3GDSA

Crystal structure of degs h198p/d320a mutant modified by dfp in complex with dnrdgnvyyf peptide
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
317
structure length
295
Chain Sequence
b'DSTDETPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINPGNGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREQGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMAQVAEIRPGSVIPVVVTLQVTIQEYPAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease degS
publication title OMP peptides activate the DegS stress-sensor protease by a relief of inhibition mechanism.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase activator
total genus 58
structure length 295
sequence length 317
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3gdsA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gdsA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gdsA01
1C5WB 5DP8A 5LGOA 1AE5A 4I8JA 3UUZA 1IQMA 1T7CA 1U37A 2A1DB 1O3KA 1SR5C 2QGRA 2J34A 4NA7A 1C2MA 2ODYB 4YTAA 1GHXH 1Q7XA 1HAPH 3K82A 1TBZH 2FWWA 4NA8A 3RXFA 2VINA 1O3HA 1O2XA 2HALA 4JOKA 2VH6A 1JRTA 2V0BA 3U9AH 2QIQA 4CRBA 1TGCA 1FPCH 1BB0B 2RA0A 5EQQA 1GBFA 4AGJA 3TLOA 2ZGBH 2GCTB 1K1IA 1YPJH 2DE8A 3EA9A 5F8TA 2G5MB 3EE0B 1LVBA 2VIDA 3RXCA 1TX8A 1UF1A 2CMYA 2GCHF 3PMHB 1DE7H 1GM1A 3BG4B 1V3XA 4SGAE 1YLDA 3SOEA 1FMGA 4CHAB 3MYWA 1QQUA 1SGYE 5F6MA 1TPSA 2ZU1A 1EJAA 1HAOH 2FX4A 1TPPA 1L1JA 2HE4A 1FXYA 1HNEE 1LKAA 5F8ZA 2M0TA 2G00A 1QB9A 3SU3A 4ABFA 8GCHG 2JOAA 3S0NA 1UEPA 1PPEE 4Y79A 4HOPA 2ILNA 2GZ8A 1NFUA 1GHZA 2JH5D 4ZXXH 1W3CA 1O33A 3QX5H 4FU8A 4B2BA 2BY7X 2XW9A 5EYZA 3HPKA 1THSH 3OY5U 1C2DA 1OWEA 1AZZA 5I7ZA 2XBXA 5C5OA 1N6FA 4GPGA 4Y8XA 1V2WT 1X7AC 4FUEA 2OCVB 1S81A 4GUXA 4X1PU 1SLXB 4ZXYH 1HIAB 1C2KA 2LC6A 1KXAA 1L4DA 3BEUA 5C1YA 3QGNB 3A87A 3NWUA 1BTHH 5HFDA 1QBOA 3RXLA 2JWEA 2W26A 4ABEA 2VPHA 2VB0A 3GY3A 4NGAH 3NUMA 5EU8A 5AFZH 5F03A 1SL3A 1GWAA 5JYIA 2HGAA 1P1EA 2QBWA 1IHTH 1ACBE 2EGKA 1J15A 3ZVCA 1O2JA 1TBRH 2O9QA 3TH4H 4NZLA 1OS8A 1EJNA 4I8KA 2D2DA 1ABIH 4RSPA 4IN2A 2Z9KA 3B76A 1IHSH 1O3DA 5TJXA 1O3FA 1P8VC 1GVLA 3AW0A 3VEQB 1ZZZA 2OQUA 4YOGA 1O2IA 1Q31A 1GMHF 2G4UA 1JMOH 3MI4A 4FXGH 3SJKA 4KP0A 1C1RA 4H6SB 1P3EA 2H3LA 2I6QA 4X2VA 5DP4A 1SGNE 1ETSH 3MH4A 1OSSA 1Z86A 1QL9A 4AFQA 1SGEE 1AB9C 2EGNA 3TK6A 2FXRA 4DG4A 4FUIA 2PUQH 2PHBA 1SBWA 1YC0A 1K28D 2ZTYA 2AMDA 4B76A 2GX4A 1V2UT 2LNCA 2ZFFH 3K9XB 1O5FH 4ZROA 1C1QA 1SGDE 1GJ5H 5FHTA 4CRGA 1C5ZB 3TSWA 3ATKA 3SUDA 1D5GA 3Q00A 3M7QA 1XMNB 2RRMA 5HEDA 2I6SA 2QC2A 1G9OA 1AO5A 4Q2NA 4Y11E 5C20A 2GD4B 4AYVB 4NSYA 1BBRH 1OP0A 1I16A 9LPRA 1CA0C 2PV9B 3PTBA 3SU6A 2XWAA 1P2OA 1BOQA 2BY9X 9ESTA 1C9PA 4MNXA 4YT7H 2OS6A 3A8CA 1P9UA 3RM0H 1UTNA 3A7ZA 2BLQA 4Q6HA 1HCGA 4X8UH 1HJAC 4B1TA 4CRFA 2VWOA 3CH8A 4K1TA 1EJMA 4E7NA 3ATLA 2UWOA 2ULLA 1YF4A 2VIPA 4HOPB 1A4WH 1VJ9U 3SO3A 4K78A 2Z7FE 1AHTH 1ELFA 2DAZA 4NMOA 1C2HA 1D9IA 2VGCC 3W94A 2PZDA 3BIUH 1TE0A 4ESTE 4I31A 1O5AB 2IWQA 3DJAA 1QRZA 1V2ST 1NFYA 2HPPH 1MKWH 4A7IB 2VWMA 3M3TA 1V2MT 3DFJA 1P2JA 1Z1IA 1F0UA 4MDSA 4GHTA 2QXGA 4GVUA 2L4SA 4MPWA 4Q6SA 1BRAA 1AN1E 3NFLA 1O2KA 1ZRKA 3NPSA 1V2QT 2CSSA 3VXFH 1OKXA 4A92A 3ID2A 1YPKH 1H9LB 4X2WA 3KQDA 2EHRA 2GDEH 1GMCF 5A8ZA 2BZ6H 2Z3DA 1Z8GA 2QXJA 5GLJA 1UM7A 1MFGA 2ZDAH 1C2IA 1DY8A 3FY5A 2EA3A 2ESTE 3SHUA 1O3JA 1K32A 1TX7A 3KNXA 2Q9VA 3E90B 1AKSA 2HE2A 3RXEA 2JXOA 1E35B 1MZAA 3QTVH 1OBZA 1GI1A 1O35A 5EZ0A 4L8NA 4Q2PA 2QF0A 4X8SH 4BAMB 2H9HA 5I46H 3KL6A 4OGXA 3ZV9A 2Y82A 1Q3XA 3H7OA 2F9BH 3ID1A 2FIRH 2HNTC 1OP2A 2FLRH 2I0IA 1UM1A 1UTJA 2BB4A 1XXDA 3P95A 1HGTH 2OD3B 1M9UA 1GGDC 1EASA 4YLQH 1ZLRA 1H4WA 4XBCA 3ZZ9A 2ZEBA 1J8AA 3GOVB 3KIDU 1O2MA 3FAOA 4FGMA 1TNHA 2NU3E 1A3BH 2XBWA 2R3YA 2ZNKH 1O32A 4TPYA 1WHDA 1RFNA 1XKAC 2W7RA 2ENOA 2QKTA 1Z71A 2HNTF 1LTOA 2THFB 2ZFRH 5JB9S 1A46H 3ID4A 2WPMS 2BX4A 1KLJH 4JK6A 1FY4A 3SJ8A 1T2MA 2FODA 3DJ3A 6ESTA 3DJ1A 4UDWH 1ZR0A 2FOBA 3PWCA 2FZZA 3OTJE 1PFXC 3LNYA 1CA0B 1GI5A 1DFPA 4K3JA 3GJ9A 1FY3A 2JINA 2O8UA 4FUBA 1UJUA 2Z9JA 1W9QA 1IQGA 4X1NU 3SNCA 1QL8A 5HETA 2GKVE 2YT7A 2UUFB 1LMWB 2VSPA 4CBNA 3RU4E 2F9PA 1WFGA 3RXSA 1NM6A 1L2EA 1YPHE 2A4GA 2Y6TA 2ZA5A 1QA7A 1QJ6B 1LHEH 2B8OH 2B9LA 4JZ1A 1TLDA 4X1RU 2VRFA 3L33A 2KRGA 3EQ0H 4JOFA 1VGCC 4MNVA 3MMGA 1EP5A 1QR3E 4BOHA 2F91A 1RTKA 1RJXB 1KLIH 3NXPA 1GHAF 3BSQA 2XBVA 1QBVH 1C2GA 1O30A 3LONA 2D92A 1BMNH 4GVDA 2R0KA 1CBWB 1TQ7B 4INKA 3RXQA 1YCPH 2XCNA 3VB6A 2VWNA 3UWJH 5EOKA 1WOFA 2KJPA 1ZJDA 4BAHB 1C2JA 2FEQH 1QIXB 2NU4E 3D65E 3BG8A 3LC5A 3OYPA 3RXMA 1TA2A 1O2ZA 1EAXA 4Z8JA 3QLPH 1GJCB 2JKHA 2W7SA 4K72A 2ZQ2A 2M0UA 1SGFA 4KFVA 2Z9IA 1PDRA 2FO9A 3MO9A 1P12E 1W9OA 2FOAA 1AKSB 3U8TH 4DW2U 1O3PB 4JZIA 1MAYA 5A2MH 3CS0A 4I33A 2STBE 4AOQA 1UCYE 2C8ZB 2AFQB 3ATMA 4NIYA 1D3QB 1Z8RA 4F8KA 3TGJE 5EW2H 3SBKA 3E6PH 1WQSA 1QJ7B 5DP9A 2C8XB 1FY8E 2P93A 1C1NA 5AVDA 1CU1A 2VVCA 2M5TA 2VIWA 3TSZA 3V3MA 1KIGH 4IBLH 4RKJB 3MNXA 3QK1A 4P2AB 2WYJA 2V6NA 1C5XB 4TPIZ 2ZHDA 3ZZBA 2V90A 2RA3A 1W13U 3S9CA 3D62A 1GGDB 5LH8A 1LPZB 5FX6A 1FDPA 2QN5T 3BV9B 1DSUA 5AF9H 1P2NA 4CR5A 1UJ1A 1O5CB 1BRBE 1C1OA 1GPZA 1V2TT 2LOBA 1IQEA 