3GDMA

Crystal structure of the k93r mutant of the orotidine 5'-monophosphate decarboxylase from saccharomyces cerevisiae
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
261
structure length
261
Chain Sequence
KATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELLELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRRFADIGNTVKLQYSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLATGEYTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDDVVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the K93R mutant of the orotidine 5'-monophosphate decarboxylase from Saccharomyces cerevisiae.
rcsb
source organism Saccharomyces cerevisiae
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 95
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3gdmA00
2CZDA 4XBKA 1HG3A 3N2XA 3N9RA 1NF0A 4JNMA 5FF2A 3IEBA 3NAVA 2H8ZA 1W5MA 3UXDA 4RK8A 3NPXA 2QEZA 2Z1BA 4QNWA 3P7YA 1PHWA 2IQTA 5IM51 4K6AA 3LX9A 1AL8A 2A21A 3MI6A 3M41A 1H7WA 3GDKA 3TW7A 3CPRA 3EWWA 2ISVA 4I9AA 1KM6A 3ZR4A 5E93A 1A5SA 1TV8A 3G1XA 1SSDA 2RDTA 1V7YA 2NWRA 1A5BA 1ZAJA 2QR6A 5LHFA 1VPXA 2V30A 4JY9A 3VCRA 4GUFA 1YADA 4KWWA 1DHPA 1QPRA 2OZ0A 3DU0A 3M1ZA 3GR7A 4IWWA 4MKNA 3MMTA 1LM1A 3TW6A 3LCWA 1XCFA 1TPFA 5K4ZA 1JCLA 3C0JA 2WQPA 3BW2A 1VZWA 3HPXA 1LBLA 4HNNA 2PC4A 3TDFA 4KFNA 3M5VA 3PSWA 3LRLA 3CEPA 5I3IA 4BR1A 1IF2A 4A21A 3F03K 4N9EA 5ABTA 1TQXA 4ALDA 1LOLA 3G18A 1F76A 1GVSA 4MJZA 2AAMA 3C2EA 1I4NA 2CW6A 3EX1A 3CB8A 3JRKA 3ATYA 2RDWA 4LRTA 4O13A 5HWJA 4O1CA 4JYDA 4LS1A 3I7QA 1FCQA 3S8HA 1SO3A 1BEUA 1EWDA 3ATZA 4Q4KA 2NUYA 3BO9A 1AK5A 1IXPA 2JKAA 4RLIA 2RKXA 2GQ9A 4ML9A 2YFOA 2DZVA 3IVUA 3TC6A 4H6KA 2RH9A 4A3UA 2HTMA 4ADSA 5C54A 3TQVA 3DI1A 1OFOA 2PURA 4BFAA 1OFEA 6ALDA 2Q8ZA 3M5ZA 5AB3A 3GAKA 4IMFA 2OJPA 1GYNA 3FLUA 3MHFA 4IXHA 1D3HA 3PBVA 2TRSA 1UASA 3LBCA 4WY0F 4ZQOA 1OK4A 1KLZA 3OHIA 2ZTJA 3W7RA 2DZWA 1K8ZA 2QDHA 2RHGA 1LTDA 1TPWA 1VHNA 2YXGA 4TMCA 3W7QA 2F84A 3LHVA 4FX6M 1ZAHA 4M6QA 3B4UA 1Q45A 1M7PA 2Y63A 4FNSA 5I3GA 5F2GA 3P67A 1G4TA 3TXZA 4QAIA 4NXSA 4O8RA 1A5AA 4IOTA 3THAA 2QUUA 1KM4A 4MYXA 3TFXA 4CQ8A 1FWTA 3Q58A 4XWUA 3N19B 5FF4A 1SO6A 1MEIA 3D0CA 3F4WA 1DJNA 3UWZA 3PSVA 4TIMA 5CSRA 4O1BA 3L2IA 1OFQA 4RV8A 3GB6A 3SSJA 5FEZA 3UZJA 5G2HA 2CLMA 3O05A 5E1QA 4FNRA 4LU0A 1FCVA 3BVJA 3A21A 1TB3A 4DPPA 1QAPA 1U5JA 4DPQA 3UQNA 4FIQA 2A0NA 3BG3A 1PV8A 1JULA 2C13A 4P2VA 4R7JA 3T4CA 4AWSA 3IGUA 2VEIA 3A5VA 3B0VC 1QDSA 1QFEA 3UY8A 2ZZ3A 2A2IA 2RDUA 3QZEA 1Q6QA 3P5ZA 1D9EA 1GVOA 3QF0A 4LVDA 4UTWA 3W2NA 3EWBX 5EBUA 3W1TA 1W31A 4DO5A 1KBJA 1ICSA 2ZCGA 4UTTA 4O1DA 4UFKA 1FXQA 3LTPA 1VJIA 1ZENA 4JXCA 3W7NA 1KFKA 3QYQA 5T26A 4FO4A 5KSWA 3EXTA 3N2MA 3C4UA 3P60A 5LNVA 4O54A 4R34A 5CZSA 2CWNA 5G5IA 3HGJA 4UR7A 1GTEA 3FYOA 2I9EA 1KBIA 2C1HA 5D04C 1YDNA 5LSMA 3KVMA 4KWVA 1OF8A 2JK2A 3QPZA 3G0XA 3QW4B 4FB7A 3O1NA 3QJAA 3H55A 3MP5A 4LC8A 2R8WA 1ML1A 1UB3A 1LCOA 3UWVA 5K9CA 1DOSA 3NQ2A 4RZ6A 3DAQA 3PUOA 5F1VA 1G67A 3LLFA 1L6YA 4RCXA 2GJLA 5DXYA 4N2YA 3W1QA 3BG5A 3NG3A 4X22A 5AC6A 2VEPA 3S1XA 1WX0A 3OVQA 2WV8A 2CLEA 2TMDA 5D03A 3CU2A 5F4WA 3W87A 8TIMA 1TMHA 1TTIA 4QISA 5A8GA 1K02A 3UWWA 6TIMA 1JCMP 4RZ4A 3W7OA 4JDYA 2WSYA 3SJ3A 2BTMA 1W5NA 4LVFA 4ZMGA 1AL7A 1R2TA 3KVLA 2VKZG 3U8GA 4MYAA 1KM1A 1ZHAA 2GJNA 2J9ZA 3L5AA 1WOAA 3R13A 2E6YA 1VC4A 1IIHA 2ZRUA 1K8YA 1UCWA 4BI7A 3GVGA 4Y96A 3GAYA 1H1ZA 3IV3A 3C2RA 4WXYA 4X2RA 3P80A 4JIQA 3W1RA 1C29A 1LRTA 3A9IA 4JEQA 5AHNA 3LV6A 4WXZA 3W1AA 3W2UA 2V8ZA 4NUWA 3HG3A 3R89A 4Z1CA 5H91A 3B06A 3M5YA 4IPJA 4XZ9A 4O18A 3EX4A 3M9YA 4FX8A 1OX5A 4RR4A 5EYWA 4JTKA 3W1XA 1KM5A 5D2TA 5FF3A 4JTTA 4NZJA 1UBSA 1XDMA 1RQEA 1HL2A 4CCDA 3TMQA 2ZZ6A 4PFMA 3TNOA 1RZMA 3G22A 3NQGA 3NL3A 3NPUA 2GVJA 4NNBA 4Z1DA 1R2RA 4M5PA 4JICA 3IIZA 4NJIA 5I3FA 3RFAA 2CLKA 4AB4A 2Y61A 4YCOA 4LOCA 1CW2A 4JR5A 2YFNA 4FNUA 4M7TA 2HSAA 2GVLA 2WSQA 3TFCA 1EWEA 2A7NA 1ME7A 1RR2A 3FA5A 4OBTA 2YYUA 3PY2A 4Y90A 5CPLA 1FXPA 3QMRA 3LXCA 3RLVA 4LVGA 4CNNA 5F4SA 5AC7A 2G5WA 3T40A 3NR0A 4CCEA 2EF9A 3HF3A 4WY0B 3HG2A 1MZHA 1TPUA 4A29A 1PE1A 3OEXA 5BW6A 3FKKA 3GR8A 1RQHA 4AF0B 3ABSA 3GDLA 4HNVA 2C18A 2FFCA 3MUXA 1W54A 2R94A 3TJLA 4MZ8A 4A22A 2Q3RA 4NNAA 2VFDA 1TPVA 3DFSA 1AMKA 3BGGA 1H7OA 1RV8A 3WK3A 2NZLA 3FFSA 1DV7A 3DH7A 3HG4A 4PCFA 1ZAIA 4UMBA 3PG9A 4QNEA 4YMZA 3W7HA 2VFIA 4AHQA 3S5NA 2A85A 3BARA 2DP3A 1L6WA 4MZ1A 3BV4A 3W6YA 5K2ZA 4N9DA 3W86A 4Q33A 5TQLA 3MP4A 2YW3A 2DZUA 3N3MA 4KKXA 3S1VA 4UNKA 5SWUA 2CU0A 4AVFA 4JTUA 4ICNA 3HGOA 4QM1A 4RZ5A 2GVGA 5BRBA 3GNDA 1BWLA 2FB3A 2Y62A 2VELA 5C2XA 1TSIA 2C6QA 4NVTA 3LTYA 4TR9A 4ZQRA 1QOPA 2NV2A 2P1FA 3NA8A 3BG9A 4FHAA 4G1KA 1O5KA 5D2VA 2ZA1A 3FKRA 1OFPA 3NQ8A 3SECA 2QAPA 1XL9A 4WJEA 1G4EA 4CCCA 4WOQA 1P0NA 2JBMA 5DBUA 5KZEA 3TROA 1WYIA 3LRMA 3E49A 4LC6A 3NQAA 1JR1A 5BNKA 2TSYA 1F74A 2JKPA 2ATMA 1MEWA 1X1OA 1NEYA 2FPVA 2B7OA 2D73A 5TBOA 1SO4A 3W1NA 2E6AA 3R5EA 1IXQA 3DKLA 1PL9A 1LRNA 2QUVA 4JTHA 1XFBA 5AYZA 4EWND 2Q8LA 4LS0A 2YR1A 4YWIA 4ZQNA 1YTEA 1H62A 3UZ5A 3TCEA 4W9TA 3C61A 4MVAA 1QPNA 5K7JA 2J27A 4X3ZA 1EB3A 3NPVA 3DKJA 3S0CA 3UPWA 1XBXA 4QITA 1XKYA 3R2GA 3N9SA 1OYBA 