3GDSA

Crystal structure of degs h198p/d320a mutant modified by dfp in complex with dnrdgnvyyf peptide
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
317
structure length
295
Chain Sequence
DSTDETPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINPGNGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREQGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMAQVAEIRPGSVIPVVVTLQVTIQEYPAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease degS
publication title OMP peptides activate the DegS stress-sensor protease by a relief of inhibition mechanism.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase activator
total genus 58
structure length 295
sequence length 317
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3gdsA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gdsA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gdsA01
1ZMJA 1T8NA 3TNTA 3ID2A 3L4FD 3M5MA 3SU5A 3LGTA 2O2TA 3TSVA 3SGAE 5EYZA 4ABJA 3DJ1A 3M7UA 4GCHF 4WMEA 4BAQB 4HGCA 1EZSC 1QURH 1V2WT 2KBSA 4N6XA 2BDCA 1GBFA 5FHTA 3PLPA 3U9AH 3TK5A 2FOGA 8ESTE 1TA2A 2BDGA 1NRQH 2QCYA 2OS6A 4B74A 1GGDC 1QL7A 4F49A 4HTCH 2ENOA 2HPQH 4LK4A 2PTNA 1EUFA 5HMAA 4CH2B 2Z94A 3SHWA 2KA9A 3A88A 3SGBE 3RMLH 5A8XA 1GHWH 1EASA 4K69A 1BRUP 4UONA 2C8XB 1O5FH 3FZZA 2BD7A 2GV6A 4Y71A 1C1MA 3MFJA 3PMHB 2V3HH 3SU0A 1X8SA 1YCPM 1BTWA 1C2FA 2D8IA 1XX9A 2YOLA 3M7TA 3QE1A 4XOJA 3E16B 3RU4E 4UE7H 1K21H 1U37A 1XUJA 1ZZZA 1K22H 2ZU3A 3GDVA 1QRWA 2A7JA 3ZVDA 3SJIA 1UVTH 1P3EA 3ATWA 1GI9B 4R2ZA 1UTPA 2ZTZA 4WVPE 1H8DH 2OC0A 4MVNA 1ELGA 2PKUA 4ISNA 1TBZH 1KWAA 2H2BA 2BY8X 1TQ3A 3DFLA 1CBWC 1SHYA 3RXAA 4BTUB 1ELVA 2G5VA 3KN2A 7LPRA 4WH6A 1UK4A 1KXBA 2A5KA 1QL9A 4H11A 1ZMLA 1C9PA 1OOKB 2OXSA 3RXJA 2LC6A 4IC6A 2I6QA 5T6FA 4X6NA 1C1TA 2KPKA 1J17T 3LGUA 2GMTC 3C1KA 1KLJH 1TAWA 4I31A 1TMUH 1F7ZA 3SV2H 4U32A 2VIVA 2ZFQH 2R2MB 1FXYA 1SMFE 2P8OC 1WQSA 3K82A 4X1PU 2C93B 3OSYA 3TH2H 1Y3VA 1GDNA 5CE1A 4OEOA 5FCRA 1KIGH 2GVFA 3SU3A 1B8QA 4GVDA 3A80A 4KTCA 4M7GA 2K20A 1BCUH 3RLWH 1NS3A 2WUCA 1WF8A 3TLOA 3F1SB 1N6EA 4WMFA 4DT7B 3S9BA 1MAXA 2XC0A 3ZZ7A 2A1DB 4A1TA 3KHFA 1FY3A 5AFYH 5PTPA 3SGQE 2PSXA 2XW9A 2VGCC 3ENSB 4Y76A 6CHAC 1B0FA 2OGPA 5HXFA 4MLFB 2FEQH 1NRNH 5C2ZA 3NK8A 1Z6EA 3ZVFA 4CHAB 4RI0A 1RD3B 2GDDA 1O0DH 5HEYA 4D7FA 1E0FD 4Y8YA 1MBMA 2PHBA 4LOYH 2OUAA 5JBBS 2ZFRH 2BDYA 2L4TA 2ESTE 1D3QB 1QR3E 2Y82A 1BBRH 3UUZA 4Y10E 4JZIA 4I8GA 1C1OA 1D9IA 1VITF 4FVDA 3KHVA 1TNLA 4A7IB 4YO9A 4E7NA 3AAVA 3RMNH 1PDRA 1AVXA 4E34A 1O2PA 1QJ1B 2DC2A 1Z7KA 1HAVA 2ZPSA 2AERH 1XUIA 2FMJA 3QO6A 3RXVA 2WPHS 2H2CA 2VIQA 3M3TA 4GAWA 5A0AE 3M3SA 3SV8A 4Q2PA 2EHRA 4NXRA 1QRXA 2FXRA 3TJVA 4KFWA 1O2YA 4XSKU 4AB8A 4RN6A 2EDZA 3SOEA 1VJ6A 1P9UA 5DP7A 2G81E 3SJOA 1P2KA 1B0EA 4NG9H 1RY4A 2BD8A 3F9GA 1TMBH 1HRTH 3CP7A 2BYGA 2B0FA 5FBIA 1OS8A 2FM2A 1LQEA 1TNKA 3PO1B 4NGAH 4X8SH 5DK1A 1FNIA 3S0NA 1Z6JH 5HF4A 1XUHA 3EE0B 4OS4A 3ID4A 2BZAA 3URDA 1OWIA 2FOMB 3NKKA 4B75A 1O3IA 4L8NA 1MTNC 1O2QA 3SV7A 2VB0A 3E0NB 4WH8A 4O06A 4YDPA 1XXDA 2H2ZA 4H6SB 4NFEA 3O8RA 1RGQA 1I16A 4NMSA 2SGPE 4AYVB 4WY3A 2ODYB 4ZHAA 2WINI 1FUJA 1WAYB 1GI4A 3M35A 1FPHH 2ZDNA 1C2LA 2JKHA 3N7OA 1NRRH 1UM1A 4NA9H 3T5FH 1E37B 1O2NA 3QK1A 1GBMA 6LPRA 1AB9B 2VRFA 1GBAA 1O34A 2AYWA 2WV4A 1Q3XA 5FAHA 1WI2A 2OC1A 4ZHMU 2RCZA 1TABE 3A83A 4MNYA 3ELAH 4JOEA 3IG6B 4XFQA 1C1SA 3OY5U 1W10U 4CR5A 1ZJKA 5HM2A 1Z71A 4IMQA 1CE5A 2Z9GA 5EXMA 3TSWA 3S7HB 4NMTA 1CHOF 1RIWC 1BQYA 1YPMH 2ZQ2A 4FUEA 1BUIA 1GL1A 2EGOA 2I0IA 1WV7H 1SGPE 4NFFA 2Y7ZA 4K76A 1FI8A 1CA0B 1DWBH 1C5XB 2CHAC 1G2MA 4REYA 1EOJA 1GQ5A 5E2PA 1FQ3A 1YPHC 1D3PB 2X7ZA 2AGEX 2G00A 4O97A 2YT8A 1Q2WA 1P2MA 4YOJA 2GCTB 3O8BA 4DOQA 1W13U 1AE5A 3MH6A 2BVRH 2D26C 2P94A 5EU8A 1SPJA 1KTSB 1WG6A 2WYGA 3DUXH 2ZGHA 4MG3A 1ZJDA 3U1IB 4X8TH 3VB7A 2JETC 2UUJB 1GHAG 4AB9A 4WJG2 1L6OA 4ABDA 1GJ9B 1G37A 4JZDH 2W7RA 1O3LA 1P2OA 1QTFA 3P92A 1P05A 4GLYA 3C27B 1LKBA 3EA9A 2P93A 3CBXA 2WPIS 3VGCB 1BTPA 1C1WH 2JOAA 1ESTA 2HALA 1RGRA 1OP2A 1OXGA 1P1EA 1AD8H 3SJ9A 4K3JA 1SOTA 3VB4A 5F67A 1K1JA 5E8EH 2A45B 2XNIA 1VB7A 1ABJH 1NO9H 1UCYK 3UPEA 5DP9A 2W4FA 1G9IE 1TNIA 1ZYOA 2G5NA 2Y5GA 3DJAA 1SFQB 2XBXA 4PQWA 5JB8S 3BG4B 4E35A 2BD2A 3I78A 1XUKA 3TITA 4UFGH 5CHAC 4NNMA 1GBJA 1N6DA 3EA8A 2P3UB 1XZ9A 2XYAA 1UHPA 2J94A 3M3VA 2GZ8A 1LHEH 4DIIH 1SI5H 1LHCH 1P2IA 2CF9H 1VJAU 1CHGA 1GJ4H 1PQAA 1WQVH 5HM9A 5JYIA 2OZFA 1UTQA 2LA8A 1CGIE 1X5RA 5F8ZA 2H1UA 2GD4B 3MU4A 4CH8B 1S81A 1DSUA 3MOCA 2O8UA 4AMHA 3K1RA 2NU3E 2FS8A 3RM0H 5SGAE 1KDQA 3DA9B 1OWHA 3GJ9A 1VZQH 3PM3A 5FXLA 2M10A 4FUHA 1CT0E 2ZNKH 3BIUH 3PB1E 4ISHH 3F68H 3PDVA 2W5EA 3CH8A 1UHBA 1SR5C 2I6VA 2NU0E 3BG8A 1SGNE 3MO9A 1OWJA 8LPRA 2BXTH 2FNEA 1ORFA 2A32A 3ODFA 1NPMA 1HDTH 1G30B 4GPGA 1UVSH 1SG8B 1ZTKA 1SC8U 1ZUBA 3LC5A 3OY6U 2A7CA 4FU8A 3B8JA 1C2IA 1W8BH 4R0IA 4FXGH 1ELDE 4SGBE 1A46H 3LOXA 1O3AA 2VZ5A 1V2LT 2RRMA 2RA0A 2ANMH 1CA8B 4MTBA 2FI4E 3F9FA 3RXCA 1O2IA 3ZVBA 1WIFA 1BRCE 5HDYA 1O2KA 1MZDA 2NU4E 2OBQA 3NCLA 1MKWK 4Q7ZA 5F8TA 2DMZA 3GY2A 1O2TA 1ZSKA 1DITH 1MQ6A 1TRMA 2TBSA 1U38A 3ATKA 2Z3CA 3R0FA 4CRCA 2GV7A 3I4WA 1CHOG 