5GIBA 2ALVA 1CT0E 2QY0B 3A86A 3CENA 1THPB 3DD2H 1QAVA 1CT4E 4JMYA 3U8OH 1TRMA 1BITA 5DP7A 5EQSA 2EEIA 1EQ9A 1FIZA 1EZXC 3UOUA 7ESTE 1WUNH 2FOEA 1GL0E 2ANYA 1H8IH 1NRQH 1AVWA 5F3XA 3TNTA 4ISOA 2HOBA 1CHOF 2VU8E 4ZH8A 1NTEA 1PPGE 1O3BA 4LZ1H 3QJNA 1SOZA 3RXJA 4FUDA 1OYQA 2AWXA 4K1EA 1IAUA 3QO6A 5EODA 4CRAA 3M3SA 1S83A 2HWLB 3PO1C 5T6GA 1N7TA 1Q3OA 1XUJA 4X8TH 4YESB 1FIWA 3MU0A 5EPNA 3ZVAA 1EKBB 4OEOA 2UWLA 4GAWA 4Q2QA 1BTPA 1WH1A 2ZTZA 1V5LA 4I8LA 3ZZCA 2ZG0H 2PTCE 1EB2A 1P02A 2BDGA 1RD3B 3BIVH 2XYAA 2QCYA 2FDAA 3A7WA 2ZU4A 2PA1A 2SGDE 1ELBA 3M5LA 3R0FA 1T4VH 3O5NA 4A6LA 2BY6X 1WFVA 4KKDA 4WYTA 4DT7B 2IJOB 5FAHA 1C2FA 3SGQE 3AVZA 2BX3A 1V2JT 2FCFA 1CQQA 1UVPA 4GVCA 1C1UH 1TP5A 1WG6A 1Q2WA 1C5UA 3NCLA 4NIXA 5E0GA 2WPLS 1XKBC 2ZDLA 4REYA 3Q3YA 3TMHA 1N6XA 2SGFE 3TJUA 2FOGA 1E36B 2SNVA 2Z6BD 2PGQB 5DP3A 2YUBA 4NXRA 5J4QA 5BPEA 4X1QU 4DURA 4NMRA 1O2OA 1ELVA 3TJVA 1GHWH 2GV7A 3A7VA 1C5YB 1QTFA 1MQ5A 1G3BA 4K60A 3M61U 1LQEA 3BF6H 1C2LA 1A5HA 3F1SB 1SC8U 3T2NA 1C4U2 1FC7A 2J94A 2OLGA 1U6QA 2V3HH 3BPUA 1ANBA 3MH5A 5GPIB 3RXDA 3LC3A 2OSGA 1BTZA 1LHGH 2KJKA 2AWWA 2BDIA 1Y5UT 1GG6B 4B71A 3RXIA 1X5NA 2KA9A 3PROA 4M7GA 1A5IA 5DKMA 4XHVA 1TNKA 3RXVA 1RIWC 5T6FA 2PGBB 2BY5X 1IOEA 3S7HB 3B9FH 1V2VT 4JOGA 1PYTC 3L4FD 1J17T 4OS2A 3SI3H 1V6BA 4GHNA 3A7XA 3TGIE 2AMPA 3GYLB 3TK9A 3PLKA 3UY9A 5AFYH 2JETC 3QZQA 1X6DA 2D8IA 4CRCA 2PR3A 1FUJA 1QCPA 4R2ZA 5FPTA 1GHBG 2BD2A 2I6VA 2QXIA 1AUJA 1GCTC 1TOMH 5EW1H 1AMHA 3HVQC 4OAJA 2FLBH 4JYUH 4Q7XA 4A5TS 1O3GA 3A83A 1UHPA 4Y71A 1QAVB 1WU1A 1CGIE 5ABWA 2FYQA 2D1JA 1FY5A 3GCTF 3HKJB 1WTHD 3F9EA 3ESTA 4NMPA 2UWPA 4JZFH 4NSVA 3CBYA 1EAWA 3NZIA 2HLCA 4AG2A 2XTTB 4UU6A 4JOJA 2YT8A 5HFBA 1V2RT 2F9UA 1CHGA 1KYNA 1MC7A 3R0HA 1K1PA 1PPZA 4LK4A 3OY6U 2C8WB 3BTHE 5A0BA 3PLBA 3RXAA 3BTME 2A2XH 1T31A 2BD9A 2BY8X 3M36A 1K1OA 1V6DA 1WI4A 3I78A 3NKKA 1KY9A 1TWXB 1ANCA 1K21H 3PO1B 3S9AA 1U38A 1ELAA 1ELTA 1QQ4A 8ESTE 1WBGB 2BVRH 2G8TA 3AAUA 3RL7A 1O3LA 3I29A 3ATWA 1DPOA 1ID5H 3PS4A 1BMLA 2R0LA 1O2NA 1W2KH 5FBIA 2A7CA 3RXBA 4IN1A 5T3HA 3RU4T 1NU7B 1GHYH 3LU9B 1KWAA 1ZSJA 4TYDA 5FX5A 1O3CA 3SW2B 1P0SH 5DPAA 3EGHC 3D49H 1NO9H 4WXVA 1DDJA 1UTOA 1KDQA 1AVGH 2VJ1A 1MD7A 1GQ4A 1C4V2 2SGEE 3P92A 3SGBE 3U69H 4F4OC 2BTCE 1D4PB 1HJ9A 3LJJA 2P8OC 3VPKA 3JZ1B 5GDSH 2GT8A 2FI5E 3ZRTA 3GY7A 4CREA 4E3BA 2A5AA 3RLEA 2ZPSA 1J16A 2SGQE 3PYHA 2H2CA 2EAQA 1TGBA 1GMHG 1JIMA 3PV5A 2EI6A 1EATA 2Z3CA 2C93B 4YOJA 1FQ3A 4O06A 2TGTA 3PMBB 1BTWA 2CS5A 2A4RA 2VIVA 2YOLA 1GI7B 2QKUA 1AVXA 1ABJH 1O3NA 5ESBA 1EX3A 3ZVBA 3ZVEA 4BAQB 1MTVA 5FXLA 1A5GH 2TGDA 3SV2H 4O3TA 3TH3H 2FS8A 3SU5A 1BCUH 2TBSA 1ZYOA 1SGPE 2UUYA 1ESTA 5E6PB 3OU0A 1ELDE 1O5BB 4X6NA 4AFSA 5A0AE 2BQ6B 1EPTC 1TONA 3GY2A 1VJ6A 7GCHG 3HK3B 3GY4A 1MKXH 5CHAB 3ZVFA 1EPTA 5F8XA 1VR1H 4NFEA 4WH6A 3FP6E 2O8LA 4YT6H 5H3JA 1L6OA 2R4HA 2Y81A 1W14U 1V2LT 2JETB 4IMQA 2KOHA 1SLUB 1GDQA 4ISNA 5F67A 1V2PT 1V62A 4NWLA 2TGAA 1DSTA 1GBAA 1T8OA 2A31A 1ZGIA 2PSYA 1QAUA 1E38B 2ANWA 1QFKH 4HGCA 4ZKSU 3S9BA 1WAYB 1GBIA 3T27A 2R2WU 4E7RG 2Q6GA 1RY4A 1G2LA 3QDZB 1VITH 4ABGA 3RXOA 1FAKH 1O2UA 4YZUA 1K1LA 1ANEA 2MHOA 1ZGVA 2NU0E 1P11E 2F9NA 2BDYA 1L0ZA 3DORA 4BAOB 4IGDA 2CSJA 2Q1JA 2DLUA 1D6WA 1LHDH 2ZFQH 1FY1A 1MTNC 1HXFH 2RCEA 3A8BA 4FUFA 1HFDA 1QB1A 1G2MA 3S7KB 4R0IA 4VGCC 1ZTJA 2BZAA 2Q6FA 2H9EH 3A80A 1C2EA 3EGKH 1DXPA 2AGIX 1OBYA 3GCOA 1OX1A 5A0CA 1PQAA 3RMNH 2KG2A 2E7KA 1C1TA 1P04A 4WH8A 1GCDA 3SU4A 1QY6A 1AFQC 1YM0A 4JZEH 3EYDA 1YLCA 4NXPA 1GMCG 1GBJA 2BLVA 4RKOB 1Y5BT 1HAHH 2G81E 1KDQB 3E17A 1DOJA 4ISHH 1S5SA 3P8GA 2Q3GA 4DY7B 1BE9A 3UNQA 4I32A 5HEBA 2BD3A 1BTXA 3QDOA 1O39A 4NZQA 1DWEH 1YGCH 1AFEH 1E34B 2GP9B 1O2HA 5GXPA 1W9EA 5JBAS 4H11A 2ZHEH 1GDUA 1O2YA 5HXFA 5GNDA 3UNRA 1CE5A 1UVTH 1M5ZA 1LCYA 1X5QA 3K6YA 2R9PA 1Z6JH 6CHAC 2ZU2A 3E0NB 3KEEA 1GJAB 3IWMA 5DP5A 1ZMLA 3GICB 4Y10E 2DE9A 1UEQA 2VH0A 2HPQH 4HFPB 1DITH 3SUZA 2PSXA 1UTKA 1SB1H 1QURH 3FZZA 1V5QA 3M37A 1C5LH 1SVPA 1EPTB 1HDTH 1RTLA 5E21A 3TVJB 2G4TA 3LH3A 1F7ZA 2FI3E 4GCHF 3SV6A 2PKSC 1NT1A 2Y5FA 4A1XA 1Y3VA 1RZXA 5GCHF 3RXPA 3T28A 1FN8A 1P2KA 1AWFH 2A45B 1NRRH 1JRSA 5B6OA 3PMJA 1FPHH 3SOSA 2KOJA 4X8VH 1THRH 3SUGA 4OS5A 4X2XA 1AUTC 5JBBS 2NWNA 1VA8A 2AERH 1QA0A 3ZVGA 2RG3A 3GISB 5DG6A 4NMVA 1CA8B 1A1RA 2F83A 3LGVA 1GI3A 1TBQH 2FOHA 1GJ4H 2ZGHA 4BANB 1K1NA 2NU2E 2P59A 2OZFA 1ZPBA 4Y8YA 2L4TA 2WUCA 3SZNA 2WPHS 1HAXB 4K8YA 4NWKA 4DGJA 2D8WA 3GSLA 1SLVB 4A1TA 5LPFA 4MPXA 1FLEE 3AXAA 2WINI 5DK1A 3HKIB 2EV8A 4AYYB 4Q80A 3GY8A 1TRNA 3PB1E 4QT8C 2L97A 1OWKA 4DCDA 1VCPA 1SHYA 2X7ZA 2H5CA 1LHFH 1FC9A 1SOTA 1G9IE 1MTNB 1AB9B 1BBRE 2WL7A 1EZSC 1W11U 1QLCA 2FOFA 1UJDA 1TMBH 2Y5HA 1O3EA 4VGCB 2KYLA 1GDNA 4DIIH 3M35A 1X5RA 3URCA 5E22A 3AAVA 3BN9A 1OP8A 3F68H 3SNAA 5L30H 3ZZ4A 4XE4A 1TNIA 2MX6A 1O2TA 3LNXA 3LH1A 4UFFH 1AU8A 1J14A 1GI9B 2AH4X 2OGPA 1LQDB 1C1PA 2BYGA 2EDVA 1UK4A 2VIQA 3P17H 3RXKA 3UQVA 2OQ5A 1C1WH 1Y5AT 4XDEA 3ATIA 1S82A 4NA9H 4ABJA 2ALPA 5HF1A 1K1JA 3IG6B 3KN2A 4XFQA 5GJ4B 1ESAA 4KGAA 1SPJA 1TNJA 3A8DA 1O2VA 2Q6DA 2WV5A 7KMEH 3B8JA 4JYTA 3RLYH 2YUYA 3ENSB 3QN7A 1W0YH 3MU4A 1RGRA 3SNDA 1FI8A 5L6NH 