4ZZ9A 1DKWA 5CZJA 3W2KA 4JN6A 5F2LA 2ZRZA 1FWRA 5G4WA 5KITA 2ZRWA 1R30A 1PCWA 3S6DA 2YZRA 3G1FA 3NQVA 2ATSA 1K8XA 1TPEA 4ZVJA 1XI3A 2FDSA 3PBUA 3EX3A 3IVSA 1S5VA 3W7CA 4DEFA 5LKYA 5CZ0A 1H50A 5H2ZA 3HQ1A 3TUUA 3RLUA 2GUUA 1NSJA 2V82A 4IPIA 4WY0A 1KFLA 3UNDA 4XBSA 3EWUA 2ABBA 1LBMA 3LHZA 3TKFA 5DELA 3W1MA 2PCQA 4OWGA 4JTGA 3A22A 4UTMA 1TV5A 2EPHA 2BLEA 3H54A 1MSSA 4AWTA 2B7QA 1K7XA 1GQNA 3BPWA 4O14A 1F7BA 4O19A 1LOSA 3L21A 2E1DA 3EKZA 2P0OA 1WAUA 1OFRA 1WXJA 1JVNA 1YLVA 2RFGA 3IRDA 3LCIA 3FYPA 1Z41A 3W73A 1YXYA 3BGJA 2BX7A 5CPNA 2C0AA 2C3ZA 5D32A 4UC5A 3A24A 4WX2A 1JCYA 1H7PA 2TPSA 3QM3A 5DY3A 2ZA3A 1ZCOA 3W1PA 2NXHA 3W7GA 5D2XA 1B57A 4PODA 1Q3NA 1S3HA 3W7KA 1SR9A 2G97A 3GXPA 2QF7A 2A1YA 1GPWA 4UTKA 3ZWTA 5C55A 4R33A 2HMCA 4LVBA 1LRQA 5K9DA 1WDWA 4HSOA 3LHWA 3GXNA 3I7RA 4BWLA 3CIWA 3PB0A 2PE4A 3TC7A 3IVTA 1IXOA 3DFOA 3HGSA 2DJLA 2FIQA 1GVRA 1TCDA 5FESA 1QNVA 4DO6A 2C15A 3SZ8A 2Y70A 2VFEA 1W56A 4UXDA 5FEPA 1EUNA 1OG0A 4NX5A 1L2UA 3STGA 3SGUA 2X1SA 4CNOA 1TTJA 2Z6JA 1JJKA 4BF9A 1Q6LA 1Y0EA 2C19A 1G7VA 3W7IA 1H7RA 3PM6A 1WA3A 3M6YA 3S1UA 3YPIA 3B0UX 3EB2A 5G4EA 4JTLA 1X7FA 2E68A 4J9JA 2GQAA 2NUXA 1QCWA 1P4CA 1VYSX 2YSWA 1E51A 4N9BA 4LY8A 3SI9A 2DZPA 5I3JA 3LTSA 3LDVA 1TRIA 3W7JA 1MXSA 3N14A 3W88A 3Q94A 3NXFA 4OQVA 3G3DA 1TPH1 1ZALA 1OVDA 4MY9A 4DF1A 4NJHA 1TJPA 1FWWA 2NX9A 3V1PA 2WNQA 2X30A 3STEA 4ADUA 4KFOA 5G2WA 3I6RA 1G7UA 1KA9F 3Q2DA 3BW4A 1A50A 3C56A 1F6PA 1NVMA 1WOBA 3OBKA 1VH7A 4POCA 2OMAA 2QJGA 3S9YA 3FEMA 3HGRA 5CKSA 4NT0A 2O7SA 3QC3A 2J9YA 4NX0A 3BLFA 4OV9A 3KXQA 3W7DA 3M43A 1VYPX 3MYPA 4FXRA 1TO3A 3L0KA 3NL5A 2YPIA 4O4WA 3TE9A 2EHHA 2ZZ5A 3P62A 1EEPA 3UWQA 1TPC1 4AEOA 1H63A 3W1LA 4K8EA 3NOEA 4AMAA 2V9DA 3W74A 4Z0JA 4UIOA 4GJ1A 3TQKA 3TA6A 4O1AA 4UFHA 1SPQA 3I68A 2ZRXA 3R12A 1HFBA 3IIPA 1XC4A 3C3NA 3KFTA 4UMAA 4PH6A 3UD6A 1KFBA 3HB9A 5HNRA 3ABRA 1AW1A 1G4SA 3M5XA 3CWOX 1A53A 4DBEA 1W0MA 4BI6A 2ZZ1A 1H1YA 4L4MA 3VNDA 4JTJA 3TR2A 2TYSA 4FNTA 2FLIA 3W2MA 1KM3A 5AHIA 4L4LA 1LZOA 3P82A 1W3TA 1KFEA 1PVNA 3GXTA 3O06A 1EP1A 4EF8A 4LNYA 3KHJA 1FDYA 1SFLA 1O5XA 4S2BA 3VFLA 1F5ZA 5BMXA 1X6UA 1QWGA 2KZHA 3LCXA 5FF0A 1EP2A 1FBAA 4MLJA 4ZL1A 2DORA 3NQ6A 1PHQA 4N02A 3HPSA 3VI2A 4UR8A 4O50A 3T55A 2I1OA 3G0UA 4K7YA 4GC4A 5CPMA 3A23A 5LHEA 2EKCA 3LXAA 1JRCA 2VXNA 5D37A 4N6EA 3P8IA 4N9CA 3QMTA 1SUXA 4C1KA 5D38A 3IGSA 4U28A 4GUJA 2V2HA 1RVGA 1THFD 3KVKA 1SZEA 4IXXA 1VS1A 2PRLA 2ZDRA 4TMBA 4C1LA 2DU2A 4UTUA 4WOZA 3DGRA 1D3GA 1O95A 3PG8A 3FJLA 4M7SA 2CLHA 2X1TA 3W83A 1C8VA 1H7XA 1WV2A 2QKFA 2V2CA 1ME8A 4IQLA 3RF9A 4AHOA 3MBFA 4JTEA 1YTKA 3WJYA 4NJKA 2UV8G 4BWLC 1JQXA 2QCFA 1FY6A 5HINA 3HMJG 1DQXA 5LNUA 2X1UA 5FF7A 1V5XA 2VEKA 1KFCA 4Y6GA 4K37A 2CZFA 3PUEA 3CIXA 4QIUA 3SIZA 1GT8A 3QPYA 4GUGA 2WKJA 3PBYA 2FTPA 1YPIA 4KFPA 4IX2A 4I7WA 1TIMA 3NL6A 3U2OA 3EWXA 3RU6A 1H5YA 2E09A 3NVTA 2E6DA 3PBWA 4LUIA 3VE9A 1G6CA 2E77A 1LDCA 3P8JA 1S5WA 3ABOA 1ZY9A 3MJYA 1KTBA 5CZTA 1OABA 3SGZA 4CQAA 4XTIA 3HG5A 3ABQA 3GK0A 1OFAA 1OYAA 1P5BA 5DBTA 3MHGA 2DZXA 2E5CA 3LHTA 3LXBA 3EXRA 3W76A 1JUBA 4DF2A 3CWNA 4IX0A 3W3OA 4IJBA 3UWYA 3W70A 2W6RA 1OX6A 4O17A 1HUVA 4HN4A 1Q6OA 2YX0A 3F4NA 5CGQA 1BKSA 4UNLA 2YCEA 3M44A 3P61A 3NGJA 4GNJA 2DZSA 4O28A 5C5YA 3E0IA 4Z1AA 2QAFA 3CTLA 2A4AA 1SW3A 1DQWA 1AW2A 5AHLA 1O60A 2C14A 4XTDA 3SW6A 1ZFJA 4OU1A 3HJZA 3B03A 4MLRA 5J5DA 4OGZA 2JGYA 2FB2A 1TREA 2NX1A 3W84A 1MEHA 3P81A 1QO2A 2EGZA 4AAJA 1Q6RA 4PL1A 1JUKA 4O4VA 1KV5A 3L66A 3TX9A 2HS6A 4K7VA 3LCHA 1FCUA 1CI1A 3W1UA 2E6FA 1VGAA 2ZZ2A 3LI1A 1OHLA 4GRSA 5HWNA 1SZNA 1LROA 2H3DA 5BMWA 1OX4B 3B8DA 3W2JA 3GZ3A 3PAJA 4YCPA 3TK7A 1I45A 1XDLA 4PA8A 2Y7FA 5G1YA 3SR7A 4OE7A 3OA3A 4M6PA 5DCEA 1EIXA 3C2VA 2AGKA 3QSTA 1GEQA 1F05A 2WNZA 3MO7A 3KRUA 2BWGA 3S5YA 1Z42A 2WO5A 3LHYA 1Z48A 2BXVA 5DY2A 1GOXA 3T44A 2F7FA 2ZRVA 1EUAA 3L67A 4DQWA 1J4EA 3VKJA 3PR2A 3GNNA 1SSGA 3KVJA 3W7LA 5K3VA 4O12A 1XBZA 2ZQ0A 2FJKA 3LOTA 3GKAA 2NWSA 2ZTKA 4FNPA 4RJEA 1CX9A 3AO0A 4UFMA 1UUMA 4BI5A 1VRDA 4LVAA 4UCGA 3LCFA 1WQ5A 1JQVA 1ICQA 2XN1A 2JGQA 1TQJA 3DBPA 3DFNA 3MHUA 1IGSA 4IMEA 4MY1A 4PEKA 5I3HA 1PIIA 3NNTA 1R2SA 4GBUA 3JR2A 3PUDA 4GWEA 5D2YA 3G1DA 2A7PA 5I3KA 4PTNA 1IXNA 2Q3OA 3C8FA 1TJRA 5IBXA 2H3BA 3W85A 3F1QA 3L5LA 4AF0A 1W1ZA 2V5LA 1M6JA 5AN7A 2EAWA 3TMLA 3G1HA 2B4GA 3G1AA 1WBHA 3DXIA 1W37A 1VCGA 4MUZA 1I8JA 3EKLA 4XQ6A 1LBFA 1NF7A 3E9AA 4EIVA 4ZQCA 4O16A 4YXGA 2NV1A 3L65A 2I14A 2XN2A 4DBDA 3PWAA 3KRSA 4JX5A 3G24A 2QCHA 4LWWA 3L0GA 2Y7GA 2VFGA 3PS7A 4N6FA 3L68A 4LV4A 3NQMA 1IIGA 1ZJIA 3CC1A 3GDMA 2OT1A 3S1WA 2CLOA 3W75A 1ALDA 2VFFA 2CLFA 3G1VA 3JS3A 5AHEA 3EWZA 4Z08A 3KAOA 2E5DA 2X16A 1RPXA 3TV8A 4O15A 1FDZA 3M16A 3TXVA 1KFJA 1F73A 2P10A 1TPB1 1KLYA 3PC0A 3O8AA 3MW7A 4LV9A 2WJZA 4X9SA 3W71A 3NYZA 3NQEA 3OIXA 2ZFAA 3NM1A 3UY7A 4JYFA 5D33A 1ME9A 3GLCA 2VFHA 3STFA 2XFWA 3WK2A 3G1YA 1ZNNA 1H7NA 5D05A 1B4EA 3DI0A 2J24A 1GJPA 3TIMA 1P0KA 4EOUA 2H90A 2QCDA 1W5OA 4HHPA 1EX5A 2QCGA 4JTSA 1HTIA 1EPXA 2VOMA 1DBTA 2Z2UA 4UTHA 1VR6A 3NL2A 4ADTA 4N4QA 5FEWA 1QOQA 1N55A 3BK0A 4FIRA 3TSDA 1M7OA 5L6UA 4ZQPA 4FNQA 1RQBA 1F2JA 5FEXA 5D02A 5HJLA 3PULA 3TQ0A 