3SORA 3ZZ8A 4B2AA 2C8WB 3E17A 2P95A 3T26A 1Q7XA 1V2UT 4P2AB 2CGAA 2HRVA 1TRYA 2G5MB 2ZG0H 4KGAA 1GI0A 1C9TA 1P2QA 4PROA 1GBKA 3M5OA 3MNBA 1AFQB 4I8KA 1BA8B 1F0SA 1Y3XA 3M5NA 1OBXA 1DT2A 2FTMA 2OMJA 4JK6A 1N7TA 2DUCA 4ZHLU 3ZZ5A 4ISOA 1SGYE 2UWLA 5EXNA 1C4V2 3MU0A 2EI6A 2UUKB 1Y3WA 1HNEE 1P11E 2QXIA 5ETXA 3FP6E 1TBQH 1V2KT 3GY6A 2IWNA 5E0HA 2YUBA 2SNVA 1C5LH 4X6OA 5C20A 1MUEB 2DLSA 5AF9H 5FB8C 5LGOA 1GVKB 2EGKA 3ZV9A 3UY9A 3RL8A 1X6DA 1OP0A 4JOGA 2Z9KA 2BQWB 4AORA 4WYTA 2PA1A 4YYXA 2A4RA 1YBOA 1BTHH 2MX6A 1BT7A 2VVUA 1CGHA 4ISIH 1PYTC 1OP8A 5G1DA 1IHJA 2HNTE 1KDQB 2GT7A 4A1XA 2ALVA 4JOPA 1N8OB 3RDZA 4FUBA 1Y5UT 1CGJE 3GCTF 2ZP0H 1AWHB 1HUTH 1PPEE 1L4ZA 1V62A 1IQNA 1GJAB 2ZFSA 1UHBB 3TJNA 2V90A 2XC5A 3SFJA 3QIKA 4INKA 1ZGIA 5LPFA 1P03A 4ZUHA 3PWBA 3QWCH 4ABBA 1LO6A 2BDIA 2Z7FE 1BTYA 1RFNA 3HATH 1BTZA 1FDPA 1MTWA 1HAOH 1SGFG 4YOGA 4E06H 4R8TB 2ANKH 1HB0B 3DFJA 2ZPRA 7ESTE 1TGTA 3A7WA 5C1UA 1Z8JB 1ELEE 2A2QH 1ZGVA 3GCHC 1ZPCA 3UOPA 3GSLA 1V5QA 2ODQA 2F3CE 5A0BA 2EAQA 1ZHPA 2QGRA 1DUEA 2J38A 2PWXA 5G4BA 1ELTA 3E91A 1QBNA 1TX7A 2R3YA 1ARBA 1EZQA 3RC5A 1A1RA 1O38A 2C90B 3OX7U 1H9HE 1O30A 2Z17A 1WU1A 1MC7A 5GNDA 2RG3A 1FZZA 5I7ZA 3DHKH 1XKAC 2THFB 4DIHH 1MTUA 1LHGH 3UREA 1HJ8A 4ZAEA 1VGCB 1QQ4A 4F4OC 5HJ1A 1ANDA 2AGIX 4I33A 1OWDA 2IOTA 1VJ9U 3NWUA 2BZ6H 1F5KU 2XBWA 1CVWH 3BSQA 4K1EA 3QGNB 3BTEE 4XBCA 1G3CA 1VCQA 1NZQH 1UEPA 1HFDA 7GCHF 1V6DA 1DM4B 2F9OA 4KKDA 2WPJS 2AWXA 5FX5A 1DVAH 4Q3HA 2IN2A 2STAE 1O3OA 2ILNA 1O5GH 4JYUH 4Y8ZA 4FUJA 4ISLA 3GOVB 2FWWA 2BQ7B 2BD9A 2FYQA 4JYTA 2HWLB 4UU5A 2QKTA 1V2ST 1O2RA 1UF1A 3SHAH 2ZDKA 4KTUA 2FODA 3A8AA 2Y5FA 4OGXA 4IN1A 3PLBA 1KSNA 4MPAA 3JZ1B 2A7HA 1O33A 1C4Y2 1CU1A 1FIWA 3SNCA 2VIDA 2AWUA 3RXDA 3SHCH 3RU4D 2FX6A 2Y81A 4B1TA 3MH5A 1OBYA 3D49H 1P2JA 3SNEA 1FC6A 4DCDA 3WKLA 4OGYA 1SGDE 1THPB 1O2HA 1PQ5A 1T2MA 2DLUA 1NC6A 3UR9A 5DP6A 3TMHA 5TJXA 3DJ3A 1TPOA 1AN1E 1K2I1 1UTLM 5JBCS 2HGAA 1WOFA 4TWWA 1LHDH 1OYTH 3MO3A 2F91A 3SZNA 4MPVA 1YP9A 1QL8A 5HEDA 1IQJA 1PFXC 3A7VA 3MTYA 1F5LA 1C5QA 2Y5HA 1EB2A 4O3UA 2OCSA 4CRBA 3RP2A 2SGQE 1DSTA 2ZWLH 2HNTC 4K6YA 3V3MA 1WTGH 2LPRA 2ZTXA 3A82A 1LPKB 2PFEA 3P17H 1XXFA 1D4PB 2QC2A 3ZZBA 1V2VT 1YLDA 4GHTA 2M0UA 1BMAA 2L97A 1K1PA 2FLRH 2QKVA 3WY8A 5JXBA 3GICB 2UUYA 5DP5A 2BVXH 3SU4A 3T28A 1PJPA 1QCPA 1YC0A 2DKRA 3ZVEA 2ZPQA 2PLXA 1BBRE 2WV5A 2DAZA 3K6YA 1HAYB 4AG1A 4MNVA 3LDXH 1S82A 1SGEE 3RC6A 3ID3A 2KG2A 1W3CA 4FUIA 4BNRA 3U8TH 5HFDA 1SOZA 4HZHA 1BIOA 2OD3B 1RTFB 2ZKSA 1MH0A 1UJDA 1GJ6A 2GGVB 3PLKA 4IGDA 4YOIA 5EOKA 3V7TA 1W0ZU 4K72A 2ZQ1A 1GI1A 1GVZA 3GY8A 3QGJA 3RXFA 4GHQA 1T7CA 1CQQA 1HAGE 1SHHB 1V1TA 2BB4A 5EQRA 1JOUB 1R6JA 4J1YA 1NT1A 5AVDA 1HYLA 1XVOA 3SBKA 4KP0A 1O5DH 2E7KA 1V2JT 3F9EA 2J92A 2KAWA 1MMJN 1UO6A 4Q2KA 1GPZA 3AVZA 2ZPMA 3SO3A 3I1EA 1GBEA 2P8OB 5E0JA 3KZEA 1HAPH 3Q3YA 1SQTA 1O3EA 2QKUA 1PPCE 2BD4A 2ZCLP 3RXIA 3U8OH 1TGSZ 1FN8A 1F5RA 3SU1A 2FOBA 1QQUA 1N7EA 1MQ5A 2AIQA 4XBDA 1S0RA 6ESTA 4JOJA 1NFWA 1A7SA 3B9FH 2M0VA 4P0CA 2AMPA 5GCHG 2VGCB 1YPHE 2KV8A 3BTFE 1GJCB 2ZI2H 4KELA 4GSOA 1AWFH 5TCAA 3MU1A 1F0TA 1C2EA 5FPYA 3UIRA 4AYYB 2R9PA 1PQ8A 1HJAC 3PYHA 3R3GB 1PPHE 2F9UA 1IQGA 4YZUA 2QXJA 1THSH 3Q00A 4MPXA 1LKAA 1O3FA 1QB9A 4MNXA 4NXPA 2DJTA 1Y3UA 3RXBA 1O2XA 1MD8A 1WTHD 4AOQA 1TIOA 5BRRE 2BQ6B 1VA8A 2OTVA 2RCEA 2GZ9A 1EQ9A 2Z3DA 3TH4H 1T8OA 3PMAB 1NTPA 1T4UH 2LNCA 4NCYA 2PNTA 1W14U 1ARCA 4K8BA 3I18A 3MNSA 1MKXH 2REYA 3MWIU 3VXEH 2BTCE 4DJZB 1HLTH 2HLCA 3LNXA 2FOFA 5T3HA 5GXPA 1WFVA 1N6FA 1C5NH 1OX1A 2ZDLA 3GYMA 8GCHG 1UVUH 5B6LA 1GJ7B 4X1NU 4O3TA 4RSPA 1L1NA 1BHXF 5IDKA 1F92A 1HAXB 5J4QA 2OP9A 2QG1A 3AW1A 1NESE 4OS2A 2AFQB 5HFCA 3RC4A 4CHAC 2FS9A 4GCHG 2EEKA 2FZZA 4AX9H 1TP3A 1IQHA 4FU7A 4X8VH 1UJ1A 1PPZA 2ZC9H 1G36A 1Z1IA 1HXEH 2I0LA 3QTVH 1LTOA 1A0HB 2VWNA 2P3WA 3O46A 2W3IA 4THNH 3V12A 1JIRA 2FE5A 3TGKE 2ZHQH 3EGHC 1NN6A 1THRH 1UM7A 2J2UA 3RUOA 3PV4A 1GHBF 2PGQB 5EPNA 1JRSA 2VNTA 2FPZA 3OYPA 1GQ4A 2R0LA 2PGBB 3GY4A 4H4FA 1TYNA 2OLGA 2EXGA 1EB1H 1TBRH 3SJKA 3MH4A 1MTSA 1IHTH 5T6DA 3RXPA 2KRGA 3Q3KA 4ZH8A 2KL1A 1HV7A 2VPHA 1J15A 1EAXA 3A7XA 3U98H 1G3DA 1Y8TA 3A85A 1AVWA 3JZ2B 4KTSA 4GVUA 1Z1JA 5F6MA 3A8DA 5EQSA 4YM9A 3OTPA 2WYJA 4JYVH 1EATA 1TP5A 2AINA 4GVCA 1S6HA 4JOHA 2F0AA 3HPKA 4Y8XA 3QJNA 3MI4A 2YNBA 3PO1C 1C1UH 3BPUA 2VVCA 3ZVCA 5JBTA 3SUFA 1UCYH 3B23B 5JPMH 4NMPA 1TNJA 1TPPA 1A4WH 1RIWB 2J34A 1NRPH 4I32A 4NSYA 3NPSA 1A3EH 1O3MA 3P8FA 2AGGX 3QDZB 3E90B 4OS1A 5DO4H 1MFLA 1L1JA 2BX4A 1C2DA 1YBWA 2W7SA 2BHGA 4CBNA 5D13A 1Q3OA 4IN2A 1BBRK 1D5GA 4B2BA 4WYUA 2ZDVH 1LVYA 5LPRA 3VEQB 1RXPA 2CJIA 1DX5M 1V2MT 1W7XH 1ZTLA 1AKSA 4Q80A 4UDWH 2BY5X 5E21A 4Y0ZE 4AFZA 2OPGA 1GBBA 2DB5A 1C5WB 3GY3A 1AB9C 4EDJA 2ZHDA 1C2GA 1OWEA 2GT8A 1EJNA 5DP8A 3QZRA 2OCVB 2D8WA 1ID5H 1MU8B 2C4FH 2D1JA 3A84A 1TNGA 1MFGA 2H3MA 3STJA 3UQVA 2VU8E 3VXFH 5FX6A 4DG4A 2HVXA 3ITIA 4TY7A 2H3LA 2KYLA 1FC7A 1HAVB 1P09A 1ELCA 2ALPA 1QAUA 4LMMA 5DTHA 1C1RA 3O8DA 1WHDA 2BY7X 2BLOA 1HPGA 3KEEA 2BY6X 1DS2E 2JH0D 1ELBA 2KJPA 1CA0C 3E6PH 3MO6A 3TIUA 1KXCA 1ZOKA 5A2MH 1QRZA 3LH3A 1K1LA 2KQFA 1GCTC 4LZ1H 1SL3A 3BN9A 2GCTC 4UD9H 