3GDUA

Crystal structure of degs h198p/d320a mutant modified by dfp and in complex with yrf peptide
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
316
structure length
294
Chain Sequence
DSTDETPASYNLAVRRAAPAVVNVYNRGLNEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINPGNGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREQGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMAQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title OMP peptides activate the DegS stress-sensor protease by a relief of inhibition mechanism.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase activator
molecule keywords DegS protease
total genus 57
structure length 294
sequence length 316
chains with identical sequence B, C
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3gduA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gduA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gduA01
5HF1A 1A0LA 4NA9H 2DE8A 1Q3PA 1K1JA 1NU9A 3ZVBA 2ZF0H 1VJAU 5AF9H 5HDYA 3CYYA 1GPZA 1NZQH 1Y8TA 2CSJA 1GWAA 2GZ7A 2ZFTA 4NCYA 1UJ1A 1PJPA 1MD8A 1S6HA 4JOPA 4GUXA 1CBWC 2XCFA 5EXLA 1WIFA 3RC4A 3BSQA 1GBTA 2G4UA 4E3BA 5F8XA 1YPEH 2YUYA 1XVMA 4BAHB 2Z6BD 1GGDC 3A7TA 3AW1A 2CS5A 1P06A 2PFEA 1YP9A 1A5GH 4XBCA 4NSVA 1TP5A 4XDEA 2KBSA 1D3DB 1Q31A 1S5SA 4INHA 2Q6GA 3V3MA 3E3TA 3LGYA 3VB4A 1TGCA 3PDVA 2BB4A 1C2LA 3A84A 4CHAC 5L2ZH 4GHTA 2ZPQA 1AIXH 3SN8A 1N6EA 1W2KH 3S9AA 1FMGA 4EDJA 7ESTE 1ZOMA 4D9QA 2BOKA 5FBIA 1C5TA 2HLCA 2L4SA 2F0AA 1OSSA 1TPPA 1NF3C 1YYY1 1EKBB 3U8OH 4LK4A 4MNXA 3RXPA 3STIA 4D8NA 2BLQA 1TMTH 2ZFPH 2FLBH 1Y5AT 2BD2A 2BY9X 3RDZA 3A7XA 3P92A 1O2KA 1PPCE 2Z3DA 2OC8A 1BBRK 5L30H 3SUGA 3P70B 1P2JA 3URDA 2OGPA 2EDZA 3TH3H 2FO9A 1HJAB 4J2YB 2H5DA 2V35A 4ABEA 1BUIA 3K6ZA 3UIRA 3HK3B 3A82A 1A61H 4JZFH 4UE7H 3TNTA 1LCYA 1SG8B 2FOAA 1IQEA 1MFLA 1P2MA 1P57B 1FJSA 5HETA 4MPAA 1BTHH 2Z3EA 4D7FA 3A8AA 2NU4E 1UTOA 1MKWH 1E37B 2OINA 5A0CA 1W9OA 1K2I1 1SHYA 3V12A 4AGJA 1N1LA 3ID4A 4ZMAH 1GBKA 4YESB 1UEQA 1PYTD 2FYQA 2QKUA 3TU7H 3CP7A 2OCSA 1XUJA 1O5GH 1X6DA 1CGIE 2PR3A 