4EF8A 3N3TA 3N25A 5FI8A 1PCWA 2AQWA 3MPGA 5C2CA 3VDBA 1WDPA 3DFSA 2L5HA 3GNDA 2ISSA 1FX6A 4NNAA 1NQKA 4H6KA 4AFYA 3TQVA 2WMIB 3W02A 4DYJA 2PSNA 2VCAA 1EPXA 3PG8A 1VPXA 3DBPA 1G69A 2RFGA 4YTQA 2W27A 4DBSA 3I7SA 1R47A 1SO6A 4ZOBA 4JTTA 4TVUA 1XIJA 1HKIA 2HK1A 2Q3RA 3DC0A 1V3MA 3KLKA 2WPGA 1FWIC 1KTBA 2GWGA 3NQEA 4AH7A 4YJ5A 4WIWA 3WLTA 1WXZA 4MF4A 3GVVA 1J6OA 1TVPA 3QF0A 4XIAA 1W2VA 4RX0A 1P0BA 4W5UA 1PKMA 1NEYA 3KRUA 3QVQA 3MMUA 4W9TA 1EDTA 2HE5A 1J10A 1LZOA 1V08A 5A6LA 3NSNA 4LTSA 4MJMA 3W00A 1HGWA 3JR2A 4JS3A 3G1AA 1XM3A 3ZVHA 3GR8A 2HISA 3CS2A 2PGRA 3PUOA 1MUMA 1VD6A 1B9ZA 3LB0A 4NI8A 3H6OA 3GS6A 3PWAA 4JZ5A 4O0QA 2DUAA 2C1HA 1LL6A 5EY5A 3YPIA 4FOKA 3ITVA 3R11A 2YL8A 3AZTA 1JI1A 4IX0A 3T0DA 2PDWA 4ORMA 3WD3A 1UWUA 1M3UA 2CITA 1BPLB 1RLDA 5AC5A 1Y8BA 3GDMA 1MXDA 1OEPA 4A4AA 4FNTA 3NUKA 4A22A 3IUHA 2XH0A 3LI0A 3CNYA 3A24A 3PBMA 1O1ZA 2NLIA 1DXIA 1G7VA 1PWMA 4DO7A 5LIYX 2Y5JA 2VM8A 3HPXA 4RL3A 5FEZA 3HQOA 2VC5A 2XVLA 3NQMA 4WLCA 5TF0A 4O14A 3LNMA 5F1UA 5ABFA 4H2HA 2DY3A 3PFMA 4KWUA 4FNUA 4KT2A 1VJSA 4W88A 3FJNA 3N2XA 4IMCA 3GH5A 1O5KA 3PB2A 3WIJA 4CQDA 2GJPA 4N6EA 5J8LA 5K4ZA 3NM3A 1YTKA 1EF3A 1RY8A 1LQ0A 1CCWB 3NQDA 3QOKA 1A0CA 3N15A 2PTXA 1JRBA 2FHBA 3UPBA 3OW1A 2XSAA 2VVNA 1PS9A 4UTTA 1ZGDA 3L68A 3H2MA 4TOQA 1XSJA 2G95A 2PDGA 4MB3A 4O18A 4PTVA 3H55A 4ZODA 3H21A 3DU0A 3VINA 1XBZA 1J8VA 3T0TA 1HW6A 3R7MA 2HNHA 3FGCB 2D0GA 1C29A 3CZGA 4K36A 3ARZA 4L9XA 1C8VA 4GWEA 3W70A 1WOBA 1JDDA 2ZXQA 3MBDA 4L6OA 2Y0FA 3WJXA 4PBEA 3P8JA 3ZWTA 4H9TA 4I8YA 3O15A 1W5NA 4Z1BA 3IRDA 5E0FA 4UMBA 5D04C 5JBEA 1Q3NA 3OQEA 2E67A 3S5NA 3VOJA 3LX9A 4DN1A 3AU6A 4C7FA 3L7RA 3DG6A 2G4FA 1RJQA 1DYSA 3CAQA 3OU8A 1LBLA 4Q4SA 3VM5A 3IJQA 1M7XA 4J3UA 3VGHA 2R82A 1H7RA 4HHHA 4LEFA 1MNZA 4N7QA 5D33A 3W81A 1IT0A 4MPQA 1Q45A 5HANA 1QU4A 3BMVA 1E3XA 3K13A 4K39A 3M5YA 3NFUA 3NQ7A 1FDZA 5TD4A 1JNDA 2HE8A 3T2OA 3DIPA 2EHHA 1QATA 4GX9A 1X8CA 3B04A 4P2VA 3UWYA 3KL5A 3AC0A 4LVDA 3QMTA 3EYPA 3R79A 4B5XA 3MCMA 2W5FA 3VCNA 3WK0A 3FXGA 3VNYA 1KM5A 5LXEA 2NQZA 5B7YA 3CO8A 3HOJA 3MV11 3ZR5A 5AC8A 4JR5A 3P93A 2PDKA 1GVYA 4GUIA 2VRQA 5CJNA 1W9VA 3LBOA 2BFGA 3OYZA 1JI2A 4GUJA 5IDZA 4ENLA 1N55A 4ZSUA 3VC5A 3PZNA 2ZWZA 3FCPA 1V6VA 3V1PA 1SW0A 1YE6A 4ERAA 3MUXA 1FXQA 5A2AA 2OZTA 3CV2A 3FJ6A 1KBIA 3RCNA 1BTCA 4DF2A 2QJNA 5JBDA 3DI0A 3ZR4A 3FY1A 4Q8UA 2B7NA 