3GDUA

Crystal structure of degs h198p/d320a mutant modified by dfp and in complex with yrf peptide
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
316
structure length
294
Chain Sequence
DSTDETPASYNLAVRRAAPAVVNVYNRGLNEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINPGNGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREQGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMAQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title OMP peptides activate the DegS stress-sensor protease by a relief of inhibition mechanism.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase activator
molecule keywords DegS protease
total genus 57
structure length 294
sequence length 316
chains with identical sequence B, C
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3gduA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gduA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gduA01
2FZZA 4I8GA 1AZZA 4ABIA 2LA8A 5I7ZA 5F3XA 3SU3A 1W2KH 2AH4X 1WCZA 3UTUH 1ZHRA 2ULLA 2FI5E 2G52A 1C1PA 1FJSA 1AE8H 2NU2E 4U01A 2VWOA 1M5ZA 2SGEE 4LZ4B 3ZZ6A 1P1EA 4XE4A 1DFPA 3UIRA 1LO6A 3GSLA 2KBSA 2AMDA 3UNQA 2UWPA 1CA8B 1BOQA 1Q3PA 3V13A 2P16A 3RXMA 2M10A 2R9PA 2PNTA 1HXEH 1P9UA 2PR3A 1MH0A 5FB8C 1DANH 2BOHB 4PROA 3TJNA 1BJUA 2O8MA 1OPHB 1E38B 4YYXA 1SFQB 1T7CA 1WU1A 4AB8A 2UUFB 1S6HA 4FUCA 2RCEA 2ZZUH 4UFFH 4KFWA 1Z7KA 2KRGA 4DGJA 3M3SA 2PKUA 3AVZA 1C5YB 1J16A 4JZIA 1Z6EA 1ABJH 5JBBS 5A8ZA 2WYGA 2FYQA 2EDPA 1T8NA 4AX9H 1C1TA 3SGQE 1GMHG 1XX9A 3RXRA 2AINA 1GI1A 3VXEH 1WI4A 1FDPA 1X5NA 1X7AC 2I1NA 1GCDA 1OP8A 4I33A 1TP3A 1O2RA 4NA8A 5A8XA 4E7NA 3TGKE 1ETTH 1BA8B 5F8XA 1ZPZA 5ESBA 3E8LA 1GBCA 3QTOH 4AORA 2GMTC 1SGYE 3A87A 2A7CA 3QWCH 1V2PT 1W14U 3ZZBA 3RU4T 1KDQB 1ANCA 4MNWA 1GL0E 4BAOB 6GCHG 3TK5A 1OX1A 2ZHEH 2VU8E 1P3CA 1Z86A 1OOKB 2A45B 1O3JA 3ID4A 3LJJA 4RKOB 3S7KB 3MOCA 3V3MA 4K1EA 5LH8A 1AQ7A 1GBMA 2XBYA 5G1EA 2P8OB 1GBKA 4IS5A 1C2MA 2ZEBA 3EYDA 4MDSA 1ID5H 1RTFB 3VQGA 3TSVA 5EG4A 2F5YA 1GJ6A 3QDZB 3K82A 2EDVA 2G81E 2E7KA 2VZ5A 1BTXA 1UO6A 1ZZZA 5DJ7A 1UTKA 2TGPZ 1V5LA 1FY8E 3PROA 1P1DA 3PTBA 3PYHA 3V0XA 2L97A 1L2EA 2VIDA 4K76A 3MO6A 2ZPRA 1U38A 2OTVA 3NGHA 1AB9B 4ISIH 4FUJA 3ZVAA 1QJ6B 2Q3GA 4X1RU 3PLBA 2GZ7A 2PZDA 4XOJA 1AVXA 1BQYA 3DFJA 5FAHA 4JL7A 2C3SA 5C2ZA 3QLPH 4FUFA 1C5OH 1TNLA 3GCNA 1AI8H 2BXTH 4Q7XA 3U8TH 1DLKB 1KLTA 1OS8A 2OC7A 4K3JA 4A5TS 1P2MA 2ZDVH 3SHCH 1J14A 4Y0YE 3MH4A 4O3TA 2MX6A 3BV9B 2HNTF 5C5OA 2KAWA 3E16B 1AVGH 1P57B 1MCVA 2XBVA 3VEQB 5HM2A 4ZROA 1WYKA 4O03A 1HJAB 3M5LA 2ZFQH 2PW8H 1TGBA 1GHBF 2ZCHP 1O3GA 1V2KT 1C5UA 1DWBH 1RIWC 4NA9H 5EXMA 1K2I1 3A8BA 3P95A 3MFJA 1TRMA 3EAJA 2PLXA 1JXPA 4AN7A 1T8LA 3SV9A 2SNWA 1XUHA 4KGAA 5C1XA 1O2IA 2OD3B 3UR6A 2RCZA 1DSTA 1ZLRA 2W7SA 4Q2PA 4MVNA 3URCA 4JOHA 4CRAA 1ELVA 1BMLA 1WV7H 7ESTE 3DIWA 1MQ6A 1FZZA 3P92A 3ID2A 3BTFE 2XWAA 2EXGA 1SOTA 4LK4A 3SORA 1O2NA 4WXVA 4U30A 2Y5HA 1UITA 3LGIA 2I6SA 4FVBA 4BTTB 5DP7A 2EJYA 1V2WT 1D4PB 4CH8B 1UK4A 2ANKH 2GDEH 3KGPA 5CHAB 1K1JA 5B6LA 4GPGA 4WVPE 4J2YB 5DKMA 1QRZA 2B9LA 2CJIA 1JOUB 1HAIH 1N8OC 3GOVB 1KLIH 2EGOA 1GDNA 1K1PA 2KPLA 3FAOA 2BY7X 2A4RA 3JZ2B 3GCTF 1MAXA 2WPLS 1UF1A 1HB0B 1UMAH 3OY6U 3TK6A 2C90B 1GGDC 2BLWA 5EXNA 5C3NA 1Z8JB 1V2LT 4JOKA 1W11U 4CREA 3GY6A 1CBWB 4GHTA 2QV1A 4NA7A 1SHYA 1I92A 3SZNA 1QRXA 1LHFH 2D90A 5A2PA 1ESAA 1GG6B 2EGNA 2W4FA 1THPB 1TGCA 2JWEA 1G9OA 2FXRA 4XDEA 3E0PB 1PQ7A 5HJ1A 1WUNH 3ZZ4A 4MPUA 1F92A 4ABAA 1D3DB 4WJG2 1BDAA 1QRWA 3BEFB 2BD9A 3S7HB 4MPWA 4O06A 1BB0B 1Z8IB 1INCA 1MZAA 1LDTT 3BTDE 1MTVA 2NU1E 4HTCH 4TYDA 1UK3A 1XXFA 5JXBA 1Y59T 2VVCA 3RXQA 1BRCE 4INHA 2OMJA 2F9NA 2VIWA 1G2MA 5GCHG 4Z33A 1RRKA 3LGYA 1B7XB 4X0WU 2QIQA 1GWAA 4JK5A 2EI6A 3KN2A 2Q6GA 2JOAA 1YCPH 1N6FA 1CA0C 4F49A 1FAXA 4YLUA 4RSPA 4B75A 3F9FA 4NIYA 1VCPA 5E8EH 4ABHA 1HDTH 1ZOKA 1OWDA 3ZZAA 3BIUH 2A5AA 5SGAE 3GDUA 2AYWA 3ATMA 3A82A 1O2OA 4I8HA 2FS8A 1EP6A 5A0AE 2EI8A 1F5LA 2VH6A 4OS7A 1OWHA 1NTPA 1NFYA 4O9VA 3OU0A 4RN6A 1R6JA 2ENOA 3MU4A 1PPBH 3SUEA 1GM1A 2IN2A 3LGUA 8LPRA 2OSGA 1Y5AT 1O2KA 3RMMH 3KQBA 2WINI 2ZHQH 2HWLB 2QF3A 5J4SA 3GY8A 3RLYH 2OINA 2H2CA 3TGJE 1EB1H 3M3TA 1C1NA 3PDVA 4ZKNU 2PGBB 1T31A 1W0YH 4INKA 1C1RA 3A81A 2ZNKH 3M3VA 5D13A 2PTCE 2KV8A 3ZRTA 1UTNA 2BDCA 4REYA 4CR9A 4AYVB 1RTKA 4PQWA 3NZIA 2EEGA 3R0FA 1WIFA 1C2KA 3OYPA 3RXHA 3SU2A 2H2ZA 3F1SB 1ZRKA 4Y7AA 2ZU4A 1CHOG 4X6PA 1GMDF 1TGTA 1EJNA 2ZGXH 1Y3WA 1OBYA 3RXKA 4Y79A 4WMDA 1OBZA 1A7SA 3DUXH 3M35A 4J1YA 3I78A 1KXFA 5L30H 1BMMH 2P95A 2VVUA 3A80A 1TGNA 4ABBA 1MZDA 1DICA 1TIOA 1ZSLA 3B9FH 3RLWH 3KHVA 3BIVH 2GCHF 1T32A 2TRMA 5E11A 3VGCB 2HLCA 5FPSA 4CRGA 4IMQA 4X2YA 2DAZA 3LC3A 3SO3A 5A0CA 2IWQA 1TPPA 3MU1A 1ZHMA 2XC5A 3FP7E 3LU9B 5LPRA 1THSH 1FI8A 2V35A 3K6ZA 2Y7XA 5A8YA 1C2DA 2W5EA 1Z1IA 1EZQA 1JRTA 4NWLA 4YO9A 1S6FA 2AGGX 4Z0KA 2BLVA 1TMTH 1PPFE 3UREA 1GJ7B 1TX7A 1CA0B 2JKHA 3U1JB 2VIQA 1U39A 2BY6X 1GHWH 2Z6BD 3RM2H 1WHAA 3MMGA 4AB9A 1P2KA 1V2QT 2C8XB 2A4GA 5E6PB 1GBFA 4X2WA 1C5VA 2OBOA 2C4FH 1O3OA 4HOPB 1FV9A 5E0HA 1IQHA 3GCOA 2W3IA 2H9HA 2YNBA 1LHDH 1SMFE 3U8OH 5EYZA 4E34A 2FX4A 2HPQH 3MYWA 5FX5A 