5A2PA 1M5ZA 1VITG 1RTLA 4X8UH 3NXPA 2FIRH 1AUJA 1O3CA 1BMLA 4HFPB 4B2CA 3TGJE 3A87A 1MKWH 3LGYA 2I6SA 3BTQE 3H7TA 2FOHA 2A2XH 6GCHF 5EQQA 1P1DA 3R68A 4F8KA 2Q3GA 2ZGJA 4X2WA 1ESBA 2VIPA 3BEUA 3CENA 3VGCC 3LGVA 1KXFA 1LPGB 1F0UA 2V1WA 3Q77A 2YT7A 2BX3A 3M37A 1YCPK 3RXGA 1Y59T 1NRSH 2SGDE 1O3PB 1XKBC 3VQGA 2A0QB 2BLVA 4A5TS 1GHBG 3V0XA 4JZ1A 3TVJB 3VB3A 4ZKNU 1FAXA 3DD2H 1LVMA 1ELFA 2O8TA 3AXAA 4IC5A 1A5HA 5HYOA 5C1XA 2IWOA 3L33A 3RXMA 2QT5A 1FY4A 1OBZA 1O2GH 1C1NA 1B7XB 1QB1A 1O3BA 3UNSA 2H5CA 1Y7NA 2VJ1A 4AN7A 2G52A 5FBEA 1EZXC 3SUGA 1FLEE 3BF6H 5L6NH 1AKSB 2B9LA 3A86A 1VITH 1VCWA 1GG6C 4JL7A 2CV3A 4JZEH 3HK6B 1YPKH 1S6FA 3KL6A 3ODDA 4FUDA 3K50A 4I8JA 3SW2B 4VGCB 1PPFE 4NIWA 5E1YA 1GDQA 3UTUH 1RZXA 1BFEA 3K6ZA 4MDSA 1YPEH 3UR6A 1NM6A 3AAUA 2ZU1A 3QN7A 1ZOMA 2QY0B 2ANWA 3WKMA 3A8CA 3SJ8A 1SQOA 1NTEA 4JOFA 1V2QT 1BHXB 4HI3A 2GX4A 1K1IA 1T8MA 1AIXH 1TNHA 5TCCA 3F9HA 3LPRA 4CBOA 4NZLA 3VB5A 3TSZA 1ANBA 1GBLA 3ZYDA 2Q1JA 1LMWB 4Z8JA 1C5YB 2SGFE 1GMHF 2XCFA 4I8LA 3VPKA 4LXBH 1WFGA 2B7DH 2ZGCA 1C5VA 1C4U2 5K7RA 4Y7BA 1SVPA 1UJUA 2ODPA 1WBGB 9LPRA 3SV9A 1KYNA 4K1TA 4NMOA 1ZPBA 4WXVA 1NF3C 1SGQE 5A09A 2GDEH 1W11U 3P95A 1NFXA 1BOQA 2TGPZ 1C5SA 2H9TH 3W94A 2FOCA 4O03A 3ZVAA 4ZROA 2VH0A 1GBCA 2DE9A 2Q6FA 2V3OH 4NA7A 3BTHE 1BMMH 3E3TA 3I77A 5F3XA 1GCDA 4U30A 3ZZ6A 3TU7H 1YPJH 1AFQC 3H5CB 2ULLA 4AG2A 2I1NA 1A3BH 1TX6A 8KME2 3BIVH 2CSSA 3PMJA 2ZCHP 3I29A 2EGNA 5LPEA 3L3TA 1WH1A 1X5QA 2Z9LA 2EEJA 3HGPA 1DLEA 4GHNA 1O32A 1IAUA 1SGFA 1FY8E 1KXAA 4TPIZ 4UFFH 6GCHG 2PUQH 4IBLH 4MQAA 4BAKB 3SUDA 1TB6H 1O5EH 1SGCA 2M5TA 3S69A 3LGIA 3ZYEA 1YLCA 3P8GA 3GCHB 3EDXB 3EA7A 4NWKA 3MNXA 4ASHA 1DWEH 1ZR0A 2ZFPH 1UTOA 1G9OA 1WF7A 1N8OC 1SLWB 1TX8A 1X7AC 1BJUA 1BJVA 2O8MA 2EEHA 3SNBA 4X0WU 1QBOA 2FOEA 3TJOA 2EC9H 5JBAS 1TFXA 4K5ZA 2KOJA 1GI3A 1G32B 2EDVA 3LU9B 2R0KA 1T32A 1AO5A 3JXTA 1DLKB 2FTLE 4I8HA 2RA3A 4TY6A 1E36B 5C67A 4ABAA 4UFDH 5EZ0A 1ETSH 1QFKH 2F9NA 5HFBA 4NIYA 1O3NA 2YNAA 2OQUA 4H42U 1IQIA 4IMZA 3NGHA 2VWOA 1FPCH 1TGNA 1MCTA 1CT4E 2GTBA 2QA9E 1GBDA 2M0ZA 1OWKA 3FAOA 3SU2A 1FMGA 4FUFA 3SQHE 1FN6A 4CRAA 2JILA 3E1XB 2I4SA 3RXLA 3GDUA 2WPMS 1PPGE 3GY5A 3LJOA 2HOBA 2ZCKP 1C5PA 1FIZA 2NWNA 4Y0YE 3PMBB 2CF8H 3U8RH 1AU8A 2DE8A 4X6MA 4FU9A 1A5GH 2WL7A 5I46H 4J2YB 4K60A 1P10A 2PSYA 1UTKA 2PW8H 1OKXA 1O5AB 2OC8A 2OQ5A 1DDJA 1OPHB 3ZZDA 2AEIH 1GHZA 1QBVH 3BTDE 2A4OA 1EAWA 4D9RA 1EXFA 1GMHG 2MHOA 1Y5BT 4ZKSU 1VGCC 2H9EH 2W3KA 1XMNB 2NU2E 1EJMA 2XWBI 3QLPH 3LKWA 1C2MA 2BM2A 3SNDA 2ZA5A 3HKJB 1O2ZA 3W95A 3NFKA 1P0SH 2EA3A 2Y7XA 2QF0A 3P6ZB 4CREA 2UWOA 3GCNA 2ZU5A 1G2LA 3T25A 1TMTH 1CSOE 1QJ7B 3FFGA 2PKSC 1BITA 3SUEA 1AQ7A 2TGDA 5FPSA 1N6YA 1YGCH 3CBYA 1LHFH 2L4SA 2BXUH 2TGAA 4JK5A 5LH8A 1O2MA 1FAKH 2QBWA 1EPTC 3TNSA 2B8OH 1O2WA 2WPLS 1GGDB 2AS9A 3AW0A 4D9QA 4IS5A 4JZFH 3HPTB 2SFAA 1C1VH 4OS5A 1S85A 5F8XA 2HPPH 1IQFA 2FLBH 2PKTA 3ESTA 2A4QA 5HGGA 1BE9A 3RMOH 3BEIB 1O3HA 1K32A 2FCFA 1S83A 2BD5A 2FI5E 5B6OA 2XRCA 2VSPA 1F0RA 1GI8B 2UZCA 1AY6H 1PQ7A 2ZDMA 1TGCA 3GCTG 4X2VA 4CR9A 3CC0A 2G51A 2AMQA 3SN8A 2ASUB 1J14A 2JH5D 3V13A 3ZVGA 2WPKS 4ESTE 2FX4A 1V5LA 1EJAA 2FO9A 1GDUA 3QGLA 1H4WA 2PDZA 2TIOA 4UFEH 1JXPA 3UWIA 1YM0A 1UTNA 2AWWA 2SNWA 5DKMA 4YESB 1LCYA 3PDZA 5E22A 2GKVE 3GGEA 1W7GH 1P57B 3QUMP 3A7ZA 4BXSA 3MHWU 2UWPA 2Y80A 2A31A 1N6XA 5DP4A 1CBWB 1BTXA 4WWYA 1GMDF 2VINA 2XWAA 2BMGB 5ABWA 1SLVB 1FONA 1P01A 5C5NA 5H3JA 3P8NA 3BTTE 4RKOB 4JMYA 4B76A 3FP8E 2KAIA 4X1RU 5E11A 4BAHB 4H6TA 1T31A 3RXTA 4YTAA 2GMTB 1V2PT 5EW2H 1ZRKA 1P06A 1A0JA 3QTOH 1DY8A 5JB9S 3IITA 2IPHA 2R3UA 5HFFA 1O3JA 3M7QA 1GJ5H 2G55A 1ACBE 2D2DA 2IJOB 2PKAA 3T62A 1SFIA 5EG4A 3Q76A 1H8IH 1C2KA 2V35A 1QIXB 4INHA 2AH4X 4Y7AA 2G4UA 3A81A 4GUXA 1CO7E 5ESTE 1GWAA 1F2SE 1UITA 1UTJA 2ZEBA 1JRTA 3SI4H 2Z9IA 1L2EA 1HJAB 3EYDA 1IQEA 6CHAB 1L0ZA 1QNJA 3HPMA 2QAAA 2RDLA 7GCHG 2KPLA 2BOKA 2F9VA 2B5TB 3RXSA 1OYQA 2O8WA 3PTNA 3P8OA 1DFPA 3HK3B 1VCPA 5E2OA 1IQLA 1AMHA 1DY9A 1WSSH 1FV9A 1Z8RA 2EI7A 5GJ4B 3LT3A 2CSJA 2CN0H 2YTWA 5L2YH 1CT2E 1H9LB 1UCYE 3RM2H 1TA6A 2BY9X 4OS6A 4Q6HA 2LUIA 1BTUA 1V2RT 1QHRB 1W0YH 1ZSLA 4I7YH 3O8CA 3FZDA 1HCGA 2F83A 5C3NA 7KMEH 1C5RA 2EV8A 4B71A 4NMVA 3FANA 4NIXA 1VR1H 1GJBB 2OSGA 1GHAF 4NA8A 3RXRA 1JBUH 3A8BA 4CRDA 2GCHF 1BB0B 3RXKA 3K65B 4Q2OA 1HAHH 2XXLA 2H5DA 4FGMA 3G01A 1EX3A 1U6QA 1E38B 2GP9B 3HKIB 3H7OA 1O2UA 5IYTA 5EW1H 3K2UA 5HF1A 1BRBE 2FN5A 2ZTYA 1O2VA 2DM8A 3D65E 3MNCA 2ZPLA 1DE7H 1N1LA 1W2KH 1KLTA 1HIAA 2P3FH 1UEZA 1V2NT 1C5MD 3E8LA 2C8ZB 4Q2QA 2XC4A 4Y11E 4E7RG 1XUGA 1IOEA 1W9OA 3GCOA 1MTNB 2KAIB 1C5TA 1JWTA 1WCZA 3OU0A 1DANH 1P8VC 3KGPA 2C8YB 3LH1A 2M3MA 2JH6D 4DW2U 2VWRA 4G69A 1ZMNA 1HBTH 3LIWA 3RXEA 5J4SA 4Q7YA 1DOJA 1DWDH 1GHYH 3TPIZ 4D76A 4X2XA 4WMDA 2PKAB 1MD7A 3ZZ4A 1RGWA 1TLDA 4JOKA 2A5AA 3A7YA 4K8YA 1NU7B 2ZF0H 3PROA 1T4VH 3SHUA 3TGIE 1YYY1 2EEGA 3RXQA 9ESTA 1Z87A 3HVQC 1EKBB 2Z9JA 3CS7A 3LC3A 1ZHMA 4MPWA 1GMDG 3KQBA 4JCNA 4CRFA 3D23A 2PUXB 1Q31A 1TONA 4NWLA 3PV2A 2PR3A 3KNXA 1NROH 3PS4A 3FVFB 1UTMA 3KIDU 3U69H 2KOHA 1QB6A 1WUNH 4XHVA 4K75A 1UVPA 2P59A 1O3KA 1WI4A 2BLWA 3PWCA 4BAMB 2JXOA 3HGNA 1J9CH 1PYTD 