4GVDA 3GCTG 1Z8JB 1WBGB 3ITIA 1L1GA 4RSPA 1CU1A 4AYVB 4ZH8A 5J4SA 5H4IB 1AN1E 1C5OH 1VGCB 3MNSA 1TNIA 1UTPA 3DHKH 1AB9B 1ZR0A 4X1SU 3RM2H 2AFQB 4Q2NA 1V2PT 2FXRA 4UU6A 3CS0A 1LQDB 3GJ9A 4JYUH 4XOJA 1AVXA 3RXHA 1YPGH 1VGCC 2BVSH 1T7CA 1ELAA 2M0UA 1NU7B 1VITF 4YOGA 3ODDA 4K5ZA 2BMGB 3V7TA 3IWMA 3K6YA 4JZDH 5GPIB 2RCEA 1C2FA 4M7GA 3SJIA 1GBEA 4CRDA 1V2ST 2H2BA 1IHTH 5A09A 3GCHB 1OWHA 2QYIA 3ZZ9A 1YLDA 2KG2A 3K50A 1O36A 1ANBA 3SUDA 1OYQA 3K82A 4WH8A 1PQ8A 5C1YA 4CRAA 1TMBH 3PMAB 2ZA5A 4ABBA 2PSYA 1SOZA 2EI7A 2HNTF 2V90A 4MNWA 2R3UA 2VGCC 1VITG 3KEEA 2JXOA 3RXVA 1OBZA 1HAHH 5EG4A 5E1YA 1L0ZA 1DM4B 1TRMA 4Q2KA 1C1NA 2SGPE 2BY5X 3NFLA 3BEUA 2ALVA 5GCHG 1V2RT 2AYWA 1GI9B 4JOKA 1P2OA 2L4TA 1P03A 5FXLA 1V2QT 3C1KA 3H7TA 3RXUA 4HFPB 1GJAB 1R6JA 1HAPH 2F9BH 1DUEA 2BYAX 6GCHG 2OUAA 2B7DH 3UR9A 3DJ1A 1MCTA 1P04A 1OOKB 2B8OH 1ZTKA 5EQRA 1K1PA 1BOQA 3PWCA 5F03A 1SLWB 3MU4A 1V5LA 1NRSH 2ZU5A 1MZDA 4AFQA 1O34A 2A4OA 2G2LA 2VINA 4E7NA 2ULLA 2AMQA 3DFLA 1QA0A 1O3KA 2FZZA 2VPHA 1G37A 4O97A 1ANEA 2BZAA 1XUKA 1YKTA 4ABAA 3M3SA 2Q3GA 1O3BA 3TITA 1VJ6A 2ZG0H 3PLPA 1TGNA 4CREA 4Y10E 1ELDE 1FZZA 2VIWA 1OBXA 1ZZZA 2BD7A 4Q7ZA 2QBWA 3W95A 3MI4A 2Y81A 2LC6A 1J16A 1I16A 3MFJA 5HM2A 1KDQB 2OQ5A 1DWBH 1P3CA 4OS5A 1DITH 2TBSA 4NMSA 2I0IA 2KYLA 2ZHEH 1BTUA 4FUCA 1U38A 1TA6A 4Y7BA 2QGRA 2ZEBA 2QXJA 2GMTB 6CHAC 3ATIA 5DKMA 4ABDA 1H9HE 4ISIH 1FI8A 3LNXA 2XWAA 3KF2A 4AFSA 5DJ7A 2XC4A 3BPUA 2QXHA 4N6XA 2DE9A 1BRAA 2C8ZB 1EASA 2BLOA 5E0JA 1KXDA 4K60A 2O8TA 1UFXA 2ZGJA 4CR9A 2VSVA 1OWEA 2KJDA 1GMDF 1ZYOA 3DJAA 1SLXB 2Y6TA 4B71A 4AYYB 1CA0B 1Y7NA 3HPTB 2LNCA 3LOXA 1TWXB 5JBTA 3FANA 4Y6DA 3SGQE 1GL0E 1A3BH 3M5NA 1UEWA 1P12E 1BA8B 1RFNA 4CH8B 1HB0B 4PROA 4E34A 4YDPA 2NWNA 2PUXB 2AIQA 2FESH 5HGGA 2ZFFH 1DSUA 1YPLH 5EW2H 3F6UH 3TK9A 2WUBA 1GI2A 1O2LA 3RU4D 4FUFA 2VIDA 1FPCH 2W7UA 2VWMA 3NK8A 1F0UA 1ABJH 1FAXA 2PGQB 1J8AA 3RL7A 2H6MA 2GP9B 2FE5A 4IS5A 2OBOA 2EI6A 2VIOA 4X2YA 1S0QA 3VB3A 5EXMA 4YZUA 4XHVA 3KQEA 1DT2A 4XBBA 2G52A 2I0LA 4DIIH 1VAEA 1PPGE 2F9VA 4LOYH 3PS4A 3GY5A 1ZHMA 2P3WA 2FPZA 3TK5A 3F1SB 