2A7HA 1TGSZ 3ZV8A 1EATA 2VIVA 3PO1C 1AN1E 1C9TA 1Y3VA 5JDUB 1XXDA 4GLYA 1MKWK 2FOGA 2WV5A 2Z9GA 4MPXA 5DP5A 1DX5M 3ZVCA 1N1LA 1QAUA 4MTBA 1UJVA 4JYTA 1FN6A 1SQTA 5CHAC 3MH7A 2CHAB 3KEEA 4GHQA 3BTME 2O8LA 3ZZ9A 5JYIA 3RU4E 5FPTA 2R0LA 2GD4B 1C1MA 1EZSC 3HATH 2KOMA 5L6NH 1VGCC 4K72A 1H9LB 1MQ5A 2XBWA 3VB5A 1G3EA 2QG1A 2W7RA 1HBTH 4A6LA 4TPIZ 1ZOMA 3DT0H 4E05H 1YPLH 1EJAA 3M7TA 3MTYA 4WY3A 2BB4A 3PLKA 3GDVA 2FP7B 1DSUA 4ZAEA 3URDA 2V90A 3RMLH 3I18A 1WQSA 1LMWB 2GVFA 2GTBA 3UWIA 1XZ9A 2ZU5A 4XBDA 2CSSA 1SPJA 1VZQH 5CMXH 2UWOA 2XTTB 1ELEE 3P6ZB 2VGCB 2CF9H 2QT5A 3BG4C 1RXPA 5E0GA 1BBRK 1EXFA 1RGRA 1MTSA 1THRH 4BXSA 1IU0A 2ZPMA 2XCNA 5AHGH 3JZ1B 1BRBE 3F9GA 2DJTA 3RXSA 4JZFH 4Y8ZA 1TE0A 1XVMA 2PKSB 1TONA 3AW1A 3ID1A 4BTIB 5EZ0A 1IQEA 4P2AB 2ESTE 5A09A 1SGCA 2OC8A 1ZYOA 1IHTH 2JIKA 1UVUH 1K1IA 4R0IA 3RMNH 2FOCA 2TIOA 1LPGB 1UJUA 2ZF0H 1W10U 1QB6A 3MU5A 1ZPCA 3HKIB 2FO9A 5L2ZH 1QGFA 5C5NA 1IQLA 4NNMA 2FIRH 1GHAF 4GSOA 4OEPA 1BTWA 1HAZB 1FY1A 1NO9H 3A7XA 3EE0B 2Y81A 4ABGA 1T4UH 2ZGHA 4Y6DA 5C1YA 4Q2NA 1RIWB 4CRBA 1AFQB 1O5FH 3OX7U 1NT1A 2BDHA 4OS5A 3TSWA 3CENA 1UM1A 1MFLA 2JILA 4Q3HA 3TH2H 4B74A 5GIBA 4ZXXH 3LIWA 1W9QA 1JIRA 1ORFA 1OP0A 4FVDA 3TLOA 4OS6A 2WPJS 1LPKB 2HVXA 1VITG 1C5TA 1RZXA 1EPTA 4LXBH 3SUDA 2SGPE 3FVFB 1GBTA 3D23A 1NFXA 3O8BA 1F5KU 4X1SU 2BZ6H 3L4FD 2OUAA 3SJOA 4X8SH 2AERH 2ZU3A 1N7TA 4O3UA 3L33A 1H8IH 1BRAA 4X2VA 5EQRA 2H5DA 1GI9B 1OSSA 1YKTA 1O2GH 1AE5A 1YGCH 1TAWA 3GY4A 4NMRA 1X5RA 1GMDG 2F9BH 3TH4H 1FCFA 3K9XB 3GY7A 3ZVGA 4WXIA 1IQJA 2LUIA 2BY8X 3ZYEA 1W9EA 1O3KA 3SNCA 3HGPA 1KXCA 3SI4H 4U32A 5FBEA 2ZDNA 2Z17A 1O3PB 4KTCA 3RXVA 3KIDU 1ELGA 4ABFA 2PFEA 1N6DA 1GI5A 3MO3A 4UONA 1IQMA 3IG6B 3E1XB 4Q2KA 4X6NA 3NXPA 2BVXH 3NWUA 3B8JA 5DP4A 2W3KA 2QXJA 3A8DA 2KA9A 1FMGA 1TRNA 1EZXC 4B1TA 2VSVA 2PKTA 2F9OA 4K60A 3SU0A 1K1MA 3K65B 2BDIA 1CT2E 1SB1H 1ELDE 2GGVB 1TNJA 2DC2A 2OC0A 2HGTH 3QO6A 3E6PH 1Z6JH 1EOLA 2PV9B 2QN5T 4AGJA 2FESH 4OGXA 1C1SA 1DXPA 1TMUH 2VWNA 1UM7A 2H3MA 5G1DA 2F9PA 3VB6A 5GXPA 1TABE 2I04A 3FY5A 1AFQC 1WSSH 3CC0A 3LNYA 1L1NA 1V2JT 3RXGA 1J15A 3B23B 4KKDA 3QUMP 5EPYA 1QL7A 1EB2A 2QKUA 1GJ8B 1YBOA 1N6XA 1LHCH 4FU9A 1QB1A 1FLEE 1C1OA 1NU7B 1BE9A 2WPIS 3OTPA 2I4SA 1ETSH 1CHOF 4XBCA 2VWLA 2BVRH 2YUBA 4DCDA 5DGJA 2AIPA 1O3IA 3T2NA 2A4QA 1PQ8A 2WPKS 2B7DH 2FYRA 3JXTA 5E1YA 1MTWA 2WPMS 3SGBE 5EXLA 3BSQA 2BLOA 2BD7A 1O2MA 3TITA 5AFYH 4X2XA 5LPEA 1V3XA 3RC6A 3V12A 3DJAA 2F91A 4NMPA 2A1DB 4MNYA 1HJAC 1GCTB 1P2OA 2KQFA 2KYLA 1A1RA 1QURH 3PS4A 2ZHWH 2CSJA 3K6YA 1P04A 1Q7XA 2R2WU 1C1VH 1C2LA 2FTMA 5AF9H 2K20A 1Z8GA 1ARBA 2GCTC 4DG4A 3CBXA 1BT7A 4XBBA 2JETB 3RM0H 8KME2 1AKSA 3MNBA 3QN7A 1VA8A 3SUGA 1EZUC 5LPFA 2Z9JA 3SHAH 3DFLA 3QGNB 1C5SA 1V2RT 1M9UA 1UVSH 2QXHA 2XCFA 1SG8B 1QBVH 3PO1B 2BQ7B 4D7FA 4JOFA 1NF3C 2A5KA 4BOHA 2V3OH 5HF1A 1RGQA 2KAIB 2Z9KA 1HAYB 4HGCA 4ZKRU 5E21A 4ZH8A 1S84A 1F0SA 2YNAA 3O8RA 1F2SE 2AMPA 2RA3A 2XYAA 1FC6A 1G3CA 1C5LH 1OWIA 1WAYB 4NZQA 1K32A 1Q31A 1CSOE 5A0BA 2PSYA 4B2AA 5HGGA 1QBOA 2ZTYA 3DHKH 4I31A 4ZMAH 4NNLA 1EKBB 1V2UT 3GY3A 3RL8A 1WQVH 3GYMA 2M0ZA 2ZDMA 3MO9A 1A0LA 1MAYA 4OGYA 3A86A 4X1PU 5BPEA 5GPIB 5HFFA 4THNH 1GHAG 5K7RA 2GZ9A 1GBIA 2TGDA 2ZGBH 5E0JA 4DY7B 1C5QA 4D7GA 1GJCB 3M5MA 4IC6A 3TMHA 1TBZH 1SHHB 1OXGA 3A7YA 3A84A 1O38A 1V6DA 2PA1A 3FFGA 1S85A 2ZC9H 1UHPA 1L1GA 4NSVA 1Z87A 1C2EA 2BY5X 3E91A 2LNCA 3ELAH 2ZFTA 3CP7A 2RG3A 1S82A 3LGVA 4Y11E 3U1IB 2FM2A 2KJPA 1P0SH 3FP6E 4Q80A 3SU4A 2WPHS 1SLXB 3VFEA 2G51A 2GDDA 4B76A 2VWRA 8GCHG 3I1EA 2D26C 2PTNA 1C2GA 2GMTB 2NU0E 3F9EA 1L4ZA 4NXQA 1EUFA 2QYIA 1KXAA 5HDYA 4B2CA 2D8WA 4UD9H 1HAOH 2AGEX 1EAXA 3SV8A 1G9IE 4GVDA 2VJ1A 2VWMA 1SLUB 3U9AH 1OBXA 3RMOH 1E34B 4ABEA 3S9CA 3GY2A 1AU8A 2ZIQH 2OZFA 4TWYA 1GJDB 3T28A 1VJ9U 4IC5A 2DUCA 5F8ZA 1GQ5A 1WHDA 1P8VC 1CE5A 1VCQA 1U37A 3WKMA 2UWLA 2RA0A 2QCYA 4UU5A 5EW1H 1CBWC 1P02A 1RTLA 1J9CH 4G69A 1A5IA 1TBQH 1ELFA 3RC5A 1FY4A 3R69A 1P2NA 1P05A 2ZPLA 1P2QA 3ZZ8A 5HEYA 2LC6A 1DOJA 1G3BA 2CF8H 1YLCA 3ZV9A 2AWXA 3RXJA 4LZ1H 1TOCB 5HXFA 2NU4E 1IQNA 4DT7B 1N6YA 1GJ4H 3MNCA 1ZMJA 3MU0A 2QBWA 2M5TA 3AW0A 3RLEA 5A2MH 2XWBI 3N7OA 3KNXA 1KIGH 1UFXA 2ANYA 1D9IA 1PPHE 3SNDA 1S83A 4H6SB 2ALPA 1O2XA 2ZFFH 2ASUB 2Z9LA 4DW2U 1P09A 5H4IB 1Z8RA 1O5AB 1W0ZU 2CS5A 1UEZA 4UEHH 2KAIA 1U3BA 1WG6A 1QL9A 2OLGA 3GCTG 3CBYA 1PQAA 1HFDA 4OEOA 1G30B 2ZWLH 2H1UA 5T6DA 3TNSA 1O36A 3QJMA 1E36B 1H9HE 1WJLA 4AFZA 2WL7A 1GBEA 1YBWA 1C4V2 3IWMA 2MHOA 1GDQA 2G55A 3ATWA 5ESTE 4TWWA 4X8TH 3TSZA 1O35A 1RD3B 3GJ9A 4VGCB 4NG9H 2PSXA 2ZCLP 3VB3A 1N6EA 1O2HA 1BTZA 4Y10E 1ZUBA 3H7OA 1W7XH 1EAUA 1TQ7B 2PHBA 2WUCA 2VVVA 3BTQE 4ISLA 4OS1A 1DM4B 1YLDA 3EGKH 1AD8H 2ILNA 5GNDA 1FIZA 4IN1A 4FUBA 2AGIX 1MTNC 5E22A 4UFGH 3KQCA 4Y8XA 1AMHA 1G37A 1AY6H 4FUIA 2I6VA 5T6FA 1ZGVA 1YP9A 1DITH 4Y8YA 1NRRH 4NGAH 2XRCA 1G2LA 1P10A 4ZKOU 1O5EH 1QHRB 4LMMA 1H8DH 2PKAB 3MU8A 3SU1A 4CR5A 1BHXB 2A7JA 4FU8A 4XSKU 2ALVA 3SN8A 1QQUA 1WBGB 5HM9A 1D3PB 1GMHF 1NESE 2XC0A 3M7QA 4KTUA 1MBMA 5TJXA 3PV2A 3K50A 2UUJB 1KEFA 2ZPSA 1HYLA 3HVQC 4D8NA 2IJOB 1O34A 3VGCC 1SGNE 2ZGJA 4Y71A 1LKBA 3SJKA 3SV6A 1VGCB 3P70B 2G5MB 1MFGA 