4XDEA 2D90A 4DGJA 2XBYA 2CHAB 2ZHEH 2VVVA 5EODA 1MKXK 4B73A 1P2NA 4ZKRU 3EAJA 3RL7A 1PPBH 2FI3E 2ZFTA 4Z33A 1RTKA 2C3SA 2VSVA 2FYRA 1YCPH 2IWPA 5K0HA 1IQKA 4AGJA 1GM1A 1S5SA 4SGAE 2EEIA 1WHAA 5A8YA 3T29A 2JETB 1JIMA 2VIWA 2V0BA 2Q6DA 1JMOH 1S0QA 1C5ZB 2VH6A 3B76A 2J9NA 2BDBA 4YLUA 1GVLA 4FUGA 3GDSA 3URCA 1L4DA 1ZRBA 2G4TA 4AGKA 4ZXXH 2Q6GA 1IU0A 2J95A 3RU4T 1Y5AT 4ZKOU 1ANEA 1A5IA 1GBHA 2V6NA 1HIAB 5HEBA 2Z3EA 1FCFA 1C5UA 1YPGH 2OINA 1GCTB 2ZECA 4X1QU 5C5OA 3FY5A 1K1NA 3MYWA 3ID1A 1S84A 1KXDA 1MAYA 1FJSA 2ZZUH 5T6GA 2TRMA 3E0PB 1BDAA 1UVOA 2AMDA 2A4GA 1KLIH 1M9UA 1O31A 5CHAB 1BRAA 3ZV8A 3SU6A 2KJKA 4X6PA 1HGTH 2GCHG 1AHTH 4O9VA 4NMQA 4ABIA 3EGGC 1C2HA 1ETTH 2FESH 2VWLA 2EJYA 1QA0A 3SNAA 3UQOA 3KQEA 1SLXB 5GIBA 2QF3A 1FY1A 3ATMA 2J4IA 4Y6DA 1O2JA 3ATLA 1SGIB 1NFYA 4YLQH 1UMAH 4WXIA 2K1ZA 2XTTB 1GJDB 1QAVA 2SGEE 4E3BA 3M36A 1SGTA 3KCGH 2ZGBH 5EXLA 3UWJH 5HFEA 1DXPA 8GCHF 2QV1A 1GI6A 3LJJA 3VQFA 2HGTH 1RS0A 2XBVA 1TQ7B 2OQSA 2PV9B 3U1JB 3PTBA 1RRKA 1AZ8A 2EI8A 3RXOA 1AVGH 1J16A 3BG4C 2Z6BD 5F03A 4A1VA 1Z8IB 3L6PA 1E34B 3SQEE 1UK3A 1QLCA 2IWQA 4NIVA 4UEHH 3AASA 2I04A 2PZDA 1MCVA 1GG6B 1ZSJA 1OSSA 4OS7A 4K78A 1GI5A 1A61H 1HAIH 1O37A 1O2OA 4TWYA 5BPEA 3SI3H 1UEQA 3QJMA 1RJXB 1ZPZA 1U39A 1C1PA 1AFEH 1TGBA 1B5GH 4E05H 2WUBA 4TPYA 4XBBA 4Z0KA 2LOBA 4ABEA 2HNTF 3R69A 1INCA 1D3TB 2HE4A 1H1BA 1SLUB 1NU9A 3CS0A 2R2WU 2A5IA 3EGKH 3BEFB 4X2YA 1P04A 1O36A 4Q7XA 3BTME 5G1EA 1O2SA 2OC7A 1GJ8B 2ZU2A 2GZVA 4HOPA 4BTIB 1VAEA 3S9AA 3SOSA 5GLJA 1J8AA 2F5YA 2BOHB 4OEPA 3GISB 3MU8A 1TQ0B 1DICA 4JORA 1L1GA 2QXGA 1XM1A 3MMGA 2TGTA 1MZAA 2BYAX 3R0HA 1SSXA 4U01A 1I92A 1YF4A 1ZLRA 1ELAA 1GMCF 2O9QA 3CBZA 3VB6A 3ZZAA 4A6LA 4AFQA 3QX5H 4BANB 2CXVA 5C1YA 5E0GA 3ZRTA 1TOMH 2ANYA 2BDHA 1K28D 1LVOA 1TWXB 3DORA 1WJLA 4OAJA 2W7UA 4MPUA 1A2CH 4X1SU 1LDTT 1AUTC 1KTTB 1SGRE 4VGCC 2VWMA 2KJDA 3NZIA 1QY6A 1X45A 5DGJA 2ZHWH 3TH3H 4KFVA 1FC9A 3CYYA 2AIPA 3KZDA 1Z8GA 1D6WA 2PTCE 2EDPA 1UEWA 4WF8A 3STIA 4DURA 3MH7A 2BVSH 3MU5A 1K1OA 2JREA 3ZZCA 3RLEA 4NNLA 3GY7A 3F6UH 1E35B 3A89A 5EGMA 2R4HA 2FP7B 1N7FA 1EZUC 1AZZA 4BAOB 1TOCB 3M5LA 1QAVB 1NFUA 1V6BA 1O35A 1P3CA 5DP3A 1SQAA 1OZIA 3K9XB 2OBOA 1D3DB 3QDOA 2FOAA 4MNWA 2O8LA 1ZHRA 3ZZ9A 1W12U 4FVBA 4Q2NA 1KXEA 1WYKA 3TK6A 5FCKA 3NFLA 4K2YA 1YKTA 4AZ2B 4U2WA 4RKJB 1P12E 2BDAA 3TK9A 1IU2A 1EP5A 1SBWA 3S9CA 1P9SA 2P3TB 2NU1E 4Y79A 5A0CA 4LZ4B 1QGFA 3EQ0H 1W9QA 1K9OE 2ZU4A 2P16A 3BTKE 4ABGA 1P02A 3TJUA 2K1QA 2QXHA 3P70B 4DVAU 1K1MA 1EPTA 1GI7B 4A92A 1DPOA 1C2JA 4ZMAH 3BV9B 2F9PA 1H9IE 2ZDAH 2BD3A 4TYDA 2JIKA 2ZO3H 3FP7E 1N99A 1DWCH 3RXUA 1GBTA 2KOMA 4QT8C 2G2LA 4ZXYH 2QN5T 2H6MA 2SGAA 4YT7H 5AFZH 1EP6A 1IHSH 1KY9A 4ABFA 5GDSH 5FPTA 1GL0E 2VIOA 1V2TT 1TPAE 4NMRA 3M61U 1NY22 1UK2A 1MU6B 1SB1H 4HOPB 4ABHA 1XVMA 1Y3YA 1GI2A 5I25A 3S7KB 4NZQA 4INLA 2LC7A 3PV5A 3LONA 2GZ7A 1ZTJA 3KQCA 1G3EA 5CMXH 3O5NA 4Z6AH 3KQDA 1TALA 3DIWA 2M0TA 3NUMA 2BLQA 2ZHFH 1EOLA 4XE4A 5A8ZA 3BTGE 1MBQA 1O5BB 4FUCA 4D8NA 1TRNA 1MTVA 2TPIZ 2YUYA 3T27A 4CRGA 1HXFH 1O3DA 3DT0H 5GWZA 4AFUA 1T8LA 1D6RA 3ZZ3A 1UJVA 1XUFA 2STBE 1G3BA 2QYIA 1C5OH 4K1SA 2JWEA 3SV6A 4Q6SA 3LGWA 5AHGH 4DY7B 1TE0A 3BTWE 2QIQA 3LNYA 3IWMA 1O3GA 2ZIQH 1KEFA 5EPYA 1GHVH 1C1QA 1YPLH 5HETA 1FY5A 1LVBA 4D7GA 2W26A 2FDAA 3UNRA 3GYLB 3Q3XA 1UFXA 4BXWA 1GMCG 2CMYA 4UU6A 3QZQA 5GPIB 1EAIA 1GHXH 1HAZB 2HE2A 4NSVA 4BOHA 1W9EA 1HJ9A 1BZXE 1TPSA 5H4IB 2D92A 1GBIA 3T2NA 3OTJE 5DPAA 1O2LA 5GCHF 3A7TA 2CS5A 3RLYH 2JINA 1ESAA 3UOUA 2UUFB 4YT6H 2PKSB 1V3XA 2Y6TA 3ATIA 4NXQA 2G8TA 1ETRH 2Q9VA 1U3BA 2ZFFH 1O39A 3SUZA 1EPTB 1LQDB 2H9HA 3RMMH 5L30H 3UNQA 4BTTB 1ABIH 1AGJA 5L2ZH 2XCNA 3D62A 2ZGXH 1BMNH 1ANCA 1AE8H 3RXHA 5DJ7A 1A0LA 1IQMA 1QA7A 5JDUB 5ESBA 2F9BH 1EAUA 1AI8H 3UFAA 3KF2A 5DG6A 1DXWA 3VFEA 1X5NA 1V2OT 4IW4E 1LPZB 1O5CB 1DUAA 1Z86A 1QJ6B 4AFSA 1Q3PA 5E6PB
chains in the Genus database with same CATH superfamily
1ZMJA 1T8NA 3TNTA 3ID2A 3L4FD 3M5MA 3SU5A 3LGTA 2O2TA 3TSVA 3SGAE 5EYZA 4ABJA 3DJ1A 3M7UA 4GCHF 4WMEA 4BAQB 4HGCA 1EZSC 1QURH 1V2WT 2KBSA 4N6XA 2BDCA 1GBFA 3EE7A 5FHTA 3PLPA 3U9AH 3TK5A 2FOGA 8ESTE 1TA2A 2BDGA 1NRQH 1COWD 2QCYA 2OS6A 4B74A 1GGDC 1QL7A 4F49A 4HTCH 2ENOA 2HPQH 4LK4A 2YMSD 2PTNA 1EUFA 2XNDD 5HMAA 4CH2B 2Z94A 5IK2D 3SHWA 2KA9A 3A88A 3SGBE 3RMLH 5A8XA 1GHWH 1EASA 4K69A 1BRUP 4UONA 2C8XB 1O5FH 3FZZA 2BD7A 2GV6A 4Y71A 4P00A 1C1MA 3MFJA 3PMHB 2V3HH 3SU0A 1X8SA 1YCPM 1BTWA 1C2FA 2D8IA 1XX9A 2YOLA 3M7TA 3QE1A 2L74A 4XOJA 3E16B 3RU4E 4UE7H 1K21H 1U37A 1XUJA 1ZZZA 1K22H 2ZU3A 3GDVA 1QRWA 2A7JA 3ZVDA 3SJIA 3F0PA 1UVTH 1P3EA 3ATWA 1GI9B 4R2ZA 1UTPA 2ZTZA 4WVPE 1H8DH 2OC0A 4MVNA 1ELGA 2PKUA 4ISNA 1TBZH 1KWAA 2H2BA 2BY8X 1TQ3A 3DFLA 1CBWC 1SHYA 3RXAA 4BTUB 1ELVA 2G5VA 3KN2A 7LPRA 4WH6A 1UK4A 1KXBA 2A5KA 2JDID 1QL9A 4H11A 1ZMLA 1C9PA 1OOKB 2OXSA 3RXJA 2LC6A 4IC6A 2I6QA 5T6FA 4X6NA 1C1TA 2KPKA 1J17T 3LGUA 2GMTC 3C1KA 1KLJH 1TAWA 4I31A 1TMUH 1F7ZA 3SV2H 4U32A 2VIVA 2ZFQH 2R2MB 1FXYA 1SMFE 4Z1MD 2P8OC 1WQSA 3K82A 4JJ3A 4X1PU 2C93B 3OSYA 3TH2H 1Y3VA 1GDNA 5CE1A 4OEOA 5FCRA 1KIGH 2GVFA 3SU3A 1B8QA 4GVDA 3A80A 4KTCA 4M7GA 2K20A 1BCUH 3RLWH 1NS3A 