3SNAA 4MPUA 1ZJKA 4NFEA 2PZDA 2V1WA 3KHFA 5HYOA 3SGAE 1MAYA 4IN2A 2FODA 1PQAA 1BHXB 4IN1A 5DP8A 4LXBH 1F5RA 1RGWA 2EAQA 1SI5H 1SGQE 2CF9H 1MQ5A 1F0RA 3UNSA 2LUIA 3FVFB 1ZUBA 1Z8GA 1S83A 2A32A 3EYDA 1C5QA 1H9LB 1H8IH 1NESE 4VGCB 1UTLM 3BIUH 1O3PB 1UJUA 1EPTA 3BG4C 3FP6E 4K8BA 2F91A 2BD3A 3LNYA 2G51A 4UFFH 3JXTA 4A5TS 5JB9S 1GM1A 1YPKH 2A0QB 2HWLB 1M9UA 2O2TA 1UTQA 4INLA 4MNYA 4CRGA 1ZLRA 1VB7A 4RKJB 1C1OA 1S82A 2OQUA 2D2DA 3K1RA 3RXBA 1RRKA 2K1QA 3UNRA 4NMRA 3A87A 2F9NA 1A2CH 2LOBA 4JZ1A 1FY4A 2NU2E 1GI3A 2BX3A 1ZRKA 2D92A 2JH5D 1SGFA 1V5QA 1DWDH 3LU9B 2ZNKH 2EEKA 1RTFB 4B2BA 5CMXH 1SQTA 3SUZA 1TOMH 4D9RA 1T32A 3QZQA 1BTPA 1FY3A 4X1RU 2ESTE 1TPAE 3SJKA 4L8NA 2F9PA 1G3BA 1WFGA 1OWDA 1WTGH 3ID1A 2ZDKA 1ELTA 3SHAH 3KNXA 1O5EH 2JETC 2W5EA 2XTTB 1K1LA 2BDCA 1XKBC 1ZPZA 3PMBB 4AN7A 1BHXF 3D65E 3ZRTA 1C5LH 4K6YA 2YNAA 1TGSZ 3EDXB 3BF6H 2JETB 4ABGA 3QJMA 2H1UA 3NZIA 4R8TB 3GY7A 1GJCB 3V0XA 5F6MA 9LPRA 1SLUB 1B7XB 3SO3A 3S7KB 1TX8A 4Q2PA 1NY22 3T5FH 1SGCA 2BXTH 1WFVA 2FWWA 3PMJA 2AEIH 4K72A 3DFJA 2R2MB 3EE0B 4BTTB 2OXSA 3E6PH 5A0AE 3ZVAA 3FFGA 4YO9A 5EQQA 3UWIA 4X6PA 1EJAA 3O8BA 4O3UA 1EAUA 1TNKA 1P8VC 2VVUA 1F5KU 3DA9B 4Y11E 4NIXA 1ZSJA 2ENOA 3SJ8A 2UZCA 2TPIZ 3ZZBA 2RA3A 1SOTA 3AASA 1KXCA 4JOGA 2CV3A 5HJ1A 3CBZA 3QGJA 4U01A 3L3TA 2C8YB 2GD4B 3DORA 1QL9A 1SGFG 3FZDA 3RXMA 4DVAU 4DURA 5TCCA 1EAWA 4B75A 2WPMS 5HEDA 2MX6A 4NZLA 3M5MA 4NXQA 2JOAA 1D9IA 5CHAC 4LZ4B 1C2HA 2UUFB 1SLVB 1P2KA 1G32B 4O9VA 1S0RA 2UWLA 5F8TA 5G4BA 1ZPCA 2QC2A 3MMGA 3E0NB 1LVOA 2ZZUH 1MC7A 2D1JA 3QJNA 3R0HA 1ARBA 2WPIS 2ZI2H 1UM7A 1HRTH 5JXBA 1A3EH 4GAWA 5FX5A 1G2MA 3PV2A 1GI1A 2BVRH 3BV9B 2QA9E 3E90B 1O3AA 3GCNA 1T8LA 1O3EA 5HM9A 4ABHA 3ODFA 1RTKA 2XBXA 1MKXK 1GQ5A 1HAVB 4TYDA 1CHOG 4TWYA 5A8ZA 4Y0ZE 2R9PA 4MLFB 1GBMA 1V2VT 2UUKB 5HFCA 1K21H 2ZFSA 3A8BA 4HGCA 2FOBA 3ZVEA 1O2HA 2H9TH 4X8TH 2C4FH 2PTNA 2G4TA 4Z6AH 1EOJA 1TNGA 5DP3A 1GI6A 1WJLA 4ISOA 3ID3A 3D23A 4I31A 4AOQA 5FCKA 1QQ4A 2J2UA 3BTKE 1MZAA 2Y7XA 3PLBA 1Y3UA 1O33A 4B74A 2I1NA 1GBIA 2Y80A 3QZRA 1ZTLA 2ANKH 1KIGH 1SB1H 2A5KA 1NTEA 3H5CB 