3CTTA 1E6ZA 4HTYA 3MT1A 4R53A 3SJ3A 4HSNA 5A1AA 1Z48A 4S3GA 3B0YA 4W89A 5CZSA 3ZJ8A 3SY1A 4QNEA 5CH9A 3TMQA 1VLIA 1UJQA 1VEOA 3C8NA 3EXRA 4M1BA 3FAWA 1GVOA 4ZO7A 3WK1A 1AJ2A 1NELA 4HMCA 4GNVA 1QW8A 3G6LA 4HN8A 2CEQA 3IJ9A 2ABBA 3W85A 2ZUVA 4RKAA 2RDUA 2NQJA 3BARA 4W86A 4IIHA 1JF6A 1XYMA 3E0WA 5FF2A 5DCBA 2NQ5A 4ZO6A 2ZX6A 5G1YA 4X2RA 4A8IA 4RNFA 2VL4A 4O1CA 4F66A 3SCUA 5IHRA 3IV3A 1PUDA 1K03A 3LRLA 1EJWC 3RU8X 3IGXA 5G2WA 5E0CA 3N6QA 3K30A 4D71A 3UR8A 1JZ6A 2BB0A 1UHVA 1NDZA 4PH6A 1ZRQA 1TJRA 3GNOA 3GZAA 5DELA 1ZUAX 1LT7A 2PDUA 1EA9C 3VIIA 5FJJA 1F2JA 2XN2A 1XLDA 4CVUA 1YNQA 4BF9A 5AHIA 1FDJA 1TV8A 4IJCA 2QKFA 1P6BA 3DFYA 2C91A 1B3ZA 5BRQA 4ALDA 1F3XA 2DQXA 5REQA 1JDAA 4B5SA 3U6WA 4UTLA 2ZCGA 1KGUA 5D2XA 4L5ZA 4ZSTA 4M3PA 4NILA 2EG6A 3QSRA 1LBFA 2CKRA 2TODA 4X0VA 2BOEX 3N14A 1F07A 2DP3A 4TMCA 3MO4A 3TYCA 1H1YA 1E51A 2BHZA 2PDPA 4MADA 4OHQA 1CDGA 4JTGA 2WLZA 4P7NA 3V5CA 4WUIA 2R14A 3KRZA 2X40A 3P8IA 1DJYA 4DNHA 4UFHA 5C2XA 4KESA 3EWCA 1IEWA 1KQZA 2CLEA 5KZ6A 2CBVA 4NT0A 2NXHA 3W86A 2BXVA 3AYTA 4DAIA 5C54A 1Q4WA 3IGHX 1GHRA 1I2NA 7REQA 4B4HA 1JCXA 1M03A 5DMMA 4UCGA 1TWDA 2ZUSA 3ZR6A 3NQ8A 4QEHA 4TVCA 1PDZA 4JFUA 4IMGA 3ANVA 5MKGA 4PB5A 2XSXA 1W3NA 4QDMA 4KGLA 4MIMA 4GNJA 3OODA 1RP8A 4Q8OA 4B3ZA 3NQGA 1XIDA 4NAFA 4IIDA 1GONA 1DWFM 1M7JA 1TV2A 3WLSA 3QEZA 1DP0A 3G18A 5GNZA 4KCWA 3O6DA 1V6UA 1WZMA 4KEZA 4UTMA 3BLOA 4QBXA 2Y7DA 2VP8A 3PTMA 4WKFA 4E2BA 1AZ2A 4Q8WA 3W7CA 2WQPA 1V77A 4RCXA 4GIEA 1IE7C 3NR0A 5GVJA 3VX0A 5CEWA 4U31A 4JTSA 4K1GA 1LQ2A 3O05A 2WHKA 5G4EA 1RPXA 1AJ0A 4FF7A 1JD9A 3DHFA 3GDLA 1RCQA 1J2WA 3ABSA 4L4PA 1QXLA 3M07A 2Y8KA 2KZHA 3SCRA 5EGRA 3E0LA 4DJFA 4RW5A 1A5KC 1GNXA 2P0IA 1AQMA 3O7UA 4LNCA 2KAUC 2ZFAA 3CAVA 3SCSA 3WNMA 4B91A 3BZJA 4CD4A 3BMWA 1RAKA 5H1WA 2Z1KA 1R38A 3MJMA 4ZVJA 3OTRA 1PX8A 1A5AA 3AFBA 3VIFA 1O12A 1KM2A 4A21A 1TIMA 3TVAA 3WLLA 3KZPA 2RGMA 1VHNA 3CQJA 2PRLA 1YX1A 4IMFA 5I79A 5LIUX 4H8NA 3OA5A 5EA9A 3VO0A 3IWPA 3L2MA 3BURA 4GYKA 8XIMA 2PGWA 3PY2A 1OINA 1JZ3A 4G6CA 3VGEA 3WBYA 4MKVA 4V1XA 4JNMA 1ZZMA 2V81A 2XYLA 5F4XA 5E1QA 4MYAA 3MQTA 3IIVA 2O9TA 2PP3A 1XIIA 4GQBA 4W4QA 2PDHA 3VNJA 4DJFC 5G2HA 2IW0A 4S3DA 4HCLA 1KFBA 3GTFA 2EQDA 1YXDA 1I2OA 1ZLPA 4IG2B 3EEZA 1B5TA 3TSDA 4AX7A 4MNMA 5E6YA 4PTDA 1JRCA 1B30A 5A95A 2Z1WA 5JIWA 4LANA 3KCOA 3G1SA 4YMZA 1K9TA 4S1FA 2FDMA 1T96A 4L9YA 