3GDSA

Crystal structure of degs h198p/d320a mutant modified by dfp in complex with dnrdgnvyyf peptide
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
317
structure length
295
Chain Sequence
DSTDETPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINPGNGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREQGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMAQVAEIRPGSVIPVVVTLQVTIQEYPAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease degS
publication title OMP peptides activate the DegS stress-sensor protease by a relief of inhibition mechanism.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase activator
total genus 58
structure length 295
sequence length 317
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3gdsA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gdsA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gdsA01
1SLXB 1GL1A 1XXDA 2J38A 1UEQA 4BAKB 1GI2A 3D49H 5IDKA 1K1JA 2FOCA 4JOFA 9LPRA 4O9VA 1ANEA 3T26A 5AFZH 1XM1A 2XC0A 3ZZ3A 2ZGXH 5A0CA 1W2KH 1U3BA 3BTWE 2CF8H 2J92A 1LCYA 1HV7A 2QV1A 1O2GH 2R0LA 2DLUA 1NY22 3LJJA 4F8KA 3BTGE 2W26A 4WWYA 2A4QA 4BTTB 5HEDA 3QGLA 1DM4B 2OUAA 1GBMA 2MX6A 4J1YA 2DM8A 1ESTA 1O2TA 2R0KA 3M5NA 4AGKA 4Z0KA 2O8LA 1Q3OA 4GHTA 1EB1H 2PTNA 1B5GH 1BMAA 1Z7KA 3KZEA 3LU9B 1C2KA 2FZZA 3S0NA 4MNWA 1SGFG 4WMEA 1NRQH 1ZMNA 4Y10E 4CR5A 3GSLA 2BX3A 4I8GA 4X8SH 3RXIA 4HFPB 1O2HA 2P3TB 3RXFA 5A0BA 2WPHS 1LHDH 1LVBA 4GLYA 4CRBA 2FDAA 1ZTJA 1XUGA 3BIUH 2F9VA 2PTCE 1VJ6A 1BTXA 1QNJA 2Z9JA 1T8OA 5GPIB 1RS0A 4B75A 1V2JT 1ELCA 2KYLA 4FUGA 1LMWB 3NFLA 2W5EA 2AH4X 3E91A 2HVXA 3RU4D 1L1JA 3EA8A 4K69A 3RU4E 1W14U 3V7TA 2UUJB 5F8TA 1KEFA 1EATA 2C3SA 1AD8H 3AASA 3QX5H 4K76A 1O30A 1QURH 5LPFA 2BXUH 1IQHA 1ZLRA 2IPHA 5E11A 3ZZAA 1HAVA 2KA9A 5F3XA 1SGIB 5A8XA 2PZDA 1GHAF 1S83A 1GMDF 1UEWA 4JL7A 2F9PA 3SNDA 4Y76A 2G2LA 2FI4E 5FCKA 1BT7A 2CSJA 2IWNA 1FMGA 1VCQA 4I32A 3ID4A 1CBWB 1BRAA 1BTYA 1Y3WA 5HJ1A 3BSQA 2G81E 2REYA 4IGDA 1UK2A 4ABAA 1F7ZA 2JREA 1SR5C 3SJ8A 2M0ZA 3SNAA 1E38B 2LUIA 1S82A 1YPKH 3EGKH 3M5OA 4JZFH 2BLOA 2A32A 2XXLA 1BMNH 1RY4A 2JKHA 1T31A 2QYIA 3R69A 1SHYA 2GCTB 3A7TA 2R2MB 2XWBI 4FVBA 1GBFA 4ASHA 3IITA 1PPCE 1Q3PA 1AFQC 1SGTA 3M7QA 1GG6C 1D3TB 5EXNA 2AINA 3ID3A 3A7ZA 3C27B 3ZVFA 3I29A 3A88A 4GCHF 1TPOA 1T2MA 1FY4A 3GY8A 4X2YA 4N6XA 1SLVB 2BQ7B 1LVYA 4UFDH 1P12E 3STIA 4Q2PA 3SNEA 3BV9B 2BDAA 3MNXA 1UHPA 2PV9B 1GM1A 2FS8A 3CS7A 7KMEH 5B6OA 3I77A 4ZXYH 2CSSA 2YT8A 1I92A 4DIIH 1LPKB 1QGFA 1ZMJA 3VPKA 1SLUB 1P3CA 4KGAA 3A7WA 1KXCA 2GTBA 2K20A 3QN7A 3ZVEA 1IQEA 4AMHA 5EQSA 2ZQ2A 3SU4A 4E7NA 4CR9A 4TY7A 1V1TA 2M0TA 5HFFA 1BTZA 5GLJA 1QJ6B 2I6SA 5ESBA 2D90A 1K1LA 5JDUB 3ZVBA 2OQ5A 2QCYA 2O8MA 3SJKA 2Y5GA 2OCSA 2ZHFH 3MOCA 3ZZ4A 1BE9A 1O3JA 2P94A 1A5HA 4DIHH 1MQ5A 3DJ1A 2OC7A 2G5MB 3QWCH 4D7FA 1T32A 3RXTA 1HBTH 1TWXB 1UTOA 3AW0A 3GISB 2THFB 4ISOA 5I25A 4FUBA 1DS2E 3UNQA 5EQRA 1BITA 4LOYH 1H9HE 2B0FA 3ZZ5A 1NTPA 2D92A 1O2WA 4NIXA 1WQVH 1YPGH 3KZDA 2K1QA 1YPJH 2H9HA 1P2MA 2YNBA 2VVVA 2CV3A 3JZ2B 1DUAA 5CHAC 1ZZZA 2QG1A 4Q7XA 5SGAE 1V2PT 3SU2A 4YLUA 3E0PB 1P06A 5K7RA 1GI3A 1C5RA 2P3WA 3RM0H 2GZVA 4MNVA 2P16A 4NWLA 2TGTA 1RD3B 2UZCA 1ORFA 1QBVH 3U1IB 2LOBA 3PV4A 2BLQA 4NFEA 1ANBA 4THNH 2QY0B 1THRH 2ODYB 4RKOB 1UVOA 3FY5A 2TRMA 1C5WB 3TH2H 1ESBA 1W11U 4WYUA 3ZZ9A 1CT0E 2V0BA 1LHEH 1ZR0A 1JBUH 3H7TA 2PKAB 1GBEA 5LPRA 3S7HB 1THSH 1P01A 3PWBA 3W95A 4BAOB 1MAXA 1O2OA 2JH6D 3M3TA 2ZP0H 1GBHA 1O2XA 1KXFA 2ZEBA 3IWMA 1GI8B 4ISNA 1WU1A 2EI7A 1N7TA 2HOBA 3TMHA 4K1EA 1ABIH 3BEUA 3O8BA 4NMPA 3ATIA 2A5IA 2JH0D 1D5GA 1GG6B 1C1PA 3ZZ6A 1SGQE 2KL1A 1HPGA 3RXQA 2ZQ1A 3LGTA 2BQWB 3VGCC 5FAHA 4Q6SA 1BB0B 1V62A 3LDXH 1MFLA 1K1NA 2GT7A 3ATKA 3BTKE 1TRNA 1O2LA 3KHFA 3QIKA 1JRTA 1QB9A 1GJBB 5C5OA 1FCFA 1QRWA 1SI5H 3MU1A 2BZ6H 2NU1E 1T8MA 2LA8A 5E0HA 2VINA 4GUXA 1Z1JA 2D26C 1SOZA 1NN6A 1EAUA 1EXFA 4KTCA 1TGCA 1DLEA 4KFWA 3R68A 1YP9A 4X2WA 1C5MD 1GI0A 1ELFA 2ENOA 3GGEA 1GHBF 2I1NA 1A5GH 2FESH 3ATWA 3RXMA 4K3JA 1EPTC 2QA9E 3RLWH 1W0ZU 1SOTA 4X1NU 2OLGA 1Y3UA 3F9HA 2RCEA 1D3PB 2BHGA 4ABEA 2BDYA 3RXBA 1A0LA 4X2VA 1WFVA 1UF1A 3BTHE 3Q3KA 2YOLA 2P8OC 1C5TA 1HAOH 2FE5A 2R2WU 4O97A 1XUKA 4ZXXH 2O8TA 2AYWA 1LHGH 3URDA 4DVAU 3UUZA 8GCHF 4MPXA 1AU8A 1O3BA 1QBOA 3P92A 3S9AA 1TAWA 3TJNA 5GCHG 4NXRA 1ZHMA 3IG6B 1FLEE 1NFXA 3SHAH 2OBQA 2ZHDA 3GDUA 1GJ8B 5EOKA 2GMTC 1Z8GA 3PB1E 2FCFA 1TOCB 2WPMS 3LH1A 3A81A 1IHSH 4E7RG 1G2LA 4YM9A 5CHAB 1TRMA 2ILNA 1DITH 5C3NA 1A61H 2G5VA 3AW1A 1O5AB 2OS6A 1IHJA 1CVWH 2CGAA 4AB9A 1O2JA 4WMFA 3A86A 1DX5M 1SMFE 1WTGH 1OWJA 1XKAC 2ANMH 3UY9A 2W3IA 4UE7H 4NIYA 1EX3A 3SGQE 2EEIA 1P2QA 4YOJA 2VNTA 1WHDA 1GCTC 1RTLA 1EAIA 1WG6A 1S81A 4U01A 3L6PA 1FXYA 1TMTH 5HF1A 2JETC 1GPZA 1IQIA 1KDQA 3SHWA 1MD7A 2B5TB 2IOTA 1SLWB 3BTDE 2I6VA 3OU0A 1GHYH 1MQ6A 1FN6A 1L4ZA 1BA8B 1LKAA 3NWUA 3Q3XA 5E2PA 1Z8RA 1J14A 2XTTB 2KOMA 3GJ9A 2GVFA 3D23A 4H4FA 4JYTA 4B74A 1TGBA 4NMTA 1VJAU 1UTLM 1D6RA 4GHQA 3SGAE 1SGEE 3P70B 1V2TT 3SV2H 1IQFA 3NGHA 2BZAA 2DE8A 4XHVA 1NFUA 1C5QA 1MFGA 1WI2A 1XVMA 1ZTLA 2AERH 2V90A 3VXEH 1MH0A 4XDEA 4JZDH 1X8SA 1O34A 3VGCB 1HAHH 