3L33A 1Q3XA 2P59A 3MHWU 3TJUA 1IQHA 3HKIB 3SHCH 1Y3VA 2DAZA 1O31A 3TGIE 1GI5A 5FAHA 2FX4A 2AWXA 5DK1A 1L6OA 2IN2A 2OC1A 1Y3YA 4XBDA 1VA8A 3TLOA 3A88A 5C1UA 2PKSB 3HK6B 1UCYE 1O3GA 2AGEX 2G5VA 4TWWA 2JILA 2O8MA 4K75A 1NRNH 3F9FA 1DE7H 4KGAA 1QAUA 2B0FA 1CVWH 2PKSC 2GVFA 4GCHF 1IQMA 2FLRH 8KME2 1AFEH 1C1VH 1YCPM 1T4UH 1W7XH 3RLYH 4UU5A 1EP6A 1WOFA 3OY6U 4FU9A 2IOTA 1UM1A 2W3IA 2VH6A 2O8LA 1FIWA 3SU4A 3LPRA 3OYPA 2ZHDA 1AVGH 2TGAA 5E22A 1VITH 1KXFA 1FY5A 5LH8A 1OZIA 2W26A 1AWFH 3ZYDA 1G3DA 3SHUA 3FP8E 4B2AA 2ZP0H 3MO6A 3MO3A 3STJA 1ZMNA 1BITA 2FI3E 2G5MB 2PSXA 3EAJA 1MFGA 2KOHA 5HFFA 3VXFH 1W0ZU 5HMAA 1MU8B 3MTYA 4NFFA 2XC5A 3P17H 1FC7A 1X7AC 3I78A 4ZKNU 1ETTH 1T31A 1QFKH 5HFEA 1KLIH 2RRMA 2HNTC 1GMCG 2M0ZA 2QKTA 4RI0A 3MH7A 1QIXB 1ESAA 2YT7A 1GJ6A 2EEJA 1L1NA 3RXCA 1LHGH 5AVDA 2F9UA 4Q6SA 3NCLA 3URCA 1N6XA 3LGVA 3SFJA 5E8EH 1KTTB 3EA7A 4YTAA 4A6LA 3OY5U 1FXYA 4X1PU 2ZU4A 4E7RG 1M5ZA 4JOFA 1GJ8B 5IDKA 1GHAF 1TA2A 1C9TA 1UITA 1FIZA 4FUIA 3GSLA 3T29A 1N8OC 1SL3A 3QX5H 3PROA 1TBZH 4WWYA 1OWJA 3I77A 2Z9KA 2OPGA 1AMHA 1V2WT 4K1EA 1HLTH 2W3KA 2DMZA 5C3NA 1TIOA 3F68H 1AFQB 1O2MA 4GVUA 4UD9H 3KQCA 1EX3A 3F9EA 4AORA 5GXPA 1WAYB 1HIAB 5F67A 2PNTA 1O2RA 3HGPA 5C2ZA 2FI4E 1Z8RA 5HFBA 1CBWB 3M7TA 3TK6A 2KA9A 2ZGBH 1N6DA 2JH0D 1AB9C 1L4DA 3TGJE 2ZDNA 4DOQA 2BDHA 1JBUH 3M3TA 1D3PB 2BVXH 5FPSA 3EGGC 1C5RA 1X8SA 1X5QA 5GDSH 2A4RA 4ABIA 1BMNH 3OSYA 1MTWA 4UFEH 3MYWA 1WTHD 2BQWB 1O3FA 1Z6JH 1C2MA 2H2ZA 2PKAB 4X1NU 2W4FA 1OX1A 5EPNA 5DP7A 5A8XA 4ZUHA 4H42U 1HAOH 1V2TT 2R0KA 3RXEA 5LGOA 2ZCHP 1IAUA 1Z6EA 5EOKA 4GSOA 4ASHA 1C9PA 2P95A 4JMYA 2ZQ1A 3UFAA 2CSSA 1TRNA 1K1MA 3MH5A 2BD4A 2CHAC 4BNRA 1KLTA 3T25A 2ANMH 4ISHH 3UR6A 1J15A 3HPKA 2RG3A 1TNHA 2WPHS 4ZKOU 1O3LA 2J94A 3LGWA 2DUCA 3UWJH 3MU1A 3QWCH 4OGXA 1TE0A 3RXFA 1LPKB 1NS3A 1C2DA 2W7SA 1G9OA 3WY8A 5JPMH 1MUEB 4X0WU 3NGHA 3GCTF 4MPXA 4JOEA 4MG3A 1TABE 1O0DH 2VZ5A 2B9LA 1F2SE 1UK3A 5E0HA 1H1BA 1QGFA 2BD5A 3V13A 1O3JA 2FOFA 3GY6A 3GY3A 3MH6A 1SC8U 3R69A 1QB9A 3TMHA 3SQHE 4DCDA 5CHAB 3EGKH 1W9QA 4JK6A 4B73A 1EPTC 2BY6X 4HOPA 2AGIX 