2DZBA 1G1YA 2W9MA 1XDLA 4I3GA 3VOIA 1FH9A 1I75A 2G4JA 1DWJM 2GUYA 1OD0A 4DPQA 4C6QA 5JU6A 1JXKA 3GDRA 3C4UA 4ZB2A 4K38A 3DFNA 3SO7A 2OO6A 4IL2A 2CYGA 1XIEA 1RR2A 4GO9A 4FEZA 3TC3A 1GG0A 1GOMA 4BI6A 3OLIA 5CJ5A 4LH8A 1ICSA 5TAOA 3LGGA 2VOMA 2QGHA 3TWAA 2GDVA 1CXEA 3EMZA 1GUVA 2XG9A 5AYIA 1AW5A 4CU6A 5U7SA 4F3HA 3N2TA 4WZHA 3A4AA 1Q63A 3QR3A 3KL0A 5I2UA 4QDPA 1S39A 4UOQA 1KBLA 3UERA 3WEMA 1WKDA 4N9BA 1EA0A 5CPTA 1AL8A 4AZIA 4OFCA 1TWSA 1IWBA 3TUUA 3EMCA 1NP2A 2A7PA 4L80A 3C2OA 1BAGA 4UTTC 4EOUA 4URIA 4LAUA 3AJ7A 3S2NA 3WCZA 2NWSA 1KXQA 4DXKA 1E43A 5CC3A 5JQ9A 1RJPA 4LAKA 4O8RA 1VIZA 3M0YA 3WELA 2QQ6A 3LZ3A 1PWLA 4AZ7A 1AUSL 4FXFA 1QDSA 2FTYA 3EDDA 3LCWA 1XKYA 1VIWA 7TAAA 4IFOA 3WH7A 2YDSA 5D8ZA 2BNJA 3SGGA 4D6JA 2BGQA 3CK5A 5ENLA 1M68A 4OUIA 2C7FA 4S3JA 1NWSA 5A6AA 3TQ0A 3FS2A 1XW8A 1GZ1A 3NTYA 1UWTA 1VC4A 2F2KA 1W3HA 1F6KA 4KGJA 4Z1CA 3SUVA 3E0VA 3W2JA 2CLIA 5EB8A 3SCNA 4S23A 3NEVA 2J75A 2WHMA 3A3WA 3QZ6A 5M5DA 4NZCA 2D3NA 2FVKA 2CPUA 4L61A 3WKZA 4QQUA 1W5OA 3R43A 1WA3A 4F40A 1CI1A 4EAYA 4D6EA 1WAUA 3V0SA 1B54A 4QLLA 2FIQA 3HGRA 5I09A 3F2DA 5BOFA 4REQA 4LJ3A 3A13A 4NAFB 2VRKA 3S9ZA 4AVNA 1CPUA 4DYEA 3AMKA 1KM6A 2BDQA 1JD7A 3BQ6A 1L8PA 4M56A 3EDKA 2CZDA 2Y88A 5MKGB 3EB4A 3CAWA 4E2VA 4N42A 4IQDA 3H54A 2DUZA 4DEFA 3WNNA 1GYNA 3CH9A 3Q37A 5CPQA 3WL0A 3NSXA 4FLSA 8XIAA 3QYQA 4WXYA 4BQ2A 5D2TA 3FN9A 3QSTA 3ORWA 3LCFA 4JY9A 5MHBA 3KBWA 2OOGA 1DPMA 2VFGA 4PEEA 2VI0A 2MUCA 5AYBA 3N29A 4AZCB 2ZZ1A 4QJ4B 3WD4A 3GDBA 1EHNA 1XRVA 2VQTA 5FJTA 1AQFA 3AHZA 1B3WA 3DFPA 5BRBA 1TPUA 1V79A 2XN1A 5XIMA 3VKKA 2E0PA 3C2VA 4Q6XA 1FH7A 3F1QA 1VFUA 2E6FA 5I24A 2VJXA 4KCVA 1V6XA 3MDWA 3XIMA 5FSEC 3S0CA 2E8ZA 1JDCA 3RUBL 4R5EA 1QO5A 1PXGA 5HR7A 3INPA 1AD1A 1A5OC 1OGGA 3H8AA 2FPTA 2V3FA 4GJJA 5XINA 1WDRA 1F73A 2E9LA 2PAJA 1UP0A 5IBXA 3UPWA 4HHMA 1ZAIA 3TA9A 3N9SA 1I4NA 1QNVA 4N4PA 4GYPC 1MQRA 5C55A 1KQYA 4YCOA 2IXUA 2Y8UA 1L9WA 3HQPA 1C8QA 4UTHA 1D8WA 2ZRUA 3GXDA 3M0XA 3KE0A 4AWEA 1F3TA 2FTWA 1FWTA 2PWEA 1UBPC 4WHBA 5HMDA 2ZZ4A 3WJWA 2EF9A 2Y85A 4JD4A 5LXXA 1W6TA 1XGZA 1KGWA 4O54A 3O63A 4DI9A 1WAWA 1JFXA 3HPAA 4GQRA 1DJZA 5FJRA 1ZNNA 5EKYA 5KTLA 2GGHA 3D3AA 2IPJA 3NZRA 3CZ8A 2Q8XA 3THAA 1TPVA 3DI1A 3BG3A 1ZFJA 3FVMA 1HJSA 4AISA 4XBJA 3TN4A 5I0DA 1H1NA 3BV7A 1H2JA 1HJQA 1TMHA 1W5PA 4NRSA 5AHFA 5GQBA 3L66A 3RGTA 3DFHA 2I5IA 1Q6LA 