2HE4A 1YLCA 1AE8H 2ZCKP 5GJ4B 5C1UA 5EW2H 1V5LA 2STBE 2AIPA 3JZ1B 3SU0A 1KXDA 4QT8C 1GHAG 1GMDG 1WF8A 3TGJE 4OAJA 3UFAA 4LZ1H 1OKXA 4K78A 2KAIA 1UEZA 4O06A 3DJAA 2RDLA 1MU6B 2QT5A 4Y7BA 2QN5T 1TRYA 1GJ5H 1ETSH 3UREA 1BOQA 1OP2A 2ZPMA 1MKWH 2Y80A 3WKLA 4XBDA 5HGGA 1TNGA 4BTUB 3CBYA 2WV5A 1PQ7A 1TPPA 2VVUA 4Y0ZE 1QL8A 4JK5A 3DORA 3JXTA 4YOGA 3BG8A 1C1RA 1EPTB 3PROA 1X5RA 5EGMA 1FJSA 4BANB 3EYDA 1BIOA 5J4SA 5EW1H 1QTFA 1TGSZ 4B2AA 3TVJB 3MH7A 1EP6A 3AVZA 4XBCA 3VB7A 1O3LA 2ZFFH 1PPHE 3LH3A 3ZYDA 1H4WA 3K6ZA 1HJAC 2P8OB 1UTJA 1GMCF 1E35B 1L4DA 2H6MA 3KIDU 2GZ7A 1C1VH 1C5SA 1KYNA 1C2GA 2BVSH 2OPGA 5J4QA 5B6LA 1HJ8A 1IQJA 1TA2A 4DY7B 5FX5A 1K1OA 3MU8A 3S7KB 1DWCH 2WYGA 1AN1E 2GMTB 6LPRA 3L33A 4YZUA 4AN7A 5EXMA 4FXGH 1U39A 2VIDA 4FGMA 3FP6E 2H9TH 3GY7A 1K1MA 1DUEA 3KF2A 3VB6A 2ZZUH 1UJUA 2BD5A 1B8QA 1MCTA 1PYTD 4DT7B 2F9UA 1D9IA 1FY1A 2BYAX 1C5PA 3ITIA 2I0IA 2BLWA 3GY6A 4U32A 1P2JA 4KTSA 4HTCH 1J15A 2XYAA 3SQEE 1UVUH 1RGWA 3SOEA 1O36A 4A1VA 1GCTB 1SGYE 3SOSA 1FC7A 2WPKS 2O8UA 4GVUA 2JETB 1V2MT 1TBZH 1U6QA 4I7YH 1HAYB 1K9OE 1K1IA 1DPOA 1O3IA 3TSWA 1IQMA 1SGNE 1WJLA 4E34A 1ZPZA 2QKTA 2BY9X 4VGCC 1EP5A 4K5ZA 3LGVA 1QLCA 1OSSA 2STAE 3BEIB 5A2PA 3BF6H 4UFFH 3OTPA 4AYVB 2BB4A 1UTPA 2AMDA 2ZFQH 2XBWA 3HGPA 2BD9A 1ARBA 4DJZB 4MPWA 3BG4C 2B7DH 5FXLA 4Y11E 1ETTH 1GBKA 5AF9H 1QJ7B 2H1UA 4NWKA 4P0CA 2YUYA 3RC4A 2PR3A 2P3FH 3EA7A 3SFJA 2ESTE 2EI6A 1QL9A 3GCHC 1S0QA 4MNYA 5FX6A 1CA8B 3SV6A 3UOUA 2PHBA 3M7UA 4O03A 2Q6DA 3KHVA 2CN0H 1F5KU 4F49A 2V3OH 2EXGA 4WJG2 5JBAS 1GJ7B 4B71A 1AZ8A 1UHBA 1TYNA 3PS4A 1AUJA 1X7AC 2BQ6B 3B9FH 3RXUA 1W9QA 1BTWA 1N6YA 1UCYK 2Y81A 2BD7A 5FPYA 4G69A 4GVCA 3K65B 2OC8A 3T62A 2Z3EA 1XUJA 4Y8XA 1FPHH 3FP7E 2R3UA 4JYVH 1JOUB 1OBZA 1DY8A 1HJAB 1K1PA 3WY8A 2EEKA 1TABE 4ZHMU 3LGUA 2D8IA 3L4FD 2QKVA 1HLTH 1AWHB 3V3MA 4FUHA 5A09A 2WPIS 3MFJA 4D76A 2Q6GA 4SGBE 1EUFA 4IN2A 2O2TA 3QTVH 1G9IE 2Y7ZA 1HB0B 1H9LB 3ZVAA 2LC7A 4UDWH 1AQ7A 2BY8X 1OX1A 3ATMA 3STJA 1OWKA 1UJVA 1SG8B 2Z9IA 3VFEA 4B73A 1GJDB 2QBWA 1SSXA 1L0ZA 2TIOA 1X6DA 1LVOA 1O5GH 4I8HA 5GCHF 1GHBG 3SBKA 1FC9A 2DUCA 3M37A 3PLBA 3S9BA 1YCPH 3EDXB 1DWBH 2TGPZ 4ESTE 3ZZ7A 5A0AE 4X1RU 4JOEA 3VQGA 4CBNA 3RC6A 1WH1A 1O2ZA 1DDJA 1WUNH 4RN6A 2EC9H 4NFFA 1WQSA 4X6NA 3SUEA 1GVKB 3R0FA 1WAYB 4X1SU 4H42U 1WI4A 1N99A 2AGIX 5C5NA 1QB1A 2WUCA 8GCHG 1C1SA 5E8EH 4UU5A 3GDVA 5F03A 2WUBA 1OWEA 1YBOA 1C2FA 5TJXA 3S69A 1W0YH 1S5SA 2TBSA 3MI4A 3UNSA 1Z8IB 1OYTH 1L1GA 2H5DA 2QXJA 1UCYH 2ZDNA 2A2XH 1SGRE 1ZHRA 4ZKRU 1TX7A 3GCNA 1QAUA 1EKBB 1TMUH 2FOHA 5GIBA 1C4U2 1BBRK 2KBSA 1F0TA 4OEPA 2KJPA 1O39A 3GYLB 4TWWA 2V35A 1C5UA 4Q2KA 1DT2A 4Y71A 2WPLS 1TP5A 4OS4A 1O5DH 5CMXH 1LHCH 1FPCH 2Q9VA 5E6PB 1AFEH 1NC6A 2VGCC 1TP3A 1L1NA 1P2IA 3BG4B 4CHAC 1RXPA 1CT4E 2SGPE 1O3OA 1WV7H 1P11E 3LGIA 4DGJA 3SV8A 5DJ7A 4ABHA 2Y6TA 1T7CA 2L97A 1NU9A 2VIVA 3GCHB 4ISIH 2PKSC 4KELA 4FU8A 3PDVA 3DT0H 2ZU5A 3TGKE 1HIAA 5JBTA 2FODA 3TJOA 5FPSA 1HUTH 1GBAA 4INKA 4CRCA 4OS5A 4CRFA 1O5CB 4KKDA 4BAMB 1O2NA 2OC1A 1PDRA 2EGKA 5HM9A 1L2EA 1O5BB 2VZ5A 1D3QB 1QCPA 2Z9LA 1TA6A 2ZC9H 3BTME 1Y3XA 3HATH 2AEIH 1P1DA 2NU2E 4AFSA 3GOVB 3HK6B 2Y5FA 1GJ9B 3A8BA 1VB7A 1ZOKA 1LDTT 4GVDA 2QKUA 4JOJA 5EU8A 2OMJA 1ELVA 2OINA 5HXFA 3RXHA 2FIRH 3U69H 1NPMA 4FUEA 1GI4A 5A8YA 3MNBA 1O3MA 5EYZA 1CGIE 1UMAH 1VCWA 1RIWC 2ZU1A 3SGBE 1BBRH 3SU5A 1C9PA 2O8WA 3HPMA 2I6QA 4I8LA 5DP9A 1M5ZA 5E21A 2W3KA 6GCHF 2HWLB 5AHGH 5E1YA 3SUDA 1M9UA 1UTNA 2ZTXA 1C1OA 1I16A 1K21H 2FYRA 1QIXB 4YTAA 1FIZA 4ABDA 1ABJH 4YYXA 3GY4A 1RGQA 3KEEA 1EZXC 4GAWA 4JZIA 4X1PU 1RTKA 1SVPA 1UK3A 3HK3B 2ZDLA 4NMVA 1FQ3A 1N1LA 1D4PB 1UTKA 3K82A 2G8TA 1DLKB 1GMCG 2ZFRH 4ABIA 2DKRA 3GCOA 2VWLA 1DSUA 1EJMA 4MVNA 2PDZA 2EI8A 3KNXA 4CH8B 5L30H 4WMDA 4I31A 1IQLA 3LNYA 5BRRE 2QC2A 3PLPA 1S85A 4YESB 3ID2A 3I4WA 3PTBA 1YPMH 2FOGA 5F67A 1UEPA 2PGQB 1WBGB 4IN1A 3T25A 2SGDE 3DFJA 3UQOA 4Q80A 1ZUBA 3ZVCA 2FXRA 3E6PH 1VZQH 1NRSH 1Q2WA 1FZZA 3ODFA 2FLRH 2BX4A 3ZZBA 1YGCH 4I8JA 4AFUA 5FPTA 2QXHA 3WKMA 3RXSA 1O2PA 2AGGX 2OP9A 1N7EA 3M5LA 4FU9A 4Y7AA 2VGCB 4ZKOU 2ANKH 4CHAB 1KLIH 4MG3A 3SQHE 2ZO3H 5AFYH 3UPEA 4Y79A 2EEGA 4ZHLU 4Q2QA 1Z1IA 4AORA 1O35A 2C4FH 1C1NA 2M0UA 3SJ9A 2PKSB 1O32A 1RZXA 5FBEA 1P57B 2RG3A 1GHVH 3Q77A 8LPRA 2EGNA 1FAKH 3PV5A 1GVLA 1NO9H 2C8XB 5A2MH 4ISLA 4BTIB 2FYQA 3RXRA 1YYY1 4K6YA 1SFQB 3PO1C 2Z6BD 3ENSB 2XNIA 1MTNC 3PYHA 1MD8A 2BD2A 1FY3A 2ZPQA 1MMJN 1O0DH 2ASUB 1B0FA 4HOPB 1EOJA 5GXPA 1LTOA 4Z33A 4MQAA 4K1TA 1C1UH 2UWOA 2FPZA 2ZU2A 2R4HA 3QJMA 4Y0YE 1GQ4A 2CS5A 4UU6A 4NXPA 1FONA 1XUIA 2Z9GA 4NNMA 2J94A 3LGYA 1V2QT 2SNWA 1AFQB 5E2OA 2F0AA 2NU0E 2MHOA 3E1XB 1EB2A 2A31A 1A2CH 5E0JA 3LT3A 1P9SA 3A8AA 2JXOA 3UR6A 1O3AA 2C93B 2FI5E 2M10A 1Q31A 3M7TA 1AKSB 1OBYA 5HDYA 2A7CA 3ZVGA 2EA3A 1RIWB 2XBYA 1ZJDA 1K22H 2B9LA 4OS6A 1E34B 2RA3A 1Y59T 4IW4E 1VAEA 2OBOA 1NT1A 1NFWA 3TPIZ 4YOIA 3MO3A 4WH6A 5CE1A 2GZ8A 4MPAA 3F68H 3RXJA 2R3YA 3A7VA 1OS8A 2ZECA 1BHXF 8ESTE 4E05H 1A7SA 3F9EA 4H11A 2SGFE 5G1EA 2CXVA 3DFLA 3BIVH 3OSYA 2ZCLP 4CRDA 3A7XA 1LO6A 2Q1JA 5EXLA 2TPIZ 3M5MA 2X7ZA 3RXDA 5I46H 2DJTA 5E22A 4IBLH 5IYTA 3DJ3A 1Y7NA 2EHRA 2A0QB 