3CC0A 2BY8X 2C8XB 3SUFA 3B76A 4ZKSU 4AB8A 3TJOA 4GHNA 1A1RA 2J38A 2QF3A 3DIWA 5J4QA 4K2YA 2Y7ZA 3UNQA 1A7SA 2EDVA 4F4OC 1ARCA 2OSGA 3JZ1B 1LKAA 1UVPA 4I32A 2QG1A 1GHXH 3TIUA 3A86A 5HXFA 1WI4A 2V3OH 3RXQA 3HPMA 1FONA 2AWUA 1QAVB 4XSKU 1CE5A 2CMYA 1SGIB 2EDPA 1LPGB 1OWIA 5EGMA 2AH4X 3UPEA 1TQ0B 1AKSA 3EQ0H 1NROH 1C5VA 1BRBE 4NMVA 4K1SA 3GDSA 2BLVA 1GBCA 1AFQC 3VEQB 2PKUA 1LHEH 4MPWA 4Q2OA 1J14A 1Y3XA 2V3HH 2ZTYA 4REYA 1GJ9B 2Y82A 5D13A 3RXGA 1E0FD 1GBBA 2A2XH 1FDPA 3W94A 1MAXA 1GHYH 1RTLA 1OS8A 1OXGA 4IMQA 1RGQA 4HI3A 4SGAE 3RXDA 1W8BH 4YYXA 1UTJA 3LGUA 3ZVCA 1QCPA 1U3BA 2KL1A 2FNEA 4CRBA 1GI4A 3BTWE 1XXFA 1KLJH 4AX9H 2PW8H 1HXEH 2KRGA 1Z8IB 3M5OA 2BD8A 3ZZ6A 2P94A 1T8MA 5C67A 1SGYE 1XUFA 3QTOH 2KJKA 3MH4A 2FTMA 8ESTE 3QO6A 3KIDU 1VZQH 3O46A 3KGPA 3SW2B 5E21A 1DY9A 1MCVA 1QL7A 2THFB 2DLUA 1T2MA 2C93B 3SU3A 1OPHB 3CS7A 1G9IE 3RXSA 4FVBA 1AI8H 1HPGA 4Q6HA 2OP9A 3RLEA 2KV8A 4OEPA 1VCQA 1N99A 1TLDA 1W11U 5A2PA 1O3IA 4D7GA 4DT7B 1TFXA 1DY8A 1SGTA 4B1TA 2KJPA 5GJ4B 3KZDA 3NUMA 1BFEA 4U32A 1A5HA 1C2JA 4NNLA 1Z7KA 1ELBA 5GLJA 1AVWA 3UY9A 1U6QA 1ORFA 4O3TA 2XWBI 1GBJA 1A4WH 3NWUA 1WI2A 5HFDA 4FUBA 1C5SA 1DUAA 1GMCF 2TGPZ 3M61U 1HFDA 3B9FH 2ZDMA 1G30B 1QRXA 2BQ6B 1TX6A 1QJ1B 2BHGA 1ACBE 1MMJN 4FU8A 2D26C 2SGFE 3VGCB 1GG6B 2VSPA 1ZMLA 2IWQA 2HVXA 3OX7U 2ZPMA 1SR5C 3GY4A 3GDUA 4NWLA 5A0BA 1W12U 3Q3KA 1FN8A 2PLXA 1EATA 2DLSA 3RXOA 5A2MH 3LJOA 2IJOB 4WXVA 1GVLA 1P9SA 3IITA 1C1SA 4BAKB 3EA9A 1ELFA 3BIVH 1TMUH 1GI8B 2PA1A 4NIWA 1QR3E 4X6NA 1T4VH 1MTUA 2HNTE 1W10U 5DG6A 1YC0A 3CH8A 2F83A 2VRFA 3ESTA 4WMEA 2VIPA 1H8DH 2FIRH 3G01A 1Z71A 1O2OA 5FHTA 3GY8A 1ELCA 4BAOB 1B0EA 4FUEA 4A7IB 1W0YH 2WPKS 1G36A 1RZXA 3LJJA 1O2UA 4ZHAA 3S9CA 3BEFB 1B8QA 2DM8A 4SGBE 1QBNA 2F9OA 1LDTT 2MHOA 5PTPA 2SNVA 1V3XA 2ZDVH 4XE4A 1YPJH 1FQ3A 3PO1B 3D62A 4FUJA 3PYHA 1HYLA 5T6FA 1S6FA 1D3TB 2ZTXA 4YOJA 1O3NA 1SSXA 3PWBA 2WYJA 2A5AA 1CT4E 3LONA 3UOUA 4NA8A 1TPOA 3TJVA 2J9NA 3ID2A 3RM0H 2P3FH 3SUEA 2NU0E 1E34B 1ZRBA 1MTSA 3BTFE 1AU8A 5EXNA 2XYAA 1HV7A 4JK5A 1ZGIA 3S7HB 2FS8A 5EZ0A 4WVPE 3OTPA 2WUCA 1MBMA 