4H6TA 1SGFG 2A2QH 2BXUH 4H4FA 1LPGB 1NS3A 1HJAB 3MFJA 2ZDKA 2B5TB 2BDHA 4INLA 2I04A 1DS2E 4FUJA 3T29A 1F0RA 1WSSH 5D13A 1HAGE 2PKAB 4JL7A 3RC5A 2WPJS 5E11A 3STJA 2JIKA 1UJVA 1TPOA 3TITA 3DA9B 2V1WA 2VGCB 4XOJA 1L1GA 3A89A 1O2LA 2WYGA 2AS9A 2WV4A 3RU4D 1A0JA 5C67A 3FFGA 3SU2A 5FBEA 2FOCA 1SGTA 3HK6B 5HYOA 3C1KA 3TK5A 2Z9GA 2Z9LA 2ZU3A 1UK3A 1C1VH 1MMJN 2BHGA 1HAYB 3CC0A 3T26A 2CHAC 3SV9A 3V13A 4Q7YA 4DOQA 1D3TB 1Z7KA 2A4QA 2W5EA 4AGKA 2H2ZA 3HATH 2PKSB 1KTSB 3RC6A 5JPMH 5T6DA 4H42U 1QL7A 2RDLA 3M7TA 3I18A 1F5RA 1CHOG 2YNBA 4IMZA 1E0FD 1N6EA 1NY22 1TABE 4GSOA 4KELA 2JREA 5HEYA 3GCHC 1TRYA 2ZPLA 4I7YH 1GI2A 4I8GA 4FUGA 4NMSA 1DLEA 1K22H 1WCZA 6LPRA 1XZ9A 2ZKSA 2QAAA 4UFDH 2F9OA 1T4UH 5E1YA 4FVBA 4E06H 1N1LA 1HAVA 2BQWB 2GMTC 4BTTB 3A84A 1Y7NA 2EC9H 4E35A 4ABBA 2ZIQH 2GVFA 3LPRA 2OXSA 3U8RH 3SUFA 3Q76A 1QRXA 3KQBA 2KL1A 2XXLA 1OWHA 3VQFA 3QWCH 4ZUHA 3U98H 1TQ3A 4ZHMU 1T8NA 2K1QA 4KTCA 1VITF 3PDVA 4Q2KA 2M0VA 5EXMA 5ESTE 1FNIA 5CE1A 1BZXE 1QGFA 1T8LA 4LOYH 1TAWA 1C5SA 2A5IA 1Y3WA 2I0LA 2ZPQA 1MKWK 2ZPMA 4Y8ZA 1ELEE 5K7RA 2Z17A 2GZ7A 1IQIA 1C1SA 2QXHA 1IHJA 4J2YB 2GZVA 2QKVA 1Z8IB 3K2UA 4NG9H 2OCSA 1A0LA 3UFAA 3NFKA 1TGNA 1SQAA 2VZ5A 1MAXA 1L1NA 1EAIA 3OSYA 4K1SA 1J9CH 2HRVA 3QTOH 1RXPA 4O97A 2J4IA 1GI0A 1GMDF 1H9IE 4Y0ZE 2W3IA 5AHGH 4ISLA 3AASA 4OS4A 1MUEB 1QHRB 1C5NH 4UEHH 4JCNA 2ZGXH 1BIOA 1UO6A 4B2CA 4Y6DA 1UMAH 1QBNA 2H2BA 1TFXA 1NFXA 3MTYA 4TWWA 1F5KU 3A7YA 4KTSA 2PTNA 1FONA 4AB8A 1XUKA 3SV8A 3BTQE 1ARBA 2IWNA 1XVOA 2ZZUH 1Y3XA 3UIRA 1VGCB 2H5DA 2QV1A 4ZAEA 1P10A 2AIPA 4B73A 4NFFA 1ZSKA 2F5YA 1GBDA 3BTWE 4WMDA 3KCGH 3SQEE 2ZDVH 2CJIA 1P2QA 1GJ9B 3GCTG 2CHAB 4NXQA 1DICA 4CH2B 3FVFB 4ABIA 1AIXH 4Z33A 5BRRE 3NK8A 2EEHA 5C1UA 3E1XB 4ZKRU 2XC5A 4BTIB 3FANA 1DY9A 5L2YH 2WPKS 2ZC9H 1O5DH 1UCYK 3QZRA 5EXNA 4B74A 4EDJA 1EZQA 2A7HA 2BVSH 3VB7A 3WKMA 4AZ2B 1G32B 4JORA 2FOMB 2ZGCA 1KLTA 4UD9H 1WF7A 5G4BA 1C9TA 4BAKB 1ZMNA 4LZ4B 2A0QB 3L6PA 4NNMA 4K2YA 2BOHB 2OTVA 1AI8H 1EUFA 4NMTA 4TWYA 3LGYA 1GBMA 3LIWA 4K8BA 3RUOA 1HAVB 2ZDNA 1GI4A 5EGMA 1TQ0B 3V7TA 2V3OH 3O8DA 3PWBA 1IQKA 1IQJA 1O3AA 1UITA 1ARCA 2GMTB 5L2ZH 3LT3A 1WV7H 5JBTA 1BHXF 3GGEA 1YYY1 2B0FA 3QIKA 2EDZA 4HZHA 5C5NA 1A7SA 4YYXA 2OBQA 2KPLA 1AY6H 1GBBA 3MU8A 1Z6EA 2F0AA 2GCHG 4AG1A 4U01A 2OMJA 2JH6D 2AYWA 5A8YA 3K1RA 2UUJB 1WHAA 2H9TH 4OGYA 4A1VA 2STAE 2TIOA 3MHWU 1O2GH 2ZHFH 2PW8H 1LKBA 2SNWA 1GI8B 2VVVA 1NRPH 1T32A 6GCHF 3KZDA 1TGTA 2QA9E 2WPIS 2PNTA 3WY8A 4DVAU 2UZCA 5HFFA 1KSNA 3HPMA 5C2ZA 1W10U 1YCPK 1OZIA 2FNEA 2KAIA 3G01A 1I92A 1IQLA 1PQ5A 2DUCA 1YPEH 3P8OA 4MPAA 1K9OE 2BLWA 5HFCA 5HDYA 1DUAA 1HAZB 2CGAA 3M3VA 2BVXH 2KV8A 1UFXA 3LKWA 4PQWA 1BRCE 2D90A 1LVYA 1ZTLA 1MBMA 4U30A 1IU0A 3UREA 1TGSZ 4MQAA 2ZFPH 1AWHB 3SU1A 3BTKE 3RP2A 3TNSA 1ZHPA 3E91A 3KGPA 3SJIA 1ETRH 1MU8B 1PPHE 1YP9A 3V12A 1ZOMA 4ABAA 3JZ2B 1JIRA 3BEFB 3ODDA 1SQTA 2J38A 1KXCA 1C1MA 1F5LA 1MZDA 3IITA 4WVPE 1GVKB 1PPCE 2C4FH 4XBBA 3RXHA 4CR9A 2OQSA 2B7DH 1NF3C 4MPUA 4ASHA 2KJDA 1TMTH 4OS1A 1TB6H 3KF2A 2C90B 1QRWA 2A7JA 5E2PA 4CH8B 2DLSA 4G69A 4U2WA 3QGLA 3ZZ6A 1TOCB 1GQ5A 3SQHE 2VWLA 3BEIB 4YLUA 2OC1A 2HGTH 3K6ZA 2PDZA 3OTPA 1W12U 1GJ8B 2OUAA 4B2AA 1NC6A 4Z6AH 2CF9H 1GHBF 3A85A 1BHXB 1TX6A 1GJDB 2FTLE 1BQYA 3QE1A 1BA8B 5A09A 1YKTA 3SHWA 2K20A 2ASUB 1BMMH 1IU2A 4MG3A 1W7XH 2XWBI 2CN0H 1ELGA 1T8MA 2AIQA 3UNSA 4UFEH 2BQ7B 5LPEA 4UFGH 3BTGE 1TYNA 1SLWB 4ISIH 3SN8A 1RIWB 1BUIA 2ZGJA 3A88A 4SGBE 4Y0YE 1UTQA 1NRNH 2W3KA 3HGPA 2UUKB 4Y7BA 1TALA 4O3UA 3LGIA 5TCCA 4X0WU 2ZQ1A 2EGOA 2EJYA 4MTBA 2P3TB 1G3CA 1BT7A 1UVUH 1ZRBA 3OX7U 1WTGH 4JOHA 4Q2OA 2HNTE 4AFUA 3ITIA 1MD8A 1GCTB 4JYVH 1ETTH 3DIWA 2IWOA 4BNRA 1NTPA 1O5EH 4ZMAH 3F9HA 2ZU5A 2OINA 1O0DH 1A61H 2F9VA 5FCRA 5J4SA 2ZWLH 1FCFA 1CO7E 4YO9A 2YNAA 2FYRA 3MOCA 5DTHA 3M5MA 2KAIB 3LJOA 4FVDA 3RXTA 3RXUA 1GBCA 1RS0A 1CGHA 1B0FA 2WUBA 1K1MA 1Y3YA 2Y80A 2EI8A 3SJOA 2R3UA 4NIVA 4X2YA 1O3IA 1AQ7A 1TPAE 4YOIA 3VB3A 5DGJA 4WYUA 2OC8A 1S85A 3LGUA 1SI5H 5DJ7A 2ZO3H 5A8XA 2O8MA 3RMMH 1O36A 3PV2A 4DIHH 3F9FA 3V0XA 2CXVA 3TJOA 1MTSA 2SGAA 4CBOA 2IOTA 2Y7ZA 4X6OA 4WMEA 5G1EA 1MFLA 4GCHG 3FZDA 4D8NA 4THNH 3VFEA 1Y8TA 3PLPA 3W95A 4K6YA 3STIA 1XUIA 2ZCKP 5GCHG 2G51A 4MVNA 2LC7A 4X6PA 3T62A 8GCHF 3Q3KA 4R8TB 1YCPM 4MPVA 1NN6A 3SHAH 1PPBH 3CP7A 4BXSA 4N6XA 2DC2A 2QG1A 1FN6A 1K2I1 1MH0A 3O8RA 1LO6A 3GCNA 1B5GH 2LUIA 3P6ZB 3A82A 3B23B 2DB5A 2ZHQH 1DWBH 2I4SA 1NU9A 2GV6A 4J1YA 2FE5A 1HJ8A 3EDXB 4DJZB 2J92A 3BTDE 4I8HA 2QF3A 3S69A 1CVWH 4UU5A 4AN7A 2ZFSA 1GVZA 4Y7AA 1HB0B 3GDSA 5JXBA 1GI6A 2KOMA 7GCHF 1AE8H 1O3OA 1ZHRA 2P8OB 1GBHA 4JK5A 5G1DA 4HTCH 1HXEH 1KTTB 3TGKE 3JXTA 2GTBA 1MCTA 3MNSA 4JZDH 1JBUH 3E8LA 1PQ8A 4ZKOU 2VIOA 4AORA 1O2PA 2EI7A 1NPMA 2G5VA 2P95A 1P09A 5TCAA 1O2RA 1WIFA 1C5TA 2HVXA 2ANKH 2PKAA 1LVMA 1V2KT 2P3UB 2AWUA 4YDPA 2G2LA 1N8OC 1VZQH 1OPHB 2C3SA 1SGCA 1F2SE 1IQHA 1JOUB 3O8CA 1H1BA 2ZFTA 3WKLA 1ELCA 2GT7A 5SGAE 2BYAX 3P8FA 2G5NA 2EDPA 3SV7A 4AMHA 1BJVA 4P0CA 2ZPRA 2FTMA 3SJ9A 3I4WA 1VJAU 2Z94A 4XSKU 3TSVA 5JB8S 4ABHA 1PPFE 1DVAH 2VNTA 1P06A 2BDAA 2Z3EA 1KXEA 2Y5GA 3Q3XA 1Y59T 3SNEA 1MU6B 4RN6A 1XXFA 2VSVA 1TA6A 4FU7A 