1G3CA 1P8VC 4AG2A 3MO6A 4NG9H 2DB5A 3RL8A 3RXPA 2KRGA 3QLPH 1MTUA 2KJDA 1P09A 3R3GB 2BXTH 3FZDA 4BNRA 1ZMLA 2ZFPH 4NA9H 4NXQA 2HALA 2AMQA 1QAVB 1DOJA 2A45B 2AFQB 2KPLA 4BOHA 5JB9S 3RXEA 1OBXA 4JORA 2QF3A 1BRCE 4LXBH 1AIXH 1E37B 3PDZA 3K2UA 2ZU3A 1YPHC 1QR3E 1GBDA 2VWNA 4J2YB 4ABBA 1H1BA 3MTYA 1G32B 2IJOB 3QZQA 5GDSH 2BVXH 1MKXK 4D8NA 1AZZA 2IWPA 5EZ0A 1ZSLA 3SI4H 1KXBA 1S84A 1W8BH 2W7RA 4CRGA 2BDCA 1C5YB 4Q2NA 4JOGA 1W12U 3TU7H 1IU0A 4Y6DA 3E3TA 1V6DA 3KQCA 3ZZCA 2EDZA 2FWWA 1VITF 4KTUA 4IS5A 4NMRA 3TH3H 1LKBA 5ESTE 1UTQA 3L3TA 3ATLA 4X2XA 4FUJA 4E35A 3QDOA 1YPHE 3OY6U 1C2EA 3B8JA 1WHAA 2PSYA 1Z87A 5DP7A 3T2NA 1A3EH 2SGQE 1BZXE 4AG1A 1OP8A 1FY8E 1GBIA 1BRUP 4K8YA 1MTNB 4IMQA 4RKJB 9ESTA 1TLDA 1Z6EA 3PMAB 1INCA 1DFPA 1UJ1A 4NMSA 3H7OA 4JZ1A 2BVRH 1E0FD 1HRTH 1MTWA 2A7JA 3AAVA 1GQ5A 1MTVA 1MTSA 3T29A 1TX8A 1A3BH 5K0HA 1D3DB 2GD4B 1HGTH 2GCHF 3AXAA 3LNXA 1C5LH 1ACBE 1DSTA 1O2QA 3FP8E 2OQUA 4NA7A 4H6TA 3T28A 3FZZA 1TBQH 3NPSA 1BTHH 1TOMH 3TGIE 1C2MA 1CHGA 1BDAA 4JOPA 1TALA 1S6HA 1CGJE 3VQFA 1RRKA 1MKXH 3LC5A 3RMMH 3I18A 3SU1A 3P95A 2KPKA 3TSVA 3HKJB 2WL7A 1JRSA 2ZHQH 3M36A 4A92A 2ZFSA 2HE2A 1HDTH 1ZJKA 1GHWH 3A8CA 1GWAA 3SV7A 3A84A 2BOKA 3TJUA 4YT7H 2F91A 4UEHH 1BMLA 1HJ9A 2UUFB 4D7GA 2BY5X 1QFKH 1SGPE 1A0JA 2A5AA 1C4Y2 1FDPA 1XX9A 2GDDA 1TGTA 2XCFA 4B2BA 2DLSA 5TCAA 2G00A 3MNSA 4E3BA 2E7KA 1HAIH 5GNDA 1V2NT 1C9TA 2P95A 2VIOA 1SGCA 2BDHA 3QDZB 3RP2A 1PYTC 2ODQA 3P8OA 2WINI 6GCHG 1P2OA 3SUZA 2PKAA 1GGDC 1ELTA 3VB4A 1O3FA 2ZA5A 3MH6A 1GDQA 4WXVA 2OSGA 4Z6AH 4INHA 5BPEA 1BMMH 1AO5A 3V12A 4OEOA 3BTQE 1HAVB 3M35A 3P8GA 4REYA 1TE0A 1V2LT 2OTVA 3MU0A 1AUTC 2OQSA 1GI6A 1J16A 1QHRB 1OZIA 1E36B 1PJPA 1C2JA 4PQWA 3D62A 1GVZA 1NFYA 1ZYOA 3O8RA 4U2WA 5HMAA 3QZRA 1C5ZB 4ZHAA 2CMYA 2Z3DA 1H8IH 3A87A 2XWAA 4X8VH 1O31A 2G55A 1QBNA 5DTHA 3CH8A 5T6GA 4DURA 2QXGA 2ODPA 1EZSC 2HNTE 1NM6A 1ANCA 1NTEA 1NF3C 1GBLA 3BEFB 2VIPA 5LH8A 4WF8A 1XZ9A 1TNJA 1GBTA 1AI8H 5E0GA 2SGAA 3NXPA 3HPKA 1ELGA 1FV9A 1EJAA 4P2AB 2ZPRA 1ELAA 1D6WA 1F5RA 3MO9A 4R0IA 5JPMH 2F83A 5TCCA 2ZCHP 1HAXB 1V6BA 4ZAEA 3M61U 3ZV8A 1W9OA 1SBWA 4NSVA 3QGJA 3FAOA 1O5FH 3LGWA 4TPIZ 1OWHA 1DWDH 2NWNA 2Y7XA 4X8TH 1NROH 3EGHC 3RXLA 1OXGA 4JK6A 2K1ZA 4O3TA 4YDPA 1A5IA 2NU4E 4Q6HA 5H4IB 1WFGA 1OWIA 3GDSA 1QB6A 5DGJA 4OS1A 3U98H 3O8CA 2O9QA 2AWWA 2Y5HA 1V2ST 3K50A 4H6SB 3Q00A 3RXOA 2F9OA 4CREA 3A80A 5F6MA 2QAAA 3SN8A 1F0SA 1GI7B 2XRCA 1NRRH 1O2KA 2QF0A 2FOBA 3U9AH 5FHTA 1MCVA 1N7FA 2M0VA 2EEHA 1G30B 3SNCA 1VCPA 1OP0A 1PQ5A 1O2YA 3GICB 2EDPA 1NRPH 1KTSB 3KQEA 1AHTH 1V5QA 2HGAA 2YUBA 1P2NA 1UTMA 4RSPA 1GJ6A 4X6OA 4K2YA 1OOKB 3LKWA 5F8ZA 1MBMA 4FUDA 2GDEH 1FAXA 3O5NA 2B8OH 4XBBA 3QK1A 1AWFH 3H5CB 3MU5A 1GGDB 1KLTA 5T3HA 3T5FH 1O3CA 1MU8B 4A5TS 3R0HA 3TSZA 1KXAA 2GCTC 4SGAE 1CA0C 1EQ9A 2PUQH 2EEJA 1XKBC 2A5KA 1U38A 4I33A 4LMMA 1FN8A 1N6DA 5FCRA 5JXBA 2CJIA 5HETA 3DD2H 2H3MA 2BY7X 1C1WH 1BQYA 1S6FA 3W94A 2GT8A 1SPJA 1WOFA 1G9OA 5G4BA 2V6NA 1GJAB 1AVGH 1QA7A 2I04A 3K6YA 1NRNH 2CHAC 3HVQC 4TPYA 5F8XA 5ETXA 2ZF0H 1CHOF 2QGRA 1FNIA 1QRZA 4E06H 2AIQA 5EQQA 2KQFA 1HXEH 1QY6A 4ZMAH 1KTTB 1TFXA 4AFQA 6CHAC 1GHZA 3GCTF 1O3GA 4IMZA 1MZDA 1YPEH 2YTWA 1GL0E 1O38A 2VVCA 1SQTA 1W9EA 3NFKA 1SHHB 4VGCB 1EJNA 4JOHA 2GKVE 3ZZ8A 1PPZA 3UQVA 3DA9B 3K9XB 1ZHPA 1O3DA 1ZRBA 2BOHB 1BTPA 4AYYB 5T6FA 5HYOA 4TYDA 2G51A 1VITG 1EPTA 4NZQA 1ETRH 2ZTZA 2Z17A 2ZGHA 2JOAA 1GMHF 2L4TA 2RCZA 2WYJA 3SW2B 1THPB 2FP7B 1GI1A 2P59A 3SI3H 1VJ9U 4XOJA 1G2MA 3KQBA 4DW2U 2BMGB 3ODDA 2H5CA 2GP9B 1C1MA 3B23B 1MUEB 1TGNA 4IC6A 3E17A 3PMJA 1GJ4H 1A4WH 4B1TA 4NMOA 3NKKA 3Q3YA 3UWJH 5C1XA 4UFGH 1GJCB 4JZEH 1GBJA 4UD9H 4BXSA 1DVAH 2DC2A 5A8ZA 1O2RA 2RRMA 4I8KA 1O3EA 1V3XA 1AB9C 2AMPA 5HEBA 1RFNA 2D2DA 3RDZA 1KLJH 2OC0A 3E90B 2XBXA 2ALPA 2C8ZB 4GSOA 2F9BH 3TH4H 1ELDE 2GCHG 1BHXB 1HYLA 3P6ZB 2EAQA 2BYGA 2J34A 1AGJA 3CBXA 1IQNA 2VU8E 4ABGA 3F9GA 5HF4A 1B0EA 2PFEA 4K1SA 1PQAA 1AVXA 1Y5AT 2ZNKH 3A83A 3K1RA 1FUJA 3VXFH 1GHXH 1NESE 3TJVA 2BD8A 2PGBB 1GBBA 1S0RA 3UOPA 4WYTA 3TNSA 3I78A 5AVDA 2SGEE 1UK4A 1KWAA 1BRBE 1ZPCA 2XC5A 1A0HB 1ELEE 2BTCE 1QQ4A 3PWCA 3SO3A 2V1WA 1CA0B 2F5YA 1LVMA 3GY5A 1WF7A 1HAGE 4NA8A 1BUIA 4KP0A 4NZLA 2HPPH 4LK4A 3G01A 3M3SA 4OGYA 1G3EA 1DXPA 1DANH 5EODA 1YC0A 2FOEA 4Y8YA 1O3HA 2PNTA 1KDQB 1CO7E 2ANYA 2KAWA 5LPEA 1U37A 1P9UA 4JYUH 2ALVA 2CHAB 1P3EA 1IU2A 3SU6A 1P02A 4DOQA 1SQAA 2ZTYA 4MLFB 3TK5A 2GZ9A 2FM2A 3QO6A 3TNTA 2J95A 4B76A 3SV9A 2KJKA 4A1TA 2A2QH 2HNTF 6CHAB 2F3CE 1Y8TA 1RGRA 2GV6A 4AOQA 1QJ1B 2IWOA 1ZGVA 1LQEA 2OXSA 1G36A 2ZDVH 1SQOA 4MNXA 2W7SA 2VB0A 1J9CH 1EAXA 4CRAA 3TITA 3RMNH 1WCZA 1C2HA 1QL7A 1O3NA 1O2VA 2AS9A 2KAIB 3BTEE 3CBZA 2DAZA 1WSSH 2ZDKA 1T8NA 4K60A 1LQDB 2ZFTA 2JINA 2EGOA 1YKTA 1UFXA 1C2DA 2JWEA 3C1KA 1C5OH 2KG2A 1V2KT 2J9NA 1G3DA 3LONA 4AX9H 3F6UH 1TNKA 7GCHF 2AGEX 3MNCA 2BY6X 2VWOA 3PLKA 2C8WB 3QGNB 4XSKU 5JYIA 3RUOA 5L2ZH 3M3VA 1MBQA 5LGOA 5T6DA 1H9IE 4U30A 1EZUC 2QIQA 1H8DH 1IAUA 5FBIA 2FLBH 5HFBA 2BDGA 1WYKA 1PPBH 3A82A 4WVPE 1IQKA 3AAUA 1C1TA 3GY2A 1AB9B 3E16B 1TQ7B 2BDIA 4PROA 1C5VA 1FC6A 2G4UA 1YLDA 2H3LA 3RXAA 3RLYH 2FI3E 1UO6A 4YT6H 2OD3B 4UFEH 