2W6ID 2WUCA 4P02A 1WF8A 3TLOA 3F1SB 1N6EA 4WMFA 4DT7B 3S9BA 1MAXA 2XC0A 3ZZ7A 1BMFD 2A1DB 4A1TA 3KHFA 1FY3A 5AFYH 5PTPA 2LP6A 3SGQE 3GABA 2PSXA 2XW9A 2VGCC 3ENSB 4Y76A 6CHAC 1B0FA 2OGPA 5HXFA 4MLFB 2FEQH 1NRNH 5C2ZA 3NK8A 1Z6EA 3ZVFA 4CHAB 4RI0A 1RD3B 2GDDA 1O0DH 5HEYA 4ACAA 4D7FA 1E0FD 4Y8YA 1MBMA 2PHBA 4LOYH 2OUAA 5JBBS 2ZFRH 2BDYA 2L4TA 2ESTE 1D3QB 1QR3E 2Y82A 1BBRH 3UUZA 4Y10E 4JZIA 4I8GA 1C1OA 1D9IA 1VITF 4FVDA 3KHVA 1TNLA 4A7IB 4YO9A 4E7NA 3AAVA 3RMNH 1PDRA 1AVXA 4Q4LA 4E34A 1O2PA 1QJ1B 2DC2A 1Z7KA 1HAVA 2ZPSA 2AERH 1XUIA 2FMJA 3QO6A 3RXVA 2WPHS 2H2CA 1E1RD 2VIQA 3M3TA 4GAWA 5A0AE 3M3SA 3SV8A 4Q2PA 2EHRA 4NXRA 1QRXA 2FXRA 3TJVA 4KFWA 1O2YA 4XSKU 4AB8A 4RN6A 2EDZA 1W0KD 3SOEA 1VJ6A 1P9UA 5DP7A 2G81E 3SJOA 1P2KA 1B0EA 4NG9H 1RY4A 2BD8A 3F9GA 4I86A 1TMBH 1HRTH 3CP7A 2BYGA 2B0FA 5FBIA 1OS8A 2FM2A 1LQEA 1TNKA 3PO1B 4NGAH 4X8SH 5DK1A 1FNIA 3S0NA 1Z6JH 5HF4A 1XUHA 3EE0B 4OS4A 3ID4A 2BZAA 3URDA 1OWIA 2FOMB 3NKKA 4B75A 1O3IA 4L8NA 1MTNC 1O2QA 3SV7A 2VB0A 3E0NB 4WH8A 4O06A 4YDPA 1XXDA 2H2ZA 4H6SB 4NFEA 3O8RA 1RGQA 1I16A 4NMSA 2SGPE 4AYVB 4WY3A 2ODYB 4ZHAA 2WINI 1FUJA 1WAYB 1GI4A 3M35A 1FPHH 2ZDNA 1C2LA 2JKHA 3N7OA 1NRRH 1UM1A 4NA9H 3T5FH 1E37B 1O2NA 3QK1A 1GBMA 6LPRA 1AB9B 2VRFA 1GBAA 1O34A 2AYWA 2M2AA 2WV4A 1Q3XA 5FAHA 1WI2A 2OC1A 4ZHMU 2RCZA 1TABE 3A83A 4MNYA 2YMSB 3ELAH 4JOEA 3IG6B 4ASUD 4XFQA 1C1SA 3OY5U 1W10U 4CR5A 1ZJKA 5HM2A 1Z71A 3CNRA 3H09A 4IMQA 1CE5A 2Z9GA 5EXMA 3TSWA 3S7HB 4NMTA 1CHOF 1RIWC 1BQYA 1YPMH 2ZQ2A 4FUEA 1BUIA 1GL1A 2EGOA 2I0IA 1WV7H 1SGPE 4NFFA 2Y7ZA 4K76A 1FI8A 1CA0B 1DWBH 1C5XB 2CHAC 1G2MA 4REYA 1EOJA 1GQ5A 5E2PA 1FQ3A 1YPHC 1D3PB 2X7ZA 2AGEX 2G00A 4O97A 2YT8A 1Q2WA 1P2MA 4YOJA 2GCTB 3O8BA 4DOQA 1W13U 2F4LA 1AE5A 3MH6A 2BVRH 1SKYE 2D26C 1FX0B 2P94A 1SPJA 5EU8A 1KTSB 1WG6A 2WYGA 3DUXH 2ZGHA 4MG3A 1ZJDA 3U1IB 4AC9A 4X8TH 3VB7A 2JETC 2UUJB 1GHAG 4AB9A 4WJG2 2KR7A 3F0OA 1L6OA 4ABDA 1MABB 1GJ9B 1G37A 4JZDH 4FLNA 2W7RA 1O3LA 1P2OA 1QTFA 3P92A 1P05A 4GLYA 3C27B 1LKBA 3EA9A 2P93A 3CBXA 2WPIS 3VGCB 1BTPA 1C1WH 2JOAA 1ESTA 2HALA 1RGRA 1OP2A 2J98A 2JIZD 1OXGA 1P1EA 1AD8H 3SJ9A 4K3JA 1SOTA 3VB4A 5F67A 1K1JA 5E8EH 2A45B 2XNIA 1VB7A 1ABJH 5EIYA 1NO9H 1UCYK 3KQ5A 3UPEA 5DP9A 2W4FA 1G9IE 1TNIA 1UW7A 1ZYOA 3KYFA 2G5NA 2Y5GA 3DJAA 1SFQB 2XBXA 4PQWA 5JB8S 3BG4B 4E35A 2AHME 2BD2A 3I78A 1XUKA 3TITA 4UFGH 5CHAC 4NNMA 1GBJA 1N6DA 3EA8A 2P3UB 1XZ9A 2XYAA 1UHPA 2J94A 3M3VA 2GZ8A 3AK5A 1LHEH 4DIIH 1SI5H 1LHCH 1P2IA 2CF9H 1VJAU 1CHGA 1GJ4H 1PQAA 1WQVH 5HM9A 5JYIA 2OZFA 1UTQA 2LA8A 1CGIE 1X5RA 5F8ZA 2H1UA 2GD4B 3MU4A 4CH8B 1S81A 1DSUA 3MOCA 2O8UA 4AMHA 3K1RA 2NU3E 2FS8A 3RM0H 5SGAE 1KDQA 3DA9B 1OWHA 3GJ9A 1VZQH 3PM3A 5FXLA 2M10A 4FUHA 1CT0E 2ZNKH 3BIUH 3PB1E 4ISHH 3F68H 3PDVA 2W5EA 3CH8A 1UHBA 1SR5C 2I6VA 2NU0E 3BG8A 1SGNE 3MO9A 1OWJA 8LPRA 2BXTH 2FNEA 1ORFA 2A32A 3ODFA 1NPMA 1HDTH 4M9FA 1G30B 4GPGA 1UVSH 1SG8B 1ZTKA 1SC8U 1ZUBA 2KCYA 3LC5A 3OY6U 2A7CA 4FU8A 3B8JA 1C2IA 1W8BH 4R0IA 4FXGH 1ELDE 4SGBE 1A46H 5HKKD 3LOXA 1O3AA 2VZ5A 1V2LT 2RRMA 2RA0A 2ANMH 1CA8B 4MTBA 2FI4E 3F9FA 3RXCA 1O2IA 3ZVBA 1WIFA 1BRCE 5HDYA 1O2KA 1MZDA 2NU4E 2OBQA 3NCLA 1MKWK 4Q7ZA 5F8TA 2DMZA 3GY2A 1O2TA 1ZSKA 1DITH 1MQ6A 1TRMA 5DSFA 2TBSA 1U38A 3ATKA 2Z3CA 3R0FA 4CRCA 2GV7A 3I4WA 1CHOG 3SORA 3ZZ8A 4B2AA 2C8WB 4B6FA 3E17A 2P95A 3T26A 1Q7XA 1V2UT 4P2AB 2CGAA 2HRVA 1TRYA 2G5MB 2ZG0H 2J98B 4KGAA 1GI0A 4OM9A 1C9TA 1P2QA 4PROA 1W0JD 1GBKA 3M5OA 3MNBA 1AFQB 4I8KA 1BA8B 1F0SA 1Y3XA 3M5NA 1OBXA 1DT2A 2J97A 2FTMA 2OMJA 4JK6A 1N7TA 2DUCA 4ZHLU 3ZZ5A 4ISOA 2IPQX 1SGYE 2UWLA 5EXNA 1C4V2 3MU0A 2EI6A 2UUKB 1Y3WA 1HNEE 1P11E 2QXIA 4YXWD 5ETXA 3FP6E 1TBQH 1V2KT 3GY6A 2IWNA 5E0HA 2YUBA 2SNVA 1C5LH 4X6OA 5C20A 1MUEB 2DLSA 5AF9H 5FB8C 5LGOA 1GVKB 2EGKA 3ZV9A 3UY9A 3RL8A 1X6DA 3OEHD 1OP0A 4JOGA 2Z9KA 2BQWB 4AORA 4WYTA 2PA1A 4YYXA 2A4RA 1YBOA 1BTHH 2MX6A 1BT7A 2VVUA 1CGHA 4ISIH 1PYTC 1OP8A 5G1DA 1IHJA 2HNTE 1KDQB 2L6OA 2GT7A 4A1XA 2ALVA 4JOPA 3PRDA 1N8OB 3RDZA 4FUBA 1Y5UT 1CGJE 3GCTF 2ZP0H 1AWHB 1HUTH 1PPEE 1L4ZA 1V62A 1IQNA 1GJAB 2ZFSA 1UHBB 3TJNA 2V90A 2XC5A 3SFJA 3QIKA 4INKA 1ZGIA 5LPFA 1P03A 4ZUHA 3PWBA 3QWCH 4ABBA 1LO6A 2BDIA 2Z7FE 1BTYA 1RFNA 3HATH 1BTZA 1FDPA 1MTWA 1HAOH 1SGFG 4YOGA 4E06H 4R8TB 2ANKH 1HB0B 5CHBA 3DFJA 2ZPRA 7ESTE 1TGTA 3A7WA 5C1UA 1Z8JB 1ELEE 2A2QH 1ZGVA 3GCHC 1ZPCA 3UOPA 3GSLA 1V5QA 2ODQA 2F3CE 5A0BA 2EAQA 1ZHPA 2QGRA 1DUEA 2J38A 2PWXA 5G4BA 1ELTA 3E91A 1QBNA 1TX7A 2R3YA 1ARBA 1EZQA 3RC5A 5EJ1A 1A1RA 1O38A 2C90B 3OX7U 1H9HE 1O30A 2Z17A 1WU1A 1MC7A 5GNDA 2RG3A 1FZZA 5I7ZA 3DHKH 1XKAC 2THFB 4DIHH 1MTUA 1LHGH 3UREA 4B6EA 1HJ8A 4ZAEA 3KDKA 1VGCB 1QQ4A 4F4OC 5HJ1A 1ANDA 2AGIX 4I33A 1OWDA 2IOTA 1VJ9U 3NWUA 2BZ6H 1F5KU 2XBWA 1CVWH 3BSQA 4K1EA 3QGNB 3BTEE 4XBCA 1G3CA 1VCQA 1NZQH 1UEPA 1HFDA 7GCHF 1V6DA 1DM4B 2F9OA 4KKDA 2WPJS 2AWXA 5FX5A 1DVAH 4Q3HA 2IN2A 2STAE 1O3OA 2ILNA 1O5GH 4JYUH 4Y8ZA 4FUJA 4ISLA 3GOVB 2FWWA 2BQ7B 2BD9A 2FYQA 4JYTA 2HWLB 4UU5A 2QKTA 1V2ST 1O2RA 1UF1A 3SHAH 3FOAA 2ZDKA 4KTUA 2FODA 3A8AA 2Y5FA 4OGXA 4IN1A 3PLBA 1KSNA 4MPAA 3JZ1B 2A7HA 1O33A 1C4Y2 1CU1A 1FIWA 3SNCA 2VIDA 2AWUA 3RXDA 