1C5MD 3TH2H 1SGIB 2ZI2H 1WI2A 3M5OA 3RM2H 1ZJKA 2ZCHP 2REYA 3K50A 4OS7A 3RXGA 3ZVDA 3ZZDA 1Z1JA 1CBWC 1PQ7A 4WJG2 3ZYDA 1A3EH 3KQCA 2QYIA 4D7FA 1S0RA 1B0EA 4D9RA 1DM4B 3SNBA 1MBQA 3O46A 1XUGA 5FPSA 2ZP0H 1XVMA 3BTTE 5HGGA 2QT5A 4K75A 5CMXH 1S6FA 1VB7A 1YBWA 3O8BA 2XNIA 3A7TA 1ZPCA 2ZF0H 2GGVB 1NROH 1RGQA 1F0TA 1H8DH 2K1ZA 1DLKB 1UHBA 1DT2A 4MNYA 2P3WA 1ZPZA 4UE7H 3LGWA 3E3TA 1SQOA 3UTUH 2FM2A 2GZ9A 1ZOKA 1GHAG 3H5CB 2V35A 4FUCA 5C3NA 1EOJA 1CT2E 1G36A 1MQ6A 1SGQE 1V2OT 5FPYA 2FX6A 3GYMA 2W7UA 1OWIA 1FJSA 1LPKB 1SMFE 5C1XA 5I25A 2PKUA 1MTWA 2BOKA 5E0JA 3DT0H 3UOPA 5K0HA 1UTMA 1UEZA 1WQVH 1MKXK 1C5VA 2FI4E 1LVOA 3CYYA 3CBZA 1AFQB 1S84A 5E2OA 2OPGA 1DXWA 1C5PA 3EAJA 1VCQA 5B6LA 1G30B 1HRTH 1NESE 2FP7B 2JH0D 1UEWA 3RMOH 1Z87A 2LPRA 3ID3A 3UR9A 3ZZ8A 2EEJA 2G55A 3P70B 3ZZ7A 1UCYH 1S0QA 1SSXA 1UTPA 3GY6A 5E8EH 4D76A 3KHFA 2RCZA 2BD4A 2J95A 2I1NA 1G3EA 1O38A 2BD7A 2CV3A 2AGGX 2OC7A 1W7GH 1P2MA 3E16B 3PV4A 5EPYA 4BTUB 1SG8B 2TGPZ 3DHKH 3RMLH 3EGGC 3R69A 1FV9A 1ORFA 2J2UA 2ODPA 3LGTA 4CRDA 1P03A 2W4FA 1O31A 3NGHA 3C27B 3TU7H 1DX5M 3PM3A 1GJ7B 4O9VA 6CHAB 2EXGA 2KAWA 3BTEE 2PLXA 3URDA 1SGRE 1HYLA 1KXDA 1VITG 4WF8A 1INCA 3CBXA 4FU9A 4X6MA 1N8OB 1B8QA 2BLOA 4Y76A 2BDCA 1D6RA 3TIUA 1OWJA 1UVOA 3SI4H 4YM9A 2ANMH 4WWYA 5DP6A 1EB1H 1C5QA 1QJ1B 5H4IB 2P94A 4KTUA 1FC6A 1BTUA 2FPZA 2TRMA 3CS7A 3GY5A 3BTFE 3VGCC 3RC4A 4TY7A 1TMUH 3ZV8A 1P9SA 2SGPE 3GDVA 1S6HA 4KFWA 3RLWH 2JILA 4Q7ZA 1BDAA 4U32A 1G37A 1Y3UA 3AW1A 2XC0A 4AB9A 2IWPA 1W0ZU 3QJMA 3D23A 3SFJA 1HPGA 1PYTD 7LPRA 1XX9A 1GMDG 3UR6A 1NZQH 2ZCLP 2ZECA 1GBTA 1TNGA 2VWRA 1BBRK 1OXGA 1XM1A 3F9GA 1ANDA 3MH7A 1A0HB 5EXLA 2PUXB 4NIWA 1TP3A 1N7FA 1MTUA 4OS6A 2ZDMA 2XC4A 2H6MA 3L3TA 3PMAB 3FP7E 1HLTH 2D26C 1EAUA 5A2PA 5LPRA 1HUTH 1ZUBA 3FP8E 5EG4A 5JDUB 1UHBB 1B7XB 2M3MA 1U39A 3KHVA 4IW4E 3F6UH 1LDTT 1GG6C 2XBYA 5JBCS 5HF4A 1A2CH 2PKTA 3HPTB 1OBXA 3UPEA 3VB5A 1R6JA 2A4OA 2O8WA 3RDZA 3KZEA 4AFZA 1G3DA 2KQFA 3E0PB 2XRCA 1OWDA 2R2MB 4JOPA 2P3FH 1O37A 4FUHA 2FS9A 2KBSA 1IQFA 1P05A 5DO4H 1N7EA 3HGNA 1GBKA 1Q3PA 2A32A 1UTLM 4D9QA 5IYTA 5EQRA 1EP6A 3ZZAA 4ZKNU 4RI0A 2PWXA 1N6YA 3TPIZ 1YPLH 3MWIU 2FMJA 4K69A 3T25A 1W8BH 1E37B 3R3GB 1O2SA 3LDXH 1AZ8A 1JWTA 3PTNA 2BD8A 3PDZA 3R68A 3MNCA 2C8YB 1F92A 2M10A 2DM8A 5HJ1A 1LHCH 1VAEA 4X1SU 3VB4A 2ODQA 1GBLA 2P16A 1D3PB 4WY3A 5GWZA 1UVSH 2GDDA 1O5GH 4NCYA 1N99A 3VQGA 4B75A 1NFWA 2BXTH 1ZSLA 4INHA 1DWDH 3ODFA 2BD5A 5E0HA 1GL1A 4IC6A 1X45A 5FCKA 1GBEA 1TIOA 3TJNA 1YBOA 5ETXA 3U1JB 1P1DA 1ZMJA 2AEIH 1JXPA 3MU1A 3A8AA 4K76A 1KXFA 3M5NA 1WYKA 1FZZA 1DUEA 3ZZ3A 1EXFA 1OYTH 1CSOE 3U1IB 3I1EA 1GJ6A 3EA8A 1ZHMA 1DWCH 2EEGA 1V2NT 3QGJA 6GCHG 4F49A 2M0ZA 4GLYA 2BDBA 1V1TA 1KXBA 4WMFA 2FN5A 2VVUA 2F3CE 2LA8A 3LOXA 1ESBA 3N7OA 3VGCB 2EEKA 2GCTC 4XBDA 2O2TA 8KME2 2H1UA 2XCFA 3SHCH 1NRSH 3K65B 2J9NA 2ZTXA 2FESH 3MO6A 4K5ZA 4HI3A 4E05H 1FAXA 3BG4C 4BXWA 4OEPA 1N6DA 3GCHB 1QNJA 2Y7XA 4MNWA 4CHAC 4LXBH 1MCVA 2OC0A 2BMGB 1XUFA 1GJBB 4PROA 3UQOA 1YPGH 1QB6A 1P57B 3MU5A 1P2IA 1BTYA 1YPHC 1VCWA 2YTWA 1UK2A 2KPKA 4IC5A 4D7GA 1P01A 3DUXH 1AGJA 1SHHB 3ZYEA 3A81A 3I77A 3Q77A 4UONA 1U3BA 2H3MA 1H9HE 3RXRA 4O03A 2SFAA 1WJLA 4WXIA 1BJUA 3SU0A 2IPHA 3ZZ5A 3SUEA 1HV7A 3M7UA 2AINA 5IDKA 2AGEX 4NNLA 1HAIH 2TPIZ 1SFIA 3MNBA 3T5FH 1DANH 1C5OH 4LMMA 1D3DB 2PFEA 1BMAA 2DJTA 1Z8JB 4GHQA 1SFQB 2OBOA 3EA7A 5CHAC 1RGWA 2CF8H 2ZHWH 2BM2A 1RRKA 5HFEA 3ELAH 4E34A 2G52A 1WF8A 2AMQA 3QUMP 1L4ZA 4TY6A 4NMQA 1P3CA 4ZHAA 1HIAA 4IS5A 5PTPA 2IN2A 4MLFB 1F0SA 1EOLA 4Z0KA 4ABDA 1X8SA 3SORA 1O3MA 3RL8A 1BRUP 1C4Y2 4Q3HA 1EZUC 3MO3A 1HBTH 1XUHA 1CGJE 3P8NA 3GDUA 1O2WA 5HM9A 3MH6A 2OP9A 1IQNA 3SGAE 5HMAA 1O2QA 2A5KA 2O8TA 5HM2A 3VXEH 5FB8C 8LPRA 3KQEA 4JOEA 3DFLA 1TNLA 4AX9H 1KEFA 1GHVH 1AD8H 4ZHLU 1OOKB 2DKRA 1BFEA 1RTFB 3H7TA 1O34A 1ZTKA 1C5RA 2DMZA 3UWIA 1PJPA 1YPMH 2NU1E
chains in the Genus database with same CATH superfamily
1C5WB 5DP8A 5LGOA 1AE5A 4I8JA 5EJZA 1IQMA 1T7CA 1U37A 3UUZA 2A1DB 1O3KA 1SR5C 2QGRA 2J34A 4NA7A 1C2MA 2ODYB 4YTAA 1GHXH 1Q7XA 1HAPH 3K82A 1TBZH 2FWWA 2YMSC 4F48B 4NA8A 3RXFA 2VINA 2J98B 1O3HA 1O2XA 2HALA 4JOKA 3OAAD 2VH6A 1JRTA 2V0BA 3KDKA 2QIQA 3U9AH 3KDGA 1TGCA 4CRBA 1FPCH 1BB0B 2RA0A 5EQQA 1GBFA 4AGJA 3TLOA 2ZGBH 2GCTB 1K1IA 1YPJH 2DE8A 3EA9A 5F8TA 2G5MB 3EE0B 1X9ZA 1LVBA 2VIDA 3RXCA 1TX8A 1UF1A 2CMYA 2GCHF 3PMHB 1DE7H 1GM1A 3BG4B 1V3XA 4SGAE 1YLDA 3SOEA 1FMGA 4CHAB 3MYWA 1QQUA 1SGYE 5F6MA 1TPSA 2ZU1A 1EJAA 1HAOH 2FX4A 1TPPA 1L1JA 3KYFA 2HE4A 1FXYA 1HNEE 1LKAA 5F8ZA 2M0TA 2G00A 1QB9A 3SU3A 4ABFA 8GCHG 2JOAA 3S0NA 1UEPA 3UAIC 1PPEE 4Y79A 4HOPA 2ILNA 2GZ8A 1NFUA 1GHZA 2JH5D 4ZXXH 1W3CA 1O33A 3QX5H 4FU8A 4B2BA 2BY7X 2XW9A 5EYZA 3HPKA 1THSH 3OY5U 1C2DA 1OWEA 2EQNA 2LELA 1AZZA 5I7ZA 2XBXA 5C5OA 1N6FA 4GPGA 4Y8XA 1V2WT 1X7AC 4FUEA 2OCVB 1S81A 4GUXA 4X1PU 1SLXB 4ZXYH 1HIAB 1C2KA 2LC6A 1KXAA 1L4DA 3BEUA 5C1YA 3QGNB 3A87A 3NWUA 1BTHH 5HFDA 1QBOA 3RXLA 2JWEA 2W26A 4ABEA 3H09A 2VPHA 2VB0A 3GY3A 4NGAH 3NUMA 5EU8A 5AFZH 5F03A 1SL3A 1GWAA 5JYIA 1YWUA 2HGAA 1P1EA 2QBWA 1IHTH 1ACBE 2EGKA 1J15A 3ZVCA 1O2JA 1TBRH 2O9QA 3TH4H 4NZLA 1OS8A 1EJNA 4I8KA 