4UFLA 5GVJA 4DXVA 3DENA 4AH7A 7TIMA 1XUUA 3TH6A 4TU1A 1O94A 3E96A 2O7QA 5K9XA 5AHMA 3V75A 1KM2A 1RD5A 1HO1A 1K03A 5E0KA 2ABAA 4JD4A 2Y7DA 2V81A 1B3OA 1TPDA 2VC6A 3TJXA 1YTDA 3QMSA 5LZLA 5LNSA 5AHFA 2ZA2A 2A6LA 3B0PA 1S5TA 1W3IA 5HWMA 2CZEA 2J6XA 3GYEA 1PS9A 1KTNA 3NDOA 4O0ZA 4H4IA 2OX1A 3S5ZA 1DJQA 2YDAA 3QSRA 5HR6A 1VCFA 1M5WA 4MJMA 1XUZA 4O0KA 3LRKA 2VEMA 5D2WA 3NZ1A 1AG1O 3H53A 3SY5A 3ZWSA 1OFDA 5L9FA 1OFBA 1JCNA 3LGEA 2NXIA 5G1TA 3UXAA 1N8FA 1YYAA 2Y7EA 3L5MA 1GZGA 3HIJA 3STCA 4HNUA 5EL1A 5KZMA 2NXGA 3C52A 2BSLA 3W7PA 3DFTA 4HSNA 3DFPA 1DORA 3DFQA 5LGXA 1FX6A 3HOJA 3KOFA 1I2PA 1VHCA 3AJXA 5KTLA 1JCXA 4K39A 5DCBA 3GKFA 1LP6A 2XN0A 4Q32A 2VENA 3OVRA 1FWSA 3TU9A 3B05A 3WJSA 3MI3A 3W7EA 3MI2A 3W22A 4IUOA 2HS8A 4MIMA 3M47A 4NZFA 4UUIA 2YGYA 3WJXA 2WOQA 1T96A 2WNNA 1X1ZA 1ONRA 3G3MA 1XM3A 4LT9A 1T99A 3U6WA 3LLDA 2W79A 3S42A 2GOUA 3P5YA 2NUWA 1G4PA 3MP3A 1QMLA 4IMCA 1I2QA 1GG1A 4DO4A 3THQA 2FQIA 1H51A 1TRDA 3WJWA 1VQTA 3MYOA 4Z0SA 3TAKA 1SZFA 4XKYA 5D30A 1K7EA 1JRBA 3O07A 5HULA 3N34A 4K8HA 4UTLA 5EPDA 1EA0A 1GTHA 4ORIA 3A5FA 3CHVA 2QCLA 3TSBA 5IBXC 1TYGA 4WUIA 1XBVA 3PB2A 1DL3A 3INPA 1OF6A 1OYCA 5CSSA 4UFJA 1VLIA 4OV4A 4MFDA 2R91A 1DVJA 1N7KA 3O15A 3BLIA 1KV8A 1GYLA 4NJGA 4NQ1A 1W3NA 1R47A 3QQ1A 5C6MA 2WPBA 1R46A 4U4MA 4XUGA 4UMCA 1KM0A 2DJXA 4OHQA 3BW3A 2PRMA 1YXDA 3ELFA 3NEVA 5KMYA 4O52A 4HT3A 4E38A 3O6YX 3WK1A 3G0SA 3ZFHA 4ONVA 4K38A 3NQFA 2H8XA 2ZBTA 3GIYA 1SZGA 3ANYA 2ZRYA 3CM4A 5TIMA 4IGHA 3FS2A 5F4XA 1SFJA 4GE8A 5DLCA 3IIVA 1B4KA 1F6KA 3L9CA 3T7VA 1P1XA 4RXGA 3C2OA 1OK6A 3HPZA 2BZNA 3IIXA 3PF3A 3PVFA 5J5RA 5D09A 1UJPA 4QQ3A 1NAL1 3O63A 3NQCA 2V2DA 4MFEA 1TTQA 3TAOA 3O6CA 3T78A 4LUJA 1VYRA 3QFEA 1FQ0A 3M7WA 4NJJA 2A6NA 1K7FA 3W7MA 5KINA 3GDTA 3NQ7A 1WBJA 3QH2A 5EA9A 3GX9A 3LHUA 4JS3A 4E2DA 1YPFA 2G95A 3ZS4A 1TV7A 3R8RA 2QJIA 5AFDA 1YDOA 3L0NA 3I65A 3DHDA 4UFIA 3CQ0A 1W5PA 2GQ8A 2R14A 3LCGA 4JY8A 4E2BA 4IMGA 5AYXA 4QSHA 1L6SA 3TSMA 5CPOA 1L9WA 4O53A 1H61A 4OT7A 5CG7A 1OJXA 4O57A 1A5CA 1XXXA 4PC8A 1U83A 4HNTA 3C6CA 5LNWA 2QCEA 3LB0A 2Y89A 3IIOA 4AWUA 5HMSA 4D2JA 1VLWA 5AC8A 5BOOA 3FOKA 3O16A 4AXKA 2ZZ7A 4MOZA 5DN1A 2FPTA 5U7SA 4FF7A 4MZYA 3KX6A 3NM3A 1SU5A 2B0MA 2V5BA 4EF9A 5U4NA 4GUHA 4JIPA 5AOUA 1LORA 3G1SA 5F2IA 3KRZA 4B5NA 4I7UA 5LGZA 4E0CA 2X1RA 4JGDA 2OT0A 2E5BA 5EMUA 1JCJA 2B7PA 1PCKA 1GVFA 2PRHA 3K30A 5F2MA 4ZQMA 2QCDB 4GXMA 5F1UA 2H6RA 1K3UA 2A5HA 3QRHA 1UUOA 5DXXA 3LBMA 3P84A 1BWKA 4Z1BA 2Y85A 3WJZA 1I2RA 2C16A 2NLIA 5HUPA 4IMDA 1GVQA 3QW3A 4JYEA 4TO8A 4CNPA 4S2CA 2Y6ZA 1W8SA 3C2FA 2GPTA 3MWAA 1FUYA 4LW7A 1OX4A 3NPWA 4WQ6A 4BK9A 4MPQA 1NFBA 2ALDA 3CEUA 5K4XA 3SFKA 2Z6IA 3W2LA 1AW5A 4O10A 1YXCA 3N73A 1LLWA 3MBDA 4YLWA 3EWYA 1MO0A 4FX7A 2LLEA 1VCVA 3DZ1A 5LNRA 3BLEA 1KTCA 2YW4A 3G8EA 2OCZA 4M6VA 4JX4A 4UTWC 4JTIA 2QCCA 1ICPA 5EY5A 3W9ZA 3EX2A 4UTTC 1ADOA 4RKAA 1SQ7A 3RNDA 3NQDA 3OVPA 4CQ9A 3EEGA 3RMJA 3LV5A 2V0TA 3NO5A 1H60A 3CT7A 4HPXA 3QQ0A 2J9XA 3VE7A 1TTPA 4RXFA 1FDJA 5DCDA 1KW1A 1B9BA 4JDBA 3B04A 3Q37A 3HO8A 3UYCA 1J2WA 2Y88A 1QPOA 1JUEA 2ZZ4A 4Y9AA 1T0OA 4WD0A 1C9DA 3EXSA 2FPYA 4PL2A 4S1FA 4H3DA 2QCNA 3OG3A 1G69A 1SW0A 1SW7A 1GWJA 1Z44A 3EX6A 4O11A 1LLZA 2CZ5A 5EKYA 4LS2A 1T8XA 5KZDA 3GDRA 3CLMA 4AHPA 3WK0A 1HO4A 3G8RA 4I7VA 4MY8A 2ZYFA 3FJ6A 1LYXA 3O6DA 2JKEA 4FEZA 4YL2A 5MHBA 2CFFA 4GFSA 2QJHA 3P74A 2YYTA 2WSRA 3E12A 2DZTA 3E02A 3IGXA 1I2OA 3USBA 2X2GA 4DELA 1EP3A 4LTSA 3LERA 3W23A 5HQEA 4K36A 1QPQA 4NNCA 4TX9A 4NU7A 2Z0IA 3UWUA 4LRSA 5HR7A 3W07A 4CLMA 4M19A 3LM7A 3S5OA 3RK8A 3LI0A 4N4PA 4RX0A 1I2NA 3FIGA 3W72A 2W0UA 1YDVA 3DHFA 4R53A 1BTMA 3NZRA 4XKYB 4JX6A 4GUIA 4FXSA 5G2IA 4ORMA 4EVZA 4A2RA 1QO5A 4NXKA 4A2SA 3HBLA 1GG0A 4WZHA 4HIBA 1J5TA 1QR7A 4HPJA 5AYYA 2A7RA 2B7NA 3QEZA 5FI8A 1LOQA 1X8FA 4P61A 4UTIA 2CLIA 3LCLA 3UPBA 2QUTA 4JTFA 4UTJA 5A5WA 2CLLA 1O4UA 2QCMA 4Y8FA 2AQWA 2NX3A 1W5QA 1SO5A 4DF0A 3M0ZA 3I7SA 3WFAA 2J88A 2G96A 1XBYA 4HKPA 2QDGA 1FWNA 4QJ1A 5HUOA 2ISWA 2ISSA 1FCBA
chains in the Genus database with same CATH superfamily
1T41A 2POTA 2KX9A 4DX3A 4AZIA 1V02A 1VFTA 2OYLA 1NF0A 4JL2A 4JNMA 1M3UA 3RR1A 2UBPC 4ZEPA 4X60A 3QGKC 4LCQA 3OBAA 2QEZA 1WUFA 1ZU8A 4QNWA 1OEPA 3LX9A 1AL8A 3H4GA 1FWIC 3FGCA 3GQYA 3CPRA 2ZVRA 2ZUUA 4I9AA 4PMOA 3GFYA 1EDGA 5E93A 4QEEA 3AIQA 3FVMA 3R0UA 1V3KA 2F61A 2AGTA 4S3CA 1EBGA 2ZWZA 1VPXA 2BOGX 2PP1A 1TX0A 2V3FA 2XIIA 3NWRA 3VNMA 4D1JA 1YADA 1XYLA 1DHPA 1QT1A 1X8CA 3M1ZA 1VB9A 2GK1B 3RYSA 1BTCA 3CUJA 3MMTA 3KL3A 5G4HC 1TPFA 5K4ZA 3C0JA 1MZRA 4W7WA 6REQA 3HPXA 1LBLA 2PC4A 4KFNA 3MJMA 3PSWA 3LRLA 4NF7A 5I3IA 3CB3A 3VOHA 2PDLA 1N82A 5FA5A 4INFA 4XVEA 5REQA 4MJZA 2AAMA 3C2EA 3SQMA 3JRKA 4K68A 1E6QM 2RDWA 1X6NA 3MSGA 2NQJA 3CT2A 4O1CA 1FCQA 4MWAD 1SO3A 1BEUA 3ATZA 3GXIA 3BO9A 2Q6ZA 3GS6A 1E1CA 4IIBA 3BURA 4KGJA 2HNHA 4TUFA 3WMBA 5DT7A 4H6KA 5XIMA 2RH9A 2D1ZA 3KHDA 3L4UA 4JKMA 4GVHA 2BY3A 3DI1A 5C0QA 1TA3A 2IKJA 1AZ2A 1AODA 2Q8ZA 3GAKA 2OJPA 2BGQA 4XZHA 3KP0A 3FLUA 3GE7A 4NAEA 3MHFA 1QHZA 1QI3A 2P5NA 2TRSA 1V0LA 3LBCA 4WY0F 3QV7A 1G01A 2VGBA 1FWDC 2CYGA 2F38A 4Y7EA 1TPWA 4QXIA 3ARYA 1PKYA 3LLXA 1ZAHA 3B4UA 