2FDSA 3S8HA 4PUDA 5DT5A 4Z2KA 2QLYA 3UY7A 3RAOA 1LTDA 1MRAA 1XQKA 1JUEA 2J7DA 4W5ZA 4OECA 3K1GA 2OWWA 5F2GA 2GDUA 1K8YA 1M41A 4E6MA 3NQBA 1DWHM 3QQWA 2ZE0A 4K1WA 2ZC1A 1TJ0A 1KWKA 3AIUA 1MZHA 1UB3A 4K37A 1XYFA 4AD2A 2W0UA 3D6NA 4UFLA 3QC0A 1RUSA 3AMDA 4GXMA 4P8WA 5FJUA 2OZ8A 3M4HA 2QJMA 4OJYA 4GJIA 5CBJA 1VCVA 4WOQA 2PD5A 3KCLA 3S5YA 2XUCA 2DGAA 4NL1A 2DJXA 4CKQA 3HPFA 3SEPA 2Z2UA 5H8PA 4GJ1A 4KWOA 4LYKA 1C8XA 1FHDA 1WNOA 4H7CA 3CMFA 3G1VA 2EPNA 5DCDA 1YEYA 1CEOA 1TPB1 2TMDA 1FWFC 2DSUA 3NPWA 1ZHAA 1IWPA 3CPGA 4RDWA 1GHSA 4A29A 1FFRA 2XFWA 4ADSA 1DJGA 3SCOA 1ISYA 1TTPA 3C2RA 5J5RA 4S39A 2J77A 2VFFA 3D3FA 1G01A 3EB2A 2WXDM 1TR9A 3OBAA 1RXOB 2H6RA 3FDKA 4J3VA 1HKJA 2DZWA 2X7VA 1U5VA 1G0CA 3G24A 4J35A 3GIYA 2WMJA 3E38A 4NYYA 3FW6A 1H7PA 1T8QA 3BANA 2BG5A 1QNOA 2PC4A 1JZ4A 3TTEA 2IXVA 6PTDA 3EKZA 4ZZ9A 4DQWA 3WLQA 3W28A 1Q6OA 4KIRA 4NU7A 5H8UA 3QM3A 1XYBA 2Q8LA 4V15A 4YTUA 2VX7A 3C61A 4NVTA 3RX4A 4PUEA 5E5CA 1OABA 1TPC1 3BVJA 4JL2A 3B8VA 4WCJA 3PANA 4JIIX 2ZDRA 3K8KA 3QHNA 4Q4MA 1PE1A 2MNRA 2A3BA 3E74A 1K9DA 3OPSA 5BXRA 3G1FA 4P7OA 4LV9A 2QF8A 3UWEA 4NY2A 1T41A 1QBBA 4GZ7A 8A3HA 5I02A 4ADTA 4A35A 4DI8A 1LG1A 4MWAA 1TSIA 2BASA 2XISA 1GZGA 3KWSA 3AIVA 1YPIA 3LM3A 4NZ4A 2DPEA 1IEQA 2NXGA 3FGCA 1H11A 1RV8A 4DUWA 3HG4A 3GLCA 3E9AA 4NI3A 3NL6A 3ITGA 5A8PA 2E6YA 4CQ8A 3B9EA 4W93A 4IFRA 4JYDA 1GVFA 3WN6A 4YL2A 3U9IA 1FXPA 4XTIA 2GDQA 4FF5A 5KEZA 4QS6A 4DF0A 3HG5A 1X96A 1OK6A 5EMLA 1QPNA 3QKEA 4HP5A 4FAMA 4LC8A 2A0NA 3AUOA 1KM4A 3T40A 1HJXA 3U57A 3UR5A 4XKYA 3CUHA 1UC4A 3VUSA 4HIBA 4F2UA 2UY5A 3B8DA 4DUXA 3LPOA 2ZXAA 7PTDA 3CTLA 3L5LA 4JQ2A 1UQZA 4S3CA 4EF9A 1U30A 3FV9A 1SW3A 3GQYA 3ITCA 1OK4A 1X1NA 3MU7A 1PHWA 2QUNA 5K2ZA 1J12A 2WVVA 4RW3A 1UWQA 2WC4A 1TREA 2GVEA 1T8XA 4YVXA 3TFCA 4L1GA 2OQYA 1E4NA 2V3GA 3SN0A 2SFPA 3NAVA 1F05A 4CEUC 3B05A 3SN4A 3SGZA 1XBVA 1MFVA 1J9YA 4GC4A 4Q8PA 1VBGA 5JMUA 4DX3A 2YCIX 4DM1A 5LZLA 1YBQA 4GACA 4QTGA 4H8HA 5C5YA 2O4MA 4OBRA 3KOYA 3N18A 1EUAA 1TR1A 2X05A 2Y8VA 5HMFA 1TV5A 1NDYA 2C14A 3GU1A 3GUGA 3S1XA 1EBHA 3ZVHB 3ECQA 2QMKA 3UGVA 2D3LA 3V1HA 3GU2A 2FFIA 4LUTB 2X41A 3SSZA 1XLAA 1C93A 1W1PA 1YPFA 1A5BA 2NLYA 3FDGA 3TJLA 1YXCA 3C8FA 3OP2A 1JQVA 1XLBA 3L0NA 1V7YA 1VB9A 3EX1A 3VABA 3V16A 1IXOA 3Q4DA 1OBAA 4HHLA 1CXKA 4H41A 1ICQA 3FOKA 3VNIA 5CXPA 1S2UA 1UWAA 2QCCA 2R24A 2WSRA 4NX5A 2PZ0A 