3SHCH 3RU4D 2FX6A 2Y81A 4B1TA 3MH5A 1OBYA 3D49H 1P2JA 3SNEA 1FC6A 4DCDA 2OK5A 3WKLA 4OGYA 1SGDE 1THPB 1O2HA 1PQ5A 1T2MA 2DLUA 1NC6A 3PRBA 3UR9A 5DP6A 3TMHA 5T1VA 3DJ3A 5TJXA 1TPOA 1AN1E 1K2I1 1UTLM 5JBCS 2HGAA 1WOFA 4TWWA 1LHDH 1OYTH 3MO3A 2F91A 3SZNA 4MPVA 1YP9A 1QL8A 5HEDA 1IQJA 1PFXC 3A7VA 3MTYA 1F5LA 1C5QA 2Y5HA 1EB2A 4O3UA 2OCSA 4CRBA 3RP2A 2SGQE 1DSTA 2ZWLH 2HNTC 4K6YA 3V3MA 1WTGH 2LPRA 2ZTXA 3A82A 1LPKB 2PFEA 3P17H 1XXFA 1D4PB 2QC2A 4RT0A 3ZZBA 1V2VT 1YLDA 3FKSD 4GHTA 2M0UA 1BMAA 2L97A 1K1PA 2FLRH 2QKVA 3WY8A 5JXBA 3GICB 2UUYA 5DP5A 2BVXH 3SU4A 3T28A 1PJPA 1QCPA 1YC0A 2DKRA 3ZVEA 2ZPQA 2PLXA 1BBRE 2WV5A 2DAZA 3K6YA 1HAYB 4AG1A 4MNVA 3LDXH 1S82A 1SGEE 3RC6A 3ID3A 2KG2A 1W3CA 4FUIA 5HIYA 4BNRA 3U8TH 5HFDA 1SOZA 4HZHA 1BIOA 2OD3B 1RTFB 2ZKSA 1MH0A 2KCAA 1UJDA 1GJ6A 2GGVB 3PLKA 4IGDA 4YOIA 2V3MA 5EOKA 2KCPA 3V7TA 1W0ZU 4K72A 2ZQ1A 1GI1A 1GVZA 3GY8A 3QGJA 3RXFA 4GHQA 1T7CA 1CQQA 1HAGE 2K8IA 1SHHB 1V1TA 2BB4A 5EQRA 1JOUB 1R6JA 4J1YA 1NT1A 2K0QA 4FETA 5AVDA 1HYLA 1XVOA 3SBKA 4KP0A 1O5DH 2E7KA 1V2JT 3F9EA 2J92A 2KAWA 1MMJN 1UO6A 4Q2KA 1GPZA 3AVZA 2ZPMA 3SO3A 3I1EA 1GBEA 2P8OB 5E0JA 3KZEA 1HAPH 3Q3YA 1SQTA 1O3EA 2QKUA 1PPCE 2BD4A 2ZCLP 3RXIA 3U8OH 4DT4A 2XOKD 1TGSZ 1FN8A 1F5RA 3SU1A 3SYJA 2FOBA 1QQUA 5C94A 4F48B 1N7EA 1MQ5A 2AIQA 4XBDA 1S0RA 6ESTA 4JOJA 1NFWA 1A7SA 3B9FH 2M0VA 4P0CA 2AMPA 5GCHG 2VGCB 1YPHE 2KV8A 3BTFE 1GJCB 2ZI2H 4KELA 4GSOA 1AWFH 5TCAA 3MU1A 1F0TA 1C2EA 5FPYA 3UIRA 4AYYB 2R9PA 1PQ8A 1HJAC 3PYHA 3WWBA 3R3GB 1PPHE 2F9UA 1IQGA 4YZUA 1YY3A 2QXJA 1THSH 3Q00A 4MPXA 1LKAA 1O3FA 1QB9A 4MNXA 4NXPA 2DJTA 1Y3UA 3RXBA 1O2XA 1MD8A 1QZ8A 1WTHD 4AOQA 1TIOA 5BRRE 2BQ6B 1VA8A 3OEED 2OTVA 2RCEA 2GZ9A 1EQ9A 2Z3DA 3TH4H 1T8OA 3PMAB 1NTPA 1T4UH 2LNCA 4NCYA 2PNTA 1W14U 1ARCA 4K8BA 3I18A 3MNSA 1MKXH 2REYA 3MWIU 3VXEH 2BTCE 4DJZB 1HLTH 2HLCA 3LNXA 2FOFA 5T3HA 5DN6D 5GXPA 1WFVA 1H8HD 1N6FA 1C5NH 1OX1A 2ZDLA 3GYMA 8GCHG 1UVUH 5B6LA 1GJ7B 4X1NU 5HIZA 4O3TA 4RSPA 1L1NA 1BHXF 5IDKA 1F92A 3OFND 1HAXB 5J4QA 2OP9A 2QG1A 3AW1A 1NESE 4OS2A 2AFQB 2WHXA 5HFCA 3F3BA 3RC4A 4CHAC 2FS9A 4GCHG 2EEKA 2FZZA 4AX9H 1TP3A 1IQHA 4FU7A 4X8VH 1UJ1A 1PPZA 2ZC9H 1G36A 1Z1IA 1HXEH 2I0LA 3QTVH 1LTOA 1A0HB 3NCVA 2P3WA 2VWNA 3O46A 2W3IA 4THNH 3V12A 1JIRA 2FE5A 2KFWA 3TGKE 2ZHQH 3EGHC 1NN6A 1THRH 1UM7A 2J2UA 3RUOA 3PV4A 1GHBF 2PGQB 5EPNA 1JRSA 2VNTA 2FPZA 3OYPA 1GQ4A 2R0LA 2PGBB 3GY4A 4H4FA 1TYNA 2OLGA 2EXGA 1EB1H 1TBRH 3SJKA 3MH4A 1MTSA 1IHTH 5T6DA 3RXPA 2KRGA 3Q3KA 4ZH8A 2IJD1 2KL1A 1HV7A 2VPHA 1J15A 1EAXA 3A7XA 3U98H 1G3DA 3N7DA 1Y8TA 3A85A 1AVWA 3JZ2B 4KTSA 4GVUA 3UB0A 1Z1JA 5F6MA 2WPDD 3A8DA 5EQSA 4YM9A 3OTPA 2WYJA 4JYVH 4HG6A 1EATA 1TP5A 2AINA 4GVCA 1S6HA 4JOHA 2F0AA 3HPKA 2KM0A 4Y8XA 3QJNA 3MI4A 2YNBA 3PO1C 1C1UH 3BPUA 2VVCA 3ZVCA 5JBTA 3SUFA 1UCYH 3B23B 5JPMH 4NMPA 1TNJA 1TPPA 1A4WH 1RIWB 2J34A 1NRPH 4I32A 3DCLA 3NPSA 1A3EH 1O3MA 3P8FA 4NSYA 2AGGX 3QDZB 3E90B 4OS1A 5DO4H 1MFLA 1L1JA 2BX4A 1C2DA 1YBWA 2W7SA 2BHGA 4CBNA 5D13A 1Q3OA 4IN2A 1BBRK 4FOUC 1D5GA 4B2BA 4WYUA 2ZDVH 1LVYA 5LPRA 3VEQB 1RXPA 2CJIA 1DX5M 1V2MT 1W7XH 1ZTLA 1AKSA 4Q80A 4UDWH 2BY5X 5E21A 4Y0ZE 4AFZA 2OPGA 1GBBA 2DB5A 1C5WB 3GY3A 1AB9C 4EDJA 2ZHDA 1C2GA 1OWEA 2GT8A 1OHHD 1EJNA 5C17A 5DP8A 3QZRA 2OCVB 2D8WA 1ID5H 1MU8B 2C4FH 2D1JA 3A84A 2JSNA 1TNGA 1MFGA 2RDEA 2H3MA 3STJA 3UQVA 2VU8E 3VXFH 5FX6A 4DG4A 2HVXA 3ITIA 4TY7A 2PP6A 2H3LA 2KYLA 1FC7A 1HAVB 1P09A 1ELCA 2ALPA 1QAUA 4LMMA 5DTHA 1C1RA 3O8DA 1WHDA 2BY7X 2BLOA 1HPGA 3KEEA 2BY6X 1DS2E 2JH0D 1ELBA 2KJPA 1CA0C 3E6PH 3MO6A 3TIUA 1KXCA 1ZOKA 5A2MH 1QRZA 3LH3A 2CK3D 1K1LA 2KQFA 1GCTC 4LZ1H 1SL3A 3BN9A 3KDGA 2GCTC 4UD9H 5A2PA 1M5ZA 1VITG 1RTLA 3N99A 4X8UH 3NXPA 2FIRH 1AUJA 1O3CA 1BMLA 4HFPB 4B2CA 3TGJE 3A87A 1MKWH 3LGYA 2I6SA 3BTQE 3H7TA 2QF4A 2FOHA 2A2XH 6GCHF 5EQQA 1P1DA 3R68A 4F8KA 2Q3GA 2ZGJA 4X2WA 1ESBA 2VIPA 3BEUA 3CENA 3VGCC 3LGVA 1KXFA 1LPGB 1F0UA 2V1WA 3Q77A 2YT7A 2BX3A 3M37A 1YCPK 2QE7D 3RXGA 1Y59T 1NRSH 2SGDE 1O3PB 1XKBC 3VQGA 2A0QB 2BLVA 4A5TS 1GHBG 3V0XA 4JZ1A 3TVJB 3VB3A 4ZKNU 1FAXA 3DD2H 1LVMA 1ELFA 2O8TA 3AXAA 4IC5A 1A5HA 5HYOA 5C1XA 2IWOA 1K0HA 3L33A 3RXMA 2QT5A 1FY4A 1OBZA 1O2GH 1C1NA 1B7XB 1QB1A 1O3BA 3UNSA 2H5CA 1Y7NA 2VJ1A 4AN7A 2G52A 5FBEA 1EZXC 3SUGA 1FLEE 3BF6H 5L6NH 1AKSB 2B9LA 3A86A 1VITH 5C0TA 1VCWA 1GG6C 4JL7A 2CV3A 4JZEH 3HK6B 1YPKH 1S6FA 3KL6A 3ODDA 4FUDA 3K50A 4I8JA 3SW2B 4VGCB 1PPFE 4NIWA 5E1YA 1GDQA 3UTUH 1RZXA 1BFEA 3K6ZA 4MDSA 1YPEH 3UR6A 1NM6A 3AAUA 2ZU1A 3QN7A 1ZOMA 2QY0B 2ANWA 3WKMA 2WV9A 3A8CA 3SJ8A 1SQOA 1NTEA 4JOFA 1V2QT 1BHXB 4HI3A 2GX4A 1K1IA 1T8MA 1AIXH 1TNHA 5TCCA 3F9HA 3LPRA 4CBOA 2J5UA 4NZLA 3VB5A 3TSZA 1ANBA 1GBLA 3ZYDA 2Q1JA 5B42A 1LMWB 4Z8JA 1C5YB 2SGFE 1GMHF 2XCFA 4I8LA 3VPKA 4LXBH 1WFGA 2B7DH 2ZGCA 1C5VA 1C4U2 5EJZA 5K7RA 4Y7BA 1SVPA 1UJUA 2ODPA 1WBGB 9LPRA 3SV9A 1KYNA 4K1TA 4NMOA 1ZPBA 4WXVA 1NF3C 1SGQE 5A09A 2GDEH 1W11U 3P95A 1NFXA 1BOQA 2TGPZ 1C5SA 2H9TH 3W94A 2FOCA 4O03A 3ZVAA 4ZROA 2VH0A 1GBCA 2DE9A 2Q6FA 2V3OH 4NA7A 3BTHE 1BMMH 3E3TA 3I77A 5F3XA 1GCDA 4U30A 3ZZ6A 3TU7H 1YPJH 1AFQC 3H5CB 2ULLA 4AG2A 2I1NA 1A3BH 1TX6A 8KME2 3BIVH 2CSSA 