2D2DA 1ABIH 4RSPA 4IN2A 2Z9KA 3B76A 1IHSH 1O3DA 5TJXA 1O3FA 1P8VC 1GVLA 3AW0A 3VEQB 1ZZZA 2OQUA 4YOGA 1O2IA 1Q31A 1GMHF 2G4UA 1JMOH 2WV9A 3MI4A 4FXGH 4KP0A 3SJKA 1C1RA 4H6SB 1P3EA 2H3LA 2I6QA 4X2VA 5DP4A 1SGNE 1ETSH 3MH4A 1OSSA 1Z86A 1QL9A 4AFQA 1SGEE 1AB9C 2EGNA 3TK6A 2FXRA 4DG4A 1VKYA 4FUIA 2PUQH 2PHBA 1SBWA 1YC0A 1K28D 2ZTYA 2AMDA 4B76A 2GX4A 1V2UT 2LNCA 2ZFFH 3K9XB 2KM0A 1O5FH 2YMSB 4ZROA 1C1QA 1SGDE 1GJ5H 5FHTA 4CRGA 1C5ZB 3TSWA 3ATKA 3SUDA 1YY3A 1D5GA 3Q00A 3M7QA 1XMNB 2RRMA 5HEDA 2I6SA 2QC2A 1G9OA 1AO5A 4Q2NA 4Y11E 5C20A 2GD4B 4AYVB 4NSYA 1BBRH 1OP0A 1I16A 9LPRA 1CA0C 2PV9B 3PTBA 3SU6A 2XWAA 1P2OA 1BOQA 2BY9X 9ESTA 1C9PA 4MNXA 4YT7H 2OS6A 3A8CA 1P9UA 3RM0H 1UTNA 2IPQX 3A7ZA 2BLQA 4Q6HA 1HCGA 4X8UH 1HJAC 4B1TA 4CRFA 2VWOA 3CH8A 4K1TA 1EJMA 4E7NA 3ATLA 2UWOA 2ULLA 1YF4A 2VIPA 4HOPB 1A4WH 1VJ9U 3SO3A 1E1QD 4K78A 2Z7FE 1AHTH 1ELFA 2DAZA 4NMOA 1C2HA 1D9IA 2VGCC 3W94A 2PZDA 3BIUH 1TE0A 4ESTE 4I31A 1O5AB 2IWQA 3DJAA 2J5UA 1QRZA 1V2ST 1NFYA 2HPPH 1MKWH 4A7IB 2VWMA 3M3TA 1V2MT 3DFJA 1P2JA 1Z1IA 1F0UA 4MDSA 4GHTA 2QXGA 4GVUA 2L4SA 4MPWA 4Q6SA 1BRAA 3WWBA 1AN1E 3NFLA 1O2KA 1ZRKA 3NPSA 4B6FA 1V2QT 2CSSA 3VXFH 1OKXA 4A92A 3ID2A 1YPKH 1H9LB 4X2WA 3KQDA 2EHRA 2GDEH 1GMCF 4DT4A 5A8ZA 2BZ6H 2Z3DA 1Z8GA 2QXJA 5GLJA 1UM7A 3VG8A 1MFGA 2ZDAH 1S6LA 1C2IA 1DY8A 3FY5A 2EA3A 2ESTE 3SHUA 1O3JA 1K32A 1TX7A 3KNXA 2Q9VA 3E90B 1AKSA 2HE2A 3RXEA 2JXOA 1E35B 1MZAA 3QTVH 1OBZA 1GI1A 1O35A 5EZ0A 4L8NA 3F0PA 4Q2PA 2QF0A 4X8SH 3CNRA 4BAMB 2H9HA 5I46H 3KL6A 4OGXA 3ZV9A 2Y82A 1Q3XA 3H7OA 2F9BH 3ID1A 2FIRH 2HNTC 1OP2A 2FLRH 2I0IA 1UM1A 1UTJA 2BB4A 1XXDA 3P95A 1HGTH 2OD3B 1M9UA 1GGDC 1EASA 4YLQH 1ZLRA 1H4WA 4FLNA 4XBCA 3ZZ9A 2ZEBA 1J8AA 3GOVB 3KIDU 1O2MA 3FAOA 4FGMA 1TNHA 2NU3E 1A3BH 2XBWA 2R3YA 2ZNKH 1O32A 4TPYA 1WHDA 1RFNA 3DSOA 1XKAC 2W7RA 2ENOA 2QKTA 1Z71A 2HNTF 1LTOA 2THFB 2ZFRH 5JB9S 1A46H 3ID4A 1W0JD 2WPMS 2BX4A 1KLJH 4JK6A 1FY4A 3SJ8A 1T2MA 2FODA 3DJ3A 6ESTA 3DJ1A 3SYJA 4UDWH 1ZR0A 2FOBA 3PWCA 2FZZA 3OTJE 1PFXC 3LNYA 1CA0B 2K0QA 1GI5A 1DFPA 4K3JA 3GJ9A 5EIYA 1FY3A 2JINA 5FL7D 2O8UA 4FUBA 1UJUA 2Z9JA 1W9QA 1IQGA 1NBME 4X1NU 3SNCA 1QL8A 5HETA 2GKVE 2YT7A 5DN6D 2UUFB 1LMWB 2VSPA 4CBNA 3RU4E 2F9PA 1WFGA 3RXSA 1NM6A 1L2EA 1YPHE 2A4GA 2Y6TA 2ZA5A 3FOAA 1QA7A 1QJ6B 1LHEH 2B8OH 2B9LA 3OE7D 4JZ1A 4Q4LA 1TLDA 4X1RU 2VRFA 3L33A 2W6ID 2KRGA 3EQ0H 4JOFA 1VGCC 4MNVA 3MMGA 1EP5A 1QR3E 4BOHA 2F91A 1RTKA 3PRDA 1RJXB 1KLIH 3NXPA 1GHAF 3BSQA 2XBVA 1QBVH 1C2GA 1O30A 3LONA 2D92A 1BMNH 4GVDA 2R0KA 1CBWB 1TQ7B 4INKA 3RXQA 1YCPH 2XCNA 3VB6A 2VWNA 3UWJH 5EOKA 1WOFA 2KJPA 1ZJDA 4BAHB 1C2JA 2FEQH 1QIXB 2NU4E 3D65E 3BG8A 3LC5A 3OYPA 3RXMA 1TA2A 1O2ZA 1EAXA 4Z8JA 3QLPH 1GJCB 2JKHA 2W7SA 4K72A 2ZQ2A 2M0UA 1SGFA 4KFVA 2J97A 1OHHD 2Z9IA 1PDRA 2FO9A 3MO9A 1P12E 1W9OA 2FOAA 1AKSB 4XD7D 3U8TH 4DW2U 1O3PB 4JZIA 1MAYA 5A2MH 3CS0A 4I33A 3F2GA 2STBE 4AOQA 1UCYE 2C8ZB 2AFQB 3ATMA 4NIYA 1D3QB 1Z8RA 4F8KA 3TGJE 5EW2H 3SBKA 3E6PH 1WQSA 1QJ7B 5DP9A 2C8XB 1FY8E 2P93A 1C1NA 5AVDA 1CU1A 2VVCA 2M5TA 2VIWA 3TSZA 3V3MA 1KIGH 1MABB 4IBLH 4RKJB 3MNXA 3QK1A 4P2AB 2WYJA 2V6NA 1C5XB 4TPIZ 2ZHDA 3ZZBA 2V90A 2RA3A 1W13U 3S9CA 3D62A 4TSFD 1GGDB 5LH8A 1LPZB 5FX6A 1FDPA 2QN5T 3BV9B 1DSUA 5AF9H 1P2NA 4CR5A 2L6OA 1UJ1A 1O5CB 1BRBE 1C1OA 1GPZA 1V2TT 2LOBA 1IQEA 5GIBA 2ALVA 1CT0E 2QY0B 3A86A 3CENA 1THPB 3DD2H 1QAVA 1CT4E 4JMYA 3U8OH 1TRMA 1BITA 5DP7A 5EQSA 2EEIA 1EQ9A 1FIZA 1EZXC 3UOUA 7ESTE 1WUNH 2FOEA 1GL0E 2ANYA 1H8IH 1NRQH 1AVWA 5F3XA 3TNTA 4ISOA 2HOBA 1CHOF 2VU8E 4ZH8A 1NTEA 1PPGE 1O3BA 4LZ1H 3QJNA 1SOZA 3RXJA 4FUDA 1OYQA 2AWXA 4K1EA 1IAUA 3QO6A 5EODA 4CRAA 3M3SA 1S83A 2HWLB 3PO1C 5T6GA 1N7TA 1Q3OA 1XUJA 4X8TH 4YESB 3FKSD 1FIWA 3MU0A 5EPNA 3ZVAA 2KCYA 1EKBB 4OEOA 2UWLA 4GAWA 4Q2QA 1BTPA 1WH1A 2ZTZA 1V5LA 4I8LA 3ZZCA 2ZG0H 2PTCE 1EB2A 1P02A 2BDGA 2J98A 1RD3B 3BIVH 2XYAA 2QCYA 2FDAA 3A7WA 2ZU4A 2PA1A 2SGDE 1ELBA 3M5LA 3R0FA 1T4VH 3O5NA 4A6LA 2BY6X 1WFVA 4KKDA 4WYTA 4DT7B 2IJOB 5FAHA 1C2FA 3SGQE 3AVZA 2BX3A 1V2JT 2FCFA 1CQQA 1UVPA 4GVCA 1C1UH 1TP5A 1WG6A 1Q2WA 1C5UA 3NCLA 4NIXA 5E0GA 2WPLS 1XKBC 2ZDLA 4REYA 3Q3YA 3TMHA 1N6XA 2SGFE 3TJUA 2FOGA 1E36B 2SNVA 2Z6BD 4Z1MD 2PGQB 5DP3A 2YUBA 4NXRA 5J4QA 5BPEA 4X1QU 4DURA 4NMRA 1O2OA 1ELVA 3TJVA 1GHWH 2GV7A 3A7VA 1C5YB 1QTFA 1MQ5A 1G3BA 4K60A 3M61U 3N7EA 1LQEA 3BF6H 1C2LA 1A5HA 3F1SB 1SC8U 3T2NA 1C4U2 1FC7A 2J94A 2OLGA 1U6QA 2V3HH 3BPUA 1ANBA 3MH5A 5GPIB 3RXDA 3LC3A 2OSGA 1BTZA 1LHGH 2KJKA 2AWWA 2BDIA 1Y5UT 1GG6B 4B71A 3RXIA 1X5NA 2KA9A 3PROA 4M7GA 1A5IA 5DKMA 4XHVA 1TNKA 3RXVA 1RIWC 5T6FA 2PGBB 2BY5X 1IOEA 2V3MA 3S7HB 3B9FH 1V2VT 4JOGA 1PYTC 3L4FD 1J17T 4OS2A 3SI3H 1V6BA 4GHNA 3A7XA 3TGIE 2AMPA 3GYLB 3TK9A 3PLKA 3UY9A 5AFYH 2JETC 3QZQA 1X6DA 2D8IA 4CRCA 2PR3A 1FUJA 1QCPA 4R2ZA 5FPTA 1GHBG 2BD2A 2I6VA 2QXIA 1AUJA 1GCTC 1TOMH 5EW1H 1AMHA 3HVQC 4OAJA 2FLBH 4JYUH 4Q7XA 4A5TS 1O3GA 3A83A 1UHPA 1K0HA 4Y71A 1QAVB 1WU1A 1CGIE 5ABWA 2FYQA 2D1JA 1FY5A 3GCTF 3HKJB 1WTHD 3F9EA 3ESTA 4NMPA 2UWPA 4JZFH 4NSVA 3CBYA 1EAWA 4FETA 3NZIA 2HLCA 4AG2A 2XTTB 4UU6A 4JOJA 2YT8A 5HFBA 1V2RT 2F9UA 1CHGA 1KYNA 1MC7A 3R0HA 1K1PA 1WXRA 1PPZA 