The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
58
|
sequence length |
317
|
structure length |
295
|
Chain Sequence |
DSTDETPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINPGNGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREQGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMAQVAEIRPGSVIPVVVTLQVTIQEYPAT
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule keywords |
Protease degS
|
| publication title |
OMP peptides activate the DegS stress-sensor protease by a relief of inhibition mechanism.
pubmed doi rcsb |
| source organism |
Escherichia coli
|
| molecule tags |
Hydrolase/hydrolase activator
|
| total genus |
58
|
| structure length |
295
|
| sequence length |
317
|
| ec nomenclature |
ec
3.4.21.107: Peptidase Do. |
| pdb deposition date | 2009-02-24 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00089 | Trypsin | Trypsin |
| A | PF00595 | PDZ | PDZ domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Roll | Pdz3 Domain | Pdz3 Domain | ||
| Mainly Beta | Beta Barrel | Thrombin, subunit H | Trypsin-like serine proteases | ||
| Mainly Beta | Beta Barrel | Thrombin, subunit H | Trypsin-like serine proteases |