1TNKA 2A0QB 3ZYDA 3MHWU 5F03A 2W26A 3TPIZ 3E3TA 1UHBB 3BTKE 1NRNH 3NK8A 1HJ8A 2DKRA 1MTUA 2KOJA 2ANWA 3LJOA 1TOMH 1KXBA 3DORA 1MKWH 1WTGH 1ZGIA 2JH0D 2O8UA 1GDUA 3CYYA 2CV3A 5GWZA 3S0NA 2H3LA 2HE2A 1W8BH 1TNIA 3SJIA 3UQOA 2JH6D 2THFB 2F83A 4ISNA 4E35A 3ODFA 1A0HB 1GMCG 4CRFA 1H9IE 1UEWA 4NXPA 4ASHA 1OKXA 1MD7A 2J2UA 1F0TA 3G01A 2XNIA 4H4FA 5FCRA 3MWIU 1FIWA 5EQQA 5JPMH 2ODPA 1VAEA 9LPRA 2QKVA 1KY9A 4Y0ZE 2H6MA 4HI3A 4K5ZA 2FPZA 1A5GH 1SVPA 2PKSC 4Q6HA 1SGQE 1G3DA 2GT7A 4WYUA 4A1XA 4D76A 1HNEE 2OXSA 4X6MA 1GJAB 1O0DH 3A7VA 2EDZA 3U8RH 3K1RA 3R68A 2B5TB 2Y5GA 2QA9E 1V2TT 3KQDA 4TY6A 1O2JA 1A3EH 4DOQA 1A4WH 1W12U 2DE9A 1UVTH 2Z3EA 2AWUA 4O97A 4RI0A 4XHVA 1SGPE 2KJDA 5BRRE 5TCCA 4Q6SA 4A7IB 4WF8A 5J4QA 3SFJA 3ATIA 2L4TA 2QF0A 4K75A 1UCYH 1D3QB 1PJPA 5JBTA 1MKXH 1K21H 4BXWA 1XUGA 2EI7A 1FONA 1A61H 1F0UA 2DMZA 4R2ZA 2ZU2A 3LOXA 4K78A 1KTSB 4NMQA 3SW2B 2CGAA 1AO5A 4CRDA 1C5PA 5C20A 3QZQA 2OS6A 4AG1A 4UFEH 2VGCC 5DK1A 4NFFA 1GJ9B 1CU1A 1GI0A 2SGAA 4JZDH 5DP8A 2OCSA 1SBWA 3ZVFA 2Y6TA 2M0VA 4UE7H 1O5CB 1Y3UA 3Q3KA 1P11E 2C8WB 1F0RA 2FMJA 5HEDA 5HEBA 1BFEA 4D9RA 3RXIA 1FC7A 1O33A 1UEPA 4FUHA 3BTEE 1ARCA 2C8YB 3QZRA 4UFDH 2Z7FE 4WMFA 4E7RG 1AUJA 2LOBA 2EGKA 3TH3H 1GVZA 3SNEA 2H2BA 4WMEA 3SQEE 4MQAA 1D3TB 1SQAA 3EA8A 1AHTH 2FCFA 2G4UA 3LH3A 3HPMA 3O8DA 6GCHF 2AWWA 2P3UB 1VITF 2G4TA 2GCHG 3A83A 1MKXK 1QLCA 3TNTA 1V2NT 3MH6A 2JXOA 3PWBA 1T2MA 1MMJN 1O5GH 1O3EA 5PTPA 4B71A 4ESTE 2WV4A 3I77A 4I32A 3TU7H 1AVWA 2ZP0H 3S9BA 1PPZA 4AMHA 3KF2A 1SFIA 3SJ9A 3SJ8A 1DPOA 5HYOA 1N7EA 3LH1A 4ABDA 5I25A 3A7ZA 4JOEA 1WF8A 2H5CA 2HGAA 4FGMA 3VB4A 4N6XA 1DLEA 2M0UA 1HUTH 1K1NA 1HIAA 1BMAA 2EEHA 2P3WA 4NMVA 3QX5H 3ID3A 1U6QA 4OS2A 4Z6AH 1GCTC 2F9VA 5HFEA 2BX4A 1BUIA 1GBJA 4YLQH 2O8TA 1GG6C 1P03A 3T26A 1TQ3A 3RDZA 2ZTZA 1ZSKA 1P01A 1E35B 4Y76A 2X7ZA 3FANA 2A2XH 4MLFB 3T29A 3CBZA 4M7GA 3QTVH 2Z9IA 3ODDA 1W7GH 3I29A 1GGDB 2ZCKP 1FUJA 1HAHH 3FZZA 4GUXA 4K1SA 4I7YH 3NFLA 2CHAC 1A0JA 4DURA 3LPRA 1WTHD 2GKVE 1MC7A 1Q2WA 1NS3A 2XXLA 5EW2H 2FLBH 4FXGH 1DDJA 3KHFA 1W3CA 3BTTE 4BNRA 3SUFA 2M0TA 4XFQA 4HOPA 1MBQA 5ABWA 3C27B 2SGDE 3RXEA 3O8CA 4CH2B 3ZZCA 1AIXH 4AFSA 5AFZH 1O30A 1X5QA 1IOEA 1GVLA 3NFKA 4ZHAA 1NU9A 5FBIA 2K1ZA 2C8ZB 3SHUA 4KP0A 1FY3A 5HFBA 5F67A 3TVJB 6CHAC 1K28D 2FI4E 3LONA 2ZDAH 3OSYA 2ZQ2A 2ANMH 1NC6A 1OYTH 1Y5UT 1DY9A 3BG4B 2J4IA 1QB9A 4VGCC 1DUEA 1KYNA 5F8TA 4JORA 4BAHB 2VINA 3QK1A 1ANEA 3PM3A 1GHYH 4GCHG 1RJXB 2D1JA 1VR1H 1YYY1 3IITA 4BAKB 5CE1A 2OC1A 2WYJA 1UJDA 1QCPA 2JH5D 2FLRH 3BTHE 3CH8A 1TNGA 4AG2A 4BAQB 1BTHH 1EJMA 1FQ3A 2RDLA 1AGJA 3GGEA 2UZCA 2ZTXA 1AFEH 1S0QA 1D6RA 5HFDA 4ZXYH 2TGAA 1O2ZA 2P8OC 4MPAA 2VIOA 2ZG0H 2A31A 1E0FD 2ZFSA 1LCYA 1P2IA 2BMGB 1S81A 1SL3A 1YPHE 1TA6A 1LTOA 1A46H 1ZRBA 3RXAA 1ZMLA 4ZHLU 4ISHH 1GQ4A 1K1OA 1P9SA 3MH5A 2R3YA 2O2TA 1LVOA 2I6QA 3TJVA 5H3JA 1BHXF 3BEIB 1BZXE 2HNTC 1PYTC 3HPTB 2BXUH 3OY5U 3PMHB 3UNSA 1UTPA 2V6NA 2FE5A 2G00A 1V5QA 3L6PA 2F0AA 1YCPK 2BD8A 3V7TA 1YPKH 2V1WA 1Z1JA 1NZQH 1LQEA 2GV7A 4YT6H 3TJOA 8GCHF 1WFGA 1NROH 4Q2OA 2D92A 2GP9B 3HK3B 2BD2A 3QE1A 5FXLA 1VB7A 4H42U 3ZVEA 1TALA 1L1JA 1GI8B 1GJBB 2YOLA 2HRVA 3P8NA 1C5WB 4RKJB 5LGOA 2BTCE 5F6MA 4DVAU 2F3CE 1BCUH 4ABJA 2EHRA 4JK6A 3PWCA 1MU8B 1J17T 1F7ZA 2FWWA 2HE4A 1GI3A 2QAAA 3E0NB 2VNTA 2BHGA 1A2CH 1KTTB 2VB0A 1LHGH 4I8JA 5EU8A 3VQFA 1SR5C 2GV6A 3KQEA 5GLJA 2ZU1A 2OPGA 3CS0A 2W7UA 2ZQ1A 3NCLA 1SC8U 3HK6B 2ZHFH 2XW9A 1MUEB 5ETXA 4MPVA 4KTSA 1C4Y2 3H5CB 4GAWA 3DD2H 1SOZA 3A89A 1DWEH 3DA9B 1C2JA 1UCYE 3BF6H 5EQSA 1FY5A 1O3HA 1FC9A 2D8IA 1NN6A 2FOBA 2P3FH 2ODQA 1QAVA 5DG6A 2K1QA 3RP2A 1X45A 1TX6A 2CN0H 4K1TA 1P06A 2BQ6B 3KL6A 1XM1A 2Y80A 1LVMA 1UK2A 2O9QA 1ZTJA 3T5FH 4FUGA 1QJ1B 3H7TA 1EOJA 5T3HA 4K69A 1Z71A 3TIUA 2VIPA 1X8SA 1QY6A 3LDXH 1GI2A 1O2WA 1XUIA 3RXDA 5DO4H 2BM2A 1NTEA 3RL7A 4A92A 4BTUB 1FAKH 1PFXC 2P94A 3QDOA 5E2OA 1UHBA 2M3MA 3U69H 4SGAE 4TPYA 2NWNA 1B0FA 2FOEA 4NIWA 2KPKA 1V2VT 3M5OA 2VRFA 4GVCA 2PDZA 4JZ1A 3VPKA 1CQQA 1XUFA 1ZJDA 4FUDA 3UPEA 4AZ2B 2ZFRH 4ZKSU 2B0FA 3P17H 1PQ5A 2ZO3H 3VXFH 2QXGA 1TRYA 4DIIH 3SV7A 2GT8A 1ABIH 2SGFE 3ZZ3A 4NMSA 4NZLA 1BTUA 1Q3OA 1GI7B 2BZAA 4IGDA 2G2LA 5JBCS 4A1TA 3UQVA 1SGDE 2PKAA 5HFCA 2TBSA 1N7FA 1GMCF 3UY9A 3AXAA 1GBDA 3SOEA 4NIXA 1O3LA 1F5RA 2QY0B 4IBLH 1DWDH 3EA7A 1HAVB 1A5HA 1EAWA 1GI6A 3WKLA 2PUXB 1QIXB 1MTNB 2DM8A 1C5XB 1OWKA 4CBNA 3UWJH 3T25A 3PLPA 3HKJB 3UOPA 1T4VH 1IQFA 1CHGA 4KFVA 3BN9A 2ODYB 1SLVB 2ZPQA 1N99A 2TPIZ 1ZTKA 4F8KA 1ANBA 2Q9VA 1AWHB 1C5MD 1O2VA 2OQ5A 2OQUA 2VPHA 1PPCE 1XUKA 3KCGH 3Q3YA 4AOQA 1GI4A 1L6OA 1GJ5H 3EQ0H 2QC2A 3LC5A 1C9PA 1ZMNA 3KZEA 2STAE 5K0HA 2Z3DA 4BANB 4L8NA 1XUJA 2QKTA 1XMNB 1O3DA 3Q77A 4YM9A 1O31A 4A1VA 4X6OA 1ZR0A 3CS7A 1WF7A 3GICB 1QAVB 1GBLA 1YPGH 5GCHF 1CVWH 2JETC 2VSPA 6ESTA 4YT7H 1V6BA 4X1NU 2L4SA 3ZZ5A 1QA7A 8ESTE 1RY4A 5EGMA 1ELBA 1D6WA 1EAIA 1LHEH 1OYQA 2Q6FA 1YC0A 1CO7E 1E37B 1ESTA 1Y3XA 1WH1A 2EA3A 1C2HA 4NIVA 2KG2A 3A85A 1SGFA 4JOJA 2Y7ZA 4HFPB 2GX4A 1QNJA 7LPRA 1BBRH 1L4DA 3LGTA 1ZPBA 2AIQA 1HPGA 1LVYA 2DLUA 3BTGE 2J34A 3D49H 3PB1E 1W9OA 2UUYA 5IYTA 1AB9C 2EC9H 2SGQE 4B73A 4Y7BA 1L0ZA 2XC4A 1S5SA 4JMYA 