4LK4A 3OY6U 2C8WB 3BTHE 5A0BA 3PLBA 3RXAA 3BTME 2A2XH 1T31A 2BD9A 2BY8X 3M36A 1K1OA 1V6DA 1WI4A 3I78A 3NKKA 1KY9A 2QF4A 1TWXB 1ANCA 1K21H 3PO1B 3S9AA 1U38A 1ELAA 1ELTA 1QQ4A 8ESTE 1WBGB 2BVRH 2G8TA 3AAUA 3RL7A 1O3LA 3I29A 3ATWA 1DPOA 1ID5H 3PS4A 1BMLA 2R0LA 1O2NA 1W2KH 2KFWA 5FBIA 2A7CA 3RXBA 4IN1A 5T3HA 3RU4T 1NU7B 1GHYH 3LU9B 1KWAA 1ZSJA 4TYDA 5FX5A 1O3CA 3SW2B 1P0SH 5DPAA 3EGHC 3D49H 1NO9H 4WXVA 1DDJA 5IL9A 1UTOA 1KDQA 1AVGH 2VJ1A 1MD7A 1GQ4A 1C4V2 2SGEE 3P92A 3SGBE 3U69H 4F4OC 2BTCE 1D4PB 1HJ9A 3LJJA 2P8OC 3VPKA 3JZ1B 5GDSH 2GT8A 2FI5E 3ZRTA 3GY7A 4CREA 4E3BA 2A5AA 3RLEA 2ZPSA 1J16A 2SGQE 3PYHA 2H2CA 2EAQA 1TGBA 1GMHG 1JIMA 3PV5A 2EI6A 1EATA 2Z3CA 2C93B 4YOJA 1FQ3A 4O06A 2TGTA 3PMBB 1BTWA 2CS5A 2A4RA 2VIVA 2YOLA 1GI7B 2QKUA 1AVXA 1ABJH 1O3NA 4ZCNA 5ESBA 1EX3A 3ZVBA 3ZVEA 4BAQB 1MTVA 5FXLA 1A5GH 2TGDA 3SV2H 4O3TA 3TH3H 2FS8A 3SU5A 1BCUH 2TBSA 1ZYOA 1SGPE 2UUYA 1ESTA 5E6PB 3OU0A 1ELDE 1O5BB 4X6NA 4AFSA 5A0AE 2BQ6B 1EPTC 1TONA 3GY2A 1VJ6A 7GCHG 3HK3B 3GY4A 1W0KD 1MKXH 5CHAB 3ZVFA 1EPTA 5F8XA 1VR1H 4NFEA 4WH6A 3FP6E 2O8LA 4YT6H 5H3JA 1L6OA 2R4HA 2Y81A 1W14U 1V2LT 2JETB 4IMQA 2KOHA 1SLUB 1GDQA 1KMHB 4ISNA 5F67A 1V2PT 1V62A 4NWLA 2TGAA 1DSTA 1GBAA 4YXWD 1T8OA 2A31A 1ZGIA 3N99A 2PSYA 1QAUA 5EJLA 1E38B 2ANWA 1QFKH 4HGCA 4ZKSU 3S9BA 1WAYB 1GBIA 3T27A 2R2WU 4E7RG 2Q6GA 1RY4A 1G2LA 3QDZB 1VITH 4ABGA 3RXOA 1FAKH 1O2UA 5CDFE 4YZUA 1K1LA 1ANEA 2MHOA 1ZGVA 2NU0E 1P11E 2F9NA 2BDYA 1L0ZA 3DORA 4BAOB 4IGDA 2CSJA 2Q1JA 2DLUA 1D6WA 1LHDH 2ZFQH 1FY1A 1MTNC 1HXFH 2RCEA 3A8BA 4FUFA 1HFDA 1QB1A 1G2MA 3S7KB 4R0IA 4VGCC 1ZTJA 2BZAA 2Q6FA 2H9EH 3A80A 1C2EA 3EGKH 1DXPA 2AGIX 1OBYA 3GCOA 1OX1A 5A0CA 1PQAA 3RMNH 2KG2A 2E7KA 1C1TA 1P04A 4WH8A 1GCDA 3SU4A 1QY6A 4JJ3A 1AFQC 1YM0A 4JZEH 3EYDA 1YLCA 4NXPA 1GMCG 1GBJA 2BLVA 4RKOB 1Y5BT 1HAHH 2G81E 1KDQB 3E17A 1DOJA 4ISHH 1S5SA 3P8GA 2Q3GA 2WHXA 4DY7B 1BE9A 3UNQA 4I32A 5HEBA 4ASUD 2BD3A 1BTXA 5B42A 3QDOA 1O39A 4NZQA 3MQKC 1DWEH 1YGCH 1AFEH 1E34B 2GP9B 1O2HA 5GXPA 1W9EA 5JBAS 4H11A 2ZHEH 1GDUA 1O2YA 5HXFA 5GNDA 3UNRA 1CE5A 1UVTH 1M5ZA 1LCYA 1X5QA 3K6YA 2R9PA 4ACAA 1Z6JH 6CHAC 2ZU2A 3E0NB 2XNDD 1GJAB 3IWMA 3KEEA 5DP5A 1ZMLA 3GICB 4Y10E 2DE9A 1UEQA 2VH0A 2HPQH 4HFPB 1DITH 3SUZA 2PSXA 1UTKA 1SB1H 1QURH 3FZZA 1V5QA 3M37A 1C5LH 1SVPA 1EPTB 1HDTH 1RTLA 5E21A 3TVJB 2G4TA 3LH3A 1F7ZA 2FI3E 4GCHF 3SV6A 2PKSC 1NT1A 2Y5FA 4A1XA 1Y3VA 1RZXA 5GCHF 3RXPA 3T28A 1FN8A 1P2KA 1AWFH 2A45B 1NRRH 3F3BA 1JRSA 5B6OA 3PMJA 1FPHH 3SOSA 2KOJA 4X8VH 1THRH 3SUGA 4OS5A 4X2XA 1AUTC 5JBBS 2NWNA 1VA8A 2AERH 1QA0A 2WZQA 3ZVGA 2RG3A 3GISB 5DG6A 4NMVA 1CA8B 1A1RA 2F83A 3LGVA 1GI3A 1TBQH 1SKYE 2FOHA 1GJ4H 2ZGHA 4BANB 1K1NA 2NU2E 2P59A 2OZFA 1ZPBA 4Y8YA 2L4TA 2WUCA 3SZNA 2WPHS 1HAXB 4K8YA 4NWKA 4DGJA 2D8WA 3GSLA 1SLVB 4A1TA 5LPFA 4MPXA 1FLEE 3AXAA 2WINI 5DK1A 3HKIB 2EV8A 1E1RD 4AYYB 4Q80A 3GY8A 1TRNA 3PB1E 4QT8C 2L97A 1OWKA 3F2HA 4DCDA 1VCPA 1SHYA 2X7ZA 2H5CA 1LHFH 1FC9A 1SOTA 1G9IE 2K8IA 1MTNB 1AB9B 1BBRE 2WL7A 1EZSC 1W11U 1QLCA 2FOFA 3OFND 1UJDA 1TMBH 2Y5HA 1O3EA 4VGCB 2KYLA 1GDNA 4DIIH 3M35A 1X5RA 3NRLA 3URCA 2V7QD 5E22A 3AAVA 3BN9A 1OP8A 3F68H 3SNAA 5L30H 3ZZ4A 1QZ8A 4XE4A 1TNIA 2MX6A 1O2TA 3LNXA 3LH1A 4UFFH 1AU8A 1J14A 1GI9B 2AH4X 2OGPA 1LQDB 1C1PA 2BYGA 2EDVA 1UK4A 2VIQA 3P17H 3RXKA 3UQVA 2OQ5A 1C1WH 1Y5AT 4XDEA 3ATIA 1S82A 4NA9H 4ABJA 2ALPA 5HF1A 1K1JA 3IG6B 3KN2A 4XFQA 5GJ4B 1ESAA 4KGAA 1SPJA 1TNJA 3A8DA 1O2VA 2Q6DA 2WV5A 7KMEH 3B8JA 4JYTA 3RLYH 2YUYA 3ENSB 3QN7A 1W0YH 3MU4A 1RGRA 3SNDA 1FI8A 5L6NH 3F2FA 1SGFG 2A2QH 2BXUH 4H4FA 4H6TA 1LPGB 1NS3A 1HJAB 3MFJA 2ZDKA 2B5TB 2BDHA 4INLA 2I04A 1DS2E 4FUJA 2OK5A 3T29A 1F0RA 1WSSH 5D13A 1HAGE 2PKAB 4JL7A 3RC5A 2WPJS 1NBMD 5E11A 3STJA 2JIKA 1UJVA 1TPOA 3TITA 3DA9B 2V1WA 3WWFA 2VGCB 4XOJA 1L1GA 3A89A 1O2LA 2WYGA 2AS9A 2WV4A 3RU4D 1A0JA 5C67A 3FFGA 3SU2A 5FBEA 2FOCA 1SGTA 3HK6B 5HYOA 3C1KA 3TK5A 2Z9GA 2Z9LA 2ZU3A 1UK3A 1C1VH 1MMJN 2BHGA 1HAYB 3CC0A 3T26A 2CHAC 3SV9A 3V13A 4Q7YA 4DOQA 1D3TB 1Z7KA 2A4QA 2W5EA 4AGKA 2H2ZA 3HATH 5HKKD 2PKSB 1KTSB 3RC6A 5JPMH 5T6DA 5KGOA 2LP6A 4H42U 1QL7A 2RDLA 3M7TA 3I18A 1F5RA 1CHOG 2YNBA 4IMZA 1E0FD 1N6EA 4JJ0A 1NY22 1TABE 4GSOA 4KELA 2JREA 5HEYA 3GCHC 4B6EA 1TRYA 2ZPLA 4I7YH 1GI2A 4I8GA 4FUGA 4NMSA 1DLEA 1K22H 1WCZA 6LPRA 1XZ9A 2ZKSA 2QAAA 4UFDH 2F9OA 2JSNA 1T4UH 5E1YA 4FVBA 4E06H 1N1LA 1HAVA 2BQWB 2GMTC 2IJD1 3OEHD 3A84A 4BTTB 1Y7NA 2EC9H 4P00A 4E35A 4ABBA 2ZIQH 2GVFA 3LPRA 2OXSA 3U8RH 3DSGA 3SUFA 3Q76A 1WDIA 1QRXA 3KQBA 2KL1A 2XXLA 1OWHA 2M2AA 3VQFA 3QWCH 4ZUHA 3U98H 1TQ3A 4ZHMU 1T8NA 2K1QA 4KTCA 1VITF 3PDVA 4Q2KA 2M0VA 1H8HD 5EXMA 5ESTE 1FNIA 5CE1A 1BZXE 1QGFA 1T8LA 4LOYH 1TAWA 1C5SA 2A5IA 1Y3WA 2I0LA 2ZPQA 3KQ5A 5IK2D 1MKWK 2ZPMA 4Y8ZA 1ELEE 5K7RA 2Z17A 2GZ7A 1IQIA 1C1SA 2QXHA 5C0UA 1IHJA 4J2YB 2GZVA 2RFKC 2QKVA 1Z8IB 3K2UA 4NG9H 2OCSA 1A0LA 3GS9A 3UFAA 3NFKA 2YMSD 1TGNA 1SQAA 2VZ5A 1MAXA 5KEDA 1L1NA 1EAIA 3OSYA 3EE7A 4K1SA 1J9CH 2HRVA 3QTOH 1RXPA 4O97A 2J4IA 1GI0A 1GMDF 1H9IE 4I86A 4Y0ZE 2W3IA 5AHGH 4ISLA 3AASA 4OS4A 1MUEB 1QHRB 1C5NH 4UEHH 4FOUC 4JCNA 2ZGXH 1BIOA 1UO6A 4B2CA 4Y6DA 1UMAH 1QBNA 2H2BA 1TFXA 