3AOFA 3BMXA 4MM1A 1LWHA 3SFKA 4QXIA 1RQEA 2YL9A 3CIXA 3L2IA 3KLLA 1U1JA 1UG6A 3GNPA 1XG3A 2Z28A 2J8FA 3ZO9A 1HFBA 3WUEA 3R0KA 1D8CA 1EZ2A 3PAJA 2RHGA 2WNQA 1Y65A 4KH2A 2A7RA 4ES4A 4JTCA 3CHVA 2YBVA 3RFAA 3WX7A 1HL2A 1JPDX 4ATLA 1KXVA 2DFAA 1WKYA 5DY3A 1GJUA 1W8GA 4YPJA 4QX4A 1PKYA 3B4UA 3LPGA 4YWIA 3FX4A 4LEQA 2ADAA 2E5BA 3LENA 3IVTA 1FY6A 2E9MA 1MO0A 3G1DA 4FLQA 2QUVA 4MB1A 5ECUA 4ZR8A 1Q6GA 2PBGA 2Z7KA 2DW6A 1QOQA 1EJTC 1UD6A 3KXQA 3W1PA 2J24A 3P62A 3WLJA 4GBUA 3PTKA 4J3SA 3CUXA 3UGRA 4US6A 4UTJA 4R7OA 3HGJA 2YCLA 4ZEPA 4FIRA 2I57A 2VDGA 4EX4A 1ISVA 1GKRA 1PTGA 3O0KA 3VD7A 3BL3A 1L6FA 1F5ZA 1KNWA 2BS9A 2AMGA 1AJZA 1HZYA 5E9AA 2Y70A 4LCQA 4N02A 3IJDA 1EH9A 3WLNA 2QEZA 1NH6A 3H7RA 2TAAA 3A6OA 3TNBA 3TTQA 3WFAA 2WJFA 4RE3A 4DY1A 2XHYA 3QH2A 4C7GA 3B3DA 4L65A 4OV4A 1W1YA 1W8SA 4F9DA 2FH8A 2ISWA 3OZMA 3ITXA 4US5D 4LVGA 2XFFA 4U33A 1E0UA 3QW3A 4M24A 1PDYA 4V2XA 1JEZA 3G6MA 1AZ1A 4WDUA 1SR0A 3F4CA 3I3EA 1EJ7L 4P7LA 5IM51 4IUGA 4AHOA 3W72A 3G0XA 2GYIA 2GJXB 3B4YA 1IZCA 4RNIA 2QJHA 1JIBA 1JQXA 4TXEA 1PIGA 2G41A 4P8XA 1SZNA 3H2EA 5A8QA 4AY7A 2WZIA 4I9JA 2QJJA 3GNXA 1CIUA 3M7WA 1QK2A 2NUYA 3UNTA 1DVJA 3H4WA 1NU5A 1OFAA 2A7NA 3HQ1A 1WUEA 2C15A 5CZKA 4JFTA 5JVLA 4Q22A 3VILA 2PWGA 3SBFA 1SW7A 4TIMA 2GSEA 3PZVA 1XRFA 4BQ4A 3PJWA 3GG0A 3SECA 3M7SA 2HZGA 4UZUA 1W3KA 3HM7A 4DBDA 4BEQA 1R3WA 3H22A 2FGZA 3T0BA 2P1FA 1UUOA 1H7WA 3PHAA 1PEZA 2BZNA 4C60A 4DUOA 1BSIA 2IPGA 2R9RA 1AH4A 3NL2A 1WDSA 4M29A 4W8LA 2PTDA 4C6PA 3BV4A 2YZ5A 3BAJA 2PDQA 4JIQA 1RPKA 3QGVA 1BWVA 3D46A 3G3DA 2YYUA 3CIVA 4L1WA 4EE9A 1GQJA 3WFZA 5I5RA 1X39A 1Y5VA 2VTFA 3DENA 4U2ZA 4A8RA 4DM2A 3R12A 1QNRA 3MHFA 5I03A 3ZOAA 3BXWA 4LWWA 1UR2A 3WH8A 1TWIA 4HA3A 3V7PA 4HB7A 2KX9A 2WVUA 3N6HA 2O9PA 3ICJA 4X9SA 2Z4GA 2G3MA 2FQIA 4CQCA 3UT0A 2EPLX 5F2IA 3OJGA 1XP3A 4AZBA 4JHOA 2ZWYA 1E6RA 2H3BA 1HUVA 1VZWA 3LN3A 4O1DA 2PB1A 2WVTA 3NNTA 4J4KA 2RGLA 1HKKA 3S4TA 4HPJA 1WUFA 5DCEA 3VX1A 5A8OA 4S3BA 3C2YA 1NWRA 1S1RA 1Q6RA 3HIJA 4JDYA 5HWNA 3KS5A 3N2OA 4JQ4A 1TTIA 4AC7C 3VCCA 1HNYA 3KP0A 1CGXA 3NQ2A 3TYZA 3T6CA 4AU0A 4NF7A 2WSYA 3LZ5A 4Q8NA 1PAMA 4ZE4A 2OLHA 2XWEA 1HL8A 4AWUA 1P6CA 5GJPA 3TJ4A 3QQ0A 2I56A 1TA3A 3F2CA 3TJXA 1V3IA 3CH0A 1JGMA 1Q2RA 1S2CA 3LYEA 1VYSX 3EDJA 3SRKA 4P7RA 5EFDA 3AS1A 2Z2AA 2WZEA 1F8IA 3HBLA 2JIEA 3LA4A 1RBOB 2O56A 5BMWA 3L5AA 5EYWA 2ZUUA 