1O33A 4X6MA 4X8UH 5ABWA 1VITH 1F2SE 1UVSH 1XUFA 2WPJS 4EDJA 2R9PA 3CENA 1BFEA 3NK8A 4NNLA 1F92A 3B76A 3ZZDA 3QTOH 4WXIA 4GPGA 3CS0A 3TK6A 8KME2 1P04A 2LNCA 1MC7A 1GDUA 4JOKA 5EPNA 2P93A 2Z3CA 2VSPA 1C5XB 1ZPBA 1DY9A 1CE5A 2FX4A 2FO9A 4Q2OA 1RJXB 3RMOH 2M5TA 2TGAA 2RA0A 2UUKB 3SORA 3QE1A 3RLEA 5D13A 2A1DB 2ZGBH 3CC0A 2PWXA 3RXGA 4OGXA 2LPRA 5JBCS 1K2I1 1VGCC 1O3PB 1YM0A 3KL6A 2FS9A 1EZQA 3SZNA 1T8LA 2ZDMA 3QUMP 1GI5A 2Q3GA 3FFGA 3VEQB 5PTPA 5HFCA 3EQ0H 3NCLA 4XE4A 1P1EA 3P8FA 4FUCA 2H2ZA 2IWQA 1SL3A 3A8DA 2SFAA 1PFXC 1ZTKA 3LIWA 5JBBS 3U1JB 2KV8A 3DIWA 1P2KA 3A7YA 1UM7A 2I4SA 2FOMB 3F1SB 1KXEA 4M7GA 1W3CA 1HAZB 1O2SA 4ZROA 1TONA 2F9NA 2VWMA 5C1YA 2JIKA 2VJ1A 4Q7YA 3V13A 4JMYA 4OS7A 2L4SA 4A1XA 4ZKSU 1UJDA 3F9FA 1BCUH 1MAYA 3UIRA 2JH5D 4ISHH 5L6NH 3BN9A 1LHFH 5HM2A 4NCYA 2FTMA 1GBCA 3PMHB 1AVWA 1AMHA 4WH8A 1Q3XA 2Y82A 1FY5A 5DP3A 1Y3VA 1K28D 4ZKNU 3RC5A 2GX4A 3O8DA 2EV8A 4AFZA 1N8OC 4BAHB 4R8TB 5DK1A 1GCDA 2A7HA 4D9QA 3SUGA 1PPFE 1LPGB 3SHUA 1CHOG 2BLVA 2FEQH 4A7IB 3VB5A 5HFDA 2W7UA 1F5LA 2AWUA 2OGPA 2VIQA 4K72A 1SFIA 3BTFE 2YT7A 3E0NB 2A4OA 1UHBB 1ZGIA 3Q76A 3UR9A 3HKIB 3GCTG 1P10A 3PM3A 3EA9A 3VB3A 2YNAA 2EJYA 2ZHWH 3TLOA 1F0RA 1MKWK 1TB6H 1O2IA 1CGHA 5FB8C 3GYMA 3PO1B 1JIRA 3S9CA 4O3UA 2LC6A 2FMJA 2G4TA 2PKTA 3ZV9A 3SUFA 1JXPA 4Z8JA 1W13U 1Z6JH 4HGCA 1TNLA 3ZVDA 4NSYA 3URCA 1QA0A 1R6JA 3N7OA 2FN5A 4XFQA 7ESTE 3CYYA 1V2UT 3PTNA 1GMHG 5DP8A 2HGTH 2C8YB 2CF9H 2FX6A 5L2YH 3HPTB 2ZDAH 1XMNB 1LPZB 1V2OT 1SGFA 1PPGE 4ABFA 3BPUA 2Z94A 1P0SH 2VWRA 1XVOA 2UWPA 4FUIA 1Z86A 1HAPH 1A46H 2XCNA 2HPQH 5JB8S 1NS3A 4X0WU 4CH2B 3EGGC 3D65E 1AY6H 1O2MA 1OWDA 1Z8JB 1EOLA 1Y5BT 1O37A 1ZSKA 4GHNA 1G3BA 1W10U 4R2ZA 2HLCA 2C90B 3RXKA 4MPVA 1ZOMA 1RTFB 4X6PA 1EASA 1Y3YA 2ANWA 1WTHD 2QXIA 5DO4H 3DUXH 4F4OC 1FIWA 1VGCB 4YO9A 2VIWA 2FOAA 3SU3A 2BDBA 2AWXA 1JMOH 2ZWLH 1HCGA 2WV4A 3OY5U 4D9RA 2OCVB 1Q7XA 4LZ4B 2DMZA 2KOHA 3MHWU 1QQUA 1YPLH 1O3KA 1CT2E 1WIFA 4TWYA 1BTUA 1EAWA 1N6FA 2PUXB 1A1RA 3A85A 2TGDA 5G1DA 1DWEH 2ZI2H 1TQ3A 1GDNA 4K75A 4OS2A 1QRXA 4Q3HA 4INLA 2ZU4A 4AZ2B 4B2CA 2ZIQH 4RI0A 5H3JA 3TK9A 4CBOA 5DP5A 3MMGA 1W7XH 1X5NA 1ANDA 1TNHA 4GCHG 1ARCA 3RU4T 2H2CA 3ZRTA 1VR1H 1J17T 2HNTC 4YLQH 1Y5UT 2IN2A 4ZUHA 4HI3A 4HOPA 4X1QU 1N8OB 4NGAH 3RM2H 3UWIA 3V0XA 1FI8A 1HIAB 2XC4A 2Z9KA 2D8WA 3MU4A 1C2IA 1UVTH 3U8RH 1TPAE 2ZKSA 1IQGA 1P03A 1TQ0B 1IHTH 5I7ZA 3KQDA 4MTBA 2FNEA 1ELBA 3ELAH 2FTLE 2G52A 4KFVA 2ULLA 2PSXA 2BD4A 2UWLA 1UCYE 3P17H 1JIMA 2ZPSA 7LPRA 1HFDA 3KGPA 1HNEE 1AKSA 1O2UA 1T4UH 3OX7U 2ZPLA 1XUHA 3T27A 2ZGJA 3CP7A 2FOFA 1C2LA 3ID1A 2VSVA 2SNVA 2VH0A 2ZG0H 2D1JA 2H2BA 4DG4A 1B7XB 5DG6A 3PV2A 4HZHA 2W4FA 4AB8A 2EDVA 4NIVA 5HFEA 2H9EH 1TNIA 4UONA 2J4IA 1F0UA 5DPAA 1C4V2 4Y8ZA 1TBRH 4AGJA 2KOJA 2HRVA 1BJVA 3MH5A 3E8LA 2P3UB 1O5EH 1ID5H 1SGDE 1TIOA 6ESTA 3UNRA 1ESAA 4A6LA 1ZRKA 2J2UA 2A4GA 7GCHG 1TMBH 3HGNA 2A4RA 3RXVA 2PKUA 3QJNA 1IOEA 1DE7H 3LC3A 4MPUA 2XBVA 4IC5A 1X5QA 1V2WT 1PQ8A 1JWTA 4JCNA 3O46A 2M3MA 1OYQA 1P05A 2JILA 1AE5A 1QAVA 4L8NA 1MZAA 1CSOE 2PA1A 2BM2A 3LPRA 4BXWA 1CQQA 2NU3E 4NIWA 1XXFA 4BAQB 3I1EA 3OTJE 1DXWA 1TX6A 3FANA 3TIUA 1YCPK 3NUMA 3PMBB 3OYPA 4K8BA 3U8TH 2I0LA 1N6XA 2BD3A 3P8NA 1YF4A 1G37A 1X45A 1DICA 4Q7ZA 3A89A 2VH6A 4FVDA 1UITA 1NZQH 1KY9A 3ZYEA 2PW8H 1KIGH 3KN2A 3MWIU 1KSNA 3BTTE 3NZIA 2VPHA 1BBRE 1HXFH 4ZH8A 3SJIA 2GV7A 1L6OA 1N6EA 5C2ZA 1V2VT 1CBWC 3FVFB 1YBWA 5C20A 1C5NH 1CU1A 5EPYA 3LJOA 3U8OH 3RXCA 1Z71A 1UVPA 3UTUH 4NMQA 2GGVB 3EE0B 5DKMA 5DP6A 3DHKH 2ZGCA 3RMLH 2DE9A 2ZHEH 5HEYA 1OPHB 1SC8U 1GI9B 4FU7A 1PPEE 2G5NA 4ABJA 3ESTA 1K32A 1V2RT 2OZFA 2VRFA 1TPSA 3SJOA 1UM1A 1BJUA 2XW9A 1YCPM 3MYWA 3LOXA 4TY6A 1C1QA 2V3HH 4MDSA 2Q6FA 1SB1H 4FUFA 1W7GH 3MH4A 3KCGH 5DP4A 3SHCH 3SNBA 2UUYA 3GY3A 1T4VH 2Z7FE 5C67A 5GWZA 2PLXA 4DCDA 1NU7B 4WY3A 1J8AA 3EAJA 5EG4A 1ZSJA 1VA8A 3RL7A
chains in the Genus database with same CATH superfamily
3GABA 1GL1A 1SLXB 1XXDA 2J38A 1UEQA 4BAKB 1GI2A 3D49H 3OEHD 5IDKA 1K1JA 2FOCA 4JOFA 9LPRA 4O9VA 1ANEA 3T26A 5AFZH 1XM1A 2XC0A 3ZZ3A 2ZGXH 5A0CA 1W2KH 1U3BA 3BTWE 2CF8H 2J92A 1LCYA 1HV7A 2QV1A 1O2GH 2R0LA 2DLUA 1NY22 2AHME 3LJJA 4F8KA 3BTGE 2W26A 4WWYA 2A4QA 4BTTB 5HEDA 3QGLA 1DM4B 2OUAA 1GBMA 2MX6A 4J1YA 2DM8A 1ESTA 1O2TA 2R0KA 3M5NA 4AGKA 4Z0KA 2O8LA 1Q3OA 4GHTA 1EB1H 2PTNA 1B5GH 1BMAA 1Z7KA 3KZEA 3LU9B 1C2KA 3FO8D 2FZZA 3S0NA 4MNWA 1SGFG 4WMEA 1NRQH 1ZMNA 1YLNA 4Y10E 4CR5A 3GSLA 2BX3A 4I8GA 4X8SH 3RXIA 4HFPB 1O2HA 2P3TB 3OFND 3RXFA 5A0BA 2WPHS 1LHDH 1LVBA 4GLYA 4CRBA 2FDAA 1ZTJA 1XUGA 3BIUH 2F9VA 2PTCE 1VJ6A 1BTXA 1QNJA 2Z9JA 1T8OA 5GPIB 1RS0A 4B75A 3AK5A 1V2JT 1ELCA 2KYLA 4FUGA 1LMWB 3NFLA 2W5EA 2AH4X 3E91A 3KQ5A 2HVXA 3RU4D 1L1JA 3EA8A 4K69A 3RU4E 1W14U 3V7TA 2UUJB 5F8TA 1KEFA 1EATA 2C3SA 1AD8H 3AASA 3QX5H 4K76A 1O30A 1QURH 5LPFA 2BXUH 1IQHA 1ZLRA 2IPHA 5E11A 2KM0A 3ZZAA 1HAVA 2KA9A 5F3XA 1SGIB 5A8XA 2PZDA 1GHAF 1S83A 1GMDF 1UEWA 4JL7A 2F9PA 3SNDA 4Y76A 2G2LA 2FI4E 5FCKA 1BT7A 2CSJA 2IWNA 1FMGA 1VCQA 4I32A 3ID4A 1CBWB 1BRAA 4AC9A 1BTYA 1Y3WA 5HJ1A 3BSQA 2G81E 2REYA 4IGDA 1UK2A 4ABAA 1F7ZA 2JREA 1SR5C 3SJ8A 2M0ZA 3SNAA 1E38B 2LUIA 1S82A 