3GDSA

Crystal structure of degs h198p/d320a mutant modified by dfp in complex with dnrdgnvyyf peptide
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
317
structure length
295
Chain Sequence
DSTDETPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINPGNGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREQGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMAQVAEIRPGSVIPVVVTLQVTIQEYPAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title OMP peptides activate the DegS stress-sensor protease by a relief of inhibition mechanism.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase activator
molecule keywords Protease degS
total genus 58
structure length 295
sequence length 317
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3gdsA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gdsA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gdsA01
4D7GA 1ANCA 3M36A 3QZQA 2THFB 3TH3H 3RXBA 2BX3A 2OUAA 1O2QA 5J4QA 1C1SA 2BY5X 1K9OE 2Z9IA 3A7ZA 3I78A 8KME2 1V5QA 3S7KB 4ZH8A 1ZPBA 3K9XB 1O2XA 1UVUH 1WJLA 4HOPA 3SUGA 4DY7B 2ZDVH 1C5YB 3RU4T 5AF9H 2XBYA 3M37A 1TRYA 4JOGA 4GHNA 2F9VA 2ZQ2A 4YOGA 1P2KA 5GPIB 1AWHB 3L3TA 4IMQA 4JOPA 1UJ1A 1ORFA 2KAIB 3D62A 3QIKA 4CHAB 1N6FA 1NFWA 3F1SB 2HOBA 1ZOMA 2G2LA 2B0FA 1BMMH 1OP2A 3RXIA 2VWMA 1H4WA 1XM1A 4JOHA 2NU0E 1FZZA 1OBZA 1GI9B 2CF8H 2HNTC 6CHAB 2PUQH 3CC0A 1GBLA 4A1TA 3SU1A 4JYTA 4E7NA 3U1IB 1MAYA 2OXSA 1B5GH 3SJ9A 1TLDA 1D3QB 2M0ZA 1UF1A 2DLUA 1UK4A 1MTNC 1QL9A 3QJMA 3QTVH 1ELCA 4R0IA 1VJ9U 5FBEA 1M5ZA 4NMRA 8GCHF 9LPRA 1T4VH 1LHFH 3LOXA 3VB3A 4NIWA 3I29A 3SHUA 2JETC 2F5YA 2VZ5A 1IQJA 5HM2A 2V1WA 4CRAA 1BRAA 3O5NA 5F8TA 1CA0C 2Y5FA 1XVOA 3PLKA 2ZFPH 2Q6DA 4Q6SA 2PDZA 5EODA 2HLCA 3SJOA 2C4FH 4BTUB 1AU8A 2AMDA 2R0KA 2GMTC 5A2MH 1GHAG 4H6SB 1HAPH 4NZLA 1ZRBA 4Y76A 2A4GA 3SHAH 2SNVA 4NXRA 1AKSA 1QL8A 1SL3A 1XKBC 2ZTZA 1JIMA 1C1QA 4GVCA 3FZDA 1KTTB 3UUZA 2DC2A 1UTKA 1GHZA 1GL0E 1P3EA 2Z3CA 1K28D 1MAXA 1HAVB 3EAJA 5FX5A 1XUFA 4D9QA 1KYNA 2DAZA 2F3CE 2PTNA 1MH0A 2V3HH 1RIWC 5LGOA 1NF3C 2VPHA 1DXWA 1DICA 2QG1A 1VITG 1TNJA 4I33A 4X1PU 1P9UA 3ITIA 2JXOA 1EP5A 1E34B 1YCPM 1ZMJA 1C2DA 1H8DH 2ZU4A 1THRH 1WF8A 4NMTA 2RCZA 5HF1A 1Z8GA 3LT3A 1MTWA 4MQAA 1HNEE 3ZZDA 3A84A 4P2AB 2KAIA 1RY4A 2Z9JA 1C4U2 4ZXYH 2KOJA 4KTSA 1K2I1 4AN7A 2BDCA 3A83A 1TRNA 5FB8C 1VITF 1B0EA 2PKAB 6CHAC 1UHBB 3AAUA 4BXSA 6GCHF 3SNDA 5FBIA 1O3AA 2P3FH 3QLPH 4UFFH 2QAAA 4KTCA 1O37A 2P16A 1ELDE 2TRMA 3LJJA 4BAHB 3T2NA 1IQIA 1B8QA 1LPKB 2XC4A 2ZDLA 1BITA 3U69H 1GBKA 4X1SU 1A5IA 1FLEE 1JRTA 1AFEH 2QF0A 3A7YA 5L6NH 3RXAA 2FOBA 4BTIB 1Y3UA 1Y8TA 2ULLA 1MU6B 1A3EH 5F67A 1AWFH 4H11A 4JZEH 5A2PA 1FIZA 1TPSA 1B0FA 2J92A 3A80A 4JOKA 2BVRH 1ARBA 1IQMA 3LGIA 1AIXH 1SFIA 1OZIA 4ZKSU 4K78A 1O39A 3O8RA 1C9TA 4HOPB 2ANYA 5JBBS 3RXPA 3LONA 2AH4X 1C5TA 4CBOA 3FFGA 2Y6TA 2QGRA 3WY8A 1V2UT 1EJAA 1HPGA 2BDBA 1V2JT 3MWIU 1ESTA 1QB9A 2V35A 2PWXA 1G9OA 1AKSB 1GJCB 1HJAB 3KIDU 4FUCA 5C3NA 2ZFQH 2VH6A 3LGWA 5B6OA 3FVFB 4FU8A 1PPEE 4RSPA 4A92A 2ZCLP 1P9SA 1O34A 1QA7A 1SPJA 1KIGH 1NN6A 2G00A 1GMCG 3DJ3A 1QRWA 1UTMA 1LTOA 1S6FA 1XUHA 1SHHB 3KCGH 1SQOA 1AVGH 1FI8A 3NKKA 2GZVA 4UU5A 1UEZA 3UNRA 2LNCA 1RD3B 2V0BA 4DGJA 3M3TA 1M9UA 2H1UA 4B75A 4TWWA 3GCOA 2PFEA 2KV8A 3TNTA 3Q77A 5DPAA 2PNTA 1FCFA 3MH4A 3E0PB 1IQEA 2XC0A 3TGKE 1OOKB 1GBFA 1UTLM 2O8LA 2Q6FA 1ANDA 1T8NA 3LGVA 1DLEA 3GCTF 4JYUH 4MPXA 1QNJA 1TONA 2OLGA 1N8OB 1GJ8B 1QAVB 1MZDA 3AAVA 5T6FA 3RXQA 2GV7A 1S0QA 2FP7B 1J14A 1GJAB 4JK6A 2RA3A 1JRSA 5CHAB 2BD3A 4AORA 3TGIE 1ZOKA 2L4SA 2RG3A 2ZI2H 5GWZA 2ALVA 5DP5A 3DA9B 4SGAE 5DP4A 5GXPA 1O3DA 4XSKU 1SGTA 1DFPA 4CRGA 1AGJA 2XWAA 5HFEA 2WV4A 1PQ7A 1O3BA 4H42U 1Z1IA 5K7RA 2A4RA 4Q2QA 1IAUA 3TVJB 1GI2A 2AGEX 3KQCA 4RI0A 1FDPA 5FPYA 3RC5A 1C2MA 1HXEH 1KTSB 2ZPQA 4A6LA 4UFGH 1A4WH 4K1TA 1HAOH 2H9HA 1TBQH 2ZHFH 2XCNA 4AYVB 1UTPA 5EXMA 5JYIA 1XXDA 3M7UA 1J8AA 2BOKA 3SORA 1OWEA 1C2HA 3CENA 3EGKH 3BEUA 4PROA 4ABJA 4KFVA 2AMQA 2ODYB 2Y7XA 1EKBB 1H9HE 1C1RA 5B6LA 1VB7A 4YOIA 3NFKA 1THSH 1QHRB 3PMJA 3V3MA 2ZHEH 5EG4A 1C1MA 4A1VA 2GMTB 3L33A 2GZ7A 3BTWE 4JOJA 2AWUA 3P8GA 1Q3XA 1OP8A 4GHQA 4UU6A 5E0GA 1FY3A 2OC0A 2RA0A 1CA8B 1D3PB 5AHGH 4WMFA 2TGAA 3UQOA 3SJIA 3ZZ9A 3URDA 1FJSA 1BE9A 1WFGA 2QCYA 2ZGJA 4GHTA 2YT8A 4K2YA 3DFLA 1F0SA 4NNLA 5EPYA 4F49A 2G8TA 4IN2A 2ZU1A 3HGNA 1ELGA 2Z17A 4O03A 2ZPMA 1YF4A 1EP6A 4FVDA 3W94A 4AMHA 1GVKB 1LHGH 3TNSA 2D90A 1W0YH 1LVMA 2CSJA 3IITA 5TJXA 1D4PB 1LVBA 3MU4A 3P6ZB 3PYHA 4ZXXH 1TNKA 1O2UA 4Y8XA 2VU8E 3TU7H 4ABBA 2A7JA 1HAXB 1GI5A 1F0RA 3CH8A 1A0HB 4ZROA 2UUYA 2A2XH 2XTTB 2J95A 2EEHA 2SGAA 3E3TA 1VJ6A 1HV7A 2FDAA 2ZGBH 2VNTA 3LKWA 4F8KA 4G69A 4JZIA 3TMHA 5G1EA 2YNBA 1GMCF 4XBCA 4NMPA 3RL7A 1TX7A 2A0QB 4AG2A 3Q3KA 2ZF0H 2AINA 2XBXA 1O2NA 4JOEA 1AUTC 3UIRA 3ZVDA 3FY5A 3A7WA 1WHDA 1TNIA 4LOYH 3E90B 1IHTH 1U38A 4AYYB 4E7RG 5EPNA 1K1OA 2RCEA 2XCFA 1BTPA 5A0BA 3QX5H 4INHA 3BTQE 2ZDKA 1C5NH 4OGYA 3R0HA 1N7TA 4FXGH 1ZUBA 4X8VH 1KSNA 3F9GA 3VFEA 5DKMA 2HPPH 1V2KT 1G30B 2ZFSA 2XC5A 1ELVA 1PJPA 1CGJE 1SGIB 2BDHA 4I31A 3GISB 9ESTA 2BDAA 1BFEA 5F3XA 1ELFA 3R68A 2BQWB 1QY6A 