1Q45A 1M7PA 2VRQA 2Y63A 2PLKA 1S2CA 5F2GA 3P67A 4WHBA 1A5AA 4EKJA 3THAA 1NWTA 2PBGA 2QUUA 1EGZA 3TFXA 3B8WA 4CQ8A 5A69A 2VURA 4AW7A 4FF5A 3Q58A 3N13A 1XD0A 1SO6A 1GOWA 3F4WA 4HCHA 1OFQA 1BXBA 5G2HA 5E1QA 1FCVA 3GG1A 5DMMA 2CKRA 5KZ6A 5FSDC 4YS1A 3KTXA 3T05A 4FIQA 2A0NA 3QTGA 2C13A 1JULA 1O5QA 5IHSA 3B0XA 3NDYA 2VEIA 1OT1A 3KLLA 3UY8A 1KCZA 2RDUA 1DE6A 3SCWA 1GVOA 4C6IA 3QF0A 3T4WA 5A6MA 2J62A 3KBSA 1E1EA 5EBUA 1LL6A 3W1TA 5H8PA 4PMRA 4UZSA 4IQDA 2QUMA 5BROA 4B2DA 3W7NA 1XLIA 3SRHA 5XIAA 2DQWA 4GIRA 1QI5A 5GPRA 3U7BA 4PRTA 3HGJA 4UR7A 1KBIA 4ZSUA 2VHLA 1HW6A 1MW1A 4H9XA 1JYNA 1IWBA 3XISA 4B91A 3MP5A 4LC8A 2OWXA 3VAVA 1NFPA 4CN1A 5IXEA 2DSWA 4IZGA 1DOSA 3NQ2A 2F9RA 5F1VA 1GQKA 3PUOA 3T2PA 4EAMA 2FGZA 1G67A 4BJHA 3QLLA 4L6HA 4TQTA 4YVPA 3W1QA 2OOFA 2VEPA 1Q6FA 4FP1A 2WV8A 2TMDA 3L12A 4QISA 1V79A 3AC0A 4YVVA 4KEZA 1TWDA 3SJ3A 1W5NA 3BLDA 5C7VA 3ZJ7A 1QASA 3D5HA 4LCSA 3VNYA 4PUKA 1AVAA 1ZHAA 2GJNA 3XINA 1LQ0A 3KE0A 5C9ZA 2QIIA 7PTDA 2J79A 1DTUA 1XS2A 2WB5A 4MG4A 3GNRA 3C2RA 2XFRA 4LPCA 1LT8A 3WLIA 2YL9A 1JPDX 3W2UA 3ECQA 3R89A 2WLZA 3CO4A 4O18A 4RR4A 5EYWA 3VMOA 4JTKA 1KM5A 4DJEA 5BXTA 3ZMRA 4JTTA 1XLKA 2HRWA 3TMQA 1QNOA 2ZUNA 3NQGA 1HP4A 3NL3A 2GVJA 3W82A 1R2RA 3VNJA 2DY3A 5IFPA 4IM4A 2V5CA 3VNZA 2JIWA 4UOQA 4AEEA 4M7TA 1ITQA 2GVLA 2WSQA 2D3NA 5D9PA 2YXOA 4OBTA 1P0EA 4HNOA 3PY2A 4PUWA 3WQ8A 3QMRA 1KXTA 3UJRA 3M0XA 2J6VA 4AIBA 4GQQA 4Q8VA 5AC7A 5LIUX 4WY0B 3D3AA 3BC9A 4A29A 3S47A 1PE1A 3P6LA 3GRIA 3GDLA 4HNVA 3A4XA 4UWMA 2FFCA 3DHUA 2OO0A 2BGSA 3NEHA 3TJLA 1DJZA 3CV6A 4DJFC 1BYCA 2VEGA 4A22A 5M5DA 1XD1A 3WNLA 2JEPA 2NZLA 4K3ZA 2E9MA 3NTYA 2A85A 1L6WA 2VZTA 1J96A 5TQLA 4CEXC 2Z29A 5TNVA 3N3MA 3AXIA 1UD5A 2ZICA 3HJEA 3WO8A 4JTUA 4EPEC 4RZ5A 2GVGA 1D8CA 4JTDA 1BWLA 5C2XA 1H41A 1TSIA 4JNZA 4MTVA 5A6JA 1TX2A 3P0WA 3ARPA 2GWNA 1GOMA 2ZXBA 3ZVHB 1TWSA 3UZYA 2PUZA 3NA8A 4H9VA 3GG0A 1OFPA 2XISA 2E8ZA 3LSBA 4WJEA 1ONXA 1KGWA 2JBMA 5DBUA 3OP2A 4RL3A 4XO7A 4KT2A 1FWJC 3E49A 1R9XA 1F74A 2JKPA 4Q8TA 2IKGA 2P0IA 3SFWA 2FPVA 3W38A 2B7OA 5TBOA 2PGEA 2OOGA 2BOEX 3RLGA 3LNMA 3CL7A 3PZQA 1KXHA 1OD0A 1IT8A 1U1HA 3UZ5A 4B3ZA 3TCEA 5LYRA 2VGGA 3C61A 2PDXA 4U2ZA 1ESWA 5K7JA 1UUQA 3DKJA 4AFYA 1GCYA 3HMCA 1XRVA 3R2GA 1HJSA 4ZZ9A 3CHDA 5CZJA 2VX4A 2ZRWA 3NQVA 4PBGA 1TPEA 1ZJAA 1JZ7A 4J28A 2FDSA 4CQBA 3EX3A 1FWFC 1S5VA 4U2YA 5H2ZA 3QV6A 3TUUA 2PDNA 2AKMA 4FS9A 4PE8A 1CGXA 3RHGA 1ADSA 1OWQA 4WY0A 4H6EA 1KFLA 4XBSA 3GH5A 2V67A 2Z28A 3GXDA 3TKFA 1XG4A 2Y1HA 4EAYA 4DBSA 2DPEA 5I03A 2J13A 3CJPA 3A22A 4JTGA 2EPHA 2J8TA 4G8TA 1ZPTA 1P0DA 1GQNA 1ZQ5A 1F7BA 2QPXA 3AYVA 5EMJA 1R3VA 3EKZA 3E3HA 1OFRA 2D2GA 3ZJKA 3IRDA 2PDPA 3LCIA 3PUGA 1Z41A 4J1OA 4M1RA 1YXYA 4FOKA 2ICSA 1G5AA 5XINA 3LMZA 1JCTA 4BQ4A 1H7PA 2VRJA 1VAHA 2ZA3A 3ITLA 2NXHA 1V77A 2NLYA 1B57A 3XIMA 1S3HA 1J01A 5DMYA 3MMDA 4TOQA 3GXPA 3OQEA 1L2QA 2A1YA 1VPYA 4IPLA 3C8NA 1QW8A 1FA2A 3UA4A 1R38A 2PE4A 2FIQA 1TCDA 2VR2A 4MAZA 4O1EA 2CZVA 3GHRA 1MRQA 4JQ2A 4IP7A 4UXDA 2QGHA 3GTHA 3E2RA 5E9XA 1WA3A 3N4EA 3AIRA 3VGBA 3GNPA 2GQAA 3AROA 4S3KA 3WH9A 2PTXA 1XISA 4P7RA 4N9BA 2DZPA 4DJED 2CLPA 3LDVA 4I5RA 3W7JA 3M07A 3N14A 3W88A 4OQVA 3G3DA 5EMLA 1ZALA 1OVDA 2VRKA 4MY9A 4DF1A 5AC4A 3A4WA 2D23A 3BANA 3STEA 5G2WA 1G7UA 4V1XA 5JIPA 2QULA 1HVXA 3N9KA 3APGA 3ES7A 2Y8VA 5JVLA 3I4KA 1VH7A 3K8KA 1MFVA 3MDUA 4NT0A 2O7SA 1OGBA 1EIBA 1W9PA 1HKIA 4GLEA 3UCCA 2P53A 3KBJA 4E8CA 3EMZA 3FAXA 5KETA 1M53A 1TO3A 2FHFA 2OU4A 3H2EA 2EHHA 1JYWA 3UWQA 1B3WA 4AEOA 4K8EA 3WUGA 1S2AA 1K9EA 3UWEA 1E9YB 5FSEC 4GJ1A 3TA6A 1FFRA 3V36A 2C0HA 3TC3A 1PUDA 2PZ0A 2C1GA 4M0XA 3KFTA 4LBSA 2J25A 2Z1XA 3RG6A 4K8GA 4WSJA 3E74A 1DIOA 4KWUA 1H1YA 4GKTA 3GVVA 3KWXA 1Y5XA 3TR2A 4QLKA 4Z17A 2W62A 1KFEA 4PYSA 1BD0A 3GO2A 2CHOA 3O06A 1QW7A 1EP1A 4EF8A 3DERA 3CL6A 1FDYA 3M0VA 1O5XA 4QP0A 1F5ZA 3U2CA 3L2MA 1JXJA 4DYKA 5A6AA 1TKKA 5FF0A 1EP2A 2RUSA 3A64A 3KOXA 1AA1B 2P8BA 4N02A 3LGDA 3VI2A 3WIJA 2TAAA 3T55A 4DJDD 4K7YA 5CPMA 3GTFA 2EKCA 1E6XM 1JRCA 2PDJA 1LWJA 4U31A 4C1KA 1FWBC 5E0FA 2OEKA 2NQHA 3WLMA 2J7DA 2PODA 4UTUA 3S83A 3PG8A 3FJLA 2GJXB 2X1TA 3W83A 4IQLA 2VVNA 3HV8A 4AHOA 4GC3A 4CD5A 1RUSA 3CAKA 1YTKA 1RP8A 4YHGA 3WJYA 1SJBA 2BASA 4BWLC 1FY6A 5HINA 4L1XA 4V28A 3OPSA 2WCAA 1F07A 3R11A 4L5ZA 4PEEA 4K37A 1EOKA 4B4FA 1DYSA 4AVNA 1GT8A 5ECVA 1EA9C 4V15A 3PBYA 3T9PA 3UP8A 4IX2A 1BGGA 1IEVA 3UZWA 5A6SA 2YIHA 3NVTA 2E6DA 3PBWA 2PTWA 4LF1A 3DYPA 3NXLA 4IQEA 1XV8A 1S5WA 3NSMA 1Q6DA 4UQCA 4LSBA 4XBJA 1PZ3A 4CQAA 3ABQA 4HZ8A 4REQA 1V3MA 3BUVA 1OFAA 1OYAA 2XIQA 4WDXA 2DZXA 3LXBA 2YLAA 1JUBA 4IPPA 2EPOA 3GY1A 3PWGA 4NSBA 3W3OA 1PEZA 3KEHA 1E72M 1OX6A 1HUVA 3ZR6A 4AD3A 4HN4A 5CGQA 3IRSA 3VDGA 3S6TA 1UA3A 3CUZA 3NGJA 2DT0A 2DZSA 2WVUA 2IW0A 3WLRA 4FMVA 4J4KA 1EJ7L 3MANA 3FK4A 4HBKA 3RCMA 2WZIA 4OU1A 1M1BA 3B03A 3LQLA 3CYJA 4XAGA 4CU6A 4OGZA 1UJQA 1MEHA 3P81A 4AAJA 3B8VA 2YL6A 3WLJA 2FH8A 4CUCA 2OTDA 1KV5A 4FR1A 4K7VA 1FCUA 1VGAA 3LI1A 5HQLA 2O4MA 1IEWA 3WD4A 2XH4A 1SZNA 2H3DA 3R0DA 1OX4B 3WBWA 1HL8A 2GQ3A 3CZ8A 4YCPA 5LIWX 1ZL1A 3TK7A 1I45A 2REQA 2ZADA 4M6PA 1EIXA 1M01A 1R5YA 1XIBA 3WMLA 1P48A 1VENA 3SBFA 1Z42A 