1YPKH 3EGKH 3M5OA 4JZFH 4TSFD 2BLOA 2A32A 2XXLA 1BMNH 5C0TA 1RY4A 4TT3D 2JKHA 1T31A 2QYIA 3R69A 1SHYA 2GCTB 3A7TA 2R2MB 2XWBI 3F3BA 4FVBA 5HIYA 1GBFA 4ASHA 3IITA 1PPCE 1Q3PA 1AFQC 2GEFA 1SGTA 3M7QA 1GG6C 1D3TB 5EXNA 2AINA 3ID3A 3A7ZA 3C27B 3ZVFA 3I29A 3A88A 4GCHF 1TPOA 1T2MA 1FY4A 3GY8A 4X2YA 4N6XA 1SLVB 2BQ7B 1LVYA 4UFDH 1P12E 3STIA 4Q2PA 3SNEA 3BV9B 2BDAA 3MNXA 1UHPA 2PV9B 1GM1A 2FS8A 3CS7A 7KMEH 5B6OA 3I77A 4ZXYH 2CSSA 2YT8A 1I92A 4DIIH 1LPKB 1QGFA 5KECA 1ZMJA 3VPKA 1SLUB 1P3CA 4KGAA 3A7WA 1KXCA 2GTBA 2K20A 3QN7A 3ZVEA 1IQEA 4AMHA 5EQSA 2ZQ2A 3F2HA 3SU4A 3U28C 4TY7A 4CR9A 4E7NA 1V1TA 2M0TA 5HFFA 1BTZA 5GLJA 1QJ6B 2I6SA 5ESBA 2D90A 1K1LA 5JDUB 3ZVBA 2OQ5A 2QCYA 2O8MA 3SJKA 2Y5GA 2OCSA 2ZHFH 3MOCA 3ZZ4A 1BE9A 1O3JA 2P94A 2M2AA 1A5HA 4DIHH 1MQ5A 3DJ1A 2OC7A 2G5MB 3QWCH 4D7FA 1T32A 3RXTA 1HBTH 1TWXB 1UTOA 2RFKC 2KCPA 3AW0A 3GISB 2THFB 4ISOA 5I25A 4FUBA 1DS2E 3UNQA 1COWD 1BITA 4LOYH 5EQRA 1H9HE 2B0FA 2VBCA 3ZZ5A 1NTPA 2D92A 1O2WA 4NIXA 1WQVH 1YPGH 3DSGA 3KZDA 2K1QA 1YPJH 2H9HA 1P2MA 2YNBA 2VVVA 2CV3A 3JZ2B 1DUAA 5CHAC 1ZZZA 2QG1A 4Q7XA 5SGAE 1V2PT 3SU2A 4YLUA 3E0PB 1P06A 5K7RA 1GI3A 1C5RA 2P3WA 3RM0H 2GZVA 4MNVA 2P16A 4NWLA 2TGTA 1RD3B 2UZCA 1ORFA 1QBVH 3U1IB 2LOBA 5CHBA 3PV4A 2BLQA 5FL7D 4NFEA 1ANBA 4THNH 2QY0B 1THRH 2ODYB 4RKOB 1UVOA 3FY5A 2TRMA 1C5WB 3TH2H 1ESBA 1W11U 4WYUA 3ZZ9A 1CT0E 2V0BA 1LHEH 1ZR0A 1JBUH 3H7TA 2PKAB 5IL9A 1GBEA 5LPRA 3S7HB 1THSH 1P01A 3PWBA 3W95A 4BAOB 1MAXA 1O2OA 2JH6D 3M3TA 2ZP0H 1GBHA 1O2XA 1KXFA 2ZEBA 3IWMA 1GI8B 4ISNA 1WU1A 2EI7A 1N7TA 2HOBA 3TMHA 4K1EA 1ABIH 3BEUA 3O8BA 4NMPA 3F0OA 3ATIA 2A5IA 2JH0D 1D5GA 1GG6B 1C1PA 3ZZ6A 1SGQE 2KL1A 1HPGA 3RXQA 2ZQ1A 3LGTA 2BQWB 3VGCC 5FAHA 4Q6SA 1BB0B 1V62A 3LDXH 1MFLA 1K1NA 2GT7A 3ATKA 3BTKE 1TRNA 1O2LA 3KHFA 3QIKA 1JRTA 1QB9A 5B42A 1GJBB 5C5OA 1FCFA 1QRWA 1SI5H 3MU1A 2BZ6H 2NU1E 1T8MA 2LA8A 5E0HA 2VINA 4GUXA 1Z1JA 2D26C 1SOZA 1NN6A 1EAUA 1EXFA 2EQNA 4KTCA 2J5UA 1TGCA 1DLEA 4KFWA 3R68A 1YP9A 4X2WA 3FN8A 1C5MD 1GI0A 1ELFA 2ENOA 3GGEA 1GHBF 2I1NA 1A5GH 2FESH 3ATWA 5HIZA 3RXMA 4K3JA 1EPTC 2QA9E 3WWBA 3RLWH 1W0ZU 1SOTA 4X1NU 2OLGA 1Y3UA 3F9HA 2RCEA 1D3PB 2BHGA 4ABEA 2BDYA 3RXBA 1A0LA 4X2VA 1WFVA 1UF1A 3BTHE 3Q3KA 2YOLA 2P8OC 1C5TA 1HAOH 2FE5A 1K0HA 2R2WU 4O97A 2XOKD 1XUKA 4ZXXH 2O8TA 2AYWA 1LHGH 3URDA 4DVAU 3UUZA 8GCHF 4MPXA 1AU8A 1O3BA 1QBOA 3P92A 3S9AA 1TAWA 3TJNA 5GCHG 4NXRA 1ZHMA 3IG6B 1FLEE 1NFXA 3SHAH 2OBQA 1NBMD 2ZHDA 3GDUA 1GJ8B 5EJ1A 1NBME 5EOKA 2GMTC 1Z8GA 3PB1E 2FCFA 1TOCB 2WPMS 3LH1A 3A81A 1IHSH 4E7RG 1G2LA 4YM9A 5CHAB 1TRMA 2ILNA 2J98B 1DITH 5C3NA 1A61H 2G5VA 3AW1A 1O5AB 2OS6A 1IHJA 1CVWH 2CGAA 4AB9A 1O2JA 4WMFA 3A86A 1DX5M 1SMFE 1WTGH 1OWJA 1XKAC 2ANMH 2LP6A 3UY9A 2W3IA 4UE7H 4NIYA 1EX3A 3SGQE 2EEIA 1P2QA 4YOJA 2VNTA 1WHDA 1GCTC 1RTLA 1EAIA 1WG6A 1S81A 4U01A 3L6PA 1FXYA 3SZEA 5HF1A 1TMTH 2JETC 1GPZA 1IQIA 1KDQA 3SHWA 4I86A 1MD7A 2B5TB 2IOTA 1SLWB 3BTDE 2I6VA 3OU0A 1GHYH 1MQ6A 1FN6A 1L4ZA 1BA8B 1LKAA 3NWUA 3Q3XA 5E2PA 1Z8RA 1J14A 2XTTB 2KOMA 3GJ9A 2GVFA 3D23A 4H4FA 4JYTA 4B74A 1TGBA 4NMTA 3W1EA 1VJAU 1UTLM 1D6RA 4GHQA 3SGAE 1SGEE 3P70B 1V2TT 3SV2H 1IQFA 3NGHA 2BZAA 2DE8A 4XHVA 1NFUA 1C5QA 1MFGA 1WI2A 1XVMA 1ZTLA 2AERH 2V90A 3VXEH 1MH0A 4XDEA 4JZDH 1X8SA 1O34A 3VGCB 1HAHH 2HE4A 4B6FA 1YLCA 1AE8H 2ZCKP 5GJ4B 5C1UA 5EW2H 1V5LA 2STBE 2AIPA 3JZ1B 3SU0A 1KXDA 4QT8C 1GHAG 1GMDG 1WF8A 3TGJE 4OAJA 3UFAA 4LZ1H 1OKXA 4K78A 2KAIA 1UEZA 4O06A 3DJAA 2RDLA 1MU6B 1FX0B 2QT5A 3UAIC 4Y7BA 2QN5T 1TRYA 1GJ5H 1ETSH 3UREA 1BOQA 1OP2A 2ZPMA 1MKWH 2Y80A 3WKLA 4XBDA 5HGGA 1TNGA 4BTUB 3CBYA 2WV5A 1PQ7A 1TPPA 2VVUA 4Y0ZE 1QL8A 4JK5A 3DORA 3JXTA 4YOGA 3BG8A 1C1RA 1EPTB 3PROA 1X5RA 5EGMA 1FJSA 4BANB 3EYDA 1BIOA 5J4SA 5EW1H 1QTFA 1TGSZ 2WPDD 4B2AA 3TVJB 3MH7A 1EP6A 3AVZA 4XBCA 3VB7A 5C0UA 1O3LA 2ZFFH 1PPHE 3LH3A 3ZYDA 1H4WA 3K6ZA 1HJAC 2P8OB 1UTJA 1GMCF 1E35B 1L4DA 2H6MA 3KIDU 1W0JD 2GZ7A 1C1VH 1C5SA 1KYNA 2KZ4A 1C2GA 2BVSH 2OPGA 5J4QA 5B6LA 3KYFA 1HJ8A 5C94A 1IQJA 2W6JD 1TA2A 4DY7B 5FX5A 1K1OA 3MU8A 3S7KB 1DWCH 2WYGA 1AN1E 2GMTB 6LPRA 3L33A 4YZUA 4AN7A 5EXMA 4FXGH 3NCVA 1U39A 2VIDA 4FGMA 3FP6E 2H9TH 3GY7A 1K1MA 1DUEA 3KF2A 3VB6A 2ZZUH 1UJUA 2BD5A 1B8QA 1MCTA 1PYTD 4DT7B 2F9UA 1D9IA 4ACBA 1FY1A 2BYAX 1C5PA 3ITIA 2I0IA 2BLWA 3GY6A 4U32A 1P2JA 4KTSA 4HTCH 1J15A 2XYAA 3SQEE 1UVUH 1RGWA 3SOEA 1O36A 4A1VA 1GCTB 1YWUA 1SGYE 3SOSA 1FC7A 2WPKS 2O8UA 4GVUA 2JETB 1V2MT 3EE7A 1TBZH 1U6QA 4I7YH 1HAYB 1K9OE 1K1IA 1DPOA 1O3IA 3TSWA 1IQMA 1SGNE 1WJLA 4E34A 1ZPZA 2QKTA 2BY9X 4VGCC 1EP5A 4K5ZA 3LGVA 1QLCA 1OSSA 2STAE 3BEIB 5A2PA 3BF6H 4UFFH 3OTPA 4AYVB 2BB4A 1UTPA 2AMDA 2ZFQH 2XBWA 5EJZA 3HGPA 2BD9A 1ARBA 4RT1A 2QF4A 4DJZB 4MPWA 3BG4C 2B7DH 5FXLA 4Y11E 1ETTH 1GBKA 5AF9H 1QJ7B 1SQRA 2H1UA 4NWKA 4P0CA 2YUYA 5C17A 3RC4A 2PR3A 2P3FH 3EA7A 3SFJA 2ESTE 2EI6A 1QL9A 3GCHC 1S0QA 1QZ8A 1WXRA 4MNYA 5FX6A 1CA8B 3SV6A 3UOUA 2PHBA 3M7UA 4O03A 2Q6DA 3KHVA 2CN0H 1F5KU 4F49A 2V3OH 2EXGA 4WJG2 5JBAS 1GJ7B 4B71A 1AZ8A 1UHBA 1TYNA 3PS4A 1AUJA 1X7AC 2BQ6B 3B9FH 3RXUA 1W9QA 1BTWA 1N6YA 1UCYK 2Y81A 2BD7A 4ASUD 5FPYA 4G69A 4GVCA 3K65B 2OC8A 2XNDD 3T62A 2Z3EA 