2FZDA 3ARRA 3G22A 4JKKA 4V33A 2VEKA 2Y1HA 5JBFA 4GKTA 3W23A 3NVTA 4JCLA 2PDMA 3GBEA 4O52A 3VKCA 3BWWA 2PF0A 1EO7A 5IOBA 1N8WA 5EMMA 1YMYA 4HNTA 2C71A 3MYPA 2G3NA 1O5XA 4UTFA 1XUUA 2GPTA 2O0TA 3REQA 3OHMB 1H5YA 6REQB 8TIMA 3KAOA 2HV5A 3GNRA 3N73A 3NGJA 4ZB0A 1EZWA 1K9EA 5CPNA 4BQ3A 4OVXA 2NQLA 4QLJA 4LY4A 4W84A 1G4EA 4TR9A 3M46A 2HWGA 1YNPA 3P74A 2PF8A 3APTA 3T9PA 1KM0A 5AOUA 2XGZA 1QMLA 2F8QA 3G2GA 1IR1A 1BWKA 4FPSA 5HR6A 2X2GA 1OG6A 4UFKA 1DJNA 1B1YA 5CKSA 4XBKA 5CG7A 3O1NA 3W7JA 3W9ZA 2WBKA 3N19B 3I4KA 1AFSA 5CSUA 1TTJA 3LMZA 2OT0A 3VDGA 4UQBA 1W91A 2OMAA 4FXRA 4UTUA 2INZA 2QR6A 3N3MA 1H63A 1E1FA 2VWSA 3BLPX 1IF2A 2PP1A 2PS2A 1BWLA 3W1NA 1ZAHA 2Y63A 2V67A 4MYXA 2PDFA 1EQCA 1VYPX 3BZGA 4LUJA 4M6UA 4RE4A 2E9BA 4MWAB 2HEJA 2GOKA 4XVDA 3VIOA 5BOEA 2QULA 2FHFA 4UR8A 4CD6A 3NQVA 3B8UA 3RILA 2Q09A 2RH9A 2FJUB 2G3JA 4K7VA 2OLSA 1CW2A 1IGWA 5FJOA 4U4MA 3N1AA 4MHBA 4DVOA 2IPFA 5AZ0A 2D2JA 2D24A 1SMDA 2FZBA 1L6WA 3G1XA 4JTFA 3ZSSA 3KX6A 2O7QA 2AQOA 1Q65A 1OFOA 1T99A 2ZQ0A 2P10A 1L2UA 3H4GA 4E38A 3MZNA 4CCDA 3UJSA 3CMGA 3W1UA 1GQIA 1FWWA 3S2LA 4RR4A 2FB2A 4LYRA 1TO3A 1M6JA 3HURA 5CGTA 1CLKA 2I7GA 3PBUA 4FP1A 1DTUA 3FYOA 3LPPA 3T08A 1UKPA 3P0XA 3MP4A 5HINA 4WX2A 2BGSA 3JZEA 2HXTA 3M0VA 5AHMA 4J28A 1KFJA 1OX5A 2PCQA 3ARPA 5I77A 3T81A 1O66A 3UZ5A 2TYSA 1VP5A 2GSHA 3S6OA 1UIOA 3SUUA 1F74A 5D2YA 3LM7A 2VOTA 3MI2A 3EMQA 4C6FA 1UASA 1GEHA 2YPIA 4XZBA 2DZAA 1YKWA 4KFOA 3UG3A 1RCOB 1TV7A 3Q94A 5C6MA 2V2HA 1SO5A 1U2YA 1FP9A 4RJEA 5D02A 1HJVA 3M0ZA 4K6AA 4MKSA 1NP0A 1FBAA 4QS5A 2PTWA 3Q67A 1MYRA 1GOIA 2PUZA 4J2PA 1GOXA 5F4WA 3SY5A 3VD3A 2IPWA 2VFDA 2HBVA 4YHEA 1EDGA 3UEQA 1CLVA 3CZJA 3Q65A 3T2QA 3LXBA 3VZXA 2VCCA 2PI6A 3GW0A 2VYOA 1V3LA 3M5VA 5FCZA 1B4KA 3CT2A 3T2PA 4C6IA 3CV6A 5BNKA 1KLYA 1P43A 3DXIA 3L4VA 4YTRA 4KWWA 4ICMA 3PG9A 2FMNA 2WKJA 2HCVA 4XD3A 1A4LA 3GVQA 1V7AA 4CNTA 3UCCA 3QFWA 5E0KA 4Z2JA 5HATA 4E4UA 2GQAA 4NXSA 3W74A 2V3DA 3WDPP 3U4FA 1EIBA 3FYPA 4M8UA 1BFNA 2WSQA 3QOMA 1XX1A 2DDXA 4QE1A 1XCFA 5BZAA 1DWGM 4H19A 7A3HA 4GZJA 3WLMA 3Q45A 1TVNA 5M2FX 2R1MA 5JUVA 1IXNA 4JL1A 2MANA 1GVIA 3H2AA 2NX9A 1B57A 4F2TA 5A6SA 6XIMA 2P5NA 1UOKA 4O11A 1M7OA 4MKNA 2VGGA 3S1UA 3GZ3A 1OYBA 4HA0A 2Z7GA 4H7VA 1NTHA 3CQHA 5B7ZA 1LF1A 4Q8MA 1WV2A 4DJDC 2O4QA 1U1UA 5GPRA 5HMEA 2YB1A 4V28A 3W87A 2F84A 1Q13A 4GFIA 2Y62A 3H2OA 4GY7A 2ZX9A 