2PGQB 1C1UH 1ELAA 1OWJA 2AFQB 2YTWA 3E17A 1SLWB 1V2MT 1BITA 4FUEA 4NMOA 1LKAA 2WUBA 4IMZA 2A2QH 3RXCA 3ZVBA 5DP6A 1IQGA 1IHSH 2LC7A 2BVSH 4FU7A 1QFKH 1AUTC 1UTMA 1K9OE 5IDKA 4R8TB 1Y8TA 1QBNA 4CRCA 4LOYH 4YOJA 1GPZA 3MI4A 1TX8A 4AFQA 3FP8E 1P2JA 2QGRA 1G32B 4D9QA 5G4BA 1EASA 4INLA 4NFEA 4SGBE 2IWOA 2A32A 2J95A 2HPPH 1TP5A 2SNVA 3RC4A 1O37A 2ZECA 3W94A 1O2TA 3QGLA 3TK9A 5B6OA 3M7UA 2V0BA 3DJ1A 4IW4E 1O32A 1OP2A 1HAVA 2GZVA 3TGIE 3EGHC 2EEKA 1CT0E 2Y82A 1O2LA 4JCNA 4WH8A 1TQ0B 2R3UA 3UR9A 2LPRA 1PYTD 1FPCH 2Y5FA 1W13U 4I8LA 4MNVA 1BBRE 2Q6DA 5FHTA 1TLDA 2ZA5A 3T27A 2ZFPH 1UCYK 3PMJA 2FTLE 2OCVB 3SV2H 3M36A 4ISOA 2BD3A 1ESBA 3RUOA 1V2ST 4TY7A 1O2QA 1TPSA 1BTPA 1RGWA 4BAMB 1QJ7B 4Z8JA 4GHNA 1HRTH 2BOKA 1XKBC 2FOMB 3GY5A 1DT2A 1QR3E 3I4WA 1P3EA 2VH0A 3SQHE 1QTFA 4X8UH 1CGHA 1C1WH 1IHJA 5T6GA 1XKAC 1GHBG 4AGKA 1S0RA 1TB6H 3Q76A 5HMAA 1KSNA 1EQ9A 1UVOA 2QXIA 3AAUA 2YT8A 1O3FA 3O5NA 5HF4A 1TFXA 2NU3E 2G5NA 2DB5A 2YUYA 3BPUA 1G36A 4ZHMU 2H9EH 4AFUA 2KJKA 3E90B 4X1QU 1YF4A 1FPHH 3M61U 5JB9S 1ELTA 1IAUA 1T8OA 5HETA 1K1LA 3D65E 3ZVDA 3A7TA 4NSYA 3M5NA 3S69A 4NMTA 3MNXA 5DPAA 1O3MA 5AVDA 7GCHF 3EGGC 5FX6A 4NWKA 2TGTA 4YZUA 2Z3CA 1DXWA 1NM6A 1TPAE 3RXTA 1ANDA 1WFVA 1GBBA 3LGWA 1I16A 2FNEA 1DVAH 3QGJA 1O3BA 1TA2A 4K2YA 1UTOA 2EAQA 5GDSH 1AKSB 3STJA 2PWXA 2EEIA 1FXYA 1O3NA 3BG8A 4B2BA 2OQSA 1VJAU 1GBAA 5DP9A 2FI3E 1B8QA 4WYTA 1JBUH 5C1UA 2BQWB 3FZDA 3SOSA 4DJZB 3EA9A 2PUQH 4IN2A 4WWYA 1GL1A 1IU2A 1XVOA 4YDPA 3F9HA 3SNAA 5I46H 1UVPA 3A8AA 3C1KA 2FN5A 4JZEH 4H11A 2OGPA 5FCKA 1NRSH 1CT4E 5GJ4B 3F68H 3STIA 1HIAB 3SU6A 3W95A 1PDRA 1A3BH 3SI3H 3K2UA 3P8OA 1UJ1A 1NY22 3ATKA 1MCTA 5TCAA 1YPJH 2FX6A 1ACBE 1HCGA 3PMBB 3KZDA 2D2DA 1KXEA 5E2PA 2ZI2H 1B0EA 2KL1A 3GCHC 1C5ZB 4Q7YA 3GYLB 1X6DA 4E3BA 1EP5A 3SHWA 3A88A 1BJVA 2FOAA 4GCHF 1OZIA 4UU6A 3D62A 1HAGE 3PDZA 1GHVH 4EDJA 3EDXB 2H9TH 2A4OA 2SFAA 4JYUH 1GHXH 4Q2QA 2CXVA 3A7WA 2FOFA 3BTWE 1C5NH 2AEIH 4AYYB 4K8BA 1T8MA 1TBRH 4JYVH 2FDAA 1H1BA 1TYNA 3L3TA 1PPGE 3Q00A 1WOFA 1GVKB 2YT7A 3HPKA 4K6YA 1EPTC 1O3CA 2DE8A 3SUZA 3AASA 2DLSA 1BMNH 2JREA 2BDYA 1K22H 5JBAS 1SGEE 3HGNA 4YOIA 1Y3YA 1SSXA 1HAPH 1YM0A 1YCPM 1C1QA 1NPMA 1ZJKA 4MG3A 1MD8A 2BYGA 1TPOA 1CGIE 2HOBA 2RRMA 1C2IA 2FS9A 3RXUA 3QIKA 3RXPA 2BYAX 3LNXA 3VB7A 1KLJH 6CHAB 2P3TB 3DJ3A 3GCHB 2BD4A 3Q3XA 2AS9A 4JOGA 3PV5A 2OBQA 3RU4D 1OWEA 1LPZB 1C5RA 1RS0A 1N8OB 1FN8A 2P93A 4YTAA 3A8CA 2GZ8A 3ITIA 5DTHA 3ESTA 1KWAA 1RFNA 2J92A 1O5DH 4H6TA 1DWCH 1O2SA 4QT8C 1Y7NA 2BDAA 4F4OC 5L2YH 2I0IA 3UNRA 1UEQA 4NXRA 1NRPH 1Q3XA 2B8OH 3P8FA 2I0LA 1SQOA 2ZDLA 5EPNA 1JIMA 1JRSA 2O8WA 4OS4A 2FEQH 3OTJE 1ZHPA 1KXDA 4HZHA 3B76A 1TWXB 2ZDKA 3SU5A 2FODA 2P59A 2BD5A 3R0HA 4GVUA 1SGTA 1D5GA 2V3HH 2AMQA 2Z94A 4MNXA 5EODA 2HNTE 4I8KA 1H4WA 1CGJE 1EPTB 3NUMA 2BLQA 3AAVA 6LPRA 3UFAA 1V1TA 1AWFH 4YOGA 2EV8A 1BIOA 1ETRH 2IWNA 2ZHDA 2BX3A 9ESTA 1ELCA 1VITH 3M37A 1B5GH 3R3GB 1SGIB 1NFWA 1O2PA 1O3AA 1QA0A 1Y5BT 2C93B 2J38A 2R2MB 4ZUHA 3SGAE 1NRQH 4CHAB 3PV4A 2JINA 3NKKA 1JWTA 1BRUP 3U98H 2BDGA 3F6UH 1P12E 4K8YA 3SNBA 1GBHA 3NPSA 2BDBA 2ZGCA 2XBXA 3RXFA 2F9UA 3PMAB 1HXFH 1O2UA 2G8TA 4E06H 1ZSJA 1KDQA 1QL8A 3GDSA 1EX3A 4JOPA 4DIHH 1DUAA 1O5BB 2J94A 1LQDB 4U2WA 3QJNA 1DY8A 2R0KA 3ENSB 5DP3A 4OAJA 1SGRE 1UTLM 1V62A 4WH6A 7KMEH 1YPHC 1O2YA 1ZTLA 3O46A 1QQ4A 2J9NA 3UOUA 3PTNA 1HLTH 2STBE 3LT3A 5EOKA 3RXBA 1LVBA 1YPMH 1HAXB 3P8GA 1HGTH 1DE7H 2KOHA 5C67A 2REYA 1DS2E 1YPEH 1HJ9A 2A5IA 3T62A 2GCTB 1UTJA 1V2OT 3RXOA 5JB8S 1UTQA 1FNIA 2FOHA 1JMOH 4YESB 4CHAC 3MNSA 2R4HA 4KELA 3S9AA 3LKWA 3WY8A 4Q7ZA 3GISB 3ATLA 2OP9A 1MU6B 1NFUA 3ZZDA 1GHZA 7GCHG 1TMBH 4P0CA 1IQKA 1SI5H 3ZZ7A 4NCYA 1VJ6A 2EEJA 1AZ8A 2CMYA 3SBKA 3TJUA 1TNHA 1IQIA 4CBOA 1SGFG 2HALA 2UUKB 2IWPA 3BEUA 4X8VH 3RXLA 1BTYA 1VCWA 2ZKSA 1HV7A 1J8AA 2Q1JA 1C4U2 1C2FA 1PPEE 5FPYA 2IPHA 2IOTA 1O39A 2G5VA 3UUZA 2BY9X 1WI2A 4UDWH
chains in the Genus database with same CATH superfamily
2FZZA 4I8GA 1AZZA 4ABIA 2LA8A 5I7ZA 3KDKA 4FOUC 5F3XA 3SU3A 1W2KH 2AH4X 1WCZA 3UTUH 1ZHRA 2ULLA 2FI5E 2G52A 1C1PA 1FJSA 1AE8H 2NU2E 4U01A 2VWOA 1M5ZA 2SGEE 4LZ4B 3ZZ6A 1P1EA 4XE4A 1DFPA 3UIRA 5KECA 1LO6A 3GSLA 1E1RD 2KBSA 2AMDA 3UNQA 2UWPA 1CA8B 1BOQA 1Q3PA 3V13A 2P16A 3RXMA 2M10A 2R9PA 2PNTA 1HXEH 1P9UA 2PR3A 1MH0A 5FB8C 1DANH 2BOHB 4PROA 3TJNA 1BJUA 2O8MA 1OPHB 1E38B 4YYXA 1SFQB 1T7CA 1WU1A 4AB8A 2UUFB 1S6HA 4FUCA 2RCEA 2ZZUH 4UFFH 4KFWA 1Z7KA 2KRGA 4DGJA 3M3SA 2PKUA 3AVZA 4ZCNA 2XNDD 3N7EA 1C5YB 5HIYA 1J16A 4JZIA 1Z6EA 1ABJH 5JBBS 5A8ZA 2WYGA 2FYQA 2EDPA 1T8NA 4AX9H 1C1TA 3SGQE 1GMHG 1XX9A 3RXRA 2AINA 1GI1A 3VXEH 1WI4A 1FDPA 1X5NA 3PRDA 1X7AC 2I1NA 1GCDA 1OP8A 4I33A 1TP3A 2AHME 1O2RA 4NA8A 5A8XA 4E7NA 3TGKE 1ETTH 1BA8B 5F8XA 1ZPZA 5ESBA 3E8LA 1GBCA 3QTOH 4AORA 2GMTC 1SGYE 3A87A 2A7CA 2F43B 1V2PT 1W14U 3QWCH 3RU4T 3ZZBA 1KDQB 1ANCA 4MNWA 1GL0E 4BAOB 6GCHG 3TK5A 1OX1A 2ZHEH 2VU8E 1P3CA 1Z86A 1OOKB 2A45B 1O3JA 3ID4A 3LJJA 4RKOB 2V7QD 3MOCA 3S7KB 4K1EA 3V3MA 5LH8A 1AQ7A 1GBMA 2XBYA 5G1EA 2P8OB 1GBKA 4IS5A 1C2MA 2ZEBA 3EYDA 4MDSA 1ID5H 1RTFB 3VQGA 3TSVA 5EG4A 2F5YA 1GJ6A 3QDZB 3K82A 2EDVA 2G81E 1E79D 2E7KA 2VZ5A 