1XUJA 4Y8XA 1FPHH 3FP7E 2R3UA 4B6EA 4JYVH 1JOUB 1OBZA 1DY8A 1HJAB 1K1PA 3WY8A 2EEKA 1TABE 4ZHMU 3LGUA 5IK2D 2D8IA 3L4FD 2QKVA 1HLTH 2W6ID 1AWHB 3V3MA 4FUHA 5A09A 2WPIS 3MFJA 4D76A 2Q6GA 4ZCNA 4SGBE 1EUFA 4IN2A 2O2TA 3QTVH 1G9IE 2Y7ZA 1HB0B 1E1QD 1H9LB 3ZVAA 2LC7A 4UDWH 1AQ7A 2BY8X 1OX1A 3ATMA 3STJA 1OWKA 1UJVA 1SG8B 2Z9IA 3VFEA 4B73A 1GJDB 2QBWA 1SSXA 1L0ZA 2TIOA 1X6DA 1LVOA 1O5GH 4I8HA 5T1VA 5GCHF 1GHBG 3SBKA 1FC9A 2DUCA 3M37A 3PLBA 3S9BA 1YCPH 3EDXB 1DWBH 2TGPZ 4ESTE 3ZZ7A 5A0AE 4X1RU 4JOEA 3VQGA 4CBNA 3RC6A 1WH1A 1O2ZA 1DDJA 1WUNH 4RN6A 2EC9H 4NFFA 1WQSA 3VG8A 4X6NA 3SUEA 1GVKB 3R0FA 1WAYB 4X1SU 4H42U 1WI4A 1N99A 2AGIX 5C5NA 1QB1A 2WUCA 8GCHG 1C1SA 5E8EH 4UU5A 3GDVA 5F03A 2WUBA 1OWEA 1YBOA 1C2FA 5TJXA 3S69A 1W0YH 1S5SA 2TBSA 3MI4A 3UNSA 1Z8IB 1OYTH 1L1GA 2H5DA 2QXJA 1UCYH 2ZDNA 2A2XH 1SGRE 1ZHRA 2IJD1 1TX7A 3GCNA 4ZKRU 1QAUA 1EKBB 1TMUH 2FOHA 2HVYB 5GIBA 1C4U2 1BBRK 2KBSA 1F0TA 4OEPA 2KJPA 1O39A 3GYLB 4TWWA 2V35A 1C5UA 4Q2KA 1DT2A 4Y71A 2WPLS 1TP5A 4OS4A 1O5DH 5CMXH 1LHCH 1FPCH 2Q9VA 5E6PB 1AFEH 1NC6A 2VGCC 1TP3A 1L1NA 1P2IA 3BG4B 4CHAC 1RXPA 1CT4E 2SGPE 1O3OA 1WV7H 1P11E 3LGIA 4DGJA 3SV8A 5DJ7A 4ABHA 2Y6TA 1T7CA 2L97A 1NU9A 2VIVA 3GCHB 4ISIH 2PKSC 4KELA 4FU8A 3PDVA 1E1RD 3DT0H 2ZU5A 3TGKE 1HIAA 5JBTA 2FODA 3TJOA 5FPSA 1HUTH 1GBAA 4INKA 4CRCA 4OS5A 4CRFA 2KR7A 1O5CB 4KKDA 4BAMB 1O2NA 2OC1A 1PDRA 2EGKA 5HM9A 1L2EA 1O5BB 2VZ5A 1D3QB 1QCPA 2Z9LA 1TA6A 2ZC9H 3BTME 1Y3XA 3HATH 2AEIH 1P1DA 2NU2E 4AFSA 3GOVB 3HK6B 2Y5FA 1GJ9B 3A8BA 1VB7A 1ZOKA 1LDTT 4GVDA 2QKUA 4JOJA 5EU8A 2OMJA 1ELVA 2OINA 5HXFA 3RXHA 2FIRH 3U69H 1NPMA 4FUEA 1GI4A 5A8YA 3MNBA 1O3MA 5EYZA 1CGIE 1UMAH 1VCWA 1RIWC 2ZU1A 3SGBE 1BBRH 1OHHD 3SU5A 1C9PA 2O8WA 3HPMA 2I6QA 4I8LA 5DP9A 1M5ZA 5E21A 2W3KA 6GCHF 2HWLB 5AHGH 5E1YA 3SUDA 1M9UA 1UTNA 2ZTXA 1C1OA 1I16A 1K21H 2FYRA 1QIXB 4YTAA 3PRDA 1FIZA 4ABDA 1ABJH 4YYXA 4F55A 3GY4A 1RGQA 3KEEA 1EZXC 4GAWA 4JZIA 4X1PU 1RTKA 1SVPA 1UK3A 3HK3B 2ZDLA 4NMVA 1FQ3A 1N1LA 1D4PB 3N7DA 1UTKA 3K82A 2G8TA 1DLKB 1GMCG 2ZFRH 4ABIA 2DKRA 3GCOA 2VWLA 1DSUA 1EJMA 4MVNA 3FOAA 2PDZA 2EI8A 3KNXA 4CH8B 5L30H 4WMDA 4I31A 1IQLA 3LNYA 5BRRE 2QC2A 3PLPA 1S85A 4YESB 3ID2A 3I4WA 3PTBA 1YPMH 2FOGA 5F67A 1UEPA 2PGQB 1WBGB 2KCAA 4IN1A 3T25A 2SGDE 3DFJA 3UQOA 4Q80A 1ZUBA 3ZVCA 2FXRA 3E6PH 1VZQH 4ACAA 1NRSH 1Q2WA 1FZZA 2V3MA 3ODFA 2FLRH 2BX4A 3ZZBA 1YGCH 4I8JA 4AFUA 5FPTA 2QXHA 2JJ2D 3WKMA 3RXSA 1O2PA 2KX4A 2AGGX 4XRNA 2OP9A 1N7EA 3M5LA 4FU9A 4Y7AA 2VGCB 4ZKOU 2ANKH 4CHAB 1KLIH 4MG3A 3SQHE 2ZO3H 5AFYH 3UPEA 5DN6D 4Y79A 2HLDD 2EEGA 4ZHLU 4Q2QA 1Z1IA 4AORA 1O35A 2C4FH 1C1NA 2M0UA 3SJ9A 2PKSB 1O32A 1RZXA 5FBEA 2JDID 1P57B 2RG3A 1GHVH 3Q77A 8LPRA 2EGNA 1FAKH 3PV5A 1GVLA 1NO9H 2C8XB 5A2MH 4ISLA 4BTIB 2FYQA 3RXRA 1YYY1 4K6YA 1SFQB 3PO1C 2Z6BD 3ENSB 2XNIA 1MTNC 3PYHA 1MD8A 2BD2A 1FY3A 2ZPQA 1MMJN 1O0DH 2ASUB 1B0FA 4HOPB 1EOJA 5GXPA 1LTOA 4Z33A 4MQAA 4K1TA 1C1UH 2UWOA 2FPZA 3F2GA 2ZU2A 3N99A 2R4HA 3QJMA 4Y0YE 1GQ4A 2CS5A 4UU6A 4NXPA 1FONA 1XUIA 2Z9GA 4NNMA 2J94A 3LGYA 1V2QT 2SNWA 1AFQB 5E2OA 2F0AA 2NU0E 2MHOA 3E1XB 1EB2A 2A31A 1A2CH 5E0JA 3LT3A 1P9SA 1KMHB 3A8AA 2JXOA 3UR6A 1O3AA 2C93B 2FI5E 2M10A 1Q31A 3M7TA 1AKSB 1OBYA 5HDYA 2A7CA 3ZVGA 3MQKC 4JJ3A 2EA3A 1RIWB 2XBYA 1ZJDA 1K22H 2B9LA 4OS6A 1E34B 2RA3A 1Y59T 3OE7D 4IW4E 1VAEA 2OBOA 1NT1A 1NFWA 3TPIZ 4YOIA 3MO3A 4WH6A 5CE1A 2GZ8A 4MPAA 3F68H 3RXJA 2R3YA 3A7VA 1OS8A 2ZECA 1BHXF 8ESTE 4E05H 1A7SA 3F9EA 4H11A 2SGFE 5G1EA 2CXVA 3DFLA 3BIVH 3OSYA 2ZCLP 4CRDA 3A7XA 1LO6A 2Q1JA 5EXLA 2TPIZ 3M5MA 2X7ZA 3RXDA 5I46H 2DJTA 5E22A 4IBLH 5IYTA 3DJ3A 1Y7NA 2EHRA 2A0QB 1G3CA 1P8VC 4AG2A 3MO6A 4NG9H 2DB5A 3RL8A 3RXPA 2KRGA 3QLPH 1MTUA 2KJDA 1P09A 3R3GB 2BXTH 3FZDA 1VKYA 4BNRA 1ZMLA 2ZFPH 4NA9H 4NXQA 2HALA 2AMQA 1QAVB 1DOJA 2A45B 2AFQB 2KPLA 4BOHA 5JB9S 3RXEA 4RT0A 1OBXA 4JORA 2QF3A 1BRCE 4LXBH 1AIXH 1E37B 3PDZA 3K2UA 2ZU3A 1YPHC 1QR3E 1GBDA 2VWNA 4J2YB 4ABBA 1H1BA 3MTYA 1G32B 2IJOB 3QZQA 5GDSH 2BVXH 1MKXK 4D8NA 1AZZA 2IWPA 5EZ0A 1ZSLA 4Q63A 3SI4H 1KXBA 1S84A 1W8BH 2W7RA 4CRGA 2BDCA 1C5YB 4Q2NA 4JOGA 1W12U 3TU7H 1IU0A 4Y6DA 3F0PA 3E3TA 1V6DA 3KQCA 3ZZCA 2EDZA 2FWWA 1VITF 4KTUA 4IS5A 4NMRA 3TH3H 1LKBA 5ESTE 1UTQA 3L3TA 3ATLA 4X2XA 2WHXA 4FUJA 4E35A 3QDOA 1YPHE 3OY6U 1C2EA 3B8JA 1WHAA 2PSYA 1Z87A 2YMSD 5DP7A 1A3EH 3T2NA 2SGQE 1BZXE 4AG1A 1OP8A 1FY8E 1GBIA 1BRUP 4K8YA 1MTNB 4IMQA 4RKJB 9ESTA 1TLDA 1Z6EA 3PMAB 4DT4A 1INCA 1DFPA 1UJ1A 4NMSA 3H7OA 4JZ1A 2BVRH 1E0FD 1HRTH 1MTWA 2A7JA 3AAVA 1GQ5A 1MTVA 1MTSA 3T29A 1TX8A 1A3BH 5K0HA 1D3DB 2GD4B 1HGTH 2GCHF 3AXAA 3LNXA 1C5LH 1ACBE 1DSTA 1O2QA 3FP8E 2OQUA 4NA7A 4H6TA 3T28A 3FZZA 1TBQH 3NPSA 1BTHH 1TOMH 3TGIE 1C2MA 1CHGA 1BDAA 4JOPA 1TALA 1UW7A 1S6HA 1CGJE 3VQFA 1RRKA 1MKXH 3LC5A 3RMMH 3I18A 3SU1A 3P95A 2KPKA 3TSVA 2F43B 3HKJB 2WL7A 1JRSA 2ZHQH 3M36A 3GS9A 4A92A 2ZFSA 2HE2A 1HDTH 1ZJKA 1GHWH 3A8CA 1GWAA 3SV7A 3A84A 2BOKA 3TJUA 4YT7H 2F91A 4UEHH 3ZIAD 1BMLA 1HJ9A 2UUFB 4D7GA 2BY5X 1QFKH 1SGPE 1A0JA 2A5AA 1C4Y2 1FDPA 1XX9A 2GDDA 1TGTA 2XCFA 4B2BA 2DLSA 5TCAA 2G00A 3MNSA 4E3BA 2E7KA 1HAIH 5GNDA 1V2NT 1C9TA 2P95A 2VIOA 1SGCA 2BDHA 3QDZB 3RP2A 