2REYA 2QXGA 1OPHB 2SGQE 3S9CA 1YBOA 2A31A 3UR9A 1X5RA 1OP0A 3SU3A 1L4DA 2I0LA 1GI7B 1ESAA 3VGCC 2KPLA 1ELEE 3TIUA 2WPLS 2NU4E 3M61U 1RIWB 3TSWA 1P2JA 1QL7A 1BMNH 2W3KA 1GQ5A 4K69A 1BRCE 4MPAA 5T6DA 1TMTH 4Q2OA 1FC9A 2GCHG 4M7GA 3V7TA 1P2MA 1TPAE 2AMPA 2H2BA 2JOAA 2CXVA 4XHVA 1CT4E 3VXFH 1TGCA 1OS8A 5L2YH 1AE5A 3K6YA 2VINA 3DD2H 3CS0A 1U3BA 5H4IB 1ZJKA 2W4FA 2FX6A 2QBWA 4BAMB 1O5DH 1SQAA 2O8MA 2DLSA 3ZZCA 1V2TT 2LC6A 1MQ6A 4ABHA 4IN1A 1L6OA 1UJUA 4E3BA 1OSSA 2A45B 4NMOA 5HGGA 3SQHE 1Q7XA 1T2MA 1TE0A 2AWWA 2BDGA 4FUFA 3T28A 1YLCA 1XUIA 5EYZA 3SHWA 2BY8X 3UTUH 2GKVE 1RS0A 1O3JA 2ZDAH 4MNXA 1AD8H 2C8YB 2GDDA 3RXHA 3HPTB 1TABE 1S82A 2VB0A 4X8SH 5E11A 5DP8A 4MNYA 1HAVA 1DY8A 3F9FA 3Q3YA 4AB8A 1FONA 2G55A 5IYTA 3N7OA 5E2OA 5HF4A 1O2MA 1UK3A 5CHAC 3VB6A 1Y5UT 1UO6A 2IJOB 4A1XA 1IQLA 2DMZA 2XNIA 1GCTC 3HPMA 3GY4A 1YPEH 2OD3B 1SGCA 3RMMH 4JZFH 1O2IA 3CP7A 4OS5A 5FPTA 1EB1H 1E35B 1UCYE 1YPLH 2WPKS 3W95A 1P02A 4YT6H 1GI4A 2JETB 2DJTA 1SGFG 4UE7H 2A5IA 2KOHA 5A09A 1GJ5H 3ZVAA 3UWJH 3KQDA 3L4FD 1CSOE 2F9BH 1EOLA 3SI4H 2IWNA 1QB6A 1D9IA 2I0IA 4A7IB 1MBMA 1OWIA 2GD4B 3SU4A 3BIVH 3A7XA 1GBBA 5E6PB 3V0XA 1P01A 1O3IA 2FCFA 4IMZA 3SNEA 4E35A 2VWRA 2FOCA 1YCPK 4X8UH 1TPOA 3MYWA 1RJXB 4NIYA 3B23B 1SVPA 4NSVA 2A32A 2GDEH 4FUHA 3RXLA 2EAQA 1P0SH 1TOMH 3SOEA 4XBDA 3H7TA 2KAWA 5DTHA 1ESBA 1EXFA 3GGEA 4X6MA 4CBNA 3TGJE 2STAE 5G1DA 5I7ZA 1QBVH 2WPMS 3IG6B 3QUMP 3SO3A 5F8ZA 4B1TA 4LZ1H 3PLPA 3E91A 4K60A 4Q2KA 3UOUA 2P8OC 4FU9A 3LC3A 5I25A 1GHWH 1WTGH 3OSYA 1LQDB 2BYAX 5FAHA 1C1NA 1F2SE 5HXFA 2GCTC 4YTAA 3BV9B 3AW1A 1A5GH 2BY9X 1K1MA 4ISOA 1G9IE 3FZZA 3K1RA 4JZ1A 3ZRTA 5EQSA 3BTME 4UEHH 3MH6A 1ZHMA 1ELAA 1N6DA 2VIQA 2FMJA 2OPGA 3ZYEA 5LPEA 4J2YB 2OTVA 1YPGH 1BZXE 3TSZA 1NTEA 1K1JA 1NY22 1U39A 1GCTB 5D13A 4WMEA 1O5BB 2PW8H 4H6TA 3VEQB 3LGTA 5FCKA 3SV6A 1L1JA 2EXGA 5LPRA 1G2MA 1Q3PA 2P8OB 1PPZA 3QGJA 4Q80A 3ATLA 1MZAA 1SGDE 3K65B 5HFCA 1S83A 1HAHH 1O2VA 1V2VT 2I04A 1O35A 1BMAA 1Z87A 2BLQA 2FOAA 4XDEA 4B71A 3WKMA 3SN8A 1DWCH 2JH5D 1WOFA 5HEYA 3EA9A 3HPKA 2GV6A 2VIDA 4U32A 4NA7A 1IQGA 1LHCH 3S7HB 2ZECA 1SGPE 2P3UB 3S9AA 3OY5U 3A7TA 1G3DA 1X5NA 1GDQA 1WI4A 3PTNA 2DE8A 3KGPA 4YDPA 2C8WB 3D65E 4B2CA 2KRGA 2G81E 1YGCH 1Y5AT 3SNAA 5SGAE 2QF3A 1GGDC 1DWBH 3VQFA 5BPEA 1DLKB 1IQHA 4GPGA 2WINI 3MTYA 2WUCA 3QTOH 5GJ4B 4JCNA 3ID2A 4Y0ZE 1TQ0B 4NMVA 1X5QA 1QAVA 2BOHB 2W7SA 3E17A 3GCHB 1V6DA 5A8YA 2GP9B 4NNMA 4Y8ZA 1SGRE 3Q3XA 3SGBE 4WF8A 3ELAH 2UWLA 5K0HA 2ZTYA 2H2ZA 3LNXA 1U6QA 5ABWA 3EA7A 1UTOA 1ZSLA 1V2ST 2FLRH 1Z1JA 1OBYA 2BY7X 5C1YA 2K1ZA 1WAYB 3M5NA 1AUJA 2B7DH 2ZCHP 1A0LA 2ANWA 2AEIH 2OP9A 5AVDA 1O3CA 3TSVA 3ZVBA 2BD9A 1N7FA 1C2KA 3A81A 3MU5A 1LPGB 3T25A 2H3MA 4Q2NA 1ABIH 3LH1A 4DT7B 1N1LA 3SJ8A 1O2WA 1BOQA 2CSSA 1TYNA 1D6RA 1YP9A 4TWYA 2LA8A 1O2RA 4ISIH 2HE2A 3G01A 5T3HA 2O9QA 1DX5M 1QFKH 4MNWA 3ZZ6A 1LO6A 1CO7E 1T4UH 4Y8YA 4R2ZA 2ZU5A 4ZHMU 3SQEE 7LPRA 1P2NA 2ZDMA 1HAYB 3OTPA 2NU2E 4WJG2 3SV9A 1BTXA 2NU3E 1G2LA 2ENOA 4FVBA 2P3WA 1O3OA 3P95A 4D8NA 1TMUH 3QN7A 7ESTE 2ZC9H 4UDWH 1GDNA 3KQEA 4YYXA 4JZDH 5GNDA 3PM3A 1F92A 1MD7A 1GCDA 3B76A 3K6ZA 1SSXA 1RTFB 4NWKA 3QO6A 4NSYA 3VB4A 4ABFA 2A4QA 1UM7A 2X7ZA 1GJ6A 1D3TB 2TGDA 3MHWU 4OS6A 3URCA 1TNLA 3U1JB 2QXJA 2QKUA 5DP7A 2A1DB 3I77A 1WUNH 2QXHA 4H4FA 2Y7ZA 2F0AA 3EGHC 3QGNB 1EPTA 4MDSA 2BXTH 3B9FH 4WH6A 2JH0D 2V3OH 2Z3EA 2FI5E 2FOHA 6LPRA 5E0JA 4FUGA 1GL1A 4LXBH 2ZQ1A 5FX6A 3ZZ8A 1TMBH 1NZQH 3MH5A 1MKWK 1W9QA 1DDJA 1AE8H 3SU6A 3UPEA 1KXCA 1FIWA 5EW1H 3KHFA 5FPSA 3M7TA 3PTBA 1TRMA 2ESTE 1C2EA 1GBHA 1SB1H 3GJ9A 2PHBA 1TP3A 1K1IA 1NU9A 2HGTH 1T32A 1I16A 2VVVA 4GSOA 2NU1E 2BVXH 1D3DB 4WWYA 3ZZ5A 1GI8B 3SJKA 5FCRA 4AG1A 1SLWB 1YPHC 1ZSKA 2DE9A 2SGEE 3ZVCA 5DK1A 1IHJA 2W5EA 2ODPA 2ZEBA 2R0LA 2KL1A 3I4WA 1QBOA 3KZDA 2HPQH 1E38B 2J38A 4REYA 1C1OA 2Q1JA 3E1XB 3OYPA 3K50A 1BBRH 1OWKA 1SLUB 3PWBA 1OWDA 1K1PA 2W3IA 2ANMH 1MFGA 3HATH 1G3CA 3ZZAA 3KZEA 4OAJA 5HEBA 1DE7H 2L4TA 1T8LA 2R2MB 2J9NA 2Z6BD 3A8CA 3QGLA 3C27B 4A5TS 2FIRH 1EZQA 4QT8C 4Z6AH 3GDSA 4GUXA 1MD8A 2H5CA 4O9VA 1AB9B 1FUJA 2FOFA 2HVXA 1KY9A 1KLJH 1OWJA 1NC6A 1FY4A 1XUGA 1Y3XA 4B76A 1RXPA 3GCHC 4ISLA 2ZU3A 1MTUA 1U37A 1BTYA 1P11E 2OC1A 4OS4A 2CJIA 5C1UA 4E06H 5GLJA 1ZTJA 4E34A 1IHSH 2Q9VA 1C2GA 4I8GA 3VGCB 4NMSA 2SGDE 2FOEA 1PQ5A 2CHAB 8ESTE 1XMNB 3BG4B 3TK9A 4THNH 1GJ7B 2CS5A 2K1QA 2JILA 1O5EH 2VGCC 4JOFA 3E0NB 1YYY1 4NA8A 2D26C 4KKDA 1FY5A 1P8VC 3SHCH 1G37A 1DSTA 1K22H 5ESTE 4AFUA 4NGAH 4DG4A 1H9IE 2LUIA 1TA6A 2KOMA 2G5MB 3EQ0H 2W26A 3V12A 1AQ7A 5HFDA 1O3FA 4WXIA 4FGMA 2HNTF 1O2KA 3UNQA 3LGYA 4ZKRU 2FE5A 1MCVA 1RGWA 2W7RA 1PDRA 3TITA 4MPUA 5CMXH 2XYAA 4DW2U 1NU7B 2YUBA 4AGKA 4FUJA 2IWPA 4Q2PA 3M7QA 3MH7A 2ZWLH 2D2DA 1ZMLA 2YT7A 4ZHAA 1LPZB 1C5QA 4I8JA 4GVUA 3SBKA 2WPHS 2Y82A 1GGDB 1NS3A 1AHTH 4CR5A 3M3SA 3TH2H 2M3MA 1J15A 4TY6A 4XE4A 3VB7A 2F91A 4AX9H 2I1NA 5H3JA 4INKA 3ZV8A 2W7UA 1BHXF 1NPMA 1S85A 3BSQA 1ARCA 1KLTA 1RGRA 3NGHA 2PSXA 2VWOA 2XW9A 4CR9A 2I6VA 3A87A 2D92A 1Z8RA 4YZUA 1Z86A 1N8OC 1LHDH 3U8RH 1HIAA 1ETTH 1L0ZA 1QJ1B 1VCPA 1WFVA 2GCTB 2D8IA 3RC4A 1DSUA 1TFXA 1TGTA 2QN5T 3R3GB 4YT7H 3B8JA 1UJDA 5L30H 