3ZZAA 1AE8H 4UONA 1W13U 1SGNE 3SOSA 3TPIZ 5JBCS 4FU7A 2R2WU 1V2UT 4Z8JA 5F3XA 3RMOH 1ZSLA 3KL6A 4K3JA 1V62A 1P01A 5BPEA 1GL1A 1Z87A 4Z33A 5EYZA 2L97A 1WQSA 3TSWA 3WKMA 1BE9A 4CBOA 3A7ZA 1DWCH 4X2VA 1SGDE 2JKHA 2ZCKP 4E05H 3BEIB 3ZZ5A 2BX4A 3AVZA 1AZ8A 2OC0A 3ZVGA 1GHBF 1A5IA 3A80A 1LKBA 1JIMA 4I8LA 2GZVA 2VWNA 3RLWH 1Y5BT 1E36B 1ZTJA 3L4FD 4WY3A 5AFZH 1GBFA 4NMTA 4TPIZ 1OP0A 1Q2WA 2HE2A 2ZKSA 4VGCC 3ATWA 2A5IA 1C2EA 2CXVA 2ANWA 4F49A 1LMWB 5FX6A 2ZPLA 4CR5A 3T2NA 1CT2E 4Z0KA 4GCHG 1XUHA 4TY7A 3LGIA 1GCTC 2XBWA 2EI8A 4K78A 3KQDA 1QRWA 1KYNA 2ANYA 1GJ4H 1KDQA 2H2CA 2NU3E 3FY5A 2EC9H 1C5NH 1QB6A 2Z9JA 5IYTA 2LC7A 1GJBB 2KAIB 3RP2A 1UVSH 4YLQH 2CN0H 3QGNB 1XKAC 1P02A 2GMTC 4PQWA 1SBWA 1HDTH 2PGBB 5JYIA 3P6ZB 3T26A 1WHAA 1P11E 2IWOA 3KHVA 4GLYA 2Z17A 1O3HA 2FOHA 1O2NA 1SGRE 1DDJA 4NMOA 1Y3WA 3DD2H 4Y0YE 4ZHLU 1O2GH 2LPRA 3C27B 4Y8XA 3QGLA 4NG9H 4KELA 4ZXXH 1RXPA 2G5NA 3AAVA 4NMPA 3SU2A 3M5LA 2OZFA 2KPLA 1D6RA 1YBOA 1GDUA 1O38A 1VCPA 2BDIA 3P95A 1E35B 2STBE 1SMFE 2KQFA 1BTYA 3M35A 4NIYA 2EGNA 2E7KA 1K9OE 5L2YH 1PPEE 3EA8A 1JIRA 5C5OA 1GJ7B 4D76A 1C5MD 4OS6A 1C2KA 2KOMA 1GHAG 1TRYA 1AGJA 3ZZ8A 3TVJB 5G1EA 1QA7A 2SNWA 2ZHQH 1ETSH 1UK2A 2RCZA 2Y5FA 4JYTA 5DP5A 2AINA 4H11A 5K0HA 1QY6A 3RC5A 3A7WA 5EW1H 1I92A 2GGVB 3QDZB 2VIQA 4IGDA 3ZV9A 1V2JT 3ZZ7A 1EZSC 2ZU3A 4WYUA 4K1TA 4E06H 5C1XA 1OP2A 1GBDA 3RXAA 2IWNA 1NPMA 3KCGH 1OP8A 4OS7A 9ESTA 1PPFE 1A46H 1SQAA 4A1XA 1Z86A 1VCWA 2TIOA 2WL7A 1TOCB 2WV5A 4AG2A 3SV8A 2A45B 2FS9A 1TALA 2WPLS 1IQNA 4NA7A 2QT5A 3SJOA 2XXLA 1AQ7A 2KAWA 1BB0B 3E0PB 3IG6B 1BT7A 4KTSA 1CO7E 1O39A 2YTWA 4XFQA 1YBWA 2OCVB 2ODQA 1D6WA 2OLGA 1TNJA 2STAE 1Q3OA 3NFKA 1T8NA 1QHRB 2J34A 3SNEA 2A7HA 2Y5HA 1C2IA 1XXDA 2GT8A 1EZQA 1V2KT 3FP7E 2A1DB 1BRCE 1C4V2 2ZHWH 3I1EA 4Q7XA 1E38B 3UQVA 4CBNA 2ZWLH 2BDAA 1SPJA 3LC5A 1FC9A 1RD3B 1HAVA 2BY7X 1FNIA 1W3CA 3ZYEA 1N6YA 3F9HA 6ESTA 3BTEE 1RJXB 2K1ZA 1G2LA 3P8NA 1FUJA 4YOIA 2QIQA 2FM2A 3PLKA 1SFIA 2F3CE 5BRRE 1KWAA 1O3MA 1WQVH 3A89A 2QAAA 3U98H 1TP3A 1NO9H 4BTIB 1BJVA 1JXPA 3ATKA 1O30A 4B2CA 4DY7B 2DB5A 1CGJE 1L2EA 