2WO5A 2NQ5A 2BXVA 3CUHA 5DY2A 7REQB 2ZRVA 3LY0A 1CPUA 2E67A 3F4CA 1LG1A 2VZOA 3KCJA 1SJDA 5HATA 4IPNB 2QDDA 1MQQA 1UZ1A 5K3VA 1UWAA 5I2UA 3WLHA 4NYUA 1CX9A 2F6KA 3AO0A 1X7IA 3I6TA 2WMFA 3ARVA 1VRDA 4UCGA 3IV8A 5A6BA 5E70A 1XGEA 4ATDA 1KC7A 2XN1A 1O12A 4IMEA 1UP0A 1PXGA 2PWUA 2PBOA 4OECA 2Q09A 2XVKA 4GWEA 3G1DA 3URBA 5GJPA 1WDDA 1IXNA 3WLTA 4I3GA 5IFTA 3C8FA 1TJRA 3HZ3A 1ZP4A 1O1ZA 1IR1A 2IKHA 3L5LA 4AF0A 5JH1A 4N7QA 4PUNA 1PDYA 2V5LA 5A8PA 5AN7A 4IGMA 5CSYA 2ON3A 3GNOA 1RY0A 4DNHA 1XINA 1I60A 3G1AA 2DEPA 3PAOA 2OVLA 1VCGA 3QKEA 3EKLA 4Q4PA 4XQ6A 4GJJA 1A5NC 3RX3A 1JYVA 1WPCA 2YJQA 5CQ1A 1UPPA 3H7VA 3CQHA 3UU0A 1JZ2A 1HIZA 4RDWA 3CQIA 1HJXA 2HVNA 1K70A 1LL7A 3L0GA 2Y7GA 7A3HA 1F4AA 4G6CA 2VFGA 2XH0A 1CT5A 4LV4A 3NQMA 1WKYA 1MXDA 1ZJIA 3CC1A 2OB3A 2A3LA 4LAUA 3W75A 1ALDA 5AHEA 4PMUA 2E5DA 1OCBA 3TV8A 3PTQA 4X61A 1FDZA 3RGTA 2OXNA 3M16A 3KS5A 3CV2A 4X63A 4XZWA 1KLYA 2QGYA 3PC0A 3U0HA 2J75A 5J04A 3O8AA 3GXMA 4IICA 1YMYA 1R9ZA 2ZFAA 3NM1A 3UY7A 1E9LA 2VQTA 1ME9A 4AX6A 2VFHA 3CQKA 2XFWA 3G1YA 1EJWC 1XRSA 1K8CA 5T9CE 1DQUA 2R1PA 1XRFA 2H90A 4HHPA 4L6DA 4C1NB 1QW9A 2A3BA 1EPXA 2A3AA 1XLAA 4UTHA 4ADTA 3QV8A 1QOQA 4BF5A 1N55A 3NVDA 3Q67A 4EPKA 3MPGA 3VX1A 4PCPA 3F2DA 4XD3A 3L4XA 5HJLA 1XRTA 3PULA 2Y8KA 3POCA 4UFLA 4F40A 1MVYA 1P7TA 1UROA 2ZXQA 3TH6A 2R82A 1N8WA 5K9XA 3ZLHA 1SVDA 3SUSA 1KM2A 3RLHA 4QE5A 3DBNA 3EA1A 5E0KA 3CV7A 4JD4A 3UW6A 1TPDA 2VC6A 4GNVA 4DUWA 2A6LA 2PD5A 5HWMA 1QXLA 1KTNA 3VK5A 4O0ZA 5IRPA 3QSRA 1LF1A 3FY1A 1VBJA 4S3DA 5D2WA 3NZ1A 5L9FA 1OFBA 3LGEA 3LEPA 2WQDA 1YYAA 3STCA 4CD6A 2EJAA 2FGBA 1BRLA 1K4HA 3C52A 3ICJA 1J0KA 4A05A 4AVOA 2NSXA 3NFUA 3BQ6A 4GGBA 1HJVA 1EXBA 3UGRA 4AXNA 1BVZA 3DG3A 3AJXA 2VZVA 4K39A 3WLPA 2XN0A 1GOQA 1QNSA 1JAEA 3WDRA 4AU0A 2AL2B 3V18A 4L64A 4H8NA 3WJSA 4ZGYA 3W22A 2HS8A 2FTWA 4NZFA 2YGYA 3RU8X 3WJXA 4YTSA 2WNNA 3GU9A 1X1ZA 1ONRA 1TMQA 1VEOA 1Q65A 3U6WA 1EOMA 3LLDA 1BF6A 1UOKA 4XAYA 2GOUA 3CBWA 1W1A1 1QMLA 1E4IA 1JNEA 2OLHA 1NELA 1TRDA 3PZMA 4U5IA 4LUTA 2X0YA 4HHLA 2YA2A 4GO8A 4XKYA 5I7GA 5D30A 1K7EA 1JRBA 3N34A 5GJNA 3GFZA 4UQAA 2ESCA 3RR4A 1LT7A 3BL3A 3BLOA 3TYCA 1EA0A 5EPDA 1GTHA 1YX1A 3WQGA 5FL1A 5IBXC 5A6LA 1XBVA 1OF6A 3AALA 3VO0A 4WRHA 4UFJA 2BMBA 2EG6A 4HP5A 4R5EA 3VUSA 1B3XA 5JUVA 4H8UA 5I24A 1DVJA 1N7KA 3BLIA 4NJGA 4CU8A 3MC5A 1VJSA 2WPBA 4ACZA 3WBYA 4OHQA 2V63A 1YXDA 1B30A 2CCRA 3ELFA 3WBAA 5KMYA 4O52A 4RPPA 4PTDA 1KWKA 1FWEC 3O6YX 5BZAA 3BJSA 5I0DA 2H8XA 1VRXA 1E0UA 4B5VA 2ZRYA 1QJWA 2VZUA 3R4IA 5TIMA 4IGHA 3FS2A 4F2BA 1NP2A 4ZXOA 5I6SA 3IIVA 1A5OC 3L9CA 3JU2A 1VFSA 1XIJA 3DEQA 4KETA 4E4FA 2HE8A 5BRPA 3LD5A 5J5RA 1BLIA 4XZBA 4BKNA 1NAL1 3O63A 3NQCA 3O3RA 2G4FA 1TTQA 2YLLA 4JKLA 1XLGA 1XR2A 4NJJA 3A13A 2X1IA 1TELA 4JFUA 2CESA 4E2DA 1YPFA 2HZGA 3UNTA 3RXZA 3R8RA 2QJIA 5AFDA 2C1IA 1A0CA 3TEVA 2YB1A 2POZA 1Q4NX 4YVXA 1YEYA 4UQEA 1DJGA 1V02E 4KERA 2JIEA 4IG2A 2W3ZA 1XXXA 2OFJA 2Y89A 1BKHA 5D9OA 1EO7A 3K46A 4GA8A 4LY4A 3TYBA 3V5FA 5D9MA 4PUMA 2ZZ7A 5DN1A 2FPTA 5LA2A 3NM3A 2V5BA 4JIPA 2OELA 3IARA 1LORA 2CBUA 2GGIA 2X0HA 2PLCA 3MUCA 4QROA 4KCWA 4JGDA 4WJXA 5LA0A 3C0SA 5EMUA 2B7PA 1WDRA 1CLKA 1OGGA 1BAGA 5F1UA 3IAQA 3P84A 1BWKA 3WJZA 2NVDA 1XG3A 2CWXA 2REQB 4CNPA 4KPLA 2Y6ZA 1WP6A 1S2UA 3C2FA 5AYBA 2YBVA 3KS6A 2DFAA 4LW7A 2OLAA 3NPWA 3C86A 1TZ7A 4JPGA 3IGHX 3SRFA 3M64A 3SFKA 3VKAA 4DXXA 3VIIA 1HKJA 3MBDA 4PSRA 4N42A 4JQ1A 5FJIA 4YLWA 1ZLPA 1MO0A 4FX7A 4PGLA 4AY8A 3BLEA 2YW4A 2ZUSA 4HNLA 2ACSA 4FLSA 5GNXA 4QJ5B 5AVHA 1ADOA 5FJTA 4AWEA 1OBAA 3NO5A 4QCEA 4L65A 3VE7A 3WEOA 1ZCCA 2QDEA 1XLDA 3UYCA 3TONA 5CBBA 2ZZ4A 3SUVA 1G69A 3TYAA 2D0GA 7TAAA 1XYCA 1GWJA 4GG9A 3EX6A 3CGTA 3PTKA 3EA2A 1XIFA 3WSUA 1HO4A 3OZOA 4I7VA 3O6DA 4YL2A 2JKEA 2VVSA 1ZBCA 3SDOA 3EDDA 5I23A 2YYTA 2BBFA 4HA3A 1I2OA 2X2GA 3ARZA 3TZFA 2WCGA 4DELA 4B5UA 3AZTA 4K36A 4NNCA 4TX9A 3POHA 1JI2A 3PPGA 2Z0IA 4M19A 2VO5A 3RK8A 3VD3A 2GK1A 1HKKA 2DDXA 3TTYA 1BFNA 1RK5A 3FIGA 3OQ8A 2W0UA 1V08A 2G3NA 1ODUA 3ARRA 3NURA 1OADA 4ORMA 1UD8A 1IZKA 3VIPA 1GORA 3HBLA 1IEIA 3G6MA 3TP4A 4IISA 3GH7A 2A7RA 3TLLA 1FFQA 1PTGA 1YQ2A 1UR1A 2GVEA 3OB8A 4UTIA 3MZNA 2VJXA 1XX1A 4UTJA 3V16A 4I8YA 4B90A 4L1GA 1W5QA 2G96A 3SQLA 2VD9A 4HKPA 1C92A 2QDGA 4CD4A 4UR9A 1FCBA 2VDIA 1PYFA 3WQWA 2NT1A 2FMNA 4XBKA 4DXKA 3N9RA 2ZE3A 2TODA 1RA0A 1XLEA 5E6YA 5FAJA 2H8ZA 1W5MA 1GHSA 2JE8A 4RK8A 2PDKA 2IXVA 5DRCA 1PZ2A 3RM9A 2WVVB 1PHWA 2CKSA 4H9MA 3MI6A 1OGSA 3BSMA 2PI6A 2PLJA 1WDQA 4Y8EA 1UW9A 4S39A 1YW1A 3VD5A 3EDKA 3G1XA 3BAIA 2RDTA 1A5BA 1ZAJA 3QZ6A 4JY9A 5ABEA 4KCVA 3UR7A 2OZ0A 4IWWA 5JH2A 4MKNA 1LM1A 2BODX 3LCWA 2O0TA 5CJMA 3VILA 1JCLA 5T8GA 1R3QA 2ZXAA 3M5VA 3CEPA 3GIQA 4K1GA 4BR1A 1EKOA 3MUAA 4A21A 3VYLA 5A6KA 4ALDA 1LOLA 2VDHA 4DZ5A 1CLXA 5A8MA 1DIEA 3ARUA 3R0KA 2J7EA 3N04A 3VKBA 5HWJA 4LS1A 4H6RA 1EWDA 2D2JA 4RLIA 2GQ9A 4OBSA 4ML9A 4FA3A 4GYPC 1YBQA 2RJHA 3TC6A 5AVNA 4JFSA 1CWYA 4LAKA 4A3UA 4ADSA 4EP8C 5C54A 4LAMA 4PTMA 1OFOA 1P1MA 2WZEA 3KOYA 1OFEA 3C0QA 3M5ZA 3OGSA 1VP5A 1H0GA 2PTYA 3SN0A 1CXHA 3HQPA 4QGCA 1GYNA 5MKGB 4P7OA 4ENLA 1NOUA 4ZQOA 4QRNA 2ZTJA 2DZWA 4JHMA 1LTDA 3NYDA 2GGHA 2VZSA 2F84A 