2XBVA 4MVNA 3SUDA 1Z7KA 2KPKA 3A7VA 3AW0A 3KN2A 1W2KH 2A5KA 2PTCE 4BANB 4IC6A 2EI8A 4NZQA 1GWAA 2EEKA 3MO6A 1PYTC 2FOGA 3F9HA 1GMHF 1LVYA 3KHVA 4Y79A 3FP8E 2I6SA 3QK1A 2ZGXH 2OS6A 3UREA 3UOPA 1H9LB 2VJ1A 1FQ3A 3GOVB 3E6PH 1FN6A 1W12U 1KEFA 1WH1A 5FXLA 1O2YA 3KF2A 2Y5GA 3A8AA 3M5MA 1AI8H 1WQVH 3RXCA 1INCA 1N6YA 2ZFRH 4K6YA 2DB5A 3PV4A 4Y6DA 3OU0A 4WXVA 1NFYA 3RXSA 1DT2A 1KXAA 2Z94A 1WF7A 2BD4A 1H1BA 5C5NA 4CHAC 5E1YA 1P2IA 1WYKA 1BCUH 1LQEA 1EQ9A 3ZVGA 2M0TA 2FZZA 1OYTH 3FP6E 1R6JA 1P1EA 1W7XH 2EGKA 1P2OA 2OCVB 4HFPB 4LZ4B 2BX4A 1UHPA 1EAWA 3GY8A 6GCHG 1S0RA 3RXDA 4ZKNU 2H3LA 1Y7NA 2D8WA 3SU5A 2EGOA 4SGBE 1TQ3A 1O3PB 1RFNA 2NWNA 2UUFB 5HEDA 1W3CA 2JINA 1UTQA 2C3SA 4DIIH 3BTTE 2MX6A 1OWHA 1VCWA 1KXDA 4Q3HA 1AN1E 2SNWA 1O2SA 3P8NA 2AFQB 2OMJA 3BTKE 5C2ZA 3ID1A 1GBEA 2PR3A 3FAOA 1F5RA 4GLYA 5GCHF 1G36A 3PO1C 3UNSA 3H5CB 2ZKSA 1ID5H 3GYLB 1DPOA 1NFXA 2Y81A 2ZP0H 3AASA 4ISNA 2BVSH 3MI4A 1V2WT 3GCNA 1EASA 2FM2A 2BQ7B 2BD7A 2FESH 1C1PA 3Q76A 3ZVFA 1HUTH 1A5HA 1HRTH 3D49H 3RL8A 1EAXA 2ZHDA 2TGTA 4X6NA 2QKVA 1MTSA 4GCHG 3RLYH 2G4TA 1X45A 2BD8A 1VAEA 5I46H 1W11U 4OS2A 5EW2H 3RXTA 1TX6A 1UHBA 4ABDA 2DM8A 1OKXA 1NTPA 1PQAA 2UWOA 3QZRA 4K8BA 1UEPA 1ZMNA 4MG3A 2ZPLA 1EX3A 1SGYE 3O8CA 2IOTA 1AVWA 1UEWA 2O2TA 1BTZA 4N6XA 1OXGA 1GBTA 1RTLA 1FC6A 4NCYA 4NFFA 2WPIS 1AZ8A 1G3EA 1SOTA 1VJAU 2EEIA 1ELTA 2ZO3H 3QWCH 4MPWA 3V13A 1EPTC 2P95A 4GVDA 2CMYA 2Y5HA 1RTKA 1BJVA 2O8WA 4JORA 3BG8A 2G51A 2JWEA 2BQ6B 1V2OT 4I32A 2FNEA 4P0CA 2OQSA 2VVCA 4X2VA 2IWQA 4U01A 5EOKA 5J4SA 1O0DH 2YOLA 3PLBA 1YPHE 4KFWA 5LH8A 1TAWA 1MKXK 5IDKA 2AS9A 1FPCH 4IGDA 1J17T 1NRNH 3A89A 4ABAA 2XXLA 2GVFA 1FV9A 1QURH 4K5ZA 2OBOA 3MO9A 2Q3GA 3MNSA 1OX1A 1DY9A 3NFLA 1V2MT 2M0UA 2V6NA 1K32A 3ZVEA 2JREA 1UTNA 5EZ0A 5A8ZA 4U2WA 2CV3A 1A46H 1TP5A 3SUEA 1BTHH 2ZNKH 5L2ZH 4DJZB 5HJ1A 3RXMA 4FUIA 1ZPCA 3M3VA 3SUFA 3VPKA 1HFDA 1WU1A 3CBZA 1IOEA 4Z33A 4X2WA 2IWOA 3GDUA 2HWLB 4Q7ZA 2EGNA 3P17H 2GZ8A 3ATKA 4NMQA 1A7SA 1ELBA 1C5PA 1FAKH 1HJ8A 1YBWA 5C1XA 1O33A 4ISHH 2C90B 3BTHE 2QYIA 3SW2B 3T27A 4MPVA 2PSYA 1YLDA 5JPMH 2QT5A 7KMEH 3DUXH 4DIHH 1JXPA 1EPTB 1Z8IB 3RXVA 1ZRKA 3RLEA 2BMGB 1BUIA 1GJ4H 1UITA 2Z9LA 4MTBA 5JB9S 2BXUH 1ETRH 1EZXC 2EDVA 3U98H 1C2IA 2J34A 2H6MA 1AFQC 1DANH 1FN8A 4Y0YE 1GI0A 1NT1A 1C5VA 5F6MA 3ATWA 1FY1A 2LOBA 1V62A 2EI6A 3EDXB 3BIUH 4VGCC 3PS4A 1C1TA 1ANBA 1FXYA 2BY6X 2ZFTA 1UCYK 4Y7AA 3GICB 4HI3A 1QQUA 4Z0KA 2PA1A 1PYTD 1BDAA 3H7OA 4Q7XA 3PMBB 2VSPA 1TB6H 5GCHG 3HKJB 1E36B 1FAXA 1W10U 3NCLA 5C67A 1GDUA 1LHEH 2ZDNA 1GJ9B 1HLTH 2BZAA 3LDXH 1GJDB 3EYDA 2BB4A 3M35A 3RXRA 1GG6C 2WL7A 2R3UA 3JZ1B 2FPZA 1UK2A 1SLVB 2CHAC 2ZHWH 1UVOA 1V1TA 5JDUB 3A88A 1DWDH 4XBBA 2M5TA 1G3BA 4BTTB 1C5XB 1Q2WA 3P92A 1X8SA 1WIFA 1V2PT 1ZHRA 3RU4D 3OX7U 3PDVA 2XBWA 2A5AA 3LNYA 1A3BH 3BTDE 2K20A 5EXLA 4F4OC 2ZHQH 2ZZUH 3KL6A 3DJAA 5JXBA 4I8HA 3SI3H 4ABGA 1TA2A 1WG6A 3RDZA 2R3YA 4YLUA 5CE1A 2VWLA 4Z8JA 1X7AC 2P3TB 1C1UH 2ZGHA 2E7KA 3UY9A 1QRXA 4TYDA 2V90A 2ANKH 2WUBA 1DS2E 1QCPA 1MC7A 2ZA5A 4ZMAH 2JIKA 1HIAB 1AZZA 2VWNA 2PLXA 5TCAA 3ODFA 1V5LA 3BTGE 1ANEA 2KBSA 3PMAB 1JWTA 1O2GH 1D6WA 2ZIQH 1MCTA 5DG6A 2YTWA 2VIWA 1TNGA 3JZ2B 2OGPA 1QLCA 1V2LT 2ZGCA 3GY6A 1YPMH 2C8ZB 1EATA 3LH3A 3T62A 1PPHE 1QRZA 1SFQB 2EJYA 4K76A 2PKTA 2OSGA 1BIOA 2J2UA 3EE0B 3AVZA 2EA3A 1DOJA 2FEQH 3RMOH 2EEGA 1IQNA 1EZSC 3DFJA 4AFQA 1O2LA 2UZCA 3GY5A 3KNXA 3NUMA 2BLWA 3MNBA 1SHYA 4WH8A 1CHGA 2FS8A 1B7XB 1F5LA 1ZHPA 1O2JA 1TGBA 4UONA 4EDJA 1XX9A 4CH8B 5LPFA 1O2HA 2B5TB 2XRCA 1BA8B 3ID4A 5E0HA 2EC9H 3TPIZ 1SGEE 1GI3A 4FUEA 5JBTA 4NA9H 1Z71A 3ZV9A 1CHOG 1ZTKA 1SG8B 1G32B 1KXBA 5A0AE 3OTJE 1P03A 2BLOA 1ZGVA 4IS5A 2OC8A 3GSLA 2EHRA 1PQ8A 1ZPZA 3ODDA 1O30A 4X6OA 4WYUA 4I8LA 3SUZA 3HGPA 1T8OA 1F0TA 3F9EA 1CE5A 4WY3A 1GI6A 1CGHA 3SFJA 1SBWA 4ABEA 2G5NA 1XZ9A 4TY7A 5A0CA 3PV2A 2FTLE 1FPHH 1CHOF 4X8TH 4X1RU 5GDSH 2HALA 3RLWH 4BOHA 1HJAC 1EZUC 2ZCKP 1P2QA 1GHVH 4OS7A 5C5OA 1C5ZB 4ZKOU 2KJKA 4ZAEA 1BHXB 1GHXH 2BLVA 2EI7A 1RRKA 3E8LA 2ZFFH 5E8EH 3PMHB 2HE4A 2FX4A 4IW4E 3MO3A 3VQGA 3DHKH 5TCCA 1Z8JB 4K3JA 1UVTH 1Y3YA 1THPB 2FYQA 1C5SA 3CS7A 1QR3E 4ABIA 4MLFB 3T26A 4K75A 1LKBA 2QIQA 5HFFA 4AB9A 1GMDF 2Z9KA 4D76A 1TIOA 4YLQH 4OS1A 1VZQH 1BMLA 3TK5A 1TX8A 1PFXC 4OGXA 1F0UA 1P3CA 4NIVA 2G4UA 3S0NA 1NO9H 1GJBB 2P93A 2EDPA 1DM4B 1Z6JH 4MNVA 1HJ9A 1EAUA 4J1YA 2Q6GA 3T5FH 4O06A 1K1LA 1ETSH 3L6PA 1SGQE 1O2ZA 1NRRH 2FI4E 2BD5A 1C5LH 4NXPA 2VH0A 3QE1A 2FWWA 2A7HA 2GT7A 3ZZ3A 4D9RA 7GCHG 2QA9E 2ILNA 2OZFA 5F03A 2OQUA 2VRFA 1W7GH 4B74A 2AWXA 1KXFA 2FLBH 2H9TH 4NIXA 3MOCA 1NROH 3RM0H 1WHAA 3I1EA 1GHAF 2PKAA 1PPCE 1P09A 1C5MD 2PV9B 3D23A 5JBCS 1N7EA 5EQQA 2VVUA 3BTFE 3MU1A 1UJVA 3BEIB 1UM1A 2SGPE 3RXFA 1W13U 1V2QT 3O8DA 3R69A 1GVLA 4CH2B 1AFQB 1A61H 3AXAA 1O5GH 2YUYA 1LDTT 3DT0H 1MTNB 4XOJA 3S9BA 4FUDA 2HGAA 1IQKA 2BDYA 1UVPA 5DO4H 1LCYA 4RKJB 2F83A 3GY7A 4BAQB 5HYOA 3LU9B 1WBGB 2HNTE 1HCGA 3BEFB 2AERH 1WV7H 1E37B 2BTCE 5GIBA 1FNIA 2PKUA 2FOMB 2OBQA 1WQSA 1UCYH 2I4SA 1SQTA 4B2BA 2CN0H 1O3MA 1MBQA 3ZZBA 3A8BA 1UMAH 1HAZB 1P04A 4NG9H 1BQYA 1FMGA 3RP2A 4AFZA 1O2PA 1C1WH 2G5VA 2GT8A 1CBWB 4U30A 2AGGX 4K1SA 