3PB1E 4BOHA 4Q3HA 3F9GA 2ZC9H 3LH3A 1KXAA 4FUHA 1HUTH 1LVBA 1C1QA 1AHTH 1MTNB 2ODPA 1CHGA 2BOHB 2GKVE 4I8GA 4CRFA 1WHDA 2EXGA 3CBYA 1LVMA 1UCYH 1K1OA 5DPAA 1WH1A 1EQ9A 3KZEA 1DOJA 3LGTA 1CT0E 4X1QU 1OYTH 4ABFA 2Q9VA 1ELEE 3ZZ3A 1EP5A 2GV7A 3UOPA 3SI3H 1O5FH 4DIHH 2BLWA 4NNMA 2PWXA 3VQGA 1PPHE 1GBAA 1YLCA 2VJ1A 5FBEA 4NZQA 3U9AH 5LPRA 1V2MT 7GCHG 1LHDH 1U39A 4FVDA 8LPRA 3ZZCA 3QN7A 1NRPH 1UJDA 3SNDA 1UHPA 1XUGA 4BANB 4HTCH 1YCPK 5T3HA 4G69A 4DG4A 1ELGA 1LTOA 1P05A 3VB7A 3SNCA 1NT1A 4K69A 3LIWA 2V6NA 2VH0A 1PPBH 1NC6A 3SV9A 2GCTC 3KQBA 1EUFA 3A83A 2Z3CA 3GICB 4BXWA 4JL7A 1QURH 3ATLA 1TQ7B 1PFXC 4GHQA 1EB1H 5DGJA 3P8OA 1YF4A 2R0LA 1P09A 1O3CA 1C5ZB 4B76A 5ETXA 1MH0A 4AZ2B 1D5GA 2W7RA 2FEQH 2GCTB 2XW9A 4WF8A 2ZECA 3TNSA 5I25A 1C4U2 2OD3B 1GHWH 5JDUB 2JH6D 2M0TA 2I4SA 3S0NA 1MKWK 1EB2A 4YT7H 1PQ5A 3VB6A 2ODYB 1RIWC 4H4FA 3ZV8A 3TH4H 3I18A 1O5DH 2HOBA 2ZPSA 1VJ9U 3RXKA 2AMDA 2EEHA 1JRTA 1ESBA 1JOUB 4A92A 4YM9A 2GCHF 4CH2B 2C90B 4ZXYH 1AY6H 2ZTZA 1HAZB 1TNLA 2BDBA 1IU0A 2LA8A 1S81A 2A31A 1TGBA 1NTPA 2G00A 1UF1A 2HRVA 5GNDA 1GDNA 1AWHB 4OGYA 1LPZB 2P93A 2WINI 3BTHE 3M37A 5GCHF 4NXRA 1IOEA 2BQ7B 1FY8E 1N8OB 2ZCLP 4UEHH 4FUDA 1ZJDA 2FN5A 4JORA 3Q00A 2FX6A 1TYNA 2QY0B 2CGAA 2BYGA 2ZFQH 3LH1A 2FDAA 4X8UH 2IPHA 3B23B 4FXGH 2GZ9A 3QE1A 3RMLH 4IBLH 2EEIA 3GDVA 2JREA 1GI7B 4ZAEA 2H9HA 1XMNB 3A7VA 4A1TA 5EODA 1V6BA 1UK4A 1QL8A 1UTNA 2GTBA 5H3JA 2YNBA 4NGAH 1IU2A 4JZIA 3MNCA 2VWRA 3PO1C 3E17A 1DWEH 5DP4A 3JZ2B 3RU4E 3TJNA 1LHFH 1SHHB 1NRRH 2XBYA 1N6FA 1W9EA 3PDZA 1RGRA 4WH6A 1IQIA 1C1MA 3OTJE 2ZGHA 1ZHRA 1GMHF 4I7YH 2EGOA 3RU4T 2P8OB 3UTUH 5HF4A 2B5TB 1EOLA 2FOGA 1UTMA 1OKXA 1O3DA 1YM0A 1KXEA 3A7YA 3BTDE 2UWPA 3GYLB 4KTCA 3U8TH 3RUOA 4X8VH 4Q7YA 3QK1A 2FCFA 1N7FA 4H6TA 1N7EA 1LO6A 8GCHF 1HCGA 1GQ4A 2CF8H 1PPZA 1GJ5H 3HGNA 2AS9A 3VFEA 3M7QA 1VR1H 1THRH 3LC3A 4KTUA 1K32A 1G3CA 2A7CA 2Y5GA 1GCDA 2I6SA 2Z7FE 3PMHB 3QUMP 1V2NT 1J9CH 4U30A 1DXPA 1GHVH 1IQJA 1QNJA 2GV6A 4KKDA 5T6GA 1AZZA 1MQ6A 2DJTA 5E0GA 1C5WB 2XNIA 4FUGA 2ZU2A 3SZNA 2D8WA 1O2IA 1NFWA 5A8YA 1IQGA 2FOMB 2GZ8A 2UUJB 