1PYTC 2ODQA 3P8OA 2WINI 6GCHG 1P2OA 3SUZA 2PKAA 1GGDC 1ELTA 3VB4A 1O3FA 2ZA5A 3MH6A 1GDQA 4WXVA 2OSGA 4Z6AH 4INHA 5BPEA 1BMMH 1AO5A 3KDGA 5F53A 3V12A 4OEOA 3BTQE 1HAVB 3M35A 3P8GA 4REYA 1TE0A 1V2LT 2OTVA 3MU0A 1AUTC 2OQSA 1GI6A 1J16A 1QHRB 1OZIA 1E36B 1PJPA 1C2JA 4PQWA 3D62A 1GVZA 1NFYA 1ZYOA 3O8RA 4U2WA 5HMAA 3QZRA 1C5ZB 4ZHAA 2CMYA 2Z3DA 1H8IH 3A87A 3F2FA 2XWAA 4X8VH 1O31A 2G55A 1QBNA 5DTHA 3CH8A 5T6GA 4DURA 2QXGA 2OK5A 2ODPA 1EZSC 2HNTE 1NM6A 1ANCA 1NTEA 2QE7D 1NF3C 1GBLA 2QF5A 3BEFB 2VIPA 5LH8A 4WF8A 1XZ9A 1TNJA 1GBTA 1AI8H 5E0GA 2SGAA 3NXPA 3HPKA 1ELGA 1FV9A 1EJAA 4P2AB 3WWFA 2ZPRA 1ELAA 1D6WA 1F5RA 4YXWD 3MO9A 4R0IA 5JPMH 2F83A 5TCCA 2ZCHP 1HAXB 1V6BA 4ZAEA 3M61U 3ZV8A 1W9OA 1SBWA 4NSVA 3QGJA 3FAOA 1O5FH 3LGWA 4TPIZ 1OWHA 1DWDH 2NWNA 2Y7XA 4X8TH 1NROH 3EGHC 3RXLA 1OXGA 4JK6A 2K1ZA 4O3TA 4YDPA 1A5IA 2NU4E 4Q6HA 5H4IB 1WFGA 1OWIA 3GDSA 1QB6A 5DGJA 4OS1A 3U98H 3O8CA 2O9QA 2AWWA 2Y5HA 1V2ST 3K50A 4H6SB 3Q00A 3RXOA 2F9OA 4CREA 3A80A 5F6MA 2QAAA 3SN8A 1F0SA 1GI7B 2WZQA 2EY4C 2XRCA 1NRRH 1O2KA 2QF0A 2FOBA 3U9AH 5FHTA 5EIYA 1MCVA 1N7FA 2M0VA 2EEHA 1G30B 2J98A 3SNCA 1VCPA 1OP0A 1PQ5A 1O2YA 3GICB 2EDPA 1NRPH 1KTSB 3KQEA 1AHTH 1V5QA 2HGAA 2YUBA 1P2NA 1UTMA 4RSPA 1GJ6A 4X6OA 4K2YA 1OOKB 3LKWA 5F8ZA 1MBMA 4FUDA 2GDEH 1FAXA 3O5NA 2B8OH 4XBBA 3QK1A 1AWFH 3H5CB 3MU5A 1GGDB 1KLTA 5T3HA 3T5FH 1O3CA 1MU8B 4A5TS 3R0HA 3TSZA 1KXAA 2GCTC 4SGAE 1CA0C 1EQ9A 2PUQH 2EEJA 1XKBC 2A5KA 1U38A 4I33A 4LMMA 1FN8A 1N6DA 5FCRA 5JXBA 2CJIA 5HETA 3DD2H 2H3MA 2BY7X 1C1WH 1BQYA 1S6FA 3W94A 2GT8A 1SPJA 1WOFA 1G9OA 5G4BA 2V6NA 1GJAB 1AVGH 4Q4LA 1QA7A 2I04A 3K6YA 1NRNH 2CHAC 3HVQC 4TPYA 5F8XA 5ETXA 2ZF0H 1CHOF 2QGRA 1FNIA 1QRZA 4E06H 2AIQA 5EQQA 2KQFA 2J97A 1HXEH 1QY6A 3KYGA 4ZMAH 1KTTB 1TFXA 4AFQA 6CHAC 1GHZA 3GCTF 1O3GA 4IMZA 1MZDA 1YPEH 2YTWA 1GL0E 1O38A 2VVCA 1SQTA 1W9EA 3NFKA 1SHHB 4VGCB 1EJNA 4JOHA 2GKVE 3ZZ8A 1PPZA 3UQVA 3DA9B 3K9XB 1ZHPA 1O3DA 1ZRBA 2BOHB 1BTPA 4AYYB 5ILBA 5T6FA 5HYOA 4TYDA 2G51A 1VITG 1EPTA 4NZQA 1ETRH 2ZTZA 2KCOA 2Z17A 2ZGHA 2JOAA 1GMHF 2L4TA 2RCZA 2WYJA 3SW2B 1THPB 2FP7B 5HKKD 1GI1A 2P59A 3SI3H 1VJ9U 4XOJA 1G2MA 3KQBA 4DW2U 2BMGB 4Z1MD 3ODDA 2K0QA 2H5CA 2GP9B 1C1MA 3B23B 1MUEB 1TGNA 4IC6A 3E17A 3PMJA 1GJ4H 1A4WH 4B1TA 4NMOA 3NKKA 3Q3YA 3UWJH 5C1XA 4UFGH 3NRLA 1GJCB 4JZEH 1GBJA 2WV9A 4OM9A 4UD9H 4BXSA 1DVAH 2DC2A 5A8ZA 2CK3D 1O2RA 2RRMA 4I8KA 1O3EA 1V3XA 1AB9C 3OEED 2AMPA 5HEBA 1RFNA 2D2DA 3RDZA 1KLJH 2OC0A 3E90B 2XBXA 2ALPA 2C8ZB 4GSOA 2F9BH 3TH4H 1ELDE 2GCHG 1BHXB 1HYLA 3P6ZB 2EAQA 2BYGA 2J34A 1AGJA 3CBXA 1IQNA 5DSFA 1H8HD 3OAAD 2VU8E 2L74A 4ABGA 3F9GA 5HF4A 1B0EA 2PFEA 4K1SA 1PQAA 1AVXA 1Y5AT 2ZNKH 3A83A 3DSOA 3K1RA 1FUJA 3VXFH 1GHXH 1NESE 3TJVA 2BD8A 2PGBB 1GBBA 1S0RA 3UOPA 4WYTA 3TNSA 3I78A 5AVDA 2SGEE 3PRBA 1UK4A 1KWAA 1BRBE 1ZPCA 2L6OA 2XC5A 1A0HB 1ELEE 2BTCE 1QQ4A 3PWCA 3SO3A 2V1WA 1CA0B 2F5YA 1LVMA 3GY5A 1WF7A 1HAGE 4NA8A 1BUIA 4KP0A 4NZLA 2HPPH 4LK4A 3G01A 3M3SA 4OGYA 4M9FA 1G3EA 1DXPA 1DANH 5EODA 1YC0A 2FOEA 4Y8YA 4JJ0A 1O3HA 3SYJA 2PNTA 1KDQB 1CO7E 2ANYA 3UB0A 2KAWA 5LPEA 1U37A 1P9UA 4JYUH 2ALVA 2CHAB 1P3EA 1IU2A 3SU6A 1P02A 4DOQA 1SQAA 2ZTYA 3FKSD 4MLFB 3TK5A 2GZ9A 2FM2A 3QO6A 3TNTA 2J95A 4B76A 3SV9A 2KJKA 4A1TA 2A2QH 2HNTF 6CHAB 2F3CE 1Y8TA 1RGRA 2GV6A 4AOQA 1QJ1B 2IWOA 5EJLA 1ZGVA 1LQEA 2OXSA 1G36A 2ZDVH 1SQOA 4XD7D 4MNXA 2W7SA 2VB0A 1J9CH 1EAXA 4CRAA 3TITA 3RMNH 5CDFE 1WCZA 1C2HA 1QL7A 1O3NA 1O2VA 2AS9A 1YY3A 2KAIB 3BTEE 3CBZA 2DAZA 1WSSH 2ZDKA 1T8NA 2RDEA 4K60A 1LQDB 2ZFTA 2JINA 2EGOA 1YKTA 1UFXA 1C2DA 2JWEA 2K8IA 3C1KA 1C5OH 2KG2A 1V2KT 2GJGA 2J9NA 1G3DA 3LONA 4AX9H 3F6UH 1TNKA 7GCHF 2AGEX 2KCYA 2BY6X 2VWOA 3MNCA 2C8WB 3PLKA 3QGNB 4XSKU 3RUOA 5JYIA 3M3VA 1MBQA 5L2ZH 5T6DA 5LGOA 1H9IE 4U30A 1EZUC 2QIQA 1H8DH 1IAUA 5FBIA 2F4LA 2FLBH 5HFBA 2BDGA 1WYKA 1PPBH 3A82A 4WVPE 1IQKA 3AAUA 1C1TA 3GY2A 1AB9B 3E16B 1TQ7B 2BDIA 4PROA 1C5VA 1FC6A 2G4UA 1YLDA 2H3LA 3RXAA 3RLYH 2FI3E 1UO6A 4YT6H 2OD3B 4UFEH 4F48B 1O33A 4X6MA 4X8UH 5ABWA 1VITH 1F2SE 1UVSH 1XUFA 2WPJS 4EDJA 2R9PA 3CENA 1BFEA 3NK8A 4NNLA 1F92A 3B76A 3ZZDA 4P00A 3QTOH 4WXIA 4GPGA 3CS0A 3TK6A 8KME2 1P04A 2LNCA 1MC7A 1GDUA 4JOKA 5EPNA 2P93A 2Z3CA 2VSPA 1C5XB 1ZPBA 1DY9A 1CE5A 1SKYE 2FO9A 2FX4A 4Q2OA 1RJXB 3RMOH 2M5TA 2TGAA 2RA0A 2UUKB 3SORA 3QE1A 3RLEA 5D13A 2A1DB 2ZGBH 3CC0A 2PWXA 3RXGA 4OGXA 2LPRA 5JBCS 3DSPA 1K2I1 1VGCC 3CNRA 1O3PB 1YM0A 3KL6A 2FS9A 1EZQA 3SZNA 1S6LA 1T8LA 2ZDMA 3QUMP 1GI5A 2Q3GA 3FFGA 3VEQB 5PTPA 5HFCA 3EQ0H 3NCLA 4XE4A 1P1EA 3P8FA 3KDKA 4FUCA 2H2ZA 2IWQA 1SL3A 3A8DA 2SFAA 1PFXC 1ZTKA 3LIWA 5JBBS 3U1JB 2KV8A 3DIWA 1P2KA 3A7YA 1UM7A 2I4SA 2FOMB 2KFWA 3F1SB 1KXEA 4M7GA 1W3CA 1HAZB 1O2SA 4ZROA 1TONA 2F9NA 2VWMA 5C1YA 2JIKA 2VJ1A 4Q7YA 3V13A 4JMYA 4OS7A 2L4SA 4A1XA 4ZKSU 1UJDA 3F9FA 1BCUH 1MAYA 3UIRA 2JH5D 4ISHH 5L6NH 3BN9A 1LHFH 5HM2A 4NCYA 2FTMA 1GBCA 3PMHB 1AVWA 1AMHA 4WH8A 1Q3XA 2Y82A 2YMSC 1FY5A 5DP3A 1Y3VA 1K28D 1EFRD 4ZKNU 3RC5A 2GX4A 3O8DA 2EV8A 4AFZA 1N8OC 4BAHB 5KEDA 4R8TB 5DK1A 1GCDA 2A7HA 4D9QA 3SUGA 1PPFE 1E79D 1LPGB 3SHUA 1CHOG 2BLVA 2FEQH 4A7IB 3VB5A 5HFDA 2W7UA 1F5LA 2AWUA 2OGPA 2VIQA 