3LPRA 1T8MA 3ZYDA 5DGJA 1OBXA 1MTVA 1NFUA 1QB1A 1YPKH 2FO9A 5E22A 1GBMA 3RM2H 1O2TA 3PDZA 3GY3A 4CREA 4B2AA 4AOQA 3ZZ7A 1WTHD 1Y5BT 1WSSH 3LGUA 2BM2A 3ATIA 2TPIZ 3STJA 1LMWB 3MMGA 2KYLA 1TNHA 1O3LA 2UUJB 2WYGA 3MNXA 4IBLH 3RXUA 1Q31A 4WYTA 1TGNA 3ATMA 2EDZA 4KP0A 1SR5C 2Z7FE 1N6XA 1SC8U 3SGQE 1ZTLA 3HKIB 2BD2A 3A8DA 2AYWA 1W8BH 2G52A 3CYYA 1ZJDA 2ODQA 3QDZB 4HGCA 4UD9H 4CRDA 3K2UA 4LK4A 3SV8A 2AIQA 1GMDG 1OYQA 2PKSC 3R0FA 3TLOA 5E2PA 2JH6D 2UUKB 4X1QU 1DUEA 1GHBF 1S84A 4BNRA 1O31A 1L1GA 2FODA 1BTUA 3U8TH 2FTMA 2FN5A 2TIOA 1TQ7B 1O36A 4Y71A 2SGFE 4L8NA 2GTBA 5HFBA 2QC2A 3TH4H 1H8IH 2D1JA 4R8TB 1N6EA 4GAWA 2FI3E 3RU4E 1CBWC 3A86A 1Y3VA 5DP3A 3MU0A 1QAUA 1K21H 2PGBB 1P12E 1C2LA 4DVAU 3RMLH 3O8BA 3U9AH 3LJOA 4YESB 5PTPA 2I6QA 2H9EH 1CT2E 1A1RA 1O38A 4IC5A 1J16A 2R9PA 3K82A 1C2FA 2GZ9A 2B8OH 1LKAA 4KTUA 1ZYOA 2Z3DA 5DP9A 2YNAA 3DJ1A 3A82A 2ZTXA 4K72A 1TBRH 1BBRE 1HDTH 5DJ7A 1BT7A 1TBZH 4UFDH 1TPPA 2EEJA 1O3HA 3RUOA 1Y3WA 2RRMA 1MU8B 2OINA 4CRCA 1AY6H 3DORA 5F8XA 1HAIH 1V3XA 1BJUA 2VIPA 3OY6U 2EV8A 1BTWA 2FS9A 3WKLA 1QGFA 1QTFA 5ETXA 4YO9A 1Y59T 3PV5A 1IU2A 5DP6A 1W9EA 3TJOA 3ID3A 3SU0A 1GPZA 1XKAC 3BTEE 1N99A 1GG6B 1O5CB 1SGNE 3FP7E 5EXNA 5C20A 4K1EA 2GCHF 1HXFH 1O5FH 4Q6HA 4X2YA 3RXEA 1O32A 3NWUA 4Y11E 2GX4A 1W9OA 1VCQA 3UQVA 1KDQA 2PUXB 4Y7BA 1YCPH 2A4OA 1FC7A 1CA0B 2J94A 3FANA 1HB0B 2FXRA 1L1NA 4HZHA 4LMMA 4RN6A 2QV1A 1W0ZU 2B9LA 4AFSA 1V2NT 3JXTA 4JYVH 3F68H 5JB8S 7GCHF 2QXIA 1IU0A 4O97A 1P06A 3VB5A 4OEOA 3BG4C 3RXJA 4YM9A 3TJNA 1EB2A 1HGTH 2VIOA 5EU8A 2F9OA 4KGAA 4ESTE 1BRUP 5EQRA 1PPGE 2VSVA 4RKOB 3BF6H 1XUKA 1KWAA 1ACBE 1JOUB 2R2WU 1P57B 5FHTA 1TOCB 1GBCA 3RXGA 1C5RA 1MQ5A 3RMNH 4TPIZ 1CGIE 4OEPA 5E21A 2A7CA 4JK5A 8GCHG 1CT0E 6ESTA 2L97A 1L4ZA 4DURA 1UTJA 1QA0A 1VGCC 3M5OA 2OC7A 1Q3OA 3SZNA 1TALA 1BBRK 1VITH 1C5UA 2H5DA 3GCTG 3TK6A 1A0JA 1EJMA 1VR1H 4DCDA 1KXEA 2R4HA 3TJUA 2ALPA 3NZIA 5EGMA 2KQFA 1MMJN 4O3UA 1S81A 3MFJA 1F5KU 1L2EA 5T6GA 3GYMA 5G4BA 4Y10E 3M5LA 3HK3B 2WV5A 1SMFE 1K1NA 1AO5A 3P8FA 2LPRA 1ZLRA 3C1KA 1QBNA 2QY0B 5HDYA 2IN2A 1XUJA 1QQ4A 3SV2H 2KJPA 1RZXA 1QJ6B 1C1VH 1XXFA 1AVXA 4VGCB 2BDIA 1NRQH 3U8OH 1GBDA 1GHBG 3LIWA 2M10A 1GQ4A 2TBSA 2PKSB 3GY2A 3LC5A 4JMYA 4ASHA 3PROA 1MKXH 5BRRE 3VXEH 2SFAA 2H2CA 1FY8E 3PB1E 3CBXA 1NRPH 1UEQA 1YC0A 1A2CH 1DVAH 3SNBA 2F9PA 1GVZA 1DWEH 5HM9A 3SNCA 3NXPA 4I8KA 4D7FA 3EA8A 3QJNA 1ZGIA 1O2OA 1O3KA 4O3TA 4PQWA 2BHGA 2CGAA 2M0VA 1VGCB 1CVWH 1QIXB 1CU1A 2PGQB 1X6DA 1QJ7B 1C2JA 2O8TA 4FUBA 1O3NA 2Y80A 2GGVB 2PZDA 3KQBA 1C4Y2 3ENSB 4BAOB 2ZU2A 3P8OA 1BB0B 4Q7YA 3NK8A 1O3EA 3UR6A 2BYGA 1ZZZA 3ESTA 2STBE 1Z6EA 4GCHF 4NWLA 1ABJH 1LVOA 3SV7A 5HETA 1NESE 2RDLA 4WMDA 1TWXB 2UWPA 1AB9C 3SOSA 4ZHLU 3UFAA 1P1DA 2O8UA 3STIA 3GDVA 1DXPA 3RXKA 3PWCA 1W14U 4XFQA 1PPFE 1XVMA 4DOQA 1EUFA 4E05H 2KG2A 1IQFA 2ZG0H 2ZPSA 4CRBA 1HAGE 2OCSA 3S69A 2P94A 1NM6A 1V2RT 3HK6B 3RXOA 1ZSJA 2F9NA 3NPSA 4X2XA 2AIPA 2ZPRA 1TGSZ 4AGJA 5A8XA 1S6HA 1F7ZA 2IPHA 1CQQA 1KDQB 1T7CA 2DKRA 1GBJA 4NFEA 4UFEH 1YPJH 1E0FD 2AGIX 1HYLA 3HVQC 1JMOH 3KEEA 2LC7A 1MUEB 4X0WU 2HRVA 5AFYH 1GHYH 3ZZ4A 1P10A 1EOJA 4TPYA 1GBAA 4X1NU 4B73A 1SLXB 3QDOA 3SGAE 1WCZA 5HMAA 3IWMA 5ESBA 3F6UH 2JKHA 2C8XB 3CBYA 4KELA 3SU2A 4BAKB 3BN9A 1O5AB 1GI1A 2ASUB 2F9UA 1D5GA 1V6BA 4X6PA 3RC6A 4BXWA 1GM1A 2QKTA 1MKWH 2FYRA 4K8YA 1T31A 1WI2A 2DUCA 2J4IA 2KJDA 3P70B 3PO1B 3EGGC 1C4V2 1ZR0A 5JBAS 2C93B 1DUAA 1JIRA 3UWIA 1BRBE 1GBIA 1UVSH 3Q00A 3BPUA 1C5WB 2VIVA 3T29A 4NXQA 1C5OH 8LPRA 2TGPZ 1HBTH 3O46A 2CF9H 4AZ2B 1RGQA 2WPJS 4I7YH 1C9PA 3TJVA 2A2QH 1SI5H 1MFLA 4YOJA 1PPBH 1GMHG 1KLIH 3E16B 2Z9GA 2MHOA 1YM0A 1DITH 2VGCB 2P59A 1JBUH 3MU8A 4INLA 1YKTA 2XWBI 4JL7A 1VA8A 1I92A 5AFZH 3I18A 2BZ6H 1EJNA 1S5SA 2OQ5A 1SOZA 1J9CH 2KA9A 4HTCH 1SGFA 3DIWA 4WVPE 1P05A 2WYJA 4ZUHA 1O3GA 3MNCA 1NRSH 4FU7A 4CRFA 1AMHA 1EAIA 3A85A 1UFXA
chains in the Genus database with same CATH superfamily
4D7GA 1ANCA 3M36A 3QZQA 2THFB 3TH3H 3RXBA 2BX3A 2OUAA 1O2QA 2LP6A 5J4QA 1C1SA 2BY5X 1K9OE 2Z9IA 3A7ZA 2LELA 3I78A 8KME2 1V5QA 3S7KB 4ZH8A 1ZPBA 3K9XB 1O2XA 1UVUH 1WJLA 4HOPA 3SUGA 4DY7B 2ZDVH 1C5YB 3RU4T 5AF9H 2XBYA 3M37A 1TRYA 4JOGA 4GHNA 2F9VA 2ZQ2A 4YOGA 1P2KA 5GPIB 1AWHB 3L3TA 4IMQA 4JOPA 1UJ1A 1ORFA 2KAIB 3D62A 3QIKA 4CHAB 1N6FA 1NFWA 3F1SB 2HOBA 1ZOMA 2G2LA 2B0FA 1BMMH 1OP2A 3RXIA 2VWMA 1H4WA 1XM1A 4JOHA 2NU0E 1FZZA 1OBZA 1GI9B 2CF8H 2HNTC 6CHAB 2PUQH 3CC0A 1GBLA 4A1TA 3SU1A 4JYTA 4E7NA 4RT1A 3U1IB 1MAYA 2OXSA 1B5GH 3SJ9A 3F0PA 1TLDA 1D3QB 2M0ZA 1UF1A 2DLUA 1UK4A 1MTNC 1QL9A 3QJMA 3QTVH 1ELCA 4R0IA 1VJ9U 5FBEA 1M5ZA 4NMRA 1E1RD 8GCHF 9LPRA 1T4VH 1LHFH 3LOXA 3VB3A 4NIWA 3I29A 3SHUA 2JETC 2F5YA 2VZ5A 1NBME 1IQJA 5HM2A 2V1WA 4CRAA 1BRAA 3O5NA 5F8TA 1CA0C 2Y5FA 1XVOA 3PLKA 2ZFPH 2Q6DA 4Q6SA 2PDZA 5EODA 2WSSD 2HLCA 3SJOA 2C4FH 4BTUB 1AU8A 2AMDA 2R0KA 2GMTC 5A2MH 1GHAG 4H6SB 1HAPH 4NZLA 1ZRBA 4Y76A 2A4GA 3SHAH 2SNVA 3AK5A 4NXRA 1AKSA 1QL8A 1SL3A 3PRBA 1XKBC 2ZTZA 1JIMA 1C1QA 4GVCA 3FZDA 1KTTB 3UUZA 2DC2A 1UTKA 1GHZA 1GL0E 1P3EA 2Z3CA 1K28D 1MAXA 1HAVB 3EAJA 3CNRA 1XUFA 5FX5A 4D9QA 1KYNA 2DAZA 2F3CE 2PTNA 1MH0A 2V3HH 1RIWC 5LGOA 1NF3C 