1BTXA 1UO6A 1ZZZA 5DJ7A 1UTKA 2TGPZ 1V5LA 1FY8E 3PROA 1P1DA 3PTBA 3PYHA 3V0XA 2L97A 1L2EA 2VIDA 4K76A 3MO6A 2ZPRA 1U38A 2OTVA 3NGHA 1AB9B 4ISIH 4FUJA 5KGOA 3ZVAA 1QJ6B 2Q3GA 4X1RU 3PLBA 2GZ7A 2PZDA 4XOJA 1AVXA 1BQYA 3DFJA 5FAHA 4JL7A 2C3SA 5C2ZA 3QLPH 4FUFA 1C5OH 1TNLA 3GCNA 1AI8H 2BXTH 4Q7XA 3U8TH 1DLKB 1KLTA 1OS8A 2OC7A 4K3JA 4A5TS 1P2MA 2HLDD 2ZDVH 3SHCH 1J14A 4Y0YE 3MH4A 3KYFA 4O3TA 2MX6A 3BV9B 2HNTF 5C5OA 2KAWA 3E16B 1AVGH 1P57B 1MCVA 2XBVA 3VEQB 5HM2A 4ZROA 1WYKA 4O03A 1HJAB 3M5LA 2ZFQH 2PW8H 1TGBA 1GHBF 2ZCHP 1O3GA 1V2KT 1C5UA 1DWBH 1RIWC 4NA9H 5EXMA 1K2I1 3A8BA 3P95A 3MFJA 1TRMA 3EAJA 2PLXA 1JXPA 4AN7A 1T8LA 3SV9A 1W0JD 2KX4A 2SNWA 1XUHA 4KGAA 5C1XA 1O2IA 2OD3B 3UR6A 2RCZA 1DSTA 1ZLRA 2W7SA 4Q2PA 4MVNA 3URCA 4JOHA 4CRAA 1ELVA 1BMLA 1WV7H 7ESTE 3DIWA 1MQ6A 1FZZA 2RFKC 3P92A 3FN8A 3ID2A 5DSFA 3BTFE 2V3MA 2XWAA 2EXGA 1SOTA 4LK4A 3SORA 1O2NA 4WXVA 4U30A 2Y5HA 1UITA 3LGIA 2I6SA 4FVBA 4BTTB 5DP7A 2EJYA 1V2WT 1D4PB 4CH8B 4Z1MD 1UK4A 2ANKH 2GDEH 3KGPA 5CHAB 1K1JA 5B6LA 4GPGA 4WVPE 4ASUD 4J2YB 4B6FA 5DKMA 1QRZA 2M2AA 2B9LA 2CJIA 1JOUB 1HAIH 1N8OC 3GOVB 1KLIH 1GDNA 2EGOA 1K1PA 2KPLA 3FAOA 2BY7X 2A4RA 3JZ2B 3GCTF 1MAXA 2WPLS 1UF1A 1HB0B 1UMAH 3OY6U 3TK6A 2C90B 1GGDC 2BLWA 5EXNA 5C3NA 1Z8JB 1V2LT 4JOKA 1W11U 4CREA 3GY6A 1CBWB 4GHTA 1X9ZA 4I86A 2QV1A 4NA7A 1SHYA 1I92A 3SZNA 1QRXA 1LHFH 2D90A 5A2PA 1ESAA 1GG6B 3F2HA 2EGNA 2W4FA 1THPB 2KZ4A 1TGCA 2JWEA 1G9OA 2FXRA 4XDEA 3E0PB 1PQ7A 5HJ1A 1WUNH 3ZZ4A 4MPUA 3H09A 1F92A 4ABAA 1D3DB 4WJG2 1BDAA 1QRWA 3KQ5A 3BEFB 2BD9A 3S7HB 4MPWA 4O06A 1BB0B 1Z8IB 1INCA 1MZAA 1LDTT 3BTDE 1MTVA 2NU1E 4HTCH 4TYDA 1UK3A 1XXFA 5JXBA 1Y59T 2VVCA 3RXQA 1BRCE 2LP6A 2OMJA 4INHA 2F9NA 2VIWA 1G2MA 5GCHG 4Z33A 1RRKA 3LGYA 1B7XB 4X0WU 2QIQA 1GWAA 1SKYE 4JK5A 2EI6A 3KN2A 2Q6GA 2JOAA 1YCPH 1N6FA 1CA0C 4F49A 1FAXA 4YLUA 4RSPA 4B75A 3F9FA 4NIYA 1VCPA 5E8EH 4ABHA 1HDTH 1ZOKA 1OWDA 3ZZAA 3BIUH 2A5AA 5SGAE 3GDUA 2AYWA 3ATMA 2JIZD 3OFND 3A82A 1O2OA 4I8HA 2FS8A 1EP6A 5A0AE 2EI8A 1F5LA 2VH6A 4OS7A 1OWHA 1NTPA 4ACBA 1NFYA 4O9VA 3OU0A 4RN6A 1R6JA 2ENOA 3MU4A 2F4LA 1PPBH 3SUEA 1GM1A 2IN2A 3LGUA 8LPRA 2OSGA 1Y5AT 1O2KA 3RMMH 3KQBA 2WINI 5HIZA 2ZHQH 2HWLB 2QF3A 5J4SA 3GY8A 3RLYH 2OINA 2H2CA 3TGJE 1EB1H 3M3TA 1C1NA 3PDVA 4ZKNU 2PGBB 1T31A 1W0YH 4INKA 1C1RA 3A81A 2ZNKH 3M3VA 5D13A 2PTCE 2KV8A 3ZRTA 1UTNA 2BDCA 4REYA 4CR9A 4AYVB 1RTKA 4PQWA 3NZIA 2EEGA 3R0FA 1WIFA 1C2KA 3OYPA 3RXHA 3SU2A 2H2ZA 3F1SB 1ZRKA 4Y7AA 2ZU4A 1CHOG 4X6PA 1GMDF 1TGTA 1EJNA 2ZGXH 1Y3WA 1OBYA 3RXKA 4Y79A 4WMDA 1OBZA 1A7SA 3DUXH 3M35A 4J1YA 3I78A 1KXFA 5L30H 1BMMH 2P95A 2VVUA 3A80A 1TGNA 4ABBA 1MZDA 1DICA 1TIOA 1ZSLA 3B9FH 3RLWH 3KHVA 3BIVH 2GCHF 1T32A 2TRMA 5E11A 3VGCB 2HLCA 5FPSA 4CRGA 4IMQA 4X2YA 2DAZA 3LC3A 3SO3A 5A0CA 2L74A 2IWQA 1TPPA 3MU1A 1ZHMA 2XC5A 3FP7E 3LU9B 5LPRA 1THSH 1FI8A 2V35A 3K6ZA 2Y7XA 5A8YA 1C2DA 2W5EA 1Z1IA 1EZQA 1JRTA 4NWLA 4YO9A 1S6FA 2AGGX 4Z0KA 2BLVA 1TMTH 1PPFE 3UREA 1GJ7B 1TX7A 2GEFA 1CA0B 2JKHA 3U1JB 5FL7D 2VIQA 1U39A 2BY6X 1GHWH 2Z6BD 2KCPA 3RM2H 1WHAA 3MMGA 4AB9A 1P2KA 1V2QT 2C8XB 2A4GA 5E6PB 1GBFA 4X2WA 1C5VA 2OBOA 3MQKC 2C4FH 5EJZA 1O3OA 4HOPB 1FV9A 5E0HA 1IQHA 3GCOA 2W3IA 2H9HA 2YNBA 1LHDH 1SMFE 2J97A 5EYZA 4E34A 2FX4A 3U8OH 2HPQH 3MYWA 5FX5A 2A7HA 1TGSZ 3ZV8A 1EATA 2VIVA 3PO1C 1AN1E 1C9TA 1Y3VA 5JDUB 1XXDA 4GLYA 1MKWK 2FOGA 2WV5A 2Z9GA 4MPXA 5DP5A 1DX5M 3ZVCA 1N1LA 1QAUA 4MTBA 1UJVA 4JYTA 1FN6A 1SQTA 4XRNA 5CHAC 3MH7A 2CHAB 3KEEA 4GHQA 3BTME 2O8LA 3ZZ9A 5JYIA 3RU4E 5FPTA 2R0LA 2GD4B 1C1MA 1EZSC 3CNRA 3HATH 2KOMA 5L6NH 1VGCC 4K72A 1H9LB 1MQ5A 2QF5A 2XBWA 3VB5A 1G3EA 2QG1A 2W7RA 1HBTH 4A6LA 4TPIZ 1ZOMA 3DT0H 4E05H 1YPLH 1EJAA 3M7TA 1H8ED 3GS9A 3MTYA 4WY3A 2BB4A 3PLKA 3GDVA 2FP7B 1DSUA 4ZAEA 3URDA 2V90A 3RMLH 3I18A 1WQSA 1LMWB 2GVFA 2GTBA 3UWIA 4OM9A 1XZ9A 2ZU5A 4XBDA 2CSSA 1SPJA 1VZQH 5CMXH 2UWOA 3UB0A 2XTTB 1ELEE 3P6ZB 2VGCB 2CF9H 2QT5A 3BG4C 1RXPA 5E0GA 1BBRK 1EXFA 1RGRA 1MTSA 1THRH 4BXSA 1IU0A 2ZPMA 2XCNA 5AHGH 3JZ1B 1BRBE 3F9GA 2DJTA 3RXSA 4JZFH 4Y8ZA 1TE0A 1XVMA 2PKSB 1TONA 3AW1A 3ID1A 4BTIB 5EZ0A 1IQEA 4P2AB 2ESTE 5A09A 1SGCA 2OC8A 1ZYOA 1IHTH 2JIKA 1UVUH 1K1IA 4JJ3A 4R0IA 2FOCA 2TIOA 1LPGB 1UJUA 2ZF0H 1W10U 3RMNH 1QB6A 1K0HA 3MU5A 1WDIA 1ZPCA 3HKIB 2FO9A 5L2ZH 1QGFA 5C5NA 1IQLA 4NNMA 2FIRH 1GHAF 4GSOA 4OEPA 1BTWA 1HAZB 1FY1A 1NO9H 3A7XA 3EE0B 2Y81A 4ABGA 1YY3A 1NBMD 1T4UH 2ZGHA 4Y6DA 5C1YA 4Q2NA 1RIWB 4CRBA 1AFQB 1O5FH 3OX7U 1NT1A 2BDHA 4OS5A 3TSWA 3CENA 1UM1A 1MFLA 2JILA 4Q3HA 3TH2H 4B74A 2J98A 5GIBA 4ZXXH 3LIWA 1W9QA 1JIRA 1ORFA 1OP0A 4FVDA 4F48B 3TLOA 2KFWA 2WPJS 4OS6A 1LPKB 2HVXA 1VITG 1C5TA 1RZXA 1EPTA 4LXBH 3SUDA 2SGPE 3FVFB 1GBTA 3D23A 1NFXA 3O8BA 1F5KU 4X1SU 2BZ6H 3L4FD 2OUAA 3SJOA 3OAAD 4FETA 4X8SH 2AERH 2ZU3A 1N7TA 4O3UA 3L33A 1H8IH 1BRAA 4X2VA 5EQRA 2H5DA 1GI9B 5C0UA 1OSSA 1YKTA 1O2GH 1AE5A 1YGCH 1TAWA 5C17A 3GY4A 4NMRA 1X5RA 1GMDG 2F9BH 3TH4H 1FCFA 3K9XB 3GY7A 3ZVGA 4WXIA 1IQJA 2LUIA 2BY8X 3ZYEA 1W9EA 1O3KA 3SNCA 3HGPA 1KXCA 3SI4H 2JDID 4U32A 5FBEA 2ZDNA 2Z17A 1O3PB 4KTCA 3RXVA 3KIDU 1ELGA 4ABFA 2PFEA 1N6DA 1GI5A 3MO3A 4UONA 1IQMA 3IG6B 3E1XB 4Q2KA 4X6NA 