2OZ3A 3GM8A 2DT1A 3WF1A 1F7BA 5HNRA 1XG4A 3AYRA 3VE7A 3WQ4A 2OSYA 1ZBCA 3L65A 4UNIA 4CNOA 1MW0A 1F4HA 4PL1A 1V4YA 4U3CA 3PTQA 3A3XA 4JTKA 5JIPA 5EMUA 3H2FA 2P3EA 2ZUWA 4PL2A 2ATSA 5HAOA 6CGTA 1FWJC 1XYZA 4PEKA 3THCA 4JYEA 4LGXA 2OSWA 4WDWA 2UY3A 2J9XA 2E4TA 3W7LA 1V02A 1BYCA 4F0KA 2TPSA 3COTA 4G8TA 1R85A 4MPKA 4AEEA 3EDEA 1KRBC 4RNHA 1RZMA 1EGVA 3QZEA 1XJBA 3DZ1A 4B9YA 1UWRA 3T8LA 4O28A 3VC6A 1FCVA 2PE4A 5DX7A 1OX4A 4JAWA 2PMQA 1US3A 1YDYA 3ZS4A 1EO5A 1V3JA 4GGHA 1H7XA 4MY9A 3SZ8A 3QKZA 2PDJA 4A3UA 1E0TA 4NX0A 1HN1A 4M0XA 1W54A 2GJNA 1X97A 4F4RA 2G3IA 2J7HA 1PTDA 2Y2WA 2WYSA 1C7SA 4O16A 2CZVA 2YDRA 1SZEA 1ZJAA 4AIOA 1R6WA 3LNPA 3W7MA 3V18A 3AYSA 1IT8A 4X9YA 2CWXA 2OGYA 5BXTA 2XZ9A 4GVIA 4PB4A 3E3HA 1OY0A 4GIRA 4MMWA 4REQB 1H7OA 2NT0A 4X0NA 4XISA 2YA0A 5ABHA 3KTCA 3EAUA 2DVTA 2FMOA 2FZ9A 3NZPA 2NVAA 3VDHA 3CV1A 3T42A 2Z0IA 2BY3A 3LTPA 5CSSA 2ODOA 4FOUA 4H8UA 3GAKA 2PDNA 2XSBA 2J25A 4OGZA 3L2LA 4K7YA 1TIWA 1F76A 1QNSA 3WUFA 5LSMA 3POCA 5DRIA 1E15A 2GLKA 1LT8A 4RZ6A 3AS0A 3W22A 4F0SA 3A4WA 1MW1A 1O68A 3CASA 1L2QA 4A3RA 1IIHA 3ZIZA 3B97A 2J62A 3F5KA 4A2RA 1WZLA 2WZMA 4JFSA 4CD8A 1I0BA 2PURA 3ANUA 3HG2A 1ODUA 4L64A 4HKPA 3MUAA 3CLWA 3LS9A 1QW9A 3C0JA 3AALA 2YSWA 4BA0A 2YBUA 2VGFA 4J2MA 1XWYA 1GVEA 3USZA 1XXXA 5LGXA 4AEOA 4A8NA 3VMOA 2ZUMA 3UF9A 2WCAA 4DBWA 2DW7A 1RCXB 1W17A 1BGGA 4JICA 4RNJA 4IXXA 2QAFA 1WBHA 3CZLA 3N4EA 4PMJA 3GHRA 3W7HA 1BKHA 4XV0A 3M0MA 4OT7A 1I1WA 5FSDC 1M01A 3E2VA 3GTXA 1J18A 1AW1A 3ATZA 3R8GA 1MEWA 4CN4A 1F4AA 3FEMA 4NKCA 3BTNA 1R2TA 4C6OA 2QJGA 3T0AA 3VNLA 1BYDA 3ABOA 5HPOA 1J0JA 2NUWA 3WLHA 4YTSA 4ADUA 5AC7A 4IT1A 1H49A 4L4MA 1P6WA 4Y8EA 3ZFHA 1SFLA 1QI0A 4W8BA 1EC7A 1OCJA 2Q6ZA 3T44A 1BGAA 1X6NA 3CZKA 2E28A 4FLOA 3LI1A 2XVGA 3EOSA 3QGAC 3IVSA 4RXGA 4HBKA 5I3HA 2Y7FA 3CL7A 3GXTA 2AGKA 4LUIA 1WE5A 3N12A 3VNDA 3M16A 1F61A 1W1VA 1SJCA 4IG2A 3G5EA 2Z27A 4ASTA 4JNYA 4GUGA 4NG3A 2FHCA 4CCEA 4D2JA 1QJWA 4LYPA 5HNNA 1MVYA 5E70A 4H8VA 1QCWA 2GGJA 2BVTA 5FAJA 4Q8TA 4EKJA 4UNLA 4IXHA 3LCXA 1BQCA 3RPDA 5DMYA 1UJPA 2BBFA 5CGQA 3VNKA 2HVMA 3B0PA 3BUVA 3DCPA 5D37A 2WHJA 2OCZA 4CNNA 4DJEA 3IAQA 4XAFA 4MUPA 4HMEA 4KRUA 5GJMA 5L9FA 4YYCA 3IRSA 3CQIA 1GJPA 1VBUA 5LA0A 2Z1SA 3MSRA 1F3EA 4N9DA 4MNLA 3FA4A 3RPTA 1XC6A 1HKVA 3OB8A 1O60A 3DBNA 5D30A 3CWHA 4AD4A 4DWDA 2G3FA 3LV6A 3HU7A 4WKHA 4G7FA 3UWWA 