2VPHA 1DXWA 1DICA 2QG1A 1VITG 1TNJA 4I33A 4X1PU 1P9UA 3ITIA 2JXOA 1EP5A 1E34B 1YCPM 1ZMJA 1C2DA 1H8DH 2ZU4A 1THRH 1WF8A 4NMTA 1VKYA 2RCZA 5HF1A 1Z8GA 3LT3A 1MTWA 4MQAA 1HNEE 3ZZDA 3A84A 4P2AB 2KAIA 1RY4A 2Z9JA 1C4U2 4ZXYH 2KOJA 4KTSA 1K2I1 4AN7A 2BDCA 3A83A 1TRNA 4JJ0A 5FB8C 1VITF 1B0EA 2PKAB 6CHAC 1UHBB 3AAUA 3WW7A 4BXSA 6GCHF 3SNDA 5FBIA 1O3AA 2P3FH 3QLPH 4UFFH 2QAAA 4KTCA 1O37A 2P16A 1ELDE 2TRMA 3LJJA 4BAHB 3T2NA 1IQIA 1B8QA 1LPKB 2XC4A 2ZDLA 1BITA 3U69H 1GBKA 4X1SU 1A5IA 1FLEE 1JRTA 1AFEH 2QF0A 1FX0B 3A7YA 5L6NH 3RXAA 2FOBA 4BTIB 1Y3UA 1Y8TA 2ULLA 1MU6B 1A3EH 5F67A 1AWFH 4H11A 4JZEH 5A2PA 1FIZA 1TPSA 1B0FA 2J92A 3A80A 4JOKA 2BVRH 1ARBA 1IQMA 3LGIA 1AIXH 1SFIA 1OZIA 5HIZA 4ZKSU 4K78A 1O39A 3O8RA 3DSGA 1C9TA 4HOPB 2ANYA 5JBBS 3RXPA 3LONA 2AH4X 1C5TA 4CBOA 3FFGA 2Y6TA 2QGRA 3WY8A 1V2UT 1EJAA 1HPGA 2BDBA 1V2JT 3MWIU 1ESTA 1QB9A 2V35A 2PWXA 1G9OA 1AKSB 1GJCB 1HJAB 3KIDU 4FUCA 5C3NA 2ZFQH 2VH6A 3LGWA 5EJZA 5B6OA 3FVFB 4FU8A 1PPEE 4RSPA 4A92A 2ZCLP 1P9SA 1O34A 1QA7A 1SPJA 4F48B 1KIGH 1NN6A 2G00A 1GMCG 3DJ3A 1QRWA 1UTMA 1LTOA 1S6FA 1XUHA 1SHHB 3KCGH 1SQOA 1AVGH 1FI8A 2VBCA 3NKKA 2GZVA 4UU5A 1UEZA 3UNRA 2LNCA 3KYFA 3F2HA 1RD3B 2V0BA 4DGJA 3M3TA 1M9UA 2H1UA 4B75A 4TWWA 3GCOA 2PFEA 2KV8A 3TNTA 3Q77A 4RT0A 5DPAA 2PNTA 1FCFA 3MH4A 3E0PB 1IQEA 2XC0A 3TGKE 1OOKB 1GBFA 1UTLM 2O8LA 2Q6FA 3F2GA 1ANDA 1T8NA 3LGVA 1DLEA 3GCTF 4JYUH 4MPXA 1QNJA 1TONA 2OLGA 1N8OB 1GJ8B 1QAVB 1MZDA 3AAVA 5T6FA 3RXQA 2GV7A 2JSNA 1S0QA 2FP7B 1J14A 1GJAB 4JK6A 2RA3A 1JRSA 5CHAB 2BD3A 4AORA 3TGIE 1ZOKA 2L4SA 2RG3A 2ZI2H 5GWZA 2ALVA 5DP5A 3DA9B 4SGAE 5DP4A 5GXPA 3F3BA 1O3DA 4XSKU 1SGTA 1DFPA 4CRGA 1AGJA 2XWAA 5HFEA 3OEHD 2WV4A 1PQ7A 1O3BA 4H42U 5DN6D 1Z1IA 5K7RA 2A4RA 4Q2QA 1IAUA 3TVJB 1GI2A 2AGEX 3KQCA 4RI0A 3KDGA 1FDPA 5FPYA 3RC5A 1C2MA 1HXEH 1KTSB 2ZPQA 4A6LA 4UFGH 1A4WH 2WPDD 4K1TA 4I86A 1HAOH 2H9HA 1TBQH 2ZHFH 5F53A 2XCNA 4AYVB 1UTPA 5EXMA 5JYIA 1XXDA 3M7UA 1J8AA 2BOKA 3SORA 1OWEA 1C2HA 3CENA 3EGKH 3UB0A 3BEUA 4PROA 4ABJA 4KFVA 2AMQA 2ODYB 2Y7XA 1EKBB 3N99A 1H9HE 1C1RA 5B6LA 1VB7A 4YOIA 3NFKA 1THSH 1QHRB 2W6ID 3PMJA 3V3MA 2ZHEH 5EG4A 1C1MA 4A1VA 2GMTB 3L33A 2GZ7A 3BTWE 4JOJA 2AWUA 3P8GA 1Q3XA 1OP8A 4GHQA 4UU6A 5E0GA 2RFKC 1FY3A 2OC0A 2RA0A 1CA8B 1D3PB 5AHGH 4WMFA 2TGAA 3UQOA 3SJIA 3ZZ9A 3URDA 1FJSA 1BE9A 1WFGA 5ILBA 2QCYA 2V3MA 2ZGJA 2YT8A 4GHTA 4K2YA 3DFLA 1F0SA 2F43B 4NNLA 3EE7A 5EPYA 4F49A 2G8TA 4IN2A 2ZU1A 3HGNA 1QZ8A 1ELGA 2Z17A 4O03A 2ZPMA 1YF4A 1EP6A 4FVDA 3W94A 4AMHA 1GVKB 1LHGH 3TNSA 2D90A 2XOKD 1W0YH 1LVMA 2CSJA 3IITA 5TJXA 1D4PB 1LVBA 3MU4A 3P6ZB 3PYHA 4ZXXH 1TNKA 1O2UA 4Y8XA 2VU8E 3TU7H 4ABBA 2A7JA 1HAXB 1GI5A 1F0RA 3CH8A 1A0HB 1MABB 4ZROA 2UUYA 2A2XH 2XTTB 2J95A 2EEHA 2SGAA 3E3TA 1VJ6A 1HV7A 2FDAA 2ZGBH 2VNTA 3LKWA 4F8KA 4G69A 4JZIA 3TMHA 5G1EA 3DSOA 2YNBA 1GMCF 4XBCA 4NMPA 2EQNA 3RL7A 1TX7A 2A0QB 4AG2A 3Q3KA 2ZF0H 2AINA 2XBXA 1O2NA 4JOEA 1AUTC 3UIRA 3ZVDA 3FY5A 3A7WA 1WHDA 5FL7D 1TNIA 4LOYH 3E90B 1IHTH 1U38A 4AYYB 4E7RG 5EPNA 1K1OA 2RCEA 2XCFA 1BTPA 5A0BA 3QX5H 4INHA 3BTQE 2ZDKA 1C5NH 4OGYA 3R0HA 1N7TA 4FXGH 1ZUBA 4X8VH 1KSNA 3F9GA 3VFEA 5DKMA 2HPPH 1V2KT 1G30B 2ZFSA 2XC5A 1ELVA 1PJPA 1CGJE 1SGIB 2BDHA 4I31A 3GISB 9ESTA 2BDAA 1BFEA 5F3XA 1ELFA 3FN8A 3R68A 2BQWB 1QY6A 2REYA 2QXGA 1OPHB 2SGQE 3S9CA 1YBOA 2A31A 3UR9A 1X5RA 1OP0A 3SU3A 1L4DA 2I0LA 1GI7B 1ESAA 3VGCC 2KPLA 1ELEE 3TIUA 2WPLS 2NU4E 3M61U 1RIWB 3TSWA 1P2JA 1QL7A 1BMNH 2W3KA 1GQ5A 4K69A 1BRCE 4MPAA 5T6DA 1TMTH 4ZCNA 4Q2OA 1FC9A 2GCHG 4M7GA 5C94A 3V7TA 1P2MA 5B42A 1TPAE 2AMPA 2H2BA 2JOAA 2CXVA 4XHVA 1CT4E 3VXFH 1TGCA 1OS8A 5L2YH 1AE5A 3K6YA 2VINA 3DD2H 3CS0A 1U3BA 5H4IB 1ZJKA 2W4FA 2FX6A 2QBWA 4BAMB 1O5DH 1SQAA 2O8MA 2DLSA 3ZZCA 1V2TT 2LC6A 1MQ6A 4ABHA 4IN1A 1L6OA 1UJUA 4E3BA 1OSSA 2A45B 4NMOA 5HGGA 3SQHE 1Q7XA 5IK2D 1T2MA 1TE0A 2AWWA 2BDGA 4FUFA 3T28A 1YLCA 1S6LA 1XUIA 5EYZA 3WWBA 3SHWA 2BY8X 3UTUH 2GKVE 1RS0A 1O3JA 2ZDAH 4MNXA 1AD8H 2C8YB 2GDDA 3RXHA 3HPTB 1TABE 1S82A 2VB0A 4X8SH 5E11A 5DP8A 4MNYA 1HAVA 1DY8A 3F9FA 3Q3YA 4AB8A 1FONA 2F4LA 2G55A 5IYTA 3N7OA 5E2OA 5HF4A 1O2MA 1UK3A 5CHAC 3VB6A 1Y5UT 1UO6A 2IJOB 4A1XA 1IQLA 2DMZA 2XNIA 1GCTC 3HPMA 3GY4A 1YPEH 2OD3B 3OEED 1SGCA 3RMMH 4JZFH 1O2IA 3CP7A 4OS5A 5FPTA 1EB1H 1E35B 1UCYE 1YPLH 2WPKS 3W95A 1P02A 4YT6H 1GI4A 2JETB 2DJTA 1SGFG 4UE7H 2A5IA 2KOHA 5A09A 1GJ5H 3ZVAA 3UWJH 3KQDA 3L4FD 1CSOE 2F9BH 5EJ1A 1EOLA 3N7EA 3SI4H 2IWNA 1QB6A 1D9IA 2I0IA 2CK3D 4A7IB 1MBMA 1OWIA 2GD4B 3SU4A 3BIVH 3A7XA 1GBBA 5E6PB 3V0XA 1P01A 1O3IA 2FCFA 4IMZA 3SNEA 4E35A 2VWRA 2FOCA 1YCPK 4X8UH 1TPOA 3MYWA 1RJXB 4NIYA 3B23B 1SVPA 4NSVA 2A32A 2GDEH 4FUHA 3RXLA 2EAQA 1P0SH 1TOMH 3SOEA 4XBDA 3H7TA 2KAWA 5DTHA 1ESBA 1EXFA 3GGEA 4X6MA 4CBNA 3TGJE 2STAE 5G1DA 5I7ZA 1QBVH 3NCVA 2WPMS 3IG6B 3QUMP 3SO3A 5F8ZA 3WWFA 4B1TA 4LZ1H 3PLPA 3E91A 4K60A 4Q2KA 3UOUA 2P8OC 4FU9A 3LC3A 5I25A 1GHWH 1WTGH 3OSYA 1LQDB 2BYAX 5FAHA 1C1NA 1F2SE 5HXFA 2GCTC 4YTAA 3BV9B 1COWD 3AW1A 1A5GH 2BY9X 1K1MA 4ISOA 1G9IE 3FZZA 3K1RA 4JZ1A 3ZRTA 5EQSA 3BTME 4UEHH 3MH6A 1ZHMA 1ELAA 1N6DA 2VIQA 2FMJA 2OPGA 3ZYEA 5LPEA 4J2YB 2OTVA 1YPGH 1BZXE 3TSZA 1NTEA 