3FA3A 2JALA 1XSJA 4FNSA 5I3GA 1G4TA 4NXSA 4O8RA 4MWAE 4MSSA 3BCDA 1FOBA 1WDSA 3GBDA 1B3VA 3SQSA 1I1WA 1QOXA 1DWIM 1FWTA 1ISYA 1DWJM 4FK9A 1UOZA 4XWUA 4D72A 3AISA 3UWZA 3T0DA 3WH5A 2BVDA 5CSRA 2W4XA 3GB6A 3SSJA 2PGWA 5FEZA 4V27A 5CLTA 1OCJA 1XP3A 5DANA 1A5KC 4FNRA 2CXGA 4D6JA 1B54A 2PDUA 3AYSA 4PB5A 1BHGA 4HD5A 1XYBA 1RSCA 1CGTA 3ORWA 3BG3A 4CNTA 4R7JA 4AWSA 2IUZA 1ISZA 1QDSA 1QFEA 3LPPA 2ZZ3A 3OJGA 2IQDA 3DCPA 1Q6QA 3P5ZA 3QZEA 1D9EA 4LVDA 4UTWA 3EWBX 5HAOA 1W31A 4FI4A 5HOSA 1EYWA 1REQA 4UFKA 4I6VA 1UQZA 4DBWA 1VJIA 1SM9A 2XWEA 4R9OA 1KFKA 1G9HA 3JUGA 5KSWA 3M0MA 2RJGA 3CAVA 4J3ZA 1FVPA 3C4UA 3UG5A 1EHAA 2QIWA 2CWNA 2VR4A 3FNDA 4C6LA 3WQOA 1XLLA 5D04C 4M82A 3OLIA 4WVXA 4IP4A 4IGNA 1OF8A 4F0MA 3G0XA 4FB7A 3N6HA 4ES4A 2D2OA 3QJAA 4LUSB 2L5HA 2R8WA 3MVIA 1LCOA 3B9NA 5DO8A 4NHVA 3VOFA 2GLKA 3UWVA 1EXPA 4HMEA 6XIMA 1AQ0A 3ITXA 2HVMA 4HU0A 4I5XA 3W26A 4CKQA 3H6OA 4PMYA 3WF1A 1PJ9A 2HNEA 3EGJA 3S1XA 5B7YA 5BYWA 3VX0A 2CLEA 3CU2A 3W87A 1TTIA 2F2KA 4RZ4A 4LANA 5GNYA 4JDYA 3W7OA 4LVFA 1C90A 3GR4A 3MKVA 3V4BA 4ERIA 1UD3A 4JAWA 3T1GA 2OGJA 3U8GA 4H1ZA 4C5ZA 2C91A 1XWYA 4HHMA 3L5AA 4XIAA 2HPIA 3VXGA 4JHOA 2XYLA 3GVGA 4AZBA 4XAPA 3GAYA 3GC5A 4WXYA 1EJXC 4JIQA 5CAKA 4WDWA 1C29A 3A9IA 4JEQA 1E6RA 3LV6A 3R25A 4G1NA 4WXZA 3GWQA 3M5YA 4IPJA 3MSRA 2IPFA 4P8UA 2XVNA 3M9YA 2PWVA 2G3FA 4CU7A 3BJTA 4LQ1A 1GGOA 4KWOA 4NZJA 1J0ZA 1UBSA 1RQEA 4CCDA 1F3XA 2BHZA 1YHTA 4A4AA 4MWAC 3G22A 3OU8A 1NDWA 2OZTA 1JFXA 1OC5A 1VFHA 3KUMA 1XH1A 5I3FA 2WHMA 2CLKA 4LOCA 1CW2A 1W9BM 4FNUA 2HSAA 2V5DA 1NWUA 3ZVIA 3CK5A 4KRTA 3T07A 4MM1A 5CPLA 1Q8AA 4IIHA 2ZX9A 3LXCA 1JDFA 1SJCA 4Q4SA 3WNKA 2QQ6A 5F4SA 3E5PA 4AZGA 2G5WA 4AD2A 3QHMA 1WXZA 3NZPA 1MNZA 1V8EA 3UERA 3HF3A 3FKKA 3GR8A 3UCQA 1RQHA 4R88A 3RN6A 1WKFA 4EXBA 2C18A 2XWDA 1W54A 2R94A 3HU7A 3DN5A 2PP3A 1PTAA 1JPIA 1GVYA 1ZSXA 2VFDA 1TPVA 3AJ7A 1AMKA 2DW6A 4B3KA 1X6LA 1H7OA 1RV8A 1SGJA 3WK3A 3LBOA 3WQDA 3DH7A 3HG4A 2OR2A 4PCFA 4UMBA 5PTDA 8XIAA 1JIBA 3W7HA 5A2CA 4AHQA 1HKWA 4JCMA 3W6YA 3W86A 4A3HA 2YW3A 3SSZA 2EG8A 4RW5A 4KKXA 3S1VA 1TFVA 1PDZA 1S39A 2QJMA 5SWUA 1IEXA 4QQUA 4FOJA 4QM1A 4GISA 4ASTA 1JF6A 1S5NA 1VIZA 3N25A 2DT1A 2VELA 4N0RA 4WEVX 4ZO7A 3T2OA 4EE9A 3G2GA 4ZQRA 4QDMA 4FHAA 4G1KA 1O5KA 3FKRA 3B97A 3SECA 1V7AA 5BXRA 1J5SA 1G4EA 4CCCA 1V6VA 1ONEA 3WF4A 1J9YA 5D4YA 4QSFA 3LRMA 4LC6A 3U2ZA 4WKFA 5BNKA 3IK2A 1U33A 1C8YA 3W4RA 1X1OA 5FJRA 3KOWA 1LQ2A 3K4AA 3W1NA 2WJFA 3M0KA 3R5EA 4WGHA 1IXQA 2PTDA 1LRNA 3REQA 1UR0A 4HPHA 3WZ0E 3C2YA 5AYZA 4JFTA 3UG3A 2Q8LA 4YWIA 2Z26A 4FLOA 1YTEA 2J4GA 4UOZA 1H62A 1NQ6A 4W9TA 9RUBA 1QPNA 2J27A 1EB3A 2BG5A 5CC5A 3HTWA 4H01A 5KEZA 1XKYA 3N9SA 1UKOA 3AIVA 5F2LA 5LIYX 5KITA 1S2VA 3W6MA 1PCWA 3S6DA 4KEMA 4B5TA 5HXMA 2ATSA 1K8XA 1XI3A 4NG3A 3PBUA 3IVSA 1X98A 2OSWA 3HQ1A 3R10A 4HZ7A 2GUUA 3H4WA 4GIYA 3BGAA 1UZ4A 3UNDA 1NU5A 4HVXA 3VGDA 3O7UA 2FZ9A 3G6LA 4FOUA 1UG6A 2PF0A 3WEMA 1I0DA 2EPMX 5DELA 3PK7A 4QE1A 2PCQA 4UTMA 2OLSA 4MB5A 4A8IA 4AWTA 4Q8PA 1BVNP 4REQB 5CC7A 1LOSA 4RW3A 2E1DA 2PA6A 1PAMA 3W28A 1WXJA 3SADA 1YLVA 2WVTA 3PBGA 1CXFA 2W61A 3ZT6A 2KAUC 3SB0A 5CPNA 4WDTA 3N3TA 1SR0A 3A24A 2GGEA 3QM3A 1KRCC 4OIFA 4E8GA 1ZCOA 1EBHA 5D2XA 4PODA 1Q3NA 4YU1A 1K77A 3W7KA 2G97A 3H7RA 2QF7A 2DVUA 4UTKA 2GL5A 4R33A 1XIEA 2HMCA 3SUUA 4LVBA 3GVRA 2PFHA 5K9DA 4TVCA 1JGIA 3LHWA 3UXLA 3GXNA 4BWLA 3CIWA 3VNKA 1IXOA 4PMDA 1OC6A 1GVRA 5DRIA 1QNVA 2C15A 7ENLA 5AZ1A 2VX6A 2O9RA 6A3HA 4C6CA 3SZ8A 4A35A 3RM4A 2VFEA 2PDYA 4Q4QA 3U48A 1L8PA 3IJ9A 1OG0A 4NX5A 1FH9A 4HCLA 2OYMA 3STGA 5A8QA 3U3HA 4CNOA 2QZRA 3WNPA 3VU2A 1VIWA 3PM6A 5DQPA 3AOFA 2OQLA 3M6YA 2P76A 3ZYZA 3S1UA 3E2QA 3CQJA 4JTLA 3AS1A 2OKTA 1QCWA 3V7PA 1VYSX 3E2VA 4EXAA 1Q7ZA 2YSWA 4LY8A 4US5D 3P93A 1TRIA 1UMLA 4H8VA 1KKOA 3VM7A 2BVTA 3Q94A 2FHBA 1F6YA 3PTMA 3N6JA 3V5CA 3O0KA 1PZ0A 4UTFA 1Q63A 2NX9A 4IG2B 4ADUA 4PBFA 2GOKA 3GHTA 1K9DA 3EOEA 1RHCA 1A50A 3L4WA 3VIMA 1WOBA 1RALA 2OMAA 5CKSA 2EEXA 2IKIA 4NX0A 5E9AA 4YPJA 1GUVA 1XYFA 3V0TA 3W7DA 1VYPX 4FXRA 2YPIA 4O4WA 3TE9A 1RK6A 4ZR8A 2MUCA 3EPMA 1EEPA 1TPC1 3VIHA 4F2UA 3W74A 2DSVA 2HQAA 2X40A 4KBXA 2J78A 1SPQA 3R12A 4LFYA 3WX7A 3GFXA 3JZEA 3GSMA 2HBXA 3IIPA 3C3NA 4UMAA 3NSNA 4LAZA 4PZVA 2DGAA 3QOKA 1G4SA 3WQEA 1GOKA 1WNOA 4JNYA 5E6ZA 1A53A 1W0MA 4YHEA 2J7BA 3GC2A 3IJLA 2TYSA 3SRKA 3W2MA 2GFTA 5AHIA 1QHOA 4L1WA 1HZYA 3P82A 1W3TA 1ZRQA 1YRRA 3GXTA 1S1PA 1ZBWA 4LNYA 2E4TA 3VFLA 1EJTC 5BMXA 2PSNA 3DG7A 3DECA 1FBAA 4MLJA 4CD7A 3BTNA 4ICCX 1UWQA 2DORA 3NQ6A 1R9YA 1PHQA 4XB3A 4UR8A 1KD0A 1KCLA 4Q22A 4TXEA 4H8HA 3A23A 3RUBL 1GZJA 4GVFA 4B4HA 2A3CA 3LS9A 2VXNA 5D37A 1D3CA 4N6EA 4C5YA 1HXJA 2HK0A 3IGSA 3MMUA 4PTVA 4GUJA 2V2HA 1BPLB 1KGXA 1Y8BA 2R1NA 5M17A 1VS1A 4TMBA 5C9XA 4LNCA 4WOZA 1FHUA 4D6DA 2UWFA 1J0JA 3KCOA 1D3GA 1O95A 3LZ5A 4MADA 4MUPA 3BLPX 1C8VA 1WV2A 3NDZA 4NIRA 2Y4SA 3ARWA 3RF9A 3MBFA 2BXYA 3EKGA 1UPMB 1XF0A 1NDZA 2ACRA 2J7GA 1V6WA 2G0WA 3NGFA 1JQXA 4K2SA 2BY1A 1JFHA 3S2CA 1CXEA 3DFHA 1XPYA 1GK8A 4HJFA 4YYCA 3HMJG 4WSHA 1XLMA 5LNUA 1F3TA 3FW6A 2ISFA 2VEKA 1MW3A 1Y65A 4QHRA 3N4FA 4RNJA 4Y6GA 3PUEA 3CIXA 3ID7A 3L4TA 4DLMA 3QPYA 