4K3ZA 4Y9AA 2CZ5A 1LM1A 1JYXA 2WK2A 2IUZA 4HHPA 4MAVA 4IQLA 3UWZA 3EWXA 1TV4A 1QAPA 4JFVA 4EACA 2Y4SA 3U3HA 1UD5A 4AMCA 1GQLA 1KCLA 1HQTA 1EP1A 2OU4A 4FSAA 3UG4A 4PCNA 1UR8A 4EPBC 1I2PA 4D6FA 2CERA 3EX3A 2J8GA 2INEA 1NSJA 1IWAA 4QAIA 2V5JA 1LLWA 1J11A 4V1YA 1DHKA 3TCEA 4DJED 5LIXX 3EB3A 3KWXA 5J5DA 1TG7A 3UZYA 3V5FA 3IARA 5I7GA 1GVRA 1QPKA 5A6BD 1XHGA 2D22A 2F7FA 3P61A 4RDZA 3POHA 1EB3A 3RCYA 2XPKA 4MZ1A 2GK1A 2UY2A 1DE5A 3GBDA 3I65A 3CUFA 3WUBA 1K02A 3TSMA 2GQ8A 3EPOA 2WC3A 3WQ8A 4WRHA 3RK8A 4DWSA 5HMSA 2WC7A 3W7OA 4L1XA 1W9UA 3AMGA 4JTAA 3NXLA 4BWLC 2J8TA 4Q8VA 3AHXA 2VDHA 4TO8A 3W24A 2A79A 4HYRA 4IM4A 2B4GA 1YNYA 1US2A 2W79A 4QCFA 3A12A 3A9IA 3CHEA 3TOPA 4IZGA 3SRHA 1OT1A 4OWGA 1NWTA 3L4ZA 1M65A 5G5IA 4AUBA 3AU2A 2VGBA 1H50A 4HYVA 4B3LA 2OYKA 2Q02A 1W56A 3MTWA 4XAYA 1OQFA 2VEFA 3BAIA 3UXAA 3O16A 2V5BA 4IPNB 4K8HA 1YTEA 3CWNA 3QC3A 1E1EA 2DSWA 3WQVA 4POCA 5J04A 4HSHA 3CEPA 3TYEA 2ZICA 1O5RA 1US0A 1ZS2A 4KIEA 1AW2A 2IS7A 4ZMGA 4JXCA 2B81A 1ISZA 3FJLA 2AL1A 3C5QA 1EKOA 3LQGA 1UIPA 1TPEA 4Z17A 1HX0A 1W0MA 2DV0A 4DZIA 3UJRA 1Z89A 1VENA 3KBVA 1NDVA 1DORA 2EPKX 2ZZ5A 4GMEA 1AQHA 1W3JA 1XLHA 4DB7A 2ON3A 3VZYA 3WK2A 1GWJA 1TX0A 3N17A 4PMOA 1W1B1 1B0IA 1WBJA 3URNA 4WJEA 3KCJA 3IAPA 1UQYA 1P0EA 4MTVA 3VTRA 4QJ1A 1OADA 2RDTA 3KRSA 5EMYA 3N2BA 1PPIA 1E1CA 2WWDA 4I7UA 2HPIA 4Q32A 1OFPA 1R3QA 3PBWA 3BLIA 1EYEA 4H4IA 2Y89A 3L5MA 4TTUA 1OSEA 1BG4A 2INFA 4E5TA 4PCPA 4FNPA 4JY8A 1S1PA 4O53A 3FKKA 4LT9A 3DECA 3WQDA 1JG9A 4DXVA 1A0EA 3SN1A 1PZ3A 4M5PA 1IGSA 5I78A 4CU7A 5AC6A 5F7UA 3R25A 3THDA 3EWZA 2DSZA 2XN0A 1QT1A 2CHNA 4M80A 1K8ZA 1CXFA 2DZSA 5A8NA 3W37A 4YCPA 1XCXA 5KINA 1XV8A 3EXSA 3GX9A 9XIMA 2I9EA 4YYFA 2OWCA 1U22A 2C6QA 2ZZ2A 3IEBA 1WQ5A 1ZENA 2WSPA 3PP7A 1MUCA 5EBUA 4Y9NA 2BY1A 1EOMA 3K5XA 1TMQA 4C6DA 3C0SA 3QPYA 3W2KA 2O9RA 3MSGA 4NJJA 3HN3A 1Z3NA 1UKQA 3CL8A 2Z26A 1FWAC 2P88A 4FXJA 2YXXA 3UYIA 1JZ7A 3WDQA 4PFHA 1E9ZB 5KZMA 4MLJA 2A21A 2QZRA 2HXUA 1ONEA 4L4OA 3EOUA 1EEPA 2RAGA 2VX5A 2QIIA 4OZOA 4FA3A 1Q7ZA 5A8MA 2G0WA 4D6GA 3UJFA 1BYAA 3HTWA 2WNNA 1ZSXA 2EG8A 1OVDA 1FKXA 2QGYA 5E09A 2QPSA 3CJPA 1J6PA 2AAMA 1VBRA 3NQFA 3SAZA 2DVXA 1POKA 1C91A 4AYSA 3NZ1A 2BX7A 1OFQA 3PZTA 2H9AB 2V5LA 1ECQA 3WDRA 4GIAA 4DXXA 4GINA 3DOPA 1K77A 4YNGA 5HK4A 4OTKA 1FTXA 2QF7A 1SFTA 1KRAC 4D6IA 3BLEA 2J79A 3HMJG 4TTGA 1M5WA 5FJIA 2VEMA