1K1JA 1NY22 1U39A 1GCTB 5D13A 4WMEA 1O5BB 2PW8H 4H6TA 3VEQB 3LGTA 5FCKA 3SV6A 1L1JA 2EXGA 5LPRA 1G2MA 1Q3PA 2P8OB 1PPZA 3QGJA 4Q80A 3ATLA 1MZAA 1SGDE 3K65B 5HFCA 1S83A 1HAHH 1O2VA 5KEDA 1V2VT 2I04A 1O35A 1BMAA 1Z87A 2BLQA 2FOAA 4XDEA 4B71A 5CDFE 3WKMA 3SN8A 1DWCH 2JH5D 1WOFA 5HEYA 3EA9A 3HPKA 2GV6A 2VIDA 4U32A 4NA7A 1IQGA 1LHCH 3S7HB 2ZECA 1SGPE 2P3UB 2PP6A 3S9AA 3OY5U 3A7TA 1G3DA 1X5NA 1GDQA 1WI4A 3PTNA 2DE8A 3KGPA 4YDPA 2C8WB 3D65E 4B2CA 2KRGA 2G81E 1YGCH 1Y5AT 3SNAA 5SGAE 2QF3A 1GGDC 1DWBH 3VQFA 5BPEA 1DLKB 1IQHA 3DCLA 4GPGA 2WINI 3MTYA 2WUCA 3QTOH 5GJ4B 4JCNA 3ID2A 4Y0ZE 1TQ0B 4NMVA 1X5QA 1QAVA 2BOHB 2W7SA 3E17A 3GCHB 1V6DA 5A8YA 2GP9B 4NNMA 4Y8ZA 1SGRE 3Q3XA 3SGBE 4WF8A 3ELAH 2UWLA 5K0HA 2ZTYA 2H2ZA 3LNXA 1U6QA 5ABWA 3EA7A 1UTOA 1UW7A 1V2ST 1ZSLA 1Z1JA 1OBYA 2BY7X 2FLRH 5C1YA 2K1ZA 1WAYB 3M5NA 1AUJA 2B7DH 2ZCHP 3U28C 1A0LA 2ANWA 2AEIH 2OP9A 3KQ5A 5AVDA 1O3CA 3TSVA 3ZVBA 2BD9A 1N7FA 1C2KA 3A81A 3MU5A 1LPGB 3T25A 2H3MA 4Q2NA 1ABIH 3LH1A 4DT7B 1N1LA 3SJ8A 1O2WA 2KFWA 1BOQA 2GEFA 2CSSA 1TYNA 1D6RA 1YP9A 4TWYA 2LA8A 1O2RA 4ISIH 2OK5A 2HE2A 3G01A 5T3HA 2O9QA 1DX5M 1QFKH 4MNWA 3ZZ6A 1LO6A 1CO7E 1T4UH 4Y8YA 4R2ZA 2ZU5A 4ZHMU 3SQEE 7LPRA 1P2NA 2ZDMA 1HAYB 3OTPA 2NU2E 4WJG2 3SV9A 1BTXA 2NU3E 1G2LA 2ENOA 4FVBA 2P3WA 1O3OA 3P95A 4D8NA 1TMUH 3QN7A 7ESTE 2ZC9H 2QE7D 4UDWH 1GDNA 3KQEA 4YYXA 4JZDH 5GNDA 3PM3A 2KCAA 1F92A 1MD7A 1GCDA 3B76A 3K6ZA 1SSXA 1RTFB 4NWKA 3QO6A 4NSYA 3VB4A 4ABFA 2A4QA 1UM7A 4JJ3A 2X7ZA 1GJ6A 1D3TB 2TGDA 3MHWU 4OS6A 3URCA 1TNLA 3U1JB 2QXJA 2QKUA 5DP7A 2A1DB 3I77A 1WUNH 2QXHA 4H4FA 2Y7ZA 2F0AA 3EGHC 3QGNB 1EPTA 4MDSA 2BXTH 3B9FH 4WH6A 2JH0D 2V3OH 2Z3EA 2FI5E 2FOHA 6LPRA 5E0JA 4FUGA 1GL1A 4LXBH 2ZQ1A 5FX6A 3ZZ8A 1TMBH 1NZQH 3MH5A 2YMSB 1MKWK 1W9QA 1DDJA 1AE8H 3SU6A 3UPEA 1KXCA 1FIWA 5EW1H 3KHFA 5FPSA 3M7TA 1OHHD 3PTBA 1SKYE 1TRMA 2ESTE 1C2EA 1GBHA 1SB1H 3GJ9A 2PHBA 1TP3A 1K1IA 1NU9A 2HGTH 1T32A 1I16A 2VVVA 4GSOA 2NU1E 2BVXH 1D3DB 4WWYA 3ZZ5A 1GI8B 3SJKA 5FCRA 3F2FA 4AG1A 1SLWB 1YPHC 1ZSKA 2DE9A 2SGEE 3ZVCA 5DK1A 1IHJA 2W5EA 2ODPA 2ZEBA 2R0LA 2KL1A 3I4WA 1QBOA 3KZDA 2HPQH 1E38B 2J38A 4XD7D 4REYA 1C1OA 2Q1JA 3E1XB 3VG8A 3OYPA 3K50A 1BBRH 1OWKA 1SLUB 3PWBA 1OWDA 1K1PA 2W3IA 2ANMH 1MFGA 3HATH 1G3CA 3ZZAA 3KZEA 4OAJA 5HEBA 1DE7H 2L4TA 1T8LA 2R2MB 1E1QD 2J9NA 2Z6BD 3QGLA 3A8CA 3C27B 4A5TS 2FIRH 1EZQA 4QT8C 4Z6AH 3GDSA 4GUXA 1MD8A 2H5CA 4O9VA 1AB9B 1FUJA 2FOFA 2HVXA 4Z1MD 1KY9A 1KLJH 1OWJA 1NC6A 1FY4A 1XUGA 1Y3XA 4B76A 1RXPA 3GCHC 2KCOA 2ZU3A 4ISLA 1MTUA 1U37A 1BTYA 1P11E 2OC1A 4OS4A 2CJIA 5C1UA 4E06H 5GLJA 1ZTJA 4E34A 2KZ4A 1IHSH 2Q9VA 1C2GA 4I8GA 3VGCB 4NMSA 2SGDE 2FOEA 1PQ5A 2CHAB 8ESTE 1XMNB 3BG4B 3TK9A 4THNH 1GJ7B 2CS5A 2K1QA 2JILA 1O5EH 2VGCC 4JOFA 3E0NB 1YYY1 4NA8A 2D26C 5KECA 4KKDA 1FY5A 1P8VC 3SHCH 1G37A 1DSTA 1K22H 5ESTE 4AFUA 4NGAH 4DG4A 1H9IE 2LUIA 1TA6A 2KOMA 2G5MB 3EQ0H 2W26A 3V12A 1AQ7A 5HFDA 1O3FA 4WXIA 4FGMA 2HNTF 1O2KA 3UNQA 2M2AA 3LGYA 4ZKRU 2FE5A 1MCVA 1RGWA 2W7RA 1PDRA 3TITA 4MPUA 5CMXH 2XYAA 4DW2U 1NU7B 2YUBA 4AGKA 4FUJA 2IWPA 4Q2PA 3M7QA 3MH7A 2ZWLH 2D2DA 1ZMLA 2YT7A 4ZHAA 1LPZB 1C5QA 4I8JA 4GVUA 3SBKA 2WPHS 2Y82A 1GGDB 5HKKD 1NS3A 1AHTH 4CR5A 3M3SA 3TH2H 2M3MA 1J15A 4TY6A 4XE4A 3VB7A 2F91A 4AX9H 2I1NA 5H3JA 4INKA 3ZV8A 2W7UA 1BHXF 1NPMA 1S85A 3BSQA 1ARCA 1KLTA 1RGRA 3NGHA 2PSXA 2VWOA 2XW9A 4CR9A 2I6VA 3A87A 2D92A 1Z8RA 4YZUA 1Z86A 1N8OC 1LHDH 3U8RH 1HIAA 1ETTH 1L0ZA 1QJ1B 1VCPA 1WFVA 2GCTB 2D8IA 3RC4A 1DSUA 1TFXA 1TGTA 2QN5T 3R3GB 4YT7H 3B8JA 1UJDA 5L30H 2XBVA 4MVNA 3SUDA 1Z7KA 2KPKA 3A7VA 3AW0A 3KN2A 1W2KH 2A5KA 2PTCE 5IL9A 4BANB 4IC6A 1EFRD 1WXRA 2EI8A 4NZQA 1GWAA 2EEKA 4P00A 3MO6A 1PYTC 2FOGA 4AC9A 3NRLA 3F9HA 1GMHF 1LVYA 3KHVA 4Y79A 3FP8E 2I6SA 3QK1A 2ZGXH 2OS6A 3UREA 3UOPA 1H9LB 2VJ1A 1FQ3A 3GOVB 3E6PH 1FN6A 1W12U 1KEFA 1WH1A 5FXLA 1O2YA 3KF2A 2Y5GA 3A8AA 3M5MA 1AI8H 1WQVH 3RXCA 1INCA 5T1VA 1N6YA 2ZFRH 4K6YA 2DB5A 3PV4A 4Y6DA 3OU0A 4WXVA 1NFYA 3RXSA 1DT2A 1KXAA 2Z94A 1WF7A 2BD4A 1H1BA 5C5NA 4CHAC 5E1YA 1P2IA 1WYKA 1BCUH 1LQEA 1EQ9A 3ZVGA 2M0TA 2FZZA 1OYTH 3FP6E 1R6JA 1P1EA 1W7XH 2EGKA 1P2OA 1W0JD 2OCVB 4HFPB 4LZ4B 2BX4A 1UHPA 1EAWA 3GY8A 3PRDA 6GCHG 1S0RA 3FKSD 3RXDA 4ZKNU 3OFND 2H3LA 1Y7NA 2D8WA 3SU5A 2EGOA 4SGBE 1TQ3A 1O3PB 1RFNA 2NWNA 2UUFB 5HEDA 1W3CA 2JINA 1UTQA 2C3SA 4DIIH 3BTTE 2MX6A 1OWHA 1VCWA 1KXDA 4Q3HA 1AN1E 2SNWA 1O2SA 3P8NA 2AFQB 2OMJA 3BTKE 5C2ZA 3ID1A 1GBEA 2PR3A 3FAOA 1F5RA 4GLYA 5GCHF 1G36A 3PO1C 3UNSA 3H5CB 2ZKSA 1ID5H 3GYLB 1DPOA 1NFXA 2Y81A 2ZP0H 3AASA 4ISNA 2BVSH 3MI4A 1V2WT 3GCNA 4FLNA 3SZEA 1EASA 2FM2A 2BQ7B 2BD7A 2FESH 1C1PA 3Q76A 3ZVFA 1HUTH 1A5HA 1HRTH 3D49H 3RL8A 1YWUA 1EAXA 2ZHDA 2TGTA 4X6NA 2QKVA 1MTSA 4GCHG 3RLYH 2G4TA 1X45A 2BD8A 1VAEA 2V7QD 5I46H 1W11U 4OS2A 5EW2H 3RXTA 1TX6A 1UHBA 4ABDA 2DM8A 1OKXA 1NTPA 1PQAA 2UWOA 3QZRA 4K8BA 1K0HA 1UEPA 1ZMNA 4MG3A 4F55A 2ZPLA 1EX3A 1SGYE 3O8CA 2IOTA 2GJGA 1AVWA 1UEWA 2O2TA 1BTZA 4N6XA 1OXGA 1GBTA 1RTLA 1FC6A 2QF5A 4NCYA 4NFFA 2WPIS 1AZ8A 1G3EA 1SOTA 1VJAU 2EEIA 1ELTA 2ZO3H 3QWCH 4MPWA 3V13A 1EPTC 2P95A 4GVDA 2CMYA 2Y5HA 1RTKA 1BJVA 2O8WA 4JORA 3BG8A 2G51A 2JWEA 2BQ6B 