3NXPA 2BVXH 3NWUA 3B8JA 5DP4A 2W3KA 2QXJA 3A8DA 2KA9A 1FMGA 1TRNA 1EZXC 4B1TA 2VSVA 2PKTA 2F9OA 4K60A 3SU0A 1K1MA 3K65B 2BDIA 1CT2E 1SB1H 1ELDE 2GGVB 1TNJA 2DC2A 2OC0A 2HGTH 3QO6A 3E6PH 1Z6JH 4F55A 4AC9A 1EOLA 2PV9B 2QN5T 4AGJA 2FESH 4OGXA 1C1SA 1DXPA 1TMUH 2VWNA 1UM7A 2H3MA 5G1DA 2F9PA 3VB6A 5GXPA 4XD7D 1TABE 2I04A 3FY5A 1AFQC 1WSSH 3CC0A 3LNYA 1L1NA 1V2JT 3RXGA 1J15A 3B23B 4KKDA 3N7DA 3QUMP 5EPYA 1QL7A 1EB2A 2QKUA 1GJ8B 1YBOA 1N6XA 1LHCH 4FU9A 1COWD 1QB1A 1FLEE 1C1OA 1NU7B 1BE9A 2WPIS 3OTPA 2I4SA 1ETSH 1CHOF 4XBCA 2VWLA 2BVRH 2YUBA 4DCDA 5DGJA 2AIPA 1O3IA 3T2NA 2A4QA 1PQ8A 2WPKS 2B7DH 2FYRA 3JXTA 5E1YA 1MTWA 2WPMS 3SGBE 5EXLA 3BSQA 2BLOA 2BD7A 1O2MA 3TITA 5AFYH 4X2XA 5LPEA 1V3XA 3RC6A 3V12A 3DJAA 2F91A 4NMPA 2A1DB 4MNYA 1HJAC 1GCTB 1P2OA 2KQFA 2KYLA 1A1RA 1QURH 3PS4A 2ZHWH 2CSJA 3K6YA 1P04A 1Q7XA 2R2WU 1C1VH 1C2LA 2FTMA 3SYJA 2K20A 1Z8GA 5AF9H 1ARBA 2GCTC 2PP6A 4DG4A 3CBXA 1BT7A 3F3BA 4XBBA 2JETB 3RM0H 8KME2 1AKSA 3MNBA 3QN7A 1VA8A 3SUGA 1EZUC 5LPFA 2IPQX 2Z9JA 3SHAH 3DFLA 3QGNB 1C5SA 1V2RT 1M9UA 1UVSH 2QXHA 2XCFA 1SG8B 1QBVH 3PO1B 2BQ7B 4D7FA 4JOFA 1NF3C 2QE7D 2A5KA 4BOHA 2V3OH 5HF1A 1RGQA 2KAIB 2Z9KA 1HAYB 4HGCA 4ZKRU 5E21A 4ZH8A 3DSOA 1S84A 1F0SA 4DT4A 2YNAA 3O8RA 5EIYA 1F2SE 2AMPA 2RA3A 2XYAA 1FC6A 1G3CA 1OWIA 5ILBA 1C5LH 1WAYB 1K32A 4NZQA 1Q31A 1CSOE 5A0BA 2PSYA 4B2AA 5HGGA 1QBOA 2ZTYA 3DHKH 4I31A 4ZMAH 4NNLA 1EKBB 1V2UT 3GY3A 3RL8A 1WQVH 3GYMA 2M0ZA 2ZDMA 3MO9A 1A0LA 1MAYA 5C94A 4OGYA 3A86A 4X1PU 5BPEA 5GPIB 5HFFA 4THNH 1GHAG 5K7RA 2GZ9A 1GBIA 2TGDA 2ZGBH 5E0JA 4DY7B 1C5QA 3OEED 4D7GA 1GJCB 3M5MA 4IC6A 3TMHA 1TBZH 1SHHB 1OXGA 3A7YA 3A84A 1O38A 1V6DA 2PA1A 3FFGA 1S85A 2ZC9H 1UHPA 3WWBA 1L1GA 4NSVA 1Z87A 1C2EA 2BY5X 3E91A 2LNCA 3ELAH 2ZFTA 3CP7A 2RG3A 1S82A 3LGVA 4Y11E 3U1IB 2FM2A 2KJPA 1P0SH 3FP6E 4Q80A 3SU4A 2WPHS 1SLXB 2KCAA 3VFEA 3FKSD 2G51A 2GDDA 4B76A 2VWRA 8GCHG 3I1EA 2D26C 2PTNA 1C2GA 2GMTB 2NU0E 3F9EA 1L4ZA 4NXQA 1EUFA 2QYIA 1KXAA 5HDYA 4B2CA 5T1VA 2D8WA 4UD9H 1HAOH 3N99A 2AGEX 1EAXA 3SV8A 1G9IE 3F0OA 4GVDA 2VJ1A 2VWMA 1SLUB 3U9AH 1OBXA 3RMOH 1E34B 4ABEA 3S9CA 3GY2A 1AU8A 2ZIQH 2OZFA 1YLNA 1GJDB 4TWYA 3T28A 1VJ9U 4IC5A 2DUCA 5F8ZA 1GQ5A 1WHDA 1P8VC 1CE5A 1VCQA 1U37A 4RT0A 3WKMA 2UWLA 2RA0A 2QCYA 4UU5A 5EW1H 1CBWC 1P02A 1RTLA 1J9CH 4G69A 1A5IA 1TBQH 1ELFA 3RC5A 1FY4A 3R69A 1P2NA 1P05A 2ZPLA 1P2QA 3ZZ8A 5HEYA 2LC6A 1DOJA 1G3BA 2CF8H 1YLCA 3ZV9A 2AWXA 3RXJA 4LZ1H 1TOCB 5HXFA 2NU4E 1IQNA 4DT7B 5F53A 1N6YA 1GJ4H 3MNCA 1ZMJA 3MU0A 2QBWA 1EFRD 2M5TA 3AW0A 3RLEA 5A2MH 2XWBI 3N7OA 3KNXA 1KIGH 1UFXA 2ANYA 1D9IA 1PPHE 3SNDA 1S83A 4H6SB 2ALPA 1O2XA 2ZFFH 2ASUB 2Z9LA 4DW2U 1P09A 5H4IB 1Z8RA 3VG8A 1O5AB 1W0ZU 2CS5A 1UEZA 4UEHH 2KAIA 1U3BA 1WG6A 1QL9A 2OLGA 3GCTG 3CBYA 1PQAA 1HFDA 4OEOA 1G30B 2ZWLH 2H1UA 5T6DA 3TNSA 1O36A 3QJMA 1E36B 1H9HE 2CK3D 1WJLA 4AFZA 2WL7A 1GBEA 3FO8D 1YBWA 1C4V2 3IWMA 2MHOA 1GDQA 2G55A 3ATWA 5ESTE 4TWWA 4JJ0A 4X8TH 3TSZA 1O35A 1RD3B 3GJ9A 4VGCB 4NG9H 2PSXA 2ZCLP 3VB3A 1N6EA 1O2HA 1BTZA 4Y10E 1ZUBA 3H7OA 1W7XH 1EAUA 1TQ7B 2PHBA 2WUCA 2EQNA 2XOKD 2VVVA 3BTQE 4ISLA 4OS1A 1DM4B 1YLDA 3EGKH 5CHBA 1AD8H 2ILNA 5GNDA 1FIZA 4IN1A 5CDFE 4FUBA 2AGIX 1MTNC 5E22A 4UFGH 3KQCA 4Y8XA 1AMHA 1G37A 1AY6H 4FUIA 2I6VA 5T6FA 2WHXA 1OHHD 1ZGVA 1YP9A 1DITH 4Y8YA 1NRRH 4NGAH 2XRCA 1G2LA 1P10A 4ZKOU 4RT1A 1O5EH 1QHRB 4LMMA 1H8DH 2PKAB 3MU8A 3SU1A 4CR5A 1BHXB 2A7JA 4FU8A 4XSKU 2ALVA 3SN8A 1QQUA 1WBGB 5HM9A 1D3PB 1GMHF 1NESE 2XC0A 3M7QA 4KTUA 1MBMA 5TJXA 2IJD1 3PV2A 3K50A 2UUJB 1KEFA 2ZPSA 1HYLA 3HVQC 4D8NA 2IJOB 2YMSB 1O34A 3VGCC 1SGNE 2ZGJA 4Y71A 1LKBA 3SJKA 3SV6A 1VGCB 3P70B 2G5MB 1MFGA 1TNKA 2A0QB 3DCLA 3KYGA 3MHWU 3ZYDA 5F03A 2W26A 3TPIZ 3E3TA 1UHBB 3BTKE 1NRNH 3NK8A 1HJ8A 2DKRA 1MTUA 2KOJA 2ANWA 3LJOA 1S6LA 1TOMH 1KXBA 3DORA 1MKWH 1WTGH 1ZGIA 2JH0D 2O8UA 1GDUA 3CYYA 2CV3A 5GWZA 3S0NA 2H3LA 2HE2A 1W8BH 1TNIA 3SJIA 3DSGA 3UQOA 2JH6D 2THFB 2F83A 1KMHB 4ISNA 4E35A 3ODFA 1A0HB 1GMCG 4CRFA 1H9IE 1UEWA 4NXPA 4ASHA 1OKXA 1MD7A 2J2UA 1F0TA 3G01A 2XNIA 4H4FA 5FCRA 3MWIU 1FIWA 5EQQA 5JPMH 2ODPA 1VAEA 9LPRA 2QKVA 1KY9A 4Y0ZE 2H6MA 4HI3A 2W6ID 4K5ZA 5DN6D 2FPZA 1A5GH 1SVPA 2PKSC 4Q6HA 1SGQE 1G3DA 2GT7A 4WYUA 4A1XA 4D76A 1HNEE 4Q63A 2OXSA 4X6MA 1GJAB 1O0DH 3A7VA 2EDZA 3U8RH 3K1RA 3R68A 2B5TB 3OEHD 2Y5GA 2QA9E 5HKKD 1V2TT 3KQDA 4TY6A 1O2JA 1A3EH 4DOQA 1A4WH 1W12U 2DE9A 1UVTH 2Z3EA 2AWUA 4O97A 4RI0A 4XHVA 1VKYA 1SGPE 2KJDA 5BRRE 5TCCA 4Q6SA 4A7IB 4WF8A 5J4QA 3SFJA 3ATIA 2L4TA 2QF0A 4K75A 1UCYH 1D3QB 1PJPA 5JBTA 1MKXH 1K21H 4BXWA 1XUGA 2EI7A 1FONA 1A61H 1F0UA 2DMZA 4R2ZA 2ZU2A 3LOXA 4K78A 1KTSB 4NMQA 3SW2B 2CGAA 1AO5A 4CRDA 1C5PA 5C20A 3QZQA 2OS6A 4AG1A 4UFEH 2VGCC 5DK1A 4NFFA 1GJ9B 1CU1A 1GI0A 2SGAA 4JZDH 5DP8A 2OCSA 1SBWA 3ZVFA 2Y6TA 2M0VA 4UE7H 1O5CB 1Y3UA 3Q3KA 1P11E 2C8WB 1F0RA 2FMJA 5HEDA 5HEBA 1BFEA 3U28C 4D9RA 3RXIA 1FC7A 1O33A 4B6EA 1UEPA 4FUHA 4HG6A 3BTEE 1ARCA 2C8YB 3QZRA 4UFDH 2Z7FE 4WMFA 4E7RG 1AUJA 2LOBA 2EGKA 3TH3H 1GVZA 3SNEA 2H2BA 4WMEA 3SQEE 4MQAA 1D3TB 1SQAA 3EA8A 1AHTH 2FCFA 2G4UA 3LH3A 3HPMA 3O8DA 6GCHF 2AWWA 2P3UB 1VITF 2G4TA 2GCHG 3EE7A 3A83A 1MKXK 1QLCA 2HVYB 