1GCTB 3RXTA 2TGDA 1RIWB 1NM6A 2QXGA 3SOEA 1C1UH 2F5YA 4JOHA 2WYGA 1IQKA 4NIVA 3SV6A 4OEOA 1ABIH 4IMZA 5JB8S 2O9QA 5TJXA 1BTXA 1DSTA 2Z9GA 1AO5A 2J95A 1EZXC 1EJNA 3CENA 2PHBA 2YT8A 4I33A 1BIOA 1HBTH 3I4WA 3S69A 3TSZA 3NKKA 4P2AB 2R4HA 4WYTA 2V0BA 3VGCC 3Q76A 1GVZA 3GGEA 3Q3XA 1YPMH 3VPKA 1UO6A 3MU8A 3BTQE 2OQSA 4ESTE 1UMAH 3SBKA 1IQLA 3O8RA 1XZ9A 3GCOA 1UCYK 4ZKRU 1EPTB 1LVYA 1AKSB 3VXEH 1D4PB 2TGTA 3VB5A 2YOLA 4UFDH 1LHCH 1V6DA 3D49H 5AFYH 4BAMB 3SNBA 1HJ9A 1THSH 2BDGA 3RXLA 2BTCE 1P2QA 1CSOE 3E91A 1DANH 1MKXH 1TQ3A 2ZGCA 3GCHC 1SFQB 1Z1IA 2QCYA 4INKA 1HIAA 1MTNC 1CQQA 5FPTA 4UDWH 3MU0A 4Y79A 3R0FA 2VNTA 2ZQ2A 1BBRH 3M3VA 2EA3A 5K7RA 3OU0A 1WV7H 2XCNA 1BMMH 1P1DA 1DVAH 3MNXA 3A8CA 3KN2A 7GCHF 2VWLA 1O32A 2OTVA 1ZPBA 1GI0A 1NRQH 1CA0C 1TX7A 1F92A 4Y8YA 4LMMA 1JMOH 4Q2QA 1DLKB 1IHJA 1ZMJA 5LPFA 5B6OA 1ANDA 2J4IA 1K22H 4JZEH 2GDDA 3HKJB 4MVNA 5E2PA 5C5NA 2HGAA 1EAIA 2GX4A 1C1TA 1O2XA 1H4WA 1NFYA 4NMQA 3T27A 1HJ8A 4WJG2 2SGQE 2AERH 2XRCA 1ANCA 1HAGE 3N7OA 3BTTE 1DXWA 3TH2H 4NWKA 2OC7A 3R68A 5DP9A 1K1IA 3ZZDA 1BZXE 3AAUA 5T6DA 4WMFA 3U1IB 1FN6A 1O2QA 4H6SB 2NU1E 2H3LA 1O2JA 2VU8E 1O2SA 2BZ6H 2REYA 2J92A 1T8OA 4QT8C 3E16B 1P2IA 4WMDA 3HVQC 1GBHA 2Z9IA 1HAXB 1H9IE 3DUXH 5DO4H 4LZ1H 2SFAA 1CHOF 2PKTA 2QN5T 2WV4A 4JYVH 2RA0A 1W14U 2A2QH 5ESBA 2M10A 3QIKA 2DKRA 1W7GH 2BM2A 1BJUA 2AGGX 5JBBS 3BG4B 2A4QA 4UFGH 3MOCA 5E6PB 1FPHH 5I7ZA 1BQYA 1WU1A 4A1VA 3U1JB 3RXJA 2FP7B 2EGKA 2H9EH 2PDZA 1F7ZA 4X6OA 1V1TA 1KSNA 3BTGE 2XBVA 1C2GA 1JRSA 4I8KA 2JINA 5FPYA 2BD9A 3ZZ4A 1B5GH 1ETRH 3WKLA 1GG6C 2HPQH 3FZZA 7KMEH 2IWPA 1ZSKA 2HPPH 4K76A 1HGTH 1UHBA 1XUIA 3A81A 1UJVA 3UQOA 2OMJA 1IQFA 1OWKA 1V2OT 1UEPA 2AWWA 1O5BB 5EPYA 1SQOA 4NXPA 2M0VA 1WUNH 2QXIA 2ZHFH 4P0CA 3ENSB 3TGKE 3NPSA 4Q80A 1TGTA 3Q77A 3GOVB 5EU8A 4E35A 1QTFA 1UTKA 3ELAH 1DICA 2VVCA 2ZPRA 4ZHMU 1GMDG 1QQUA 3LT3A 1CA8B 1NFUA 3DJ3A 2FOEA 1KEFA 4AB9A 4MNVA 1FCFA 1Y59T 4MTBA 4CRCA 1FV9A 2ZDLA 3A85A 2VWOA 2R3YA 2A7JA 3P8GA 3K9XB 2FMJA 1DS2E 4KFVA 1F0SA 2ZDAH 1P1EA 2HGTH 1BTZA 4THNH 5GIBA 1DFPA 1GGDB 1GHBG 1IHSH 4AG1A 2C8WB 