1NFXA 3MTYA 4TWWA 1F5KU 3A7YA 4KTSA 2PTNA 1FONA 4AB8A 1XUKA 3SV8A 3BTQE 1ARBA 2IWNA 5F53A 1XVOA 2ZZUH 1Y3XA 3UIRA 1VGCB 2H5DA 2QV1A 4ZAEA 1P10A 2AIPA 4B73A 4NFFA 1ZSKA 2F5YA 1GBDA 1YLNA 3BTWE 4WMDA 3KCGH 3SQEE 2ZDVH 2CJIA 1P2QA 1GJ9B 3GCTG 2CHAB 4NXQA 1DICA 4CH2B 3FVFB 4ABIA 1AIXH 4Z33A 5BRRE 3NK8A 2EEHA 5C1UA 3E1XB 4ZKRU 2XC5A 4BTIB 3FANA 1DY9A 5L2YH 2WPKS 2ZC9H 1O5DH 1UCYK 3QZRA 5EXNA 4B74A 4EDJA 1EZQA 2A7HA 2BVSH 3VB7A 3WKMA 4AZ2B 1G32B 4JORA 2FOMB 2ZGCA 1KLTA 4UD9H 1WF7A 5G4BA 1C9TA 4BAKB 1ZMNA 4LZ4B 2A0QB 3L6PA 4NNMA 4K2YA 2BOHB 2OTVA 1AI8H 1EUFA 4NMTA 4TWYA 3LGYA 1GBMA 2JIZD 3LIWA 4K8BA 3RUOA 1HAVB 2ZDNA 1GI4A 5EGMA 1TQ0B 3V7TA 2V3OH 3O8DA 3PWBA 1IQKA 1IQJA 1O3AA 1UITA 1ARCA 1SQRA 2GMTB 5L2ZH 3LT3A 1WV7H 5JBTA 1BHXF 3GGEA 1YYY1 2B0FA 3QIKA 2EDZA 4HZHA 5C5NA 1A7SA 4YYXA 2OBQA 3PRBA 2KPLA 1AY6H 1GBBA 3MU8A 1Z6EA 2F0AA 2GCHG 2XOKD 4AG1A 4U01A 2OMJA 2JH6D 2AYWA 5A8YA 3K1RA 2UUJB 1WHAA 2H9TH 4OGYA 4A1VA 2STAE 2TIOA 3MHWU 1O2GH 2ZHFH 2PW8H 1LKBA 2SNWA 1GI8B 2VVVA 1NRPH 1T32A 6GCHF 3KZDA 1TGTA 2QA9E 2WPIS 2PNTA 3WY8A 4DVAU 2UZCA 5HFFA 1KSNA 3HPMA 5C2ZA 1W10U 1YCPK 1OZIA 2FNEA 2KAIA 3G01A 1I92A 1IQLA 1PQ5A 2DUCA 1YPEH 3P8OA 4MPAA 1K9OE 3GABA 2BLWA 5HFCA 5HDYA 1DUAA 1HAZB 2CGAA 3M3VA 2BVXH 3AK5A 2KV8A 1UFXA 3LKWA 4PQWA 1BRCE 5T1VA 2D90A 1LVYA 4OM9A 1ZTLA 1MBMA 4U30A 1IU0A 3UREA 1TGSZ 4MQAA 2ZFPH 1AWHB 3SU1A 3BTKE 3RP2A 3TNSA 1ZHPA 3E91A 3KGPA 3SJIA 1ETRH 1MU8B 1PPHE 1YP9A 3V12A 3FO8D 1ZOMA 4ABAA 3JZ2B 1JIRA 3BEFB 3ODDA 2QE7D 1SQTA 2J38A 1KXCA 3UB0A 1C1MA 4M9FA 1F5LA 1MZDA 3IITA 4WVPE 1GVKB 1PPCE 2C4FH 4XBBA 3RXHA 4CR9A 2OQSA 2B7DH 1NF3C 4MPUA 4ASHA 2KJDA 1TMTH 2HVYB 4OS1A 1TB6H 3KF2A 2C90B 1QRWA 4XRNA 2A7JA 5E2PA 4CH8B 2DLSA 4G69A 4U2WA 3QGLA 3ZZ6A 1TOCB 5C0TA 1GQ5A 3SQHE 2VWLA 3BEIB 4YLUA 2OC1A 2HGTH 3K6ZA 2PDZA 3F0OA 3OTPA 1W12U 1GJ8B 2OUAA 4B2AA 1NC6A 4Z6AH 2CF9H 1GHBF 2JDID 1BHXB 1TX6A 1GJDB 3A85A 2FTLE 1BQYA 3QE1A 3KYGA 1BA8B 5A09A 1COWD 1YKTA 3SHWA 2K20A 2ASUB 1BMMH 1IU2A 4MG3A 1W7XH 2XWBI 2CN0H 1ELGA 1T8MA 2AIQA 3UNSA 4UFEH 2BQ7B 5LPEA 4UFGH 3BTGE 1TYNA 1SLWB 4ISIH 3SN8A 2GEFA 1RIWB 1BUIA 2ZGJA 2KCAA 3A88A 4Q63A 4SGBE 1UTQA 2KX4A 4Y0YE 1NRNH 2W3KA 3HGPA 2UUKB 4Y7BA 1TALA 4O3UA 3LGIA 5TCCA 4X0WU 2ZQ1A 2EGOA 2EJYA 4MTBA 2P3TB 1G3CA 1BT7A 5ILBA 1UVUH 1ZRBA 3OX7U 1WTGH 4JOHA 4Q2OA 2HNTE 4AFUA 3ITIA 1MD8A 1GCTB 4JYVH 1ETTH 3DIWA 2IWOA 4BNRA 1NTPA 1O5EH 4ZMAH 3F9HA 2ZU5A 2OINA 1O0DH 1A61H 2F9VA 5FCRA 5J4SA 2ZWLH 1FCFA 1CO7E 4YO9A 2YNAA 2FYRA 3MOCA 5DTHA 3M5MA 2KAIB 3LJOA 4FVDA 3RXTA 3RXUA 3WW7A 1GBCA 1RS0A 1CGHA 1B0FA 2WUBA 1K1MA 1Y3YA 2Y80A 2EI8A 3SJOA 2R3UA 4NIVA 4X2YA 5HIZA 1O3IA 1AQ7A 1TPAE 4YOIA 3VB3A 5DGJA 4WYUA 3ZIAD 2OC8A 1S85A 3LGUA 1SI5H 5DJ7A 2ZO3H 5HIYA 5A8XA 2O8MA 3RMMH 1O36A 3PV2A 4DIHH 3F9FA 3V0XA 2CXVA 3TJOA 1MTSA 2SGAA 4CBOA 2IOTA 2Y7ZA 4X6OA 2KCPA 4WMEA 5G1EA 1MFLA 4GCHG 3FZDA 4D8NA 4THNH 3VFEA 1Y8TA 3PLPA 3W95A 4K6YA 3STIA 1XUIA 1UW7A 2ZCKP 5GCHG 2G51A 2L74A 2LC7A 4MVNA 4X6PA 3T62A 8GCHF 3Q3KA 4R8TB 1H8ED 1YCPM 1NN6A 4MPVA 1PPBH 3SHAH 3CP7A 4BXSA 4N6XA 3SZEA 2DC2A 2QG1A 1FN6A 1K2I1 1MH0A 2F43B 3O8RA 1LO6A 3GCNA 1B5GH 2KCOA 2LUIA 3P6ZB 3A82A 3B23B 2DB5A 2ZHQH 1DWBH 2I4SA 1NU9A 2GV6A 4J1YA 2FE5A 1HJ8A 3EDXB 4DJZB 2J92A 3BTDE 4I8HA 2QF3A 3S69A 1CVWH 4UU5A 4AN7A 2ZFSA 1GVZA 4Y7AA 1HB0B 3GDSA 5JXBA 1GI6A 2KOMA 3DCLA 7GCHF 1AE8H 1O3OA 5C94A 1ZHRA 2P8OB 1GBHA 4HG6A 5G1DA 4HTCH 4JK5A 2HLDD 1HXEH 3U28C 1KTTB 3TGKE 3JXTA 2GTBA 1MCTA 3MNSA 4JZDH 1JBUH 3E8LA 1PQ8A 4ZKOU 2VIOA 4AORA 1O2PA 2EI7A 1NPMA 2G5VA 2P95A 1P09A 5TCAA 1O2RA 1WIFA 1C5TA 2HVXA 2ANKH 2PKAA 1LVMA 1V2KT 2P3UB 2AWUA 4YDPA 2G2LA 1N8OC 1VZQH 1OPHB 2C3SA 1SGCA 1F2SE 1IQHA 3NCVA 1JOUB 3O8CA 5EJ1A 1H1BA 2ZFTA 3WKLA 1ELCA 2GT7A 5SGAE 2BYAX 3P8FA 2G5NA 2EDPA 3SV7A 4AMHA 1BJVA 4P0CA 2ZPRA 2FTMA 3SJ9A 3I4WA 1VJAU 2Z94A 4XSKU 3TSVA 5JB8S 2F4LA 4ABHA 1PPFE 1DVAH 2VNTA 1P06A 2BDAA 2Z3EA 1KXEA 2Y5GA 3Q3XA 1Y59T 3SNEA 4TT3D 1MU6B 4RN6A 1XXFA 2VSVA 1TA6A 4FU7A 1C5MD 3TH2H 1SGIB 2CK3D 2ZI2H 1WI2A 3M5OA 3RM2H 1ZJKA 2ZCHP 2REYA 3K50A 4OS7A 3RXGA 3ZVDA 3ZZDA 1Z1JA 1CBWC 1PQ7A 4WJG2 3ZYDA 1A3EH 3KQCA 2QYIA 4D7FA 1S0RA 1B0EA 4D9RA 1DM4B 4RT0A 3SNBA 1MBQA 3O46A 1XUGA 5FPSA 2ZP0H 1XVMA 3BTTE 3DSPA 5HGGA 2QT5A 4K75A 5CMXH 1S6FA 1VB7A 1YBWA 3O8BA 2XNIA 4AC9A 3A7TA 1ZPCA 2ZF0H 2GGVB 1NROH 1RGQA 1F0TA 1H8DH 2K1ZA 1DLKB 1UHBA 1DT2A 4MNYA 2P3WA 1ZPZA 4UE7H 2W6JD 3LGWA 1BMFD 3E3TA 1SQOA 3UTUH 2FM2A 2GZ9A 1ZOKA 1GHAG 3H5CB 2V35A 4FUCA 5C3NA 1EOJA 1CT2E 1G36A 1MQ6A 1SGQE 1V2OT 5FPYA 2FX6A 3GYMA 2W7UA 1OWIA 1FJSA 1LPKB 1SMFE 5C1XA 5I25A 2PKUA 1MTWA 2BOKA 5E0JA 3DT0H 3UOPA 5K0HA 1UTMA 1UEZA 1WQVH 1MKXK 1C5VA 2FI4E 1LVOA 3CYYA 3CBZA 1AFQB 1S84A 5E2OA 2OPGA 1DXWA 1C5PA 3EAJA 1VCQA 5B6LA 1G30B 1HRTH 1NESE 2FP7B 2JH0D 5DSFA 1UEWA 3RMOH 1Z87A 2LPRA 3ID3A 3UR9A 3ZZ8A 2EEJA 2G55A 3P70B 3ZZ7A 1UCYH 1S0QA 1SSXA 1UTPA 3GY6A 5E8EH 4D76A 3KHFA 2RCZA 2BD4A 2J95A 2I1NA 1G3EA 1O38A 2BD7A 2CV3A 2AGGX 2OC7A 1W7GH 1P2MA 3E16B 3PV4A 5EPYA 4BTUB 1SG8B 2TGPZ 3DHKH 3RMLH 3EGGC 3R69A 1FV9A 1ORFA 2J2UA 2ODPA 3LGTA 1EFRD 4CRDA 1P03A 2W4FA 1O31A 4RT1A 