4GUGA 4I90A 1YPIA 3OZYA 5BXPA 2RGLA 1B3YA 1TIMA 3V35A 3U2OA 3EWXA 8CGTA 4XZIA 2WAGA 4LUIA 4AZCA 3EA3A 3VE9A 2E77A 3BICA 1UH2A 3H2FA 4WJ8A 4JEJA 3MJYA 2YDQA 1TZZA 4LUSA 3BAKA 4XTIA 1TWIA 3WD0A 4LAOA 3BAJA 3GK0A 5F7UA 3MHGA 3S5SA 3LHTA 4Q3MA 3BZJA 5CGMA 4DF2A 2ONEA 3CWNA 4IX0A 2W6RA 1Q6OA 4EPBC 1BQCA 4PMVA 5EMMA 1S5MA 4D6EA 1JI1A 5C5YA 3A12A 1JXKA 1XLHA 1AW2A 5AHLA 1UA7A 3H70A 2FVLA 1Q4WA 2X7WA 2P88A 2INFA 3DC8A 2NX1A 1TREA 1Q5MA 2XJ7A 2WWDA 2QPUA 1QI0A 3TN4A 2OSYA 4BEUA 3BWWA 4DNMA 3WF0A 3L66A 4AIEA 3VNLA 4I8DA 2I57A 4MNLA 4YNGA 4B3LA 4I5UA 4ERAA 4ICMA 3AIWA 1LROA 3GZ3A 1T7LA 1T40A 2IQ0A 1L0PA 3SY1A 5I00A 3GTNA 5G1YA 3SR7A 4OE7A 2WJDA 3OLEA 3QSTA 4BEQA 1F05A 1I1XA 5BWFA 2BWGA 3EYPA 2BXZA 3UA3A 1IHIA 4GVGA 2C79A 4GGHA 1EQPA 3FEQA 3IUDA 1J4EA 3PR2A 3GNNA 4XUYA 3MS8A 3LK6A 2X41A 4R9XA 4WSKA 2ZQ0A 4FNPA 3O0FA 2X8RA 3LCFA 1WQ5A 3GU2A 3VA8A 1JZ8A 1A4LA 4PTWA 2E9LA 4PFHA 4ILSA 3CZLA 1BRLB 1HNYA 3DFNA 3MHUA 2Y5SA 3D46A 3VABA 1G0CA 4CVWA 2O56A 4PEKA 4MY1A 3VOIA 1PIIA 4GBUA 2CITA 2W63A 4WKAA 3PUDA 1W9XA 4PMQA 5D2YA 3VCCA 4WLCA 2W66A 4C60A 4OFCA 9CGTA 2WK2A 1XIIA 3NO1A 4GI4A 2AL2A 2H3BA 3KZPA 3W85A 4HK7A 3WG6A 3F1QA 5LA1A 4GPNA 3CAWA 1M6JA 2W91A 4L9ZA 4DN1A 2EAWA 3TMLA 4GI6A 4GXWA 2B4GA 3R58A 4PB4A 5C2CA 3CAQA 2DVTA 1E0VA 1I8JA 1NF7A 1W3LA 4KS0A 2NV1A 3OYZA 1QVBA 5HMFA 2I14A 2AOSA 3COTA 3KRSA 4LWWA 3AYTA 3G5EA 1V3JA 5I07A 3DUGA 1V0NA 3L68A 4AG0A 2CLOA 2ZC1A 3SAZA 3L4ZA 3G1VA 3JS3A 1A49A 3WLSA 3EWZA 3VKDA 5CBIA 1FHLA 4R7OA 3TXVA 1F73A 2QNEA 3WDQA 1IGWA 5D8WA 2VOTA 4H9YA 3MW7A 4G9PA 5D33A 1LG2A 2B81A 2ZUTA 5D05A 2PTZA 3DI0A 1XHGA 2Z25A 1GJPA 2J24A 3AIUA 4EOUA 4W87A 5JBEA 4S3JA 4HA0A 3UZZA 4JTSA 1HTIA 3AXHA 1DBTA 1C7SA 4NZ1A 2XSAA 1VR6A 1GHRA 4BS0A 3HPAA 4FIRA 1OM0A 1M7OA 4H04A 3UG8A 4ZQPA 4EWJA 1RQBA 5D02A 4IFKB 1IYXA 3WEZA 3GUGA 1TV2A 3BMVA 3DENA 3OGRA 1GZ1A 1XUUA 2VTFA 3QHNA 3CASA 3V75A 2XVLA 4QCFA 2E25A 1HO1A 1GOOA 2INZA 4DYJA 1JZ4A 3VC5A 4QJ4B 2G8ZA 2HDJA 2ACUA 1WE5A 1YTDA 5LNSA 4Z2LA 4FLQA 3LZ3A 1W1PA 1EGVA 2J6XA 2GDQA 1PS9A 3AMDA 4H4IA 2OX1A 4PCTA 5HR6A 3AXKA 1VCFA 1HGYA 4KWSA 1YE6A 1VBGA 3UR8A 2XIMA 4ZB0A 4FAMA 5C7HA 3E0VA 3WLKX 4HSHA 4HYWA 4YJ5A 2Y7EA 1R3RA 3L5MA 4GJIA 4J3UA 1XSIA 2NXGA 3MWCA 4BQ3A 2VGIA 2BSLA 3IWPA 3DFTA 4HSNA 1CIUA 1ZZMA 3VM5A 1FX6A 3HOJA 3E0WA 1VHCA 2VWSA 5DCBA 1BXNA 1J0IA 1JEZA 3MA8A 1UWIA 3OVRA 3TU9A 2FGLA 1F8IA 1XC6A 3MI2A 4ZA0A 4MIMA 2V3DA 4UUIA 1CNVA 2EO7A 3R8GA 4CN4A 4J3SA 2BS9A 2W79A 3S42A 3SCPA 5JXQA 2NUWA 1GJUA 2O55A 3MP3A 1CEOA 1U2YA 4IMCA 1I2QA 2FQIA 1VQTA 4Z0SA 1SZFA 2QT3A 2WYSA 5HULA 1XLBA 1ODZA 4UQDA 5H1WA 4K8HA 1NARA 3VOJA 3A5FA 3CHVA 2QCLA 3J7HA 3OLDA 1KRAC 4W93A 2GJPA 1TYGA 4WUIA 4D1IA 1DL3A 1PX4A 3S1GA 3TZNA 3WQFA 3OZMA 1AH0A 2FVMA 4OV4A 4YN5A 3KP1A 2OEJA 5BU9A 2FFIA 4DRSA 4QAWA 2E0PA 3PN8A 1KRMA 4NQ1A 5C6MA 1R46A 1V3LA 1KM0A 2DJXA 2XZ9A 1AD4A 3ITYA 1R87A 4J2MA 4E38A 3G77A 4J40A 2VGFA 2A79A 3GIYA 3S2MA 1SZGA 3CUXA 3TOPA 4W84A 4GE8A 1VBRA 3ZZ1A 5EMKA 5CBJA 4D6HA 3S2JA 3C2OA 3MUIA 3TJIA 3AS2A 3RDKA 3PPCA 3PVFA 1JDAA 2FZDA 3MCNA 3EPOA 1MFUA 1IT0A 3O6CA 3T78A 4ZTYA 3LG3A 1FQ0A 1QK2A 2A6NA 3SCNA 3NQ7A 1WBJA 3QH2A 1NWSA 3GX9A 3LHUA 3MMWA 2HCVA 3U9IA 3ZS4A 1GOIA 1TV7A 2WBKA 4NASA 1YDOA 3I65A 3DHDA 4LGXA 3CQ0A 4UFIA 1W5PA 1ZBKA 1C93A 2WANA 1SMAA 2FZ8A 3LCGA 4L7ZA 4E2BA 4IMGA 3VZXA 3NO3A 2XM1A 2PF8A 5A8NA 4GK8A 3N15A 1TR1A 1U83A 3OIHA 4HNTA 3C6CA 3FSTA 2QCEA 3LB0A 4DI8A 1AJ0A 1CLVA 5AC8A 5BWAA 3FOKA 3U5UA 3WH6A 3O16A 2HISA 4MOZA 4FF7A 3KX6A 5U4NA 3WQ6A 4XSMA 3TTOA 3G1SA 2V68A 4DUOA 3KRZA 4B5NA 3PZNA 2WMHA 3M0LA 2VCCA 4E0CA 4E4UA 2OT0A 2XFYA 1JCJA 3TWBA 3ALFA 1PKMA 2PRHA 3K30A 1EX1A 5F2MA 3RO6A 3VDBA 3T42A 4ZQMA 5HQMA 2H6RA 1K3UA 2A5HA 1U1UA 1UUOA 1DXIA 5E09A 1TVPA 4GNKB 3LBMA 1Z8AA 2C16A 1DJIA 2NLIA 3QY7A 3LN3A 2GPTA 1W1IE 2J7CA 2WPGA 2XH2A 4MPQA 1NFBA 3IS4A 1OY0A 2ALDA 2VD8A 2XUCA 2Z6IA 3W2LA 1AW5A 1J8VA 4O10A 1YXCA 3N73A 1LLWA 4M24A 3L7RA 4F8XA 1PIFA 4LUYA 4AD0A 3WLNA 3W37A 1UC4A 3G8EA 3GC4A 3UJSA 4UTWC 5HNNA 2GSHA 4JTIA 2VCAA 1ICPA 4HJWA 5EY5A 2OWWA 3T0AA 1IZCA 3EX2A 3ITCA 1OCQA 4RKAA 1SQ7A 2FHCA 3NQDA 3OVPA 3LV5A 4KEUA 1IV8A 2V0TA 3WFLA 2J9XA 4RXFA 1AJ2A 4QG9A 5LXXA 1B9BA 3DOPA 4C6KA 2YKKA 4LYQA 2BV9A 4Y9AA 3OYXA 1VEPA 1C9DA 2FPYA 5AZ0A 4AZCB 3FHAA 3OG3A 1SW0A 1PTDA 1Z44A 3AIEA 1LLZA 1J0YA 1T8XA 2GJXA 1ZB5A 1GKRA 1QU4A 3GDRA 4V2XA 3RAOA 3VIGA 2ZYFA 5MHBA 4FEZA 1TVNA 2AMGA 2CFFA 2GGJA 2YCIX 1A3HA 3TW9A 4P5UA 2O9TA 2XGBA 1BG9A 3W81A 1TG7A 3SCOA 3USBA 4LTSA 2W9MA 2PWHA 3LERA 1FWGC 1MWOA 1BYDA 3EOOA 3UWUA 4CN6A 1E4NA 1QBBA 2E1WA 1OIMA 1TVLA 3SCRA 4Q8OA 4ZO8A 3SCVA 2GJRA 1YDVA 4R53A 4DWSC 3NZRA 3IJQA 4L4PA 3DGBA 4PMNA 1WKDA 4GUIA 1O1HA 4EVZA 4A2RA 2E9BA 4NXKA 4JIHA 4IFKA 3GVWA 4DAFA 4WZHA 1J5TA 1S1RA 1VFLA 2IPJA 2V5KA 3WNMA 3E0LA 4UQ9A 2XTKA 3F2BA 3EAUA 3LCLA 3A3WA 1EDTA 5A5WA 3PWIA 3IPWA 4Y8FA 2WZHA 5M03A 1HKVA 3I7SA 4MJ2A 1VPQA 3QN3A 1R85A 3F5JA 1F3EA 3BCFA 3PP7A 4XKMA 4XD6A 3N2XA 3PNZA 3IEBA 4DBUA 4JTAA 3FXYA 4GZIA 1C91A 5CH9A 3S46A 4X0NA 3UXDA 3MY9A 5IOBA 2ACQA 3NPXA 3ITVA 3P7YA 2IQTA 4K6AA 1YNYA 2YCJA 2A21A 3CUIA 3SCSA 1H7WA 3GDKA 