4K72A 1SFIA 3BTFE 2YT7A 3E0NB 2A4OA 1UHBB 2WSSD 1ZGIA 3Q76A 3UR9A 3HKIB 3GCTG 1P10A 3PM3A 3EA9A 3VB3A 2YNAA 2EJYA 2ZHWH 3TLOA 1F0RA 1MKWK 1TB6H 1O2IA 1CGHA 5FB8C 3GYMA 1W0KD 1JIRA 3PO1B 4HG6A 4O3UA 2LC6A 2FMJA 3S9CA 2G4TA 2PKTA 3ZV9A 3SUFA 1JXPA 4Z8JA 1W13U 1Z6JH 4HGCA 1TNLA 3ZVDA 4NSYA 3URCA 1QA0A 1R6JA 3N7OA 2FN5A 4XFQA 7ESTE 3CYYA 1V2UT 3PTNA 1GMHG 5DP8A 2HGTH 2C8YB 2CF9H 2FX6A 5L2YH 3HPTB 2ZDAH 1XMNB 1LPZB 1V2OT 1SGFA 1PPGE 4ABFA 3BPUA 3H09A 2Z94A 1P0SH 2VWRA 1XVOA 2UWPA 4FUIA 1Z86A 1HAPH 1A46H 2XCNA 2HPQH 5JB8S 1NS3A 4X0WU 4CH2B 3EGGC 3D65E 1AY6H 1O2MA 1OWDA 1Z8JB 1EOLA 1Y5BT 1O37A 1ZSKA 4GHNA 1G3BA 1W10U 4R2ZA 2HLCA 2C90B 3RXKA 4MPVA 1ZOMA 1RTFB 4X6PA 1EASA 1Y3YA 2ANWA 1WTHD 2QXIA 5DO4H 3DUXH 4F4OC 1FIWA 1VGCB 4YO9A 2VIWA 2FOAA 3SU3A 2BDBA 2AWXA 1JMOH 2ZWLH 1HCGA 2WV4A 3OY5U 4D9RA 2OCVB 1Q7XA 4LZ4B 2DMZA 2KOHA 3MHWU 1QQUA 2JJ1D 1YPLH 1O3KA 1CT2E 1WIFA 4TWYA 1BTUA 1EAWA 1N6FA 2PUXB 1A1RA 3A85A 2TGDA 5G1DA 1DWEH 2ZI2H 1TQ3A 1GDNA 4K75A 4OS2A 2JIZD 1QRXA 4Q3HA 4INLA 2ZU4A 4AZ2B 4B2CA 2ZIQH 4RI0A 5H3JA 3TK9A 4CBOA 5DP5A 3MMGA 1W7XH 1X5NA 1ANDA 1TNHA 4FLNA 4GCHG 1ARCA 3RU4T 2H2CA 2YMSB 4FETA 3ZRTA 1VR1H 1J17T 2HNTC 4YLQH 1Y5UT 2IN2A 4ZUHA 4HI3A 4HOPA 4X1QU 1N8OB 4NGAH 3RM2H 3UWIA 3V0XA 1FI8A 1HIAB 2XC4A 2Z9KA 2JSNA 2D8WA 1C2IA 1UVTH 3MU4A 3U8RH 3N7EA 1TPAE 2ZKSA 1IQGA 1P03A 1TQ0B 1IHTH 5I7ZA 3KQDA 4MTBA 2FNEA 1ELBA 3ELAH 2FTLE 2G52A 4KFVA 2ULLA 2PSXA 2BD4A 2UWLA 1UCYE 3P17H 1JIMA 2ZPSA 7LPRA 1HFDA 3KGPA 1HNEE 1AKSA 1H8ED 1O2UA 1T4UH 3OX7U 4FOUC 2ZPLA 1XUHA 3T27A 2ZGJA 3CP7A 2FOFA 1C2LA 3ID1A 2LELA 2VSVA 2SNVA 2VH0A 2ZG0H 2D1JA 2H2BA 1BMFD 1WDIA 4DG4A 1B7XB 5DG6A 3PV2A 4HZHA 2W4FA 4AB8A 2EDVA 4NIVA 5HFEA 2H9EH 1TNIA 4UONA 2J4IA 1F0UA 5DPAA 1C4V2 4Y8ZA 1TBRH 4AGJA 2KOJA 2HRVA 1BJVA 3MH5A 3E8LA 2P3UB 1O5EH 1ID5H 1SGDE 1TIOA 6ESTA 3UNRA 1ESAA 4A6LA 1ZRKA 2J2UA 2A4GA 7GCHG 1TMBH 3HGNA 2A4RA 3RXVA 2PKUA 1X9ZA 3QJNA 1IOEA 1DE7H 3LC3A 4MPUA 2XBVA 4IC5A 1X5QA 1V2WT 1PQ8A 1JWTA 4JCNA 3O46A 2M3MA 1OYQA 1P05A 2JILA 1AE5A 1QAVA 4L8NA 1MZAA 1CSOE 2PA1A 2BM2A 3LPRA 4BXWA 1CQQA 2NU3E 4NIWA 1XXFA 4BAQB 3I1EA 3OTJE 1DXWA 1TX6A 3FANA 3TIUA 1YCPK 3NUMA 3PMBB 2PP6A 3OYPA 4K8BA 3U8TH 2I0LA 1N6XA 2BD3A 3P8NA 4P02A 1YF4A 1G37A 1X45A 1DICA 4Q7ZA 3A89A 2VH6A 4FVDA 1UITA 1NZQH 1KY9A 3ZYEA 2PW8H 1KIGH 3KN2A 3MWIU 2IPQX 1KSNA 3BTTE 3NZIA 2VPHA 1BBRE 1HXFH 3DCLA 4ZH8A 3SJIA 2GV7A 1L6OA 1N6EA 5C2ZA 1V2VT 1CBWC 3FVFB 1YBWA 5C20A 1C5NH 1CU1A 1MABB 5EPYA 3LJOA 3U8OH 3RXCA 1Z71A 1UVPA 3UTUH 4NMQA 2GGVB 3EE0B 5DKMA 5DP6A 3DHKH 2ZGCA 3RMLH 2DE9A 2ZHEH 5HEYA 1OPHB 1SC8U 1GI9B 4FU7A 1PPEE 2G5NA 4ABJA 3ESTA 5KGOA 1K32A 1V2RT 2OZFA 2VRFA 1TPSA 3SJOA 1UM1A 1BJUA 2V7QD 2XW9A 1YCPM 3MYWA 3LOXA 4TY6A 1C1QA 2V3HH 4MDSA 2Q6FA 1SB1H 4FUFA 1W7GH 3MH4A 3KCGH 5DP4A 3SHCH 3SNBA 2UUYA 3GY3A 1T4VH 3WW7A 2Z7FE 5C67A 5GWZA 2PLXA 4DCDA 1NU7B 4WY3A 1J8AA 3EAJA 5EG4A 1ZSJA 1VA8A 3RL7A
chains in the Genus database with same CATH topology
3GABA 1GL1A 1SLXB 1XXDA 2J38A 1UEQA 4BAKB 1GI2A 3D49H 5IDKA 1K1JA 2FOCA 4JOFA 9LPRA 4O9VA 1ANEA 3T26A 5AFZH 1XM1A 2XC0A 3ZZ3A 2ZGXH 5A0CA 1W2KH 1U3BA 3BTWE 2CF8H 2J92A 1LCYA 1HV7A 2QV1A 1O2GH 2R0LA 2DLUA 1NY22 3LJJA 4F8KA 3BTGE 2W26A 4WWYA 2A4QA 4BTTB 5HEDA 3QGLA 1DM4B 2OUAA 1GBMA 2MX6A 4J1YA 2DM8A 1ESTA 1O2TA 2R0KA 3M5NA 4AGKA 4Z0KA 2O8LA 1Q3OA 4GHTA 1EB1H 2PTNA 1B5GH 1BMAA 1Z7KA 3KZEA 3LU9B 1C2KA 2FZZA 3S0NA 4MNWA 1SGFG 4WMEA 1NRQH 1ZMNA 4Y10E 4CR5A 3GSLA 2BX3A 4I8GA 4X8SH 3RXIA 4HFPB 1O2HA 2P3TB 3RXFA 5A0BA 2WPHS 1LHDH 1LVBA 4GLYA 4CRBA 2FDAA 1ZTJA 1XUGA 3BIUH 2F9VA 2PTCE 1VJ6A 1BTXA 1QNJA 2Z9JA 1T8OA 5GPIB 1RS0A 4B75A 1V2JT 1ELCA 2KYLA 4FUGA 1LMWB 3NFLA 2W5EA 2AH4X 3E91A 2HVXA 3RU4D 1L1JA 3EA8A 4K69A 3RU4E 1W14U 3V7TA 2UUJB 5F8TA 1KEFA 1EATA 2C3SA 1AD8H 3AASA 3QX5H 4K76A 1O30A 1QURH 5LPFA 2BXUH 1IQHA 1ZLRA 2IPHA 5E11A 3ZZAA 1HAVA 2KA9A 5F3XA 1SGIB 5A8XA 2PZDA 1GHAF 1S83A 1GMDF 1UEWA 4JL7A 2F9PA 3SNDA 4Y76A 2G2LA 2FI4E 5FCKA 1BT7A 2CSJA 2IWNA 1FMGA 1VCQA 4I32A 3ID4A 1CBWB 1BRAA 1BTYA 1Y3WA 5HJ1A 3BSQA 2G81E 2REYA 4IGDA 1UK2A 4ABAA 1F7ZA 2JREA 1SR5C 3SJ8A 2M0ZA 3SNAA 1E38B 2LUIA 1S82A 1YPKH 3EGKH 3M5OA 4JZFH 2BLOA 2A32A 2XXLA 1BMNH 1RY4A 2JKHA 1T31A 2QYIA 3R69A 1SHYA 2GCTB 3A7TA 2R2MB 2XWBI 4FVBA 1GBFA 4ASHA 3IITA 1PPCE 1Q3PA 1AFQC 2GEFA 1SGTA 3M7QA 1GG6C 1D3TB 5EXNA 2AINA 3ID3A 3A7ZA 3C27B 3ZVFA 3I29A 3A88A 4GCHF 1TPOA 1T2MA 1FY4A 3GY8A 4X2YA 4N6XA 1SLVB 2BQ7B 1LVYA 4UFDH 1P12E 3STIA 4Q2PA 3SNEA 3BV9B 2BDAA 3MNXA 1UHPA 2PV9B 1GM1A 2FS8A 3CS7A 7KMEH 5B6OA 3I77A 4ZXYH 2CSSA 2YT8A 1I92A 4DIIH 1LPKB 1QGFA 1ZMJA 3VPKA 1SLUB 1P3CA 4KGAA 3A7WA 1KXCA 2GTBA 2K20A 3QN7A 3ZVEA 1IQEA 4AMHA 5EQSA 2ZQ2A 3SU4A 4E7NA 4CR9A 4TY7A 1V1TA 2M0TA 5HFFA 1BTZA 5GLJA 1QJ6B 2I6SA 5ESBA 2D90A 1K1LA 5JDUB 3ZVBA 2OQ5A 2QCYA 2O8MA 3SJKA 2Y5GA 2OCSA 2ZHFH 3MOCA 3ZZ4A 1BE9A 1O3JA 2P94A 1A5HA 4DIHH 1MQ5A 3DJ1A 2OC7A 2G5MB 3QWCH 4D7FA 1T32A 3RXTA 1HBTH 1TWXB 1UTOA 3AW0A 3GISB 2THFB 4ISOA 5I25A 4FUBA 1DS2E 3UNQA 5EQRA 1BITA 4LOYH 1H9HE 2B0FA 3ZZ5A 1NTPA 2D92A 1O2WA 4NIXA 1WQVH 1YPGH 3KZDA 2K1QA 1YPJH 2H9HA 1P2MA 2YNBA 2VVV