1H8ED 2ZCHP 3I29A 2EGNA 3PMJA 5LPEA 3L3TA 1WH1A 1X5QA 2Z9LA 2EEJA 3HGPA 1DLEA 4GHNA 1O32A 1IAUA 1SGFA 1FY8E 1KXAA 4TPIZ 4UFFH 6GCHG 2PUQH 4IBLH 4MQAA 4BAKB 3F2FA 3SUDA 3N7EA 1TB6H 1O5EH 1SGCA 2M5TA 3S69A 3LGIA 3ZYEA 1YLCA 3P8GA 3GCHB 4RT1A 3EDXB 3EA7A 4NWKA 3MNXA 4ASHA 1DWEH 1ZR0A 2ZFPH 1UTOA 1G9OA 1WF7A 1N8OC 1SLWB 1TX8A 1X7AC 1BJUA 1BJVA 2O8MA 2EEHA 3SNBA 4X0WU 1QBOA 2FOEA 3TJOA 2EC9H 5JBAS 1TFXA 4K5ZA 2KOJA 1GI3A 1G32B 2EDVA 3LU9B 2R0KA 1T32A 1AO5A 3JXTA 1DLKB 2FTLE 4I8HA 2RA3A 4TY6A 1E36B 2KCOA 5C67A 4ABAA 4UFDH 5EZ0A 1ETSH 1QFKH 2F9NA 5HFBA 4NIYA 1O3NA 2YNAA 2OQUA 4H42U 1IQIA 4IMZA 3NGHA 2VWOA 1FPCH 1TGNA 1MCTA 1CT4E 2GTBA 2QA9E 1GBDA 2M0ZA 1OWKA 2HVYB 3FAOA 3SU2A 1FMGA 4FUFA 3SQHE 1FN6A 4CRAA 2JILA 3E1XB 2I4SA 3RXLA 3GDUA 2WPMS 1PPGE 3GY5A 3LJOA 2HOBA 2RFKC 2ZCKP 1C5PA 1FIZA 2NWNA 4Y0YE 3PMBB 2CF8H 3U8RH 1AU8A 2DE8A 4X6MA 4FU9A 1A5GH 2WL7A 5I46H 4J2YB 1YWUA 4K60A 1P10A 2PSYA 1UTKA 2PW8H 1OKXA 1O5AB 2OC8A 2OQ5A 1DDJA 1OPHB 3ZZDA 2AEIH 1GHZA 1QBVH 3BTDE 2A4OA 1EAWA 4D9RA 1EXFA 1GMHG 2MHOA 1Y5BT 4ZKSU 1VGCC 2H9EH 2W3KA 1XMNB 2NU2E 1EJMA 2XWBI 3QLPH 3LKWA 1C2MA 2BM2A 3SNDA 2ZA5A 3HKJB 1O2ZA 3W95A 3NFKA 1P0SH 2EA3A 2Y7XA 2QF0A 2EQNA 3P6ZB 4CREA 2UWOA 3GCNA 2ZU5A 1G2LA 3T25A 1TMTH 1CSOE 1QJ7B 3FFGA 2PKSC 1BITA 3SUEA 1AQ7A 2TGDA 5FPSA 1N6YA 1E79D 1YGCH 3CBYA 1LHFH 2L4SA 2BXUH 2TGAA 4JK5A 5LH8A 1O2MA 1FAKH 3DSOA 2QBWA 1EPTC 2VBCA 3F2HA 3TNSA 2B8OH 1O2WA 2WPLS 1GGDB 2AS9A 3AW0A 3FO8D 4D9QA 4IS5A 4JZFH 3HPTB 2SFAA 1C1VH 4OS5A 1S85A 5F8XA 2HPPH 1IQFA 2FLBH 2PKTA 3ESTA 2A4QA 5HGGA 1BE9A 3RMOH 3BEIB 1O3HA 1K32A 2FCFA 1S83A 2BD5A 2FI5E 5B6OA 2XRCA 2VSPA 1F0RA 1GI8B 2UZCA 1AY6H 1PQ7A 2ZDMA 5KGOA 1TGCA 3GCTG 4X2VA 4CR9A 3CC0A 2G51A 2AMQA 3SN8A 2ASUB 1J14A 2JH5D 3V13A 3ZVGA 2KX4A 2WPKS 4ESTE 2FX4A 1V5LA 1EJAA 2FO9A 1GDUA 3QGLA 1H4WA 2PDZA 2TIOA 3UAIC 4UFEH 1JXPA 3UWIA 1YM0A 3NRLA 1UTNA 2AWWA 5ILBA 2SNWA 5DKMA 4YESB 1LCYA 3PDZA 5E22A 2GKVE 3GGEA 1W7GH 1P57B 3QUMP 3A7ZA 3WW7A 4BXSA 3MHWU 2UWPA 2Y80A 2A31A 1N6XA 5DP4A 1CBWB 1BTXA 4WWYA 1GMDF 1YLNA 2VINA 2XWAA 2BMGB 5ABWA 1SLVB 1FONA 1P01A 5C5NA 5H3JA 3P8NA 3BTTE 4RKOB 4JMYA 4B76A 3FP8E 2KAIA 4X1RU 5E11A 4BAHB 4H6TA 1T31A 3RXTA 4YTAA 2GMTB 1V2PT 5EW2H 1ZRKA 1P06A 1A0JA 3QTOH 1DY8A 5JB9S 3IITA 2IPHA 2R3UA 2KZ4A 5HFFA 1O3JA 3M7QA 1GJ5H 2G55A 1ACBE 2D2DA 2IJOB 2PKAA 3T62A 1SFIA 5EG4A 3Q76A 1H8IH 1C2KA 2V35A 1QIXB 4INHA 2AH4X 4Y7AA 2G4UA 3A81A 4GUXA 3MQKC 1CO7E 5ESTE 3SZEA 1GWAA 1F2SE 1UITA 1UTJA 2ZEBA 1JRTA 3SI4H 2Z9IA 1L2EA 1HJAB 3EYDA 1IQEA 6CHAB 1L0ZA 1QNJA 3HPMA 2QAAA 2RDLA 7GCHG 2KPLA 2BOKA 2F9VA 2B5TB 3RXSA 1OYQA 2O8WA 3DSPA 3PTNA 3P8OA 1DFPA 3HK3B 1VCPA 5E2OA 1IQLA 1AMHA 1DY9A 1WSSH 1FV9A 1Z8RA 2EI7A 5GJ4B 3LT3A 2CSJA 2CN0H 2YTWA 5L2YH 5IL9A 1CT2E 1H9LB 1UCYE 3RM2H 1TA6A 5F53A 2BY9X 4OS6A 4Q6HA 2LUIA 1BTUA 1V2RT 1QHRB 1W0YH 1ZSLA 4I7YH 3O8CA 3FZDA 1HCGA 2F83A 5C3NA 7KMEH 1C5RA 2EV8A 4B71A 4NMVA 3FANA 4NIXA 1VR1H 1GJBB 2OSGA 1GHAF 4NA8A 3RXRA 1JBUH 3A8BA 4CRDA 2GCHF 1BB0B 3RXKA 3F2GA 3K65B 4Q2OA 1HAHH 2XXLA 2H5DA 4FGMA 3G01A 1EX3A 1U6QA 1E38B 2GP9B 3HKIB 3H7OA 1O2UA 5IYTA 5EW1H 3K2UA 5KECA 5HF1A 1BRBE 2FN5A 2ZTYA 1O2VA 2DM8A 2QF5A 3D65E 3MNCA 2ZPLA 1DE7H 1N1LA 1W2KH 1KLTA 1HIAA 2P3FH 3KYGA 1UEZA 1V2NT 1C5MD 3E8LA 2C8ZB 4Q2QA 2XC4A 4Y11E 4E7RG 1XUGA 1IOEA 1W9OA 3GCOA 1MTNB 2KAIB 1C5TA 1JWTA 1WCZA 3OU0A 1DANH 1P8VC 3KGPA 2C8YB 3LH1A 2M3MA 2JH6D 4DW2U 2VWRA 4G69A 1ZMNA 1HBTH 3LIWA 3RXEA 5J4SA 4Q7YA 1DOJA 1DWDH 1GHYH 3TPIZ 4D76A 4X2XA 4WMDA 2PKAB 1MD7A 3ZZ4A 1RGWA 1TLDA 4XD7D 4JOKA 2A5AA 3A7YA 4K8YA 1NU7B 2ZF0H 3PROA 1T4VH 3SHUA 3TGIE 1YYY1 2JJ2D 2EEGA 3RXQA 9ESTA 1Z87A 3HVQC 1EKBB 2Z9JA 3CS7A 3LC3A 1ZHMA 4MPWA 1GMDG 3KQBA 4JCNA 4CRFA 3D23A 2PUXB 1Q31A 1TONA 4NWLA 3PV2A 2PR3A 3KNXA 1NROH 3PS4A 3FVFB 1UTMA 3KIDU 3U69H 2KOHA 1QB6A 1WUNH 4XHVA 4K75A 1UVPA 2P59A 1O3KA 1WI4A 2BLWA 3PWCA 4BAMB 2JXOA 1SQRA 3HGNA 5FL7D 1J9CH 1PYTD 2V7QD 4XDEA 2D90A 4DGJA 2XBYA 2CHAB 2ZHEH 2VVVA 5EODA 1MKXK 4B73A 1P2NA 4ZKRU 3EAJA 3RL7A 1PPBH 2FI3E 2ZFTA 4Z33A 1RTKA 2C3SA 2VSVA 2FYRA 1YCPH 2IWPA 4JJ0A 5K0HA 1IQKA 4AGJA 1GM1A 1S5SA 4SGAE 2EEIA 1WHAA 5A8YA 3T29A 2JETB 1JIMA 2YMSC 2VIWA 2V0BA 2Q6DA 1JMOH 1S0QA 1C5ZB 2VH6A 3B76A 2J9NA 2BDBA 4YLUA 1GVLA 4FUGA 3GDSA 3URCA 1L4DA 1ZRBA 2G4TA 4AGKA 4ZXXH 2Q6GA 1IU0A 2J95A 3RU4T 1Y5AT 4ZKOU 1ANEA 1A5IA 1GBHA 2V6NA 1HIAB 5HEBA 2Z3EA 1FCFA 1C5UA 1YPGH 2OINA 1GCTB 2ZECA 4X1QU 5C5OA 3FY5A 1EFRD 1K1NA 3MYWA 3ID1A 1S84A 1KXDA 1MAYA 1FJSA 2ZZUH 5T6GA 2TRMA 3E0PB 1BDAA 1UVOA 2AMDA 2A4GA 5EJLA 1KLIH 1M9UA 1O31A 4Q63A 1BRAA 5CHAB 3SU6A 3ZV8A 2KJKA 4X6PA 1HGTH 2JJ1D 2GCHG 1AHTH 4O9VA 4NMQA 4TSFD 4ABIA 3EGGC 1C2HA 1ETTH 2FESH 2VWLA 2EJYA 1QA0A 3SNAA 3UQOA 3KQEA 1SLXB 5GIBA 2QF3A 1FY1A 3ATMA 2J4IA 4Y6DA 1O2JA 3ATLA 1SGIB 1NFYA 4YLQH 1UMAH 4WXIA 2K1ZA 2XTTB 1GJDB 1QAVA 2SGEE 4E3BA 3M36A 1SGTA 3KCGH 2ZGBH 5EXLA 3UWJH 3W1EA 5HFEA 2HLDD 1DXPA 8GCHF 2QV1A 1GI6A 3LJJA 3VQFA 2HGTH 1RS0A 2XBVA 1TQ7B 3U28C 2OQSA 2PV9B 3U1JB 3PTBA 1RRKA 1AZ8A 2EI8A 3RXOA 1AVGH 1J16A 3BG4C 2Z6BD 5F03A 4A1VA 1Z8IB 3L6PA 1E34B 3SQEE 1UK3A 1QLCA 2IWQA 4NIVA 4UEHH 