3NGHA 3C27B 3TU7H 1DX5M 3PM3A 1GJ7B 4O9VA 6CHAB 2EXGA 2KAWA 3BTEE 2PLXA 3URDA 1SGRE 1HYLA 1KXDA 1VITG 4WF8A 1INCA 3CBXA 4FU9A 4X6MA 1N8OB 1B8QA 2BLOA 4Y76A 2BDCA 1D6RA 3TIUA 1OWJA 1UVOA 3SI4H 4YM9A 2ANMH 4WWYA 5DP6A 1EB1H 1C5QA 1QJ1B 5H4IB 5C17A 2P94A 4KTUA 1FC6A 1BTUA 2FPZA 2TRMA 3CS7A 3GY5A 3BTFE 3VGCC 3RC4A 4TY7A 1TMUH 3ZV8A 1P9SA 2SGPE 3GDVA 1S6HA 4KFWA 3RLWH 2JILA 4Q7ZA 1BDAA 4U32A 1G37A 1Y3UA 3N7DA 3AW1A 3W1EA 2XC0A 4AB9A 2IWPA 1W0ZU 3QJMA 3D23A 3SFJA 1HPGA 1PYTD 7LPRA 1XX9A 1GMDG 3UR6A 1NZQH 2ZCLP 2ZECA 1GBTA 1TNGA 2VWRA 2PP6A 1BBRK 1OXGA 1XM1A 2JJ2D 3F9GA 1ANDA 3MH7A 1A0HB 5EXLA 2PUXB 4NIWA 1TP3A 2EY4C 1N7FA 1MTUA 4OS6A 2ZDMA 2XC4A 2H6MA 3L3TA 3PMAB 3FP7E 1HLTH 2D26C 1EAUA 5A2PA 5LPRA 1HUTH 1ZUBA 3FP8E 5EG4A 5JDUB 1UHBB 1B7XB 2M3MA 1U39A 3KHVA 4IW4E 3F6UH 1LDTT 1GG6C 2XBYA 5JBCS 5HF4A 1A2CH 2PKTA 3HPTB 1OBXA 3UPEA 3VB5A 1R6JA 2A4OA 2O8WA 3RDZA 3KZEA 4AFZA 1G3DA 2KQFA 3E0PB 2XRCA 1OWDA 2R2MB 4JOPA 2P3FH 1O37A 4FUHA 2FS9A 2KBSA 1IQFA 1P05A 5DO4H 1N7EA 3HGNA 1GBKA 4P02A 1Q3PA 2A32A 1UTLM 4D9QA 5IYTA 5EQRA 1EP6A 3ZZAA 4ZKNU 4RI0A 2PWXA 1N6YA 3TPIZ 1YPLH 3MWIU 5CHBA 2FMJA 4K69A 3T25A 1W8BH 1E37B 3R3GB 1O2SA 3LDXH 1AZ8A 1JWTA 3PTNA 2BD8A 3PDZA 3R68A 3MNCA 2C8YB 1F92A 2M10A 2JJ1D 2DM8A 5HJ1A 1LHCH 1VAEA 4X1SU 3VB4A 2ODQA 1GBLA 2P16A 1D3PB 4WY3A 5GWZA 1UVSH 2GDDA 1O5GH 4NCYA 1N99A 3VQGA 4B75A 1NFWA 2BXTH 1ZSLA 4INHA 2WSSD 1E79D 1DWDH 3ODFA 2BD5A 5E0HA 1GL1A 4IC6A 1X45A 5FCKA 1GBEA 1TIOA 3TJNA 1YBOA 5ETXA 3U1JB 1P1DA 1ZMJA 2AEIH 1JXPA 3MU1A 3A8AA 4K76A 1KXFA 3M5NA 1WYKA 1FZZA 1DUEA 3ZZ3A 1EXFA 1OYTH 1CSOE 3U1IB 3I1EA 1GJ6A 3EA8A 2KR7A 1ZHMA 1DWCH 2EEGA 1V2NT 3QGJA 6GCHG 4F49A 2M0ZA 4GLYA 2BDBA 1V1TA 1KXBA 4WMFA 2FN5A 2VVUA 2F3CE 2LA8A 3FN8A 1ESBA 3LOXA 3N7OA 3VGCB 2EEKA 2GCTC 4XBDA 2O2TA 8KME2 2H1UA 2XCFA 3SHCH 1NRSH 3K65B 2J9NA 2ZTXA 2GJGA 2FESH 3MO6A 4K5ZA 4HI3A 4E05H 1FAXA 2AHME 3BG4C 4BXWA 4OEPA 1N6DA 3GCHB 1QNJA 2Y7XA 4MNWA 4CHAC 4LXBH 2RDEA 1MCVA 2OC0A 2BMGB 1XUFA 1GJBB 4PROA 2WPDD 3UQOA 1YPGH 1QB6A 1P57B 3MU5A 1P2IA 1BTYA 1YPHC 1VCWA 2YTWA 1UK2A 2KPKA 4IC5A 4D7GA 1P01A 3DUXH 1AGJA 1SHHB 3ZYEA 3A81A 3I77A 3Q77A 4UONA 1U3BA 2H3MA 1H9HE 3RXRA 4O03A 2SFAA 1WJLA 4WXIA 2VBCA 1BJUA 3SU0A 2IPHA 3ZZ5A 3SUEA 1HV7A 3M7UA 4F55A 2AINA 5IDKA 2AGEX 4NNLA 1HAIH 2TPIZ 1SFIA 3MNBA 3T5FH 1DANH 1C5OH 4LMMA 1D3DB 2KZ4A 2PFEA 1BMAA 2DJTA 5KECA 1Z8JB 4GHQA 1SFQB 3OEED 2OBOA 3EA7A 5CHAC 1RGWA 2CF8H 2ZHWH 2BM2A 1RRKA 5HFEA 3ELAH 4E34A 2G52A 1WF8A 2AMQA 3QUMP 1L4ZA 4TY6A 4NMQA 1P3CA 4ZHAA 1HIAA 4IS5A 5PTPA 2IN2A 4MLFB 1F0SA 1EOLA 4Z0KA 4ABDA 1X8SA 3SORA 1O3MA 3RL8A 1BRUP 1C4Y2 4Q3HA 1EZUC 3MO3A 1HBTH 1XUHA 1CGJE 3P8NA 3GDUA 1O2WA 2QF5A 5HM9A 3MH6A 2OP9A 1IQNA 3SGAE 5HMAA 1O2QA 2A5KA 2O8TA 5HM2A 3VXEH 5FB8C 4ACBA 3KQEA 8LPRA 4JOEA 3DFLA 1TNLA 1FX0B 4AX9H 1KEFA 1GHVH 1AD8H 4ZHLU 1OOKB 2DKRA 1BFEA 1RTFB 3H7TA 1O34A 1ZTKA 1C5RA 2DMZA 3UWIA 1PJPA 1YPMH 2NU1E
chains in the Genus database with same CATH topology
1C5WB 5DP8A 5LGOA 1AE5A 4I8JA 3UUZA 1IQMA 1T7CA 1U37A 2A1DB 1O3KA 1SR5C 2QGRA 2J34A 4NA7A 1C2MA 2ODYB 4YTAA 1GHXH 1Q7XA 1HAPH 3K82A 1TBZH 2FWWA 4NA8A 3RXFA 2VINA 1O3HA 1O2XA 2HALA 4JOKA 2VH6A 1JRTA 2V0BA 3KDKA 2QIQA 3U9AH 3KDGA 1TGCA 4CRBA 1FPCH 1BB0B 2RA0A 5EQQA 1GBFA 4AGJA 3TLOA 2ZGBH 2GCTB 1K1IA 1YPJH 2DE8A 3EA9A 5F8TA 2G5MB 3EE0B 1X9ZA 1LVBA 2VIDA 3RXCA 1TX8A 1UF1A 2CMYA 2GCHF 3PMHB 1DE7H 1GM1A 3BG4B 1V3XA 4SGAE 1YLDA 3SOEA 1FMGA 4CHAB 3MYWA 1QQUA 1SGYE 5F6MA 1TPSA 2ZU1A 1EJAA 1HAOH 2FX4A 1TPPA 1L1JA 2HE4A 1FXYA 1HNEE 1LKAA 5F8ZA 2M0TA 2G00A 1QB9A 3SU3A 4ABFA 8GCHG 2JOAA 3S0NA 1UEPA 1PPEE 4Y79A 4HOPA 2ILNA 2GZ8A 1NFUA 1GHZA 2JH5D 4ZXXH 1W3CA 1O33A 3QX5H 4FU8A 4B2BA 2BY7X 2XW9A 5EYZA 3HPKA 1THSH 3OY5U 1C2DA 1OWEA 1AZZA 5I7ZA 2XBXA 5C5OA 1N6FA 4GPGA 4Y8XA 1V2WT 1X7AC 4FUEA 2OCVB 1S81A 4GUXA 4X1PU 1SLXB 4ZXYH 1HIAB 1C2KA 2LC6A 1KXAA 1L4DA 3BEUA 5C1YA 3QGNB 3A87A 3NWUA 1BTHH 5HFDA 1QBOA 3RXLA 2JWEA 2W26A 4ABEA 2VPHA 2VB0A 3GY3A 4NGAH 3NUMA 5EU8A 5AFZH 5F03A 1SL3A 1GWAA 5JYIA 2HGAA 1P1EA 2QBWA 1IHTH 1ACBE 2EGKA 1J15A 3ZVCA 1O2JA 1TBRH 2O9QA 3TH4H 4NZLA 1OS8A 1EJNA 4I8KA 2D2DA 1ABIH 4RSPA 4IN2A 2Z9KA 3B76A 1IHSH 1O3DA 5TJXA 1O3FA 1P8VC 1GVLA 3AW0A 3VEQB 1ZZZA 2OQUA 4YOGA 1O2IA 1Q31A 1GMHF 2G4UA 1JMOH 3MI4A 4FXGH 3SJKA 4KP0A 1C1RA 4H6SB 1P3EA 2H3LA 2I6QA 4X2VA 5DP4A 1SGNE 1ETSH 3MH4A 1OSSA 1Z86A 1QL9A 4AFQA 1SGEE 1AB9C 2EGNA 3TK6A 2FXRA 4DG4A 4FUIA 2PUQH 2PHBA 1SBWA 1YC0A 1K28D 2ZTYA 2AMDA 4B76A 2GX4A 1V2UT 2LNCA 2ZFFH 3K9XB 1O5FH 4ZROA 1C1QA 1SGDE 1GJ5H 5FHTA 4CRGA 1C5ZB 3TSWA 3ATKA 3SUDA 1D5GA 3Q00A 3M7QA 1XMNB 2RRMA 5HEDA 2I6SA 2QC2A 1G9OA 1AO5A 4Q2NA 4Y11E 5C20A 2GD4B 4AYVB 4NSYA 1BBRH 1OP0A 1I16A 9LPRA 1CA0C 2PV9B 3PTBA 3SU6A 2XWAA 1P2OA 1BOQA 2BY9X 9ESTA 1C9PA 4MNXA 4YT7H 2OS6A 3A8CA 1P9UA 3RM0H 1UTNA 3A7ZA 2BLQA 4Q6HA 1HCGA 4X8UH 1HJAC 4B1TA 4CRFA 2VWOA 3CH8A 4K1TA 1EJMA 4E7NA 3ATLA 2UWOA 2ULLA 1YF4A 2VIPA 4HOPB 1A4WH 1VJ9U 3SO3A 4K78A 2Z7FE 1AHTH 1ELFA 2DAZA 4NMOA 1C2HA 1D9IA 2VGCC 3W94A 2PZDA 3BIUH 1TE0A 4ESTE 4I31A 1O5AB 2IWQA 3DJAA 1QRZA 1V2ST 1NFYA 2HPPH 1MKWH 4A7IB 2VWMA 3M3TA </