3WQ4A 2ISVA 4GZEA 4S3BA 1KM6A 4LJ3A 3ZR4A 1A5SA 1TV8A 1SSDA 3RJYA 2NWRA 1NDVA 2QR6A 5ECUA 2V30A 1RJPA 3VCRA 3KLKA 4GUFA 4ZXLA 4XG1A 1QPRA 1E6ZA 3GR7A 2UY3A 4US6A 1RH9A 3PJTA 3EZ4A 1XCFA 4HOWA 3FJNA 4E3VA 3WBXA 1VZWA 4MKSA 3KWSA 2AKZA 2XU2A 3M0JA 4J7RA 4EX4A 3F03K 4N9EA 4B92A 1TQXA 1V4YA 2DT3A 3FVDA 5HDRA 3AXXA 1RBAA 3EX1A 4LRTA 1W9UA 3T8LA 2X05A 4F4RA 4PUEA 2G50A 1CCWB 2CBJA 4FXJA 4JYDA 3I7QA 1AK5A 1IXPA 2JKAA 4KEVA 3CYVA 2DZVA 3IVUA 4R85A 1LWHA 1POJA 2HTMA 3TQVA 3VZZA 3ZXWA 3L2LA 3EWCA 1ZBVA 7XIMA 2QUNA 2EG7A 1AQFA 2Z1VA 5AB3A 4IMFA 4AISA 2XG9A 1GKPA 4IXHA 3PJWA 1D3HA 4OVXA 3ITOA 3PBVA 4AY7A 8RUCA 1OK4A 1KLZA 3OHIA 4GO9A 3W7RA 3WENA 4KIRA 4PUJA 2QDHA 4IIGA 4KRZA 3IJDA 4FALA 2YXGA 1A4MA 3LHVA 4FX6M 4M6QA 3R7MA 4W86A 5A94A 2UY5A 3TXZA 4QAIA 1GQLA 3SUTA 4IOTA 4I9JA 1UD6A 1Z9AA 4M56A 4DJFD 6PTDA 2F8QA 4P7LA 9XIMA 3DFYA 2YZ5A 4GACA 2B31A 5FJPA 4BQ2A 3EWDA 3AXMA 5FF4A 3A47A 1MEIA 4NP7A 4O1BA 2C71A 3B8IA 1V6TA 3GNXA 1Q6CA 4LU0A 3AU6A 1LUCB 3BVJA 4PCNA 3A21A 4JIRA 4WF7A 3RPTA 3LGGA 1YDYA 2DZAA 1QAPA 3PPFA 1U5JA 4QS5A 4DPQA 1PV8A 3T2QA 4IJRA 3T4CA 2VX5A 3WL0A 3IGUA 3A5VA 3B0VC 3H23A 2PC8A 3AQUA 3URQA 4MJ4A 2A2IA 2AQVA 4GI8A 1ISVA 2I16A 2ZUMA 2WZMA 1O6IA 1ICSA 3LTPA 3HQNA 4AZ5A 3ZO9A 3QYQA 4FO4A 1D7KA 4CNSA 4IL2A 3N2MA 2CC0A 3P60A 4O54A 4R34A 1RVKA 1F9CA 2PCEA 3T0TA 4GZ7A 3QY8A 3FYOA 2I9EA 1YDNA 5LSMA 4IMAA 3KVMA 5CXPA 2JK2A 2XPKA 3QW4B 3H55A 1XICA 3B9OA 4F48A 2ZOXA 3MZ2A 4QDWA 3AZSA 2DUXA 3D3FA 4RNIA 2WVSA 1W3HA 2AL1A 1L6YA 2R6OA 2GJLA 2J66A 4O0QA 3WH7A 2VCBA 5AC6A 1WX0A 3OVQA 3ZT5A 5D03A 8TIMA 5F4WA 1TMHA 1K02A 4HYVA 1JCMP 2WSYA 4ZMGA 1AL7A 4C6BA 1RD6A 3KVLA 3H2CA 2VKZG 1VD6A 4MYAA 5EMYA 2D0HA 2J9ZA 1HN1A 3GHSA 3R13A 1IIHA 1UCWA 2QVHA 3TLQA 2VL4A 3STPA 3H4XA 3K8MA 1H1ZA 1VBHA 1CXIA 3PZUA 2QYGA 4X2RA 3MKCA 5CC6A 3BE7A 2PPGA 1LRTA 3R79A 3W1AA 2QPSA 1TJ1A 3HG3A 3MU7A 5H91A 1MUWA 2CETA 3AMLA 4FX8A 1CENA 3W1XA 4RDYA 1FP9A 5D2TA 5FF3A 4DWSA 1WB0A 1XDMA 4H2CA 1HL2A 3MUY1 2XSXA 3M0HA 1FTXA 2ZZ6A 4PFMA 3TNOA 1RZMA 3BJFA 3D6NA 1MQPA 4RPQA 4L9XA 4NNBA 4Z1DA 3EDJA 1YIXA 4G56A 4DUXA 3IIZA 1V0KA 5CC3A 3OZPA 2UY4A 3RFAA 2OO6A 4AB4A 2Y61A 4YCOA 4PULA 3QZAA 2OODA 4M80A 4IIEA 3TFCA 2QJNA 2A7NA 1RR2A 4GY7A 1W8GA 3ALGA 4XX6A 3SURA 3RLVA 2Z24A 4CNNA 4Q8WA 3T40A 4CCEA 2EF9A 2BY2A 3OEXA 4DWDA 1O7AA 3RILA 3UYIA 3LU2A 3AS0A 3S4TA 3KTCA 1EL3A 1C8XA 3AHZA 2Q3RA 5DMNA 2HVOA 3DFSA 3FA4A 5A95A 3WD2A 1E9IA 3BGGA 3FFSA 4DLFA 2J8GA 3PG9A 3WDIA 4YMZA 2VFIA 3DYOA 1MW2A 4GCXA 3W27A 3S5NA 2PDMA 3BARA 5HBFA 4MZ1A 5K2ZA 4DIAA 3FV9A 3T09A 2ZXDA 4HN8A 3SUWA 2XGIA 4HK6A 4UNKA 4W89A 2CU0A 4NZCA 4AVFA 1V93A 3WD3A 3HGOA 3ZJ6A 1UWTA 2WCSA 3WN6A 5BRBA 3N2CA 2C6QA 4LBUA 3GXFA 4NVTA 4I9MA 4TR9A 1F4HA 3N2BA 4JTRA 4OJYA 1ONWA 2NV2A 5HK4A 3FAWA 3WL1A 1A5MC 4RNFA 3URAA 3BG9A 2ZA1A 3MDWA 2ADAA 2QW5A 4H83A 1NOWA 1XL9A 1F3WA 2P3ZA 4WOQA 1P0NA 3K1GA 2J7FA 1UR3M 2ATMA 4F9DA 4ZODA 1ITCA 5CSUA 1TV3A 2D73A 4V33A 3CH9A 4ZB2A 2G41A 1KBBA 1DWGM 3DKLA 1PL9A 2QUVA 3Q65A 5FJJA 3AHTA 2O4QA 3OO2A 4EWND 1QPKA 3S2NA 1NH6A 5C9UA 1E5NA 2D3LA 3LPOA 3N17A 4LEFA 1FWHC 1JZ5A 1US2A 4HMNA 4MVAA 4F79A 3VDCA 4ROPA 3CTTA 3QR1A 4ZO6A 3QYSA 4X3ZA 4ZTXA 4MMWA 3UESA 3QLDA 3GVQA 3EB3A 2NQLA 4P8WA 3H12A 3DESA 1XBXA 1OYBA 2XZ7A 3UJFA 3E5BA 1W91A 2ZRZA 3P14A 1NJJA 1R30A 4DY1A 3NZQA 3V0SA 4H41A 1WKEA 3MSYA 3W7CA 2Y5EA 4PMZA 5EFDA 3VMNA 3RX4A 2V6AA 4B15A 3FN9A 4HB7A 3RPDA 4W4QA 3UJEA 5BCAA 5CPSA 1EFZA 4HGXA 1W9VA 4IPIA 2RDXA 2JQXA 3EWUA 1LBMA 4GIEA 4HOXA 4H7CA 4AZHA 2FJUB 3LHZA 4M29A 1TCMA 3TCSA 4OWGA 3GH4A 5C8BB 4URIA 1TV5A 4G7EB 4M51A 2BLEA 3H54A 3ZR5A 1M41A 5FD0A 2WM0A 1Q2RA 1K7XA 1E4MM 4U10A 4CD8A 4O14A 4EXQA 1D7FA 3MVTA 4FZIA 1WAUA 1JVNA 4MHBA 2VT0A 3FYPA 3W73A 1EEXA 4LEQA 2PWFA 4JL1A 4AX7A 2WMIB 3WF2A 2C3ZA 5D32A 2EPNA 1JCYA 2TPSA 1Q66A 4JTQA 5DY3A 4JHZA 3W7GA 3N29A 3U4FA 3MSDA 4YTUA 3I6EA 5D9NA 3ZWTA 2BNJA 3ANUA 1C7TA 5JU6A 1MYRA 4PMXA 4OOUA 3CL8A 1LRQA 3FYYA 1WDWA 1KRBC 3VOGA 3UG4A 2CPUA 4OUEA 3PB0A 3N11A 1ZS2A 3IVTA 3HGSA 3EPNA 4GKLA 4D8LA 1EF2A 4GQGA 1Z3NA 2PP0A 5H6HA 4XVDA 3QR3A 4D6GA 1W56A 4IH3A 4WR3A 1UQYA 5FEPA 1L2UA 2X1SA 4AD1A 1PB0A 1TTJA 1BSIA 4BF9A 1Y0EA 1ECQA 3VDAA 1XJBA 1G7VA 3TTSA 1H7RA 3U5YA 3W7IA 2E7FA 3UFYA 2A3EA 3GDBA 3B0UX 1DWAM 5G4EA 1X7FA 2E68A 4J9JA 2NUXA 1TJ0A 1XYMA 4LB3A 1VJZA 4AYSA 1E51A 1EGMA 1GQIA 5C2GA 3B4YA 1IZJA 3CZKA 4P7NA 2DIJA 1TPH1 4NJHA 5ENLA 1FWWA 3WUEA 4WDUA 5A6TC 2ZVIA 2JF6A 3V1PA 2E3ZA 2WNQA 2X30A 4KFOA 1A80A 1KB3A 1Q7QA 4KCUA 3REQB 1DIDA 3BAWA 4LBRA 4HQVA 4XZMX 4DI9A 2Y8UA 1F6PA 3A4AA 1NVMA 2EJ1A 3B3DA 3AHXA 4POCA 1PZ1A 2OEMA 4ECLA 3TYEA 2QJGA 3FEMA 4FR6A 1KR0A 5DF0A 2WC3A 2XSBA 3BLFA 3KXQA 3MYPA 1KQZA 3L0KA 3NL5A 4B9ZA 2ZZ5A 1R0MA 2G3IA 2OSXA 1K9TA 4AMAA 2V9DA 4Z0JA 3U57A 4UIOA 2WHKA 1QTWA 3S6OA 2WXDM 2VC9A 3WQVA 4UFHA 2ZRXA 1HFBA 3UR2A 3UD6A 2OQHA 1KFBA 3EOSA 3K2GA 3SO7A 4A8LA 3ERPA 4TTUA 2NVAA 1AW1A 4AY1A 4M3PA 3CWOX 4E4PA 4ZFCA 1HKMA 1KQYA 3QVQA 1JD9A 4BI6A 1HP5A 4L4MA 2XM2A 3VNDA 4XAZA 1LQAA 4JTJA 2QV4A 3OODA 4FNTA 1KM3A 4L4LA 4HA4A 3BH4A 1E4LA 3ONCA 1KKRA 1KWGA 3KHJA 1SFLA 2VM8A 2YCKX 4W5UA 2VWTA 3K4WA