3AASA 2I04A 2PZDA 1MCVA 1GG6B 1ZSJA 1OSSA 4OS7A 4K78A 1GI5A 1A61H 1HAIH 1O37A 1O2OA 4TWYA 5BPEA 3SI3H 1UEQA 3WWFA 3QJMA 1RJXB 1ZPZA 1U39A 1C1PA 1AFEH 1TGBA 1B5GH 4E05H 2WUBA 4TPYA 4XBBA 4Z0KA 2LOBA 4ABEA 2HNTF 3R69A 1INCA 1D3TB 2HE4A 1H1BA 1SLUB 1NU9A 4XRNA 3CS0A 2R2WU 2A5IA 3EGKH 2WSSD 3BEFB 4X2YA 3VG8A 1P04A 1O36A 4Q7XA 3BTME 5CDFE 5G1EA 1O2SA 2OC7A 1GJ8B 2ZU2A 2GZVA 4HOPA 4BTIB 1VAEA 3S9AA 2GEFA 5GLJA 3SOSA 1J8AA 2F5YA 2BOHB 4OEPA 3GISB 3MU8A 1TQ0B 1DICA 4JORA 1L1GA 2QXGA 1XM1A 3MMGA 2TGTA 1MZAA 2BYAX 3R0HA 1SSXA 4U01A 1I92A 1YF4A 1ZLRA 1ELAA 1GMCF 2O9QA 3CBZA 3VB6A 3ZZAA 4A6LA 1E1QD 4AFQA 3QX5H 4BANB 2CXVA 5C1YA 5E0GA 3ZRTA 1KMHB 1WXRA 1TOMH 2ANYA 2BDHA 1K28D 1LVOA 1TWXB 3DORA 1WJLA 4OAJA 2W7UA 4MPUA 1A2CH 4X1SU 1LDTT 1AUTC 1KTTB 1SGRE 4VGCC 2VWMA 2KJDA 3NZIA 1QY6A 1X45A 5DGJA 2ZHWH 3TH3H 4KFVA 1FC9A 3CYYA 2AIPA 3KZDA 1Z8GA 1D6WA 2PTCE 2EDPA 1UEWA 4WF8A 3STIA 4DURA 3MH7A 2BVSH 3MU5A 2GJGA 1K1OA 2JREA 3ZZCA 3RLEA 4NNLA 3GY7A 3F6UH 1E35B 3A89A 5EGMA 2R4HA 2FP7B 1N7FA 1EZUC 1AZZA 5C0UA 4BAOB 1TOCB 3M5LA 4TT3D 1QAVB 1NFUA 1V6BA 1O35A 1P3CA 3OAAD 5DP3A 1SQAA 1OZIA 3K9XB 2OBOA 1D3DB 3QDOA 2FOAA 4MNWA 2O8LA 1ZHRA 3ZZ9A 1S6LA 1W12U 4Q2NA 1KXEA 1WYKA 4FVBA 3TK6A 5FCKA 3NFLA 4K2YA 1YKTA 4AZ2B 4U2WA 4RKJB 1P12E 2BDAA 3TK9A 1IU2A 1EP5A 1SBWA 3S9CA 2LELA 1P9SA 2P3TB 2NU1E 4Y79A 5A0CA 4LZ4B 1QGFA 3EQ0H 1W9QA 1K9OE 2ZU4A 2P16A 3BTKE 4ABGA 1P02A 3TJUA 3OE7D 5KEDA 2K1QA 2QXHA 3P70B 4DVAU 1K1MA 1EPTA 1GI7B 4A92A 1DPOA 1C2JA 4ZMAH 3BV9B 2F9PA 1H9IE 2ZDAH 2BD3A 4TYDA 2JIKA 2ZO3H 3FP7E 1N99A 1DWCH 3RXUA 1GBTA 2KOMA 4QT8C 2G2LA 4ZXYH 2QN5T 2H6MA 2SGAA 4YT7H 1NBMD 5AFZH 3DSGA 1EP6A 1IHSH 1KY9A 4ABFA 5GDSH 5FPTA 1GL0E 2VIOA 1V2TT 1TPAE 4NMRA 3M61U 1NY22 1UK2A 1MU6B 1SB1H 4HOPB 4ABHA 1XVMA 1Y3YA 1GI2A 5I25A 3S7KB 4NZQA 4INLA 2LC7A 2WZQA 3PV5A 3LONA 4ZCNA 2GZ7A 1ZTJA 3KQCA 1G3EA 5CMXH 3O5NA 4Z6AH 3KQDA 1TALA 3DIWA 4F55A 2M0TA 2EY4C 3NUMA 2W6JD 2BLQA 2ZHFH 1EOLA 4XE4A 5A8ZA 3BTGE 3FN8A 1MBQA 1O5BB 4FUCA 4D8NA 1TRNA 1MTVA 2TPIZ 2YUYA 3T27A 4CRGA 1HXFH 1O3DA 3DT0H 5GWZA 4AFUA 1T8LA 1D6RA 3ZZ3A 1UJVA 1XUFA 2STBE 1X9ZA 1G3BA 1C5OH 2QYIA 4K1SA 2JWEA 3SV6A 4Q6SA 3LGWA 5AHGH 4DY7B 1TE0A 3BTWE 4ACBA 2QIQA 3LNYA 3IWMA 1O3GA 2ZIQH 1KEFA 5EPYA 3GS9A 1GHVH 1C1QA 1YPLH 5HETA 1FY5A 1LVBA 4D7GA 2W26A 2FDAA 3UNRA 3GYLB 3Q3XA 1UFXA 4BXWA 1GMCG 2CMYA 4UU6A 1NBME 3QZQA 5GPIB 1EAIA 1GHXH 1HAZB 2HE2A 4NSVA 4BOHA 1W9EA 1HJ9A 1BZXE 1TPSA 5H4IB 2D92A 1GBIA 3T2NA 3OTJE 5DPAA 1O2LA 5GCHF 3A7TA 2CS5A 3RLYH 2JINA 1ESAA 3UOUA 2UUFB 4YT6H 2PKSB 1V3XA 2Y6TA 3ATIA 4NXQA 3ZIAD 2G8TA 1ETRH 2Q9VA 1U3BA 2ZFFH 1O39A 3SUZA 1EPTB 1LQDB 2H9HA 3RMMH 5L30H 3UNQA 4BTTB 1WDIA 1ABIH 1AGJA 5L2ZH 2XCNA 3D62A 2ZGXH 1BMNH 1ANCA 2F43B 1AE8H 3RXHA 5DJ7A 1A0LA 1IQMA 1QA7A 5JDUB 5ESBA 2F9BH 1EAUA 1AI8H 3UFAA 3KF2A 5DG6A 1VKYA 1DXWA 3VFEA 1X5NA 1V2OT 4IW4E 1LPZB 1O5CB 1DUAA 1Z86A 1QJ6B 4AFSA 1Q3PA 5E6PB
chains in the Genus database with same CATH topology
1ZMJA 1T8NA 3TNTA 3ID2A 3L4FD 3M5MA 3SU5A 3LGTA 2O2TA 3TSVA 3SGAE 5EYZA 4ABJA 3DJ1A 3M7UA 4GCHF 4WMEA 4BAQB 4HGCA 1EZSC 1QURH 1V2WT 2KBSA 4N6XA 2BDCA 1GBFA 5FHTA 3PLPA 3U9AH 3TK5A 2FOGA 8ESTE 1TA2A 2BDGA 1NRQH 2QCYA 2OS6A 4B74A 1GGDC 1QL7A 4F49A 4HTCH 2ENOA 2HPQH 4LK4A 2PTNA 1EUFA 5HMAA 4CH2B 2Z94A 3SHWA 2KA9A 3A88A 3SGBE 3RMLH 5A8XA 1GHWH 1EASA 4K69A 1BRUP 4UONA 2C8XB 1O5FH 3FZZA 2BD7A 2GV6A 4Y71A 1C1MA 3MFJA 3PMHB 2V3HH 3SU0A 1X8SA 1YCPM 1BTWA 1C2FA 2D8IA 1XX9A 2YOLA 3M7TA 3QE1A 4XOJA 3E16B 3RU4E 4UE7H 1K21H 1U37A 1XUJA 1ZZZA 1K22H 2ZU3A 3GDVA 1QRWA 2A7JA 3ZVDA 3SJIA 1UVTH 1P3EA 3ATWA 1GI9B 4R2ZA 1UTPA 2ZTZA 4WVPE 1H8DH 2OC0A 4MVNA 1ELGA 2PKUA 4ISNA 1TBZH 1KWAA 2H2BA 2BY8X 1TQ3A 3DFLA 1CBWC 1SHYA 3RXAA 4BTUB 1ELVA 2G5VA 3KN2A 7LPRA 4WH6A 1UK4A 1KXBA 2A5KA 1QL9A 4H11A 1ZMLA 1C9PA 1OOKB 2OXSA 3RXJA 2LC6A 4IC6A 2I6QA 5T6FA 4X6NA 1C1TA 2KPKA 1J17T 3LGUA 2GMTC 3C1KA 1KLJH 1TAWA 4I31A 1TMUH 1F7ZA 3SV2H 4U32A 2VIVA 2ZFQH 2R2MB 1FXYA 1SMFE 2P8OC 1WQSA 3K82A 4JJ3A 4X1PU 2C93B 3OSYA 3TH2H 1Y3VA 1GDNA 5CE1A 4OEOA 5FCRA 1KIGH 2GVFA 3SU3A 1B8QA 4GVDA 3A80A 4KTCA 4M7GA 2K20A 1BCUH 3RLWH 1NS3A 2WUCA 1WF8A 3TLOA 3F1SB 1N6EA 4WMFA 4DT7B 3S9BA 1MAXA 2XC0A 3ZZ7A 2A1DB 4A1TA 3KHFA 1FY3A 5AFYH 5PTPA 3SGQE 3GABA 2PSXA 2XW9A 2VGCC 3ENSB 4Y76A 6CHAC 1B0FA 2OGPA 5HXFA 4MLFB 2FEQH 1NRNH 5C2ZA 3NK8A 1Z6EA 3ZVFA 4CHAB 4RI0A 1RD3B 2GDDA 1O0DH 5HEYA 4D7FA 1E0FD 4Y8YA 1MBMA 2PHBA 4LOYH 2OUAA 5JBBS 2ZFRH 2BDYA 2L4TA 2ESTE 1D3QB 1QR3E 2Y82A 1BBRH 3UUZA 4Y10E 4JZIA 4I8GA 1C1OA 1D9IA 1VITF 4FVDA 3KHVA 1TNLA 4A7IB 4YO9A 4E7NA 3AAVA 3RMNH 1PDRA 1AVXA 4E34A 1O2PA 1QJ1B 2DC2A 1Z7KA 1HAVA 2ZPSA 2AERH 1XUIA 2FMJA 3QO6A 3RXVA 2WPHS 2H2CA 2VIQA 3M3TA 4GAWA 5A0AE 3M3SA 3SV8A 4Q2PA 2EHRA 4NXRA 1QRXA 2FXRA 3TJVA 4KFWA 1O2YA 4XSKU 4AB8A 4RN6A 2EDZA 3SOEA 1VJ6A 1P9UA 5DP7A 2G81E 3SJOA 1P2KA 1B0EA 4NG9H 1RY4A 2BD8A 3F9GA 1TMBH 1HRTH 3CP7A 2BYGA 2B0FA 5FBIA 1OS8A 2FM2A 1LQEA 1TNKA 3PO1B 4NGAH 4X8SH 5DK1A 1FNIA 3S0NA 1Z6JH 5HF4A 1XUHA 3EE0B 4OS4A 3ID4A 2BZAA 3URDA 1OWIA 2FOMB 3NKKA 4B75A 1O3IA 4L8NA 1MTNC 1O2QA 3SV7A 2VB0A 3E0NB 4WH8A 4O06