3TNTA 1V2NT 3MH6A 2JXOA 3PWBA 1T2MA 1MMJN 1O5GH 1O3EA 5PTPA 4B71A 4ESTE 2WV4A 3I77A 4I32A 3TU7H 1AVWA 2ZP0H 3S9BA 1PPZA 4AMHA 2RDEA 3KF2A 1SFIA 3SJ9A 3SJ8A 1DPOA 5HYOA 1N7EA 3LH1A 4ABDA 5I25A 3A7ZA 4JOEA 1WF8A 2H5CA 2HGAA 4FGMA 3VB4A 4N6XA 1DLEA 2M0UA 4P02A 1HUTH 1K1NA 1HIAA 3F2FA 1BMAA 2EEHA 2P3WA 4NMVA 3QX5H 3ID3A 1U6QA 4OS2A 4Z6AH 1GCTC 2F9VA 5HFEA 2BX4A 1BUIA 1GBJA 4YLQH 2O8TA 1GG6C 1P03A 3T26A 1TQ3A 3RDZA 2ZTZA 1SQRA 1ZSKA 1P01A 1E35B 4Y76A 2X7ZA 3FANA 2A2XH 4MLFB 3T29A 3CBZA 4M7GA 2W6JD 3QTVH 2Z9IA 3ODDA 1W7GH 3I29A 1GGDB 2ZCKP 1FUJA 1W0KD 1HAHH 3FZZA 4GUXA 4K1SA 4I7YH 3NFLA 2CHAC 1A0JA 2J5UA 4TSFD 4DURA 3LPRA 1WTHD 2GKVE 1MC7A 1Q2WA 1NS3A 2XXLA 5EW2H 2FLBH 4FXGH 1DDJA 3KHFA 1W3CA 3BTTE 4BNRA 3SUFA 2M0TA 4XFQA 4HOPA 1MBQA 3F0PA 5ABWA 3C27B 2SGDE 3RXEA 3O8CA 4CH2B 3ZZCA 1AIXH 4AFSA 5AFZH 1O30A 1X5QA 1IOEA 1GVLA 3NFKA 4ZHAA 1NU9A 5FBIA 2K1ZA 2C8ZB 3SHUA 4KP0A 1FY3A 5HFBA 5F67A 3TVJB 6CHAC 1K28D 2FI4E 3LONA 2ZDAH 3OSYA 2ZQ2A 2ANMH 1NC6A 1OYTH 1Y5UT 1DY9A 3BG4B 2J4IA 1QB9A 4VGCC 1DUEA 1KYNA 5F8TA 4JORA 4BAHB 2VINA 3QK1A 1ANEA 3PM3A 1GHYH 4GCHG 1RJXB 2D1JA 1VR1H 1YYY1 3IITA 4BAKB 5CE1A 2OC1A 2WYJA 1UJDA 1QCPA 2JH5D 2FLRH 3BTHE 3CH8A 1TNGA 4AG2A 4BAQB 1BTHH 1EJMA 1FQ3A 2RDLA 3OE7D 1AGJA 3GGEA 2UZCA 2ZTXA 1AFEH 1S0QA 1D6RA 5HFDA 4ZXYH 2TGAA 1O2ZA 2P8OC 4MPAA 2VIOA 2ZG0H 2A31A 1E0FD 2ZFSA 1LCYA 1P2IA 2BMGB 1S81A 1SL3A 3GABA 1YPHE 1TA6A 1LTOA 1A46H 4M9FA 1ZRBA 3RXAA 1ZMLA 4ZHLU 4ISHH 1GQ4A 1K1OA 1P9SA 1MABB 3MH5A 2R3YA 2O2TA 1LVOA 2I6QA 3TJVA 5H3JA 1BHXF 3BEIB 1BZXE 2HNTC 1PYTC 3HPTB 4P00A 2BXUH 3OY5U 3PMHB 3UNSA 1UTPA 2V6NA 4ACAA 2FE5A 2G00A 1V5QA 3L6PA 2F0AA 1YCPK 2BD8A 3V7TA 1YPKH 2V1WA 1Z1JA 1NZQH 1LQEA 2GV7A 4YT6H 3TJOA 8GCHF 1WFGA 1NROH 4Q2OA 2D92A 2VBCA 2GP9B 3HK3B 2BD2A 3QE1A 5FXLA 1VB7A 4H42U 3ZVEA 1TALA 1L1JA 1GI8B 1GJBB 2YOLA 2HRVA 3P8NA 1C5WB 4RKJB 5LGOA 2BTCE 5F6MA 4DVAU 2F3CE 1BCUH 4ABJA 2EHRA 4JK6A 3PWCA 1MU8B 1J17T 1F7ZA 2FWWA 2HE4A 1GI3A 2QAAA 3E0NB 2VNTA 2BHGA 1A2CH 1KTTB 2VB0A 1LHGH 4I8JA 5EU8A 3VQFA 1SR5C 2GV6A 3KQEA 4Q4LA 5GLJA 2ZU1A 2OPGA 3CS0A 2W7UA 2ZQ1A 3NCLA 1SC8U 3HK6B 2ZHFH 2XW9A 1MUEB 5ETXA 4MPVA 4KTSA 1C4Y2 3H5CB 4GAWA 3DD2H 1SOZA 3A89A 1DWEH 3DA9B 1C2JA 1UCYE 3BF6H 2OK5A 5EQSA 3NCVA 1FY5A 1O3HA 1FC9A 2D8IA 1NN6A 2FOBA 2P3FH 2ODQA 1QAVA 5DG6A 2K1QA 3RP2A 1X45A 1TX6A 2CN0H 4K1TA 1E1QD 1P06A 2BQ6B 3KL6A 1XM1A 2Y80A 1LVMA 1UK2A 2O9QA 1ZTJA 3T5FH 4FUGA 1QJ1B 3H7TA 1EOJA 5T3HA 2KR7A 4K69A 1Z71A 3TIUA 2VIPA 1X8SA 1QY6A 3LDXH 1GI2A 1O2WA 1XUIA 2K8IA 3RXDA 5DO4H 2BM2A 1NTEA 3RL7A 4A92A 4BTUB 1FAKH 1PFXC 2P94A 3QDOA 5E2OA 1UHBA 2M3MA 3U69H 4SGAE 4TPYA 2NWNA 1B0FA 2FOEA 4NIWA 2KPKA 1V2VT 3M5OA 2VRFA 4GVCA 2PDZA 4JZ1A 3VPKA 1CQQA 1XUFA 1ZJDA 4FUDA 3UPEA 4AZ2B 2ZFRH 4ZKSU 2B0FA 3SZEA 3P17H 1PQ5A 2ZO3H 3VXFH 2QXGA 1TRYA 4DIIH 3SV7A 2GT8A 1ABIH 2SGFE 3ZZ3A 4NMSA 4NZLA 1BTUA 1Q3OA 1GI7B 2BZAA 4IGDA 2G2LA 5JBCS 4A1TA 3UQVA 1SGDE 2PKAA 5HFCA 2TBSA 1N7FA 1GMCF 3UY9A 3AXAA 1GBDA 3SOEA 4NIXA 1O3LA 1F5RA 2QY0B 4IBLH 1DWDH 3EA7A 1HAVB 1A5HA 1EAWA 1GI6A 3WKLA 2PUXB 1QIXB 1MTNB 3FOAA 2DM8A 1C5XB 1OWKA 4CBNA 3UWJH 2WPDD 3PLPA 3T25A 3HKJB 3UOPA 1T4VH 1IQFA 1CHGA 4KFVA 3BN9A 2ODYB 1SLVB 5EJLA 2ZPQA 1N99A 2TPIZ 1ZTKA 4F8KA 1ANBA 2Q9VA 1AWHB 1C5MD 1O2VA 2OQ5A 2OQUA 2VPHA 1PPCE 1XUKA 3KCGH 3Q3YA 4AOQA 1GI4A 1L6OA 1GJ5H 5KEDA 3EQ0H 2QC2A 3LC5A 1C9PA 1ZMNA 3KZEA 2STAE 5K0HA 2Z3DA 4BANB 4L8NA 1XUJA 2QKTA 1XMNB 1O3DA 3Q77A 4YM9A 1O31A 4A1VA 4X6OA 1ZR0A 3CS7A 1WF7A 3GICB 1QAVB 1GBLA 1YPGH 5GCHF 1CVWH 2JETC 2VSPA 6ESTA 4YT7H 1V6BA 2WZQA 4X1NU 2L4SA 2YMSD 3ZZ5A 1QA7A 8ESTE 1RY4A 5EGMA 1ELBA 1D6WA 1EAIA 1LHEH 1OYQA 2Q6FA 1YC0A 1CO7E 1E37B 1ESTA 1Y3XA 1WH1A 2EA3A 1C2HA 4NIVA 2KG2A 3PRBA 3A85A 1SGFA 4JOJA 2Y7ZA 4HFPB 2GX4A 1QNJA 7LPRA 1BBRH 1L4DA 3LGTA 1ZPBA 2AIQA 1HPGA 2KM0A 1LVYA 2DLUA 3BTGE 1UW7A 2J34A 3D49H 3PB1E 1W9OA 2UUYA 1BMFD 5IYTA 1AB9C 2EC9H 2SGQE 4B73A 4Y7BA 3UAIC 1L0ZA 2XC4A 1S5SA 4JMYA 2PGQB 1C1UH 1ELAA 1OWJA 2AFQB 1H8HD 2YTWA 3E17A 3WWFA 1SLWB 1V2MT 1BITA 4FUEA 4NMOA 1LKAA 2WUBA 4IMZA 2A2QH 3RXCA 3ZVBA 5DP6A 1IQGA 1IHSH 2LC7A 2BVSH 4FU7A 1QFKH 1AUTC 1UTMA 1K9OE 5IDKA 4R8TB 1Y8TA 1QBNA 2L6OA 4CRCA 4LOYH 4YOJA 1GPZA 3MI4A 1TX8A 4AFQA 2EY4C 3FP8E 1P2JA 2QGRA 1G32B 4D9QA 5G4BA 1EASA 4INLA 4NFEA 4SGBE 2IWOA 2A32A 2J95A 2HPPH 1TP5A 2SNVA 3RC4A 1O37A 2ZECA 3W94A 1O2TA 3QGLA 3TK9A 5B6OA 3M7UA 2V0BA 3DJ1A 4IW4E 1O32A 1OP2A 1HAVA 2GZVA 3TGIE 3EGHC 2EEKA 1CT0E 2Y82A 1O2LA 4JCNA 4WH8A 1TQ0B 2R3UA 3UR9A 2LPRA 1PYTD 1FPCH 2Y5FA 1W13U 4I8LA 4MNVA 1BBRE 2Q6DA 5FHTA 1TLDA 2ZA5A 3T27A 2ZFPH 1UCYK 3PMJA 2FTLE 2OCVB 3SV2H 3M36A 4ISOA 2BD3A 1ESBA 3RUOA 1V2ST 4TY7A 1O2QA 1TPSA 2WV9A 1BTPA 1RGWA 4BAMB 1QJ7B 4Z8JA 4GHNA 1HRTH 2BOKA 1XKBC 2FOMB 3GY5A 1DT2A 1QR3E 3I4WA 1P3EA 2VH0A 3SQHE 1QTFA 4X8UH 1CGHA 1C1WH 1IHJA 5T6GA 1XKAC 1GHBG 4AGKA 1S0RA 1TB6H 3Q76A 5HMAA 1KSNA 1EQ9A 1UVOA 2QXIA 3AAUA 2YT8A 1O3FA 3O5NA 5HF4A 1TFXA 2NU3E 2G5NA 2DB5A 2YUYA 3BPUA 1G36A 4ZHMU 2H9EH 4AFUA 2KJKA 3E90B 4X1QU 1YF4A 1FPHH 3M61U 5JB9S 1ELTA 1IAUA 1T8OA 5HETA 1K1LA 3D65E 3ZVDA 3A7TA 4NSYA 3M5NA 3S69A 4NMTA 3MNXA 