1V2OT 4I32A 2FNEA 4P0CA 5C17A 2OQSA 2VVCA 4X2VA 4Q4LA 2IWQA 4U01A 5EOKA 5J4SA 1O0DH 2YOLA 3PLBA 1YPHE 4KFWA 5LH8A 1TAWA 1MKXK 5IDKA 2AS9A 1FPCH 2KM0A 1J17T 1NRNH 3A89A 4IGDA 2XXLA 4ABAA 2GVFA 1FV9A 1QURH 4K5ZA 2OBOA 2JIZD 1YY3A 3MO9A 2Q3GA 3MNSA 1OX1A 1DY9A 3NFLA 1V2MT 2M0UA 2V6NA 1K32A 3ZVEA 2JREA 1UTNA 5EZ0A 5A8ZA 4U2WA 2CV3A 1A46H 1TP5A 3SUEA 1BTHH 2ZNKH 5L2ZH 4DJZB 5HJ1A 5DSFA 3RXMA 4FUIA 1ZPCA 3M3VA 3SUFA 3VPKA 1HFDA 1WU1A 3SYJA 3CBZA 1IOEA 4Z33A 2KR7A 4X2WA 2IWOA 3GDUA 2HWLB 4Q7ZA 2EGNA 3P17H 2GZ8A 3ATKA 2WZQA 4NMQA 1A7SA 1ELBA 1WDIA 1C5PA 1FAKH 2K0QA 1HJ8A 1YBWA 5C1XA 1O33A 4ISHH 4OM9A 2C90B 3BTHE 2QYIA 3SW2B 3T27A 4MPVA 2PSYA 1YLDA 5JPMH 2QT5A 7KMEH 3DUXH 4DIHH 1JXPA 1EPTB 1Z8IB 3RXVA 1ZRKA 3RLEA 2BMGB 1BUIA 1GJ4H 1UITA 2Z9LA 4MTBA 5JB9S 2BXUH 4DT4A 1ETRH 1EZXC 2EDVA 3U98H 1C2IA 2J34A 2H6MA 1AFQC 1DANH 1FN8A 4Y0YE 1GI0A 1NT1A 1C5VA 5F6MA 3ATWA 1FY1A 2LOBA 1V62A 2EI6A 3EDXB 3BIUH 4VGCC 3PS4A 1C1TA 5EIYA 2WV9A 1ANBA 1FXYA 2BY6X 2ZFTA 1UCYK 4Y7AA 3GICB 4HI3A 1QQUA 4Z0KA 2PA1A 1H8HD 1PYTD 1BDAA 3H7OA 2J98B 4Q7XA 3PMBB 2VSPA 1TB6H 5GCHG 3HKJB 1E36B 1FAXA 1W10U 3NCLA 5C67A 1GDUA 1LHEH 2ZDNA 1GJ9B 1HLTH 2BZAA 3LDXH 1GJDB 3EYDA 2BB4A 3M35A 3RXRA 1GG6C 2WL7A 2R3UA 3JZ1B 2FPZA 1UK2A 1SLVB 2CHAC 2ZHWH 1UVOA 1V1TA 5JDUB 3A88A 1DWDH 4XBBA 2M5TA 1G3BA 4BTTB 1C5XB 1Q2WA 3P92A 1X8SA 1WIFA 1V2PT 1ZHRA 3RU4D 3OX7U 3PDVA 2XBWA 2A5AA 3LNYA 1A3BH 3BTDE 2K20A 3FO8D 5EXLA 4F4OC 2ZHQH 2ZZUH 2JJ2D 3KL6A 3DJAA 5JXBA 4I8HA 3SI3H 4ABGA 1TA2A 1WG6A 3RDZA 2R3YA 4YLUA 5CE1A 2VWLA 4Z8JA 1X7AC 2P3TB 1C1UH 2ZGHA 2E7KA 3UY9A 1QRXA 4TYDA 2V90A 2ANKH 3KYGA 2WUBA 1DS2E 1QCPA 1MC7A 2ZA5A 4ZMAH 2JIKA 1HIAB 1AZZA 2VWNA 2PLXA 5TCAA 3ODFA 1V5LA 3BTGE 1ANEA 2KBSA 3PMAB 1JWTA 1O2GH 1D6WA 2ZIQH 1MCTA 5DG6A 2YTWA 2VIWA 1TNGA 3DSPA 3JZ2B 2OGPA 1QLCA 1V2LT 2ZGCA 3GY6A 2KCPA 1YPMH 2C8ZB 1EATA 3LH3A 2YMSC 3T62A 1PPHE 1QRZA 1SFQB 2EJYA 4K76A 2PKTA 2OSGA 1BIOA 2J2UA 3EE0B 3AVZA 2EA3A 1DOJA 2FEQH 3RMOH 2EEGA 1IQNA 1EZSC 3DFJA 4AFQA 1O2LA 2UZCA 3GY5A 3KNXA 3NUMA 2BLWA 3MNBA 1SHYA 4WH8A 1CHGA 2FS8A 5C0UA 1B7XB 1F5LA 1ZHPA 1O2JA 1TGBA 4UONA 4EDJA 1XX9A 3GS9A 4CH8B 5LPFA 4XRNA 1O2HA 2B5TB 2XRCA 1BA8B 3ID4A 5E0HA 2EC9H 3TPIZ 1SGEE 1GI3A 4FUEA 5JBTA 4NA9H 1Z71A 3ZV9A 1CHOG 1ZTKA 1SG8B 1G32B 3KDKA 1KXBA 5A0AE 3OTJE 1P03A 2BLOA 1ZGVA 4IS5A 2OC8A 3GSLA 2EHRA 1PQ8A 1ZPZA 3ODDA 1O30A 4X6OA 4WYUA 4I8LA 3SUZA 3HGPA 1T8OA 1F0TA 3F9EA 1CE5A 4WY3A 1GI6A 1CGHA 3SFJA 1SBWA 4ABEA 2G5NA 1XZ9A 4TY7A 5A0CA 3PV2A 2FTLE 1FPHH 1CHOF 4X8TH 4X1RU 5GDSH 2HALA 3RLWH 4BOHA 5HIYA 1HJAC 1EZUC 2ZCKP 1P2QA 1GHVH 3F0OA 4OS7A 5C5OA 1C5ZB 4ZKOU 1H8ED 2KJKA 4ZAEA 1BHXB 1GHXH 2BLVA 2EI7A 1RRKA 3E8LA 2ZFFH 5E8EH 2JJ1D 3PMHB 2HE4A 2FX4A 4IW4E 4Q63A 3MO3A 3VQGA 3DHKH 5TCCA 1Z8JB 4K3JA 1UVTH 1Y3YA 1THPB 2FYQA 1C5SA 3CS7A 1QR3E 4ABIA 4MLFB 3T26A 4K75A 1LKBA 2QIQA 5HFFA 4AB9A 1GMDF 2Z9KA 3UAIC 4D76A 1TIOA 4YLQH 4OS1A 1VZQH 5C0TA 1BMLA 3TK5A 1TX8A 1PFXC 4OGXA 1F0UA 1P3CA 4NIVA 2G4UA 3S0NA 1NO9H 1GJBB 2P93A 4FETA 2EDPA 1DM4B 1Z6JH 4MNVA 1HJ9A 1EAUA 4J1YA 2Q6GA 3T5FH 4O06A 1K1LA 1ETSH 3L6PA 1SGQE 1O2ZA 1NRRH 2FI4E 2BD5A 1C5LH 4NXPA 2VH0A 3QE1A 2FWWA 2A7HA 2GT7A 3ZZ3A 4D9RA 7GCHG 2QA9E 2ILNA 2OZFA 5F03A 2OQUA 2VRFA 1W7GH 3W1EA 4B74A 2AWXA 1KXFA 2FLBH 2H9TH 4NIXA 3MOCA 1NROH 3RM0H 1WHAA 3I1EA 1GHAF 2PKAA 4B6FA 1PPCE 1P09A 1C5MD 2PV9B 3D23A 5JBCS 1N7EA 5EQQA 2VVUA 3BTFE 3MU1A 1UJVA 3BEIB 1UM1A 2SGPE 4FOUC 3RXFA 1W13U 1V2QT 3O8DA 3R69A 1GVLA 4CH2B 1AFQB 1A61H 2HVYB 2J97A 3AXAA 1O5GH 2YUYA 1LDTT 3DT0H 1MTNB 4XOJA 3S9BA 4FUDA 2HGAA 1IQKA 2BDYA 3OE7D 1UVPA 5DO4H 1LCYA 4RKJB 2F83A 3GY7A 4BAQB 5HYOA 3LU9B 2RDEA 1WBGB 2HNTE 1HCGA 3BEFB 2AERH 1WV7H 1E37B 2BTCE 5GIBA 1FNIA 2PKUA 2FOMB 2OBQA 1WQSA 1UCYH 2I4SA 1SQTA 4B2BA 2CN0H 1O3MA 1MBQA 3ZZBA 3A8BA 1UMAH 1HAZB 1P04A 4NG9H 1BQYA 4ACAA 1FMGA 3RP2A 4AFZA 1O2PA 1C1WH 2G5VA 2GT8A 1CBWB 2IPQX 3FOAA 3N7DA 2AGGX 4U30A 4K1SA 3LPRA 1T8MA 3ZYDA 5DGJA 1OBXA 1MTVA 1NFUA 1QB1A 1YPKH 2FO9A 5E22A 1GBMA 3RM2H 1O2TA 2L74A 3PDZA 3GY3A 4CREA 4B2AA 4AOQA 3ZZ7A 1WTHD 1Y5BT 1WSSH 3LGUA 2BM2A 3ATIA 2TPIZ 3STJA 1LMWB 3MMGA 2KYLA 1TNHA 1O3LA 2UUJB 2WYGA 3MNXA 4IBLH 3RXUA 1Q31A 4WYTA 1TGNA 3ATMA 2EDZA 4KP0A 1SR5C 2Z7FE 1N6XA 1SC8U 3SGQE 1ZTLA 3HKIB 2BD2A 3A8DA 2AYWA 1W8BH 2G52A 3CYYA 1ZJDA 2ODQA 3QDZB 4HGCA 4UD9H 4CRDA 3K2UA 4LK4A 3SV8A 2AIQA 1GMDG 1OYQA 2PKSC 3R0FA 3TLOA 5E2PA 2JH6D 2UUKB 4X1QU 3H09A 1DUEA 1GHBF 1S84A 4ACBA 4BNRA 2AHME 1W0KD 1O31A 1L1GA 2FODA 1BTUA 3U8TH 2FTMA 2FN5A 2TIOA 1TQ7B 1O36A 4Y71A 2SGFE 4L8NA 2GTBA 5HFBA 2QC2A 3TH4H 1H8IH 2D1JA 4R8TB 1N6EA 2YMSD 4GAWA 2FI3E 3RU4E 4YXWD 1CBWC 3A86A 1Y3VA 5DP3A 3MU0A 1QAUA 1K21H 2PGBB 1P12E 1C2LA 4DVAU 3RMLH 3O8BA 3U9AH 3LJOA 4YESB 5PTPA 2I6QA 2H9EH 1CT2E 1A1RA 1O38A 4IC5A 1J16A 2R9PA 3K82A 1C2FA 2GZ9A 2B8OH 1LKAA 4KTUA 1ZYOA 5EJLA 2JDID 2Z3DA 5DP9A 1E79D 2YNAA 3DJ1A 2K8IA 3A82A 2ZTXA 4K72A 1TBRH 1BBRE 1HDTH 5DJ7A 1BT7A 1TBZH 4UFDH 1TPPA 2EEJA 1O3HA 3RUOA 1Y3WA 2RRMA 1MU8B 2OINA 5CHBA 4CRCA 1AY6H 3DORA 5F8XA 1HAIH 1V3XA 1BJUA 2VIPA 3OY6U 2EV8A 1BTWA 2FS9A 3WKLA 1QGFA 1QTFA 5ETXA 4YO9A 1Y59T 3PV5A 1IU2A 5DP6A 1W9EA 3TJOA 2KCYA 3ID3A 3SU0A 1GPZA 1XKAC 3BTEE 1N99A 1GG6B 1SQRA 1O5CB 1SGNE 3FP7E 5EXNA 5C20A 4K1EA 2GCHF 1HXFH 1O5FH 4Q6HA 4X2YA 3RXEA 1O32A 3NWUA 4Y11E 2GX4A 1W9OA 1VCQA 3UQVA 1KDQA 2PUXB 4Y7BA 1YCPH 2A4OA 1FC7A 1CA0B 2J94A 3FANA 1HB0B 2FXRA 1L1NA 4HZHA 4LMMA 4RN6A 2QV1A 1W0ZU 2B9LA 4AFSA 1V2NT 3JXTA 4JYVH 3F68H 5JB8S 7GCHF 2QXIA 1IU0A 4O97A 1P06A 3VB5A 4OEOA 2WHXA 3BG4C 4P02A 3RXJA 4ASUD 3TJNA 4YM9A 1EB2A 1HGTH 2VIOA 5EU8A 2F9OA 4KGAA 4ESTE 1BRUP 5EQRA 1PPGE 1NBMD 2VSVA 4RKOB 3BF6H 1XUKA 1KWAA 1ACBE 1JOUB 2R2WU 1P57B 5FHTA 1TOCB 1GBCA 3RXGA 1C5RA 1MQ5A 3RMNH 4TPIZ 1CGIE 4OEPA 5E21A 2A7CA 4JK5A 8GCHG 1CT0E 6ESTA 2L97A 1L4ZA 4DURA 1UTJA 1QA0A 1VGCC 3M5OA 2OC7A 1Q3OA 2J98A 3SZNA 1TALA 1BBRK 1VITH 2XNDD 1C5UA 2H5DA 3GCTG 3TK6A 1A0JA 1EJMA 1VR1H 4DCDA 1KXEA 2R4HA 3TJUA 2ALPA 3NZIA 5EGMA 2KQFA 1MMJN 4O3UA 1S81A 3MFJA 1F5KU 1L2EA 5T6GA 3GYMA 5G4BA 4Y10E 3M5LA 3HK3B 2WV5A 1SMFE 2L6OA 1K1NA 1AO5A 3P8FA 2LPRA 1ZLRA 3C1KA 1QBNA 2QY0B 5HDYA 2IN2A 1XUJA 1QQ4A 3SV2H 3OAAD 2KJPA 1RZXA 1QJ6B 1C1VH 1XXFA 1AVXA 4VGCB 2BDIA 1NRQH 3U8OH 1GBDA 1GHBG 3LIWA 2M10A 1GQ4A 2TBSA 2PKSB 3GY2A 3LC5A 4JMYA 4ASHA 3PROA 1MKXH 1YLNA 5BRRE 3VXEH 2SFAA 2H2CA 1X9ZA 1FY8E 3CBXA 3PB1E 1NRPH 1UEQA 1YC0A 3MQKC 1A2CH 1DVAH 3SNBA 2F9PA 1GVZA 1DWEH 5HM9A 4HG6A 3SNCA 3NXPA 4I8KA 4D7FA 3EA8A 3QJNA 1ZGIA 1O2OA 1O3KA 4O3TA 4PQWA 2BHGA 2CGAA 2M0VA 1VGCB 1CVWH 1QIXB 1CU1A 2PGQB 1X6DA 1QJ7B 1C2JA 2O8TA 4FUBA 1O3NA 2Y80A 2GGVB 2PZDA 3KQBA 1C4Y2 3ENSB 4BAOB 2ZU2A 3P8OA 1BB0B 4Q7YA 4TT3D 3NK8A 1O3EA 3UR6A 2BYGA 1ZZZA 3ESTA 2HLDD 2STBE 1Z6EA 4GCHF 4NWLA 1ABJH 1LVOA 3SV7A 5HETA 1NESE 2RDLA 4WMDA 1TWXB 3GABA 2UWPA 1AB9C 3SOSA 4ZHLU 3UFAA 1P1DA 2O8UA 3STIA 3GDVA 1DXPA 3RXKA 3PWCA 1W14U 4XFQA 1PPFE 1XVMA 4DOQA 1EUFA 4E05H 2KG2A 1IQFA 2ZG0H 2ZPSA 4CRBA 1HAGE 2OCSA 2W6JD 3S69A 2P94A 1NM6A 1V2RT 3HK6B 3RXOA 1ZSJA 2F9NA 3NPSA 4X2XA 2AIPA 2ZPRA 1TGSZ 4AGJA 5A8XA 1S6HA 1F7ZA 2IPHA 1CQQA 1KDQB 1T7CA 2DKRA 1GBJA 4NFEA 4UFEH 2J5UA 1BMFD 5KGOA 1YPJH 1E0FD 2AGIX 1HYLA 3HVQC 1JMOH 3KEEA 2LC7A 1MUEB 4X0WU 2HRVA 5AFYH 1GHYH 3ZZ4A 1P10A 2QF4A 1EOJA 4TPYA 1GBAA 4X1NU 4B73A 1SLXB 3QDOA 3SGAE 1WCZA 5HMAA 3IWMA 5ESBA 2IJD1 3F6UH 2JKHA 2C8XB 3CBYA 4KELA 3SU2A 4BAKB 3BN9A 1O5AB 1GI1A 2ASUB 2F9UA 1D5GA 1V6BA 4X6PA 3RC6A 4BXWA 4B6EA 1GM1A 2QKTA 1MKWH 2FYRA 4K8YA 1T31A 1WI2A 2DUCA 2J4IA 2KJDA 3P70B 3PO1B 3EGGC 1C4V2 1ZR0A 5JBAS 2C93B 1DUAA 1JIRA 2EY4C 3UWIA 1BRBE 1GBIA 1UVSH 3Q00A 3BPUA 1C5WB 2VIVA 3T29A 4NXQA 1C5OH 8LPRA 2TGPZ 1HBTH 3O46A 2CF9H 4AZ2B 1RGQA 2WPJS 4I7YH 1C9PA 3TJVA 2A2QH 1SI5H 1MFLA 4YOJA 1PPBH 1GMHG 1KLIH 3E16B 4TSFD 2Z9GA 2MHOA 1DITH 1YM0A 2VGCB 2P59A 1JBUH 3MU8A 4INLA 1YKTA 2XWBI 4JL7A 1VA8A 4M9FA 1I92A 5AFZH 3I18A 1KMHB 3ZIAD 2BZ6H 1EJNA 1S5SA 2OQ5A 1SOZA 1J9CH 2KA9A 4HTCH 1SGFA 3DIWA 4WVPE 1P05A 2KX4A 2WYJA 4ZUHA 1O3GA 3MNCA 1NRSH 4FU7A 4CRFA 1AMHA 1EAIA 3A85A 1UFXA
chains in the Genus database with same CATH topology
4D7GA 1ANCA 3M36A 3QZQA 2THFB 3TH3H 3RXBA 2BX3A 2OUAA 1O2QA 5J4QA 1C1SA 2BY5X 1K9OE 2Z9IA 3A7ZA 3I78A 8KME2 1V5QA 3S7KB 4ZH8A 1ZPBA 3K9XB 1O2XA 1UVUH 1WJLA 4HOPA 3SUGA 4DY7B 2ZDVH 1C5YB 3RU4T 5AF9H 2XBYA 3M37A 1TRYA 4JOGA 4GHNA 2F9VA 2ZQ2A 4YOGA 1P2KA 5GPIB 1AWHB 3L3TA 4IMQA 4JOPA 1UJ1A 1ORFA 2KAIB 3D62A 3QIKA 4CHAB 1N6FA 1NFWA 3F1SB 2HOBA 1ZOMA 2G2LA 2B0FA 1BMMH 1OP2A 3RXIA 2VWMA 1H4WA 1XM1A 4JOHA 2NU0E 1FZZA 1OBZA 1GI9B 2CF8H 2HNTC 6CHAB 2PUQH 3CC0A 1GBLA 4A1TA 3SU1A 4JYTA 4E7NA 3U1IB 1MAYA 2OXSA 1B5GH 3SJ9A 1TLDA 1D3QB 2M0ZA 1UF1A 2DLUA 1UK4A 1MTNC 1QL9A 3QJMA 3QTVH 1ELCA 4R0IA 1VJ9U 5FBEA 1M5ZA 4NMRA 8GCHF 9LPRA 1T4VH 1LHFH 3LOXA 3VB3A 4NIWA 3I29A 3SHUA 2JETC 2F5YA 2VZ5A 1IQJA 5HM2A 2V1WA 4CRAA 1BRAA 3O5NA 5F8TA 1CA0C 2Y5FA 1XVOA 3PLKA 2ZFPH 2Q6DA 4Q6SA 2PDZA 5EODA 2HLCA 3SJOA 2C4FH 4BTUB 1AU8A 2AMDA 2R0KA 2GMTC 5A2MH 1GHAG 4H6SB 1HAPH 4NZLA 1ZRBA 4Y76A 2A4GA 3SHAH 2SNVA 4NXRA 1AKSA 1QL8A 1SL3A 1XKBC 2ZTZA 1JIMA 1C1QA 4GVCA 3FZDA 1KTTB 3UUZA 2DC2A 1UTKA 1GHZA 1GL0E 1P3EA 2Z3CA 1K28D 1MAXA 1HAVB 3EAJA 5FX5A 1XUFA 4D9QA 1KYNA 2DAZA 2F3CE 2PTNA 1MH0A 2V3HH 1RIWC 5LGOA 1NF3C 2VPHA 1DXWA 1DICA 2QG1A 1VITG 1TNJA 4I33A 4X1PU 1P9UA 3ITIA 2JXOA 1EP5A 1E34B 1YCPM 1ZMJA 1C2DA 1H8DH 2ZU4A 1THRH 1WF8A 4NMTA 2RCZA 5HF1A 1Z8GA 3LT3A 1MTWA 4MQAA 1HNEE 3ZZDA 3A84A 4P2AB 2KAIA 1RY4A 2Z9JA 1C4U2 4ZXYH 2KOJA 4KTSA 1K2I1 4AN7A 2BDCA 3A83A 1TRNA 4JJ0A 5FB8C 1VITF 1B0EA 2PKAB 6CHAC 1UHBB 3AAUA 4BXSA 6GCHF 3SNDA 5FBIA 1O3AA 2P3FH 3QLPH 4UFFH 2QAAA 4KTCA 1O37A 2P16A 1ELDE 2TRMA 3LJJA 4BAHB 3T2NA 1IQIA 1B8QA 1LPKB 2XC4A 2ZDLA 1BITA 3U69H 1GBKA 4X1SU 1A5IA 1FLEE 1JRTA 1AFEH 2QF0A 3A7YA 5L6NH 3RXAA 2FOBA 4BTIB 1Y3UA 1Y8TA 2ULLA 1MU6B 1A3EH 5F67A 1AWFH 4H11A 4JZEH 5A2PA 1FIZA 1TPSA 1B0FA 2J92A 3A80A 4JOKA 2BVRH 1ARBA 1IQMA 3LGIA 1AIXH 1SFIA 1OZIA 4ZKSU 4K78A 1O39A 3O8RA 1C9TA 4HOPB 2ANYA 5JBBS 3RXPA 3LONA 2AH4X 1C5TA 4CBOA 3FFGA 2Y6TA 2QGRA 3WY8A 1V2UT 1EJAA 1HPGA 2BDBA 1V2JT 3MWIU 1ESTA 1QB9A 2V35A 2PWXA 1G9OA 1AKSB 1GJCB 1HJAB 3KIDU 4FUCA 5C3NA 2ZFQH 2VH6A 3LGWA 5B6OA 3FVFB 4FU8A 1PPEE 4RSPA 4A92A 2ZCLP 1P9SA 1O34A