5DPAA 1O3MA 5AVDA 7GCHF 3EGGC 5FX6A 4NWKA 2TGTA 4YZUA 2Z3CA 1DXWA 1NM6A 1TPAE 3RXTA 1ANDA 1WFVA 1GBBA 3LGWA 1I16A 2FNEA 1DVAH 3QGJA 1O3BA 1TA2A 4K2YA 1UTOA 2QF4A 2EAQA 5GDSH 1AKSB 3STJA 2PWXA 2EEIA 1FXYA 1O3NA 3BG8A 4B2BA 2OQSA 1VJAU 1GBAA 5DP9A 2FI3E 1B8QA 4WYTA 1JBUH 5C1UA 2BQWB 3FZDA 3SOSA 4DJZB 3EA9A 2PUQH 4IN2A 4WWYA 3KDGA 2WSSD 1GL1A 1IU2A 1XVOA 1FX0B 4YDPA 3F9HA 3SNAA 5I46H 1UVPA 3A8AA 3C1KA 2FN5A 4JZEH 4H11A 2OGPA 5FCKA 1NRSH 1CT4E 5GJ4B 3F68H 3STIA 1HIAB 4YXWD 3SU6A 3W95A 1PDRA 1A3BH 3SI3H 3K2UA 3P8OA 1UJ1A 1NY22 3ATKA 1MCTA 5TCAA 1WXRA 1YPJH 2FX6A 1ACBE 1HCGA 3PMBB 3KZDA 2D2DA 1KXEA 5E2PA 2ZI2H 1B0EA 2KL1A 2JSNA 3GCHC 1C5ZB 4Q7YA 3GYLB 1X6DA 4E3BA 1EP5A 3SHWA 3A88A 1BJVA 2FOAA 4GCHF 1OZIA 4UU6A 3D62A 1HAGE 3PDZA 1GHVH 4EDJA 3EDXB 2H9TH 2A4OA 2SFAA 4JYUH 1GHXH 4Q2QA 2CXVA 3A7WA 2FOFA 1YWUA 3BTWE 1C5NH 2AEIH 4AYYB 4K8BA 1T8MA 1TBRH 4JYVH 2FDAA 4FLNA 1H1BA 1TYNA 2GJGA 1PPGE 3L3TA 3Q00A 1WOFA 1GVKB 2YT7A 3HPKA 4K6YA 1EPTC 1O3CA 2DE8A 3SUZA 3AASA 2DLSA 1BMNH 2JREA 2BDYA 1K22H 5JBAS 1SGEE 3HGNA 4YOIA 1Y3YA 1SSXA 1HAPH 1YCPM 1YM0A 1C1QA 1NPMA 1ZJKA 2KCOA 4MG3A 1MD8A 2BYGA 1TPOA 1CGIE 2HOBA 2RRMA 1C2IA 2FS9A 3RXUA 3QIKA 3RXPA 2BYAX 3LNXA 3VB7A 1KLJH 6CHAB 2P3TB 3DJ3A 3GCHB 2BD4A 3Q3XA 2AS9A 4JOGA 3PV5A 2OBQA 3RU4D 1OWEA 1LPZB 3NRLA 1C5RA 1RS0A 1N8OB 1FN8A 2P93A 4YTAA 3A8CA 2GZ8A 3ITIA 5DTHA 3ESTA 1KWAA 1RFNA 1NBME 1O5DH 2J92A 4H6TA 1DWCH 1O2SA 4QT8C 1Y7NA 2BDAA 4F4OC 5L2YH 2I0IA 3UNRA 1UEQA 4NXRA 1NRPH 1Q3XA 2B8OH 3P8FA 2I0LA 1SQOA 2ZDLA 5EPNA 1JIMA 1JRSA 2O8WA 3DSPA 4OS4A 2FEQH 3OTJE 2JJ2D 1ZHPA 1KXDA 4HZHA 3B76A 1TWXB 2ZDKA 3SU5A 2FODA 3WW7A 2P59A 2BD5A 3R0HA 4GVUA 1SGTA 1D5GA 2V3HH 2AMQA 2Z94A 4MNXA 5EODA 2HNTE 4I8KA 1H4WA 1CGJE 1EPTB 3NUMA 3ZIAD 2BLQA 3AAVA 6LPRA 3UFAA 1V1TA 1AWFH 4YOGA 2EV8A 1BIOA 1ETRH 2IWNA 2ZHDA 2BX3A 2J98B 9ESTA 1ELCA 1VITH 3M37A 1B5GH 3R3GB 1SGIB 1NFWA 1O2PA 1O3AA 1QA0A 1Y5BT 2C93B 2J38A 2R2MB 2YMSC 4ZUHA 3SGAE 1NRQH 4CHAB 3PV4A 2JINA 3NKKA 1JWTA 2JJ1D 1BRUP 3U98H 2BDGA 3F6UH 1P12E 4K8YA 3SNBA 1GBHA 3NPSA 2BDBA 2ZGCA 2XBXA 3RXFA 2F9UA 3PMAB 5B42A 1HXFH 1O2UA 2G8TA 4E06H 1ZSJA 1KDQA 1QL8A 2K0QA 3GDSA 1EX3A 4JOPA 4DIHH 1DUAA 2KCYA 3AK5A 1O5BB 2J94A 1LQDB 4U2WA 3QJNA 1DY8A 2R0KA 3ENSB 5DP3A 4OAJA 1SGRE 1UTLM 1V62A 4WH6A 7KMEH 1YPHC 1O2YA 1ZTLA 3O46A 1QQ4A 2J9NA 3UOUA 3PTNA 1HLTH 5IK2D 2STBE 3LT3A 5EOKA 3RXBA 1LVBA 3W1EA 1YPMH 1HAXB 3P8GA 5C0TA 1HGTH 1DE7H 2KOHA 5C67A 2REYA 1DS2E 1YPEH 1HJ9A 2A5IA 3T62A 2GCTB 1UTJA 1V2OT 2LELA 3RXOA 1UTQA 1FNIA 2FOHA 1JMOH 4YESB 4CHAC 5JB8S 3MNSA 2R4HA 4KELA 3S9AA 3LKWA 3WY8A 4Q7ZA 3GISB 3ATLA 2OP9A 1MU6B 1NFUA 3ZZDA 1GHZA 7GCHG 1TMBH 4P0CA 1IQKA 1SI5H 3ZZ7A 4NCYA 1VJ6A 2EEJA 1AZ8A 2CMYA 3SBKA 3TJUA 5IL9A 1TNHA 1IQIA 4CBOA 1SGFG 2HALA 1QZ8A 2UUKB 2IWPA 3BEUA 4X8VH 3RXLA 1BTYA 1VCWA 5EJ1A 2ZKSA 1HV7A 1J8AA 3F2GA 2Q1JA 1C4U2 1C2FA 1PPEE 5FPYA 2IPHA 2IOTA 1O39A 4TT3D 2G5VA 3UUZA 2BY9X 1WI2A 4UDWH
chains in the Genus database with same CATH topology
2FZZA 4I8GA 1AZZA 4ABIA 2LA8A 5I7ZA 3KDKA 5F3XA 3SU3A 1W2KH 2AH4X 1WCZA 3UTUH 1ZHRA 2ULLA 2FI5E 2G52A 1C1PA 1FJSA 1AE8H 2NU2E 4U01A 2VWOA 1M5ZA 2SGEE 4LZ4B 3ZZ6A 1P1EA 4XE4A 1DFPA 3UIRA 1LO6A 3GSLA 2KBSA 2AMDA 3UNQA 2UWPA 1CA8B 1BOQA 1Q3PA 3V13A 2P16A 3RXMA 2M10A 2R9PA 2PNTA 1HXEH 1P9UA 2PR3A 1MH0A 5FB8C 1DANH 2BOHB 4PROA 3TJNA 1BJUA 2O8MA 1OPHB 1E38B 4YYXA 1SFQB 1T7CA 1WU1A 4AB8A 2UUFB 1S6HA 4FUCA 2RCEA 2ZZUH 4UFFH 4KFWA 1Z7KA 2KRGA 4DGJA 3M3SA 2PKUA 3AVZA 1C5YB 1J16A 4JZIA 1Z6EA 1ABJH 5JBBS 5A8ZA 2WYGA 2FYQA 2EDPA 1T8NA 4AX9H 1C1TA 3SGQE 1GMHG 1XX9A 3RXRA 2AINA 1GI1A 3VXEH 1WI4A 1FDPA 1X5NA 1X7AC 2I1NA 1GCDA 1OP8A 4I33A 1TP3A 1O2RA 4NA8A 5A8XA 4E7NA 3TGKE 1ETTH 1BA8B 5F8XA 1ZPZA 5ESBA 3E8LA 1GBCA 3QTOH 4AORA 2GMTC 1SGYE 3A87A 2A7CA 3QWCH 1V2PT 1W14U 3ZZBA 3RU4T 1KDQB 1ANCA 4MNWA 1GL0E 4BAOB 6GCHG 3TK5A 1OX1A 2ZHEH 2VU8E 1P3CA 1Z86A 1OOKB 2A45B 1O3JA 3ID4A 3LJJA 4RKOB 3S7KB 3MOCA 3V3MA 4K1EA 5LH8A 1AQ7A 1GBMA 2XBYA 5G1EA 2P8OB 1GBKA 4IS5A 1C2MA 2ZEBA 3EYDA 4MDSA 1ID5H 1RTFB 3VQGA 3TSVA 5EG4A 2F5YA 1GJ6A 3QDZB 3K82A 2EDVA 2G81E 2E7KA 2VZ5A 1BTXA 1UO6A 1ZZZA 5DJ7A 1UTKA 2TGPZ 1V5LA 1FY8E 3PROA 1P1DA 3PTBA 3PYHA 3V0XA 2L97A 1L2EA 2VIDA 4K76A 3MO6A 2ZPRA 1U38A 2OTVA 3NGHA 1AB9B 4ISIH 4FUJA 3ZVAA 1QJ6B 2Q3GA 4X1RU 3PLBA 2GZ7A 2PZDA 4XOJA 1AVXA 1BQYA 3DFJA 5FAHA 4JL7A 2C3SA 5C2ZA 3QLPH 4FUFA 1C5OH 1TNLA 3GCNA 1AI8H 2BXTH 4Q7XA 3U8TH 1DLKB 1KLTA 1OS8A 2OC7A 4K3JA 4A5TS 1P2MA 2ZDVH 3SHCH 1J14A 4Y0YE 3MH4A 4O3TA 2MX6A 3BV9B 2HNTF 5C5OA 2KAWA 3E16B 1AVGH 1P57B 1MCVA 2XBVA 3VEQB 5HM2A 4ZROA 1WYKA 4O03A 1HJAB 3M5LA 2ZFQH 2PW8H 1TGBA 1GHBF 2ZCHP 1O3GA 1V2KT 1C5UA 1DWBH 1RIWC 4NA9H 5EXMA 1K2I1 3A8BA 3P95A 3MFJA 1TRMA 3EAJA 2PLXA 1JXPA 4AN7A 1T8LA 3SV9A 2SNWA 1XUHA 4KGAA 5C1XA 1O2IA 2OD3B 3UR6A 2RCZA 1DSTA 1ZLRA 2W7SA 4Q2PA 4MVNA 3URCA 4JOHA 4CRAA 1ELVA 1BMLA 1WV7H 7ESTE 3DIWA 1MQ6A 1FZZA 3P92A 3ID2A 3BTFE 2XWAA 2EXGA 1SOTA 4LK4A 3SORA 1O2NA 4WXVA 4U30A 2Y5HA 1UITA 3LGIA 2I6SA 4FVBA 4BTTB 5DP7A 2EJYA 1V2WT 1D4PB 4CH8B 1UK4A 2ANKH 2GDEH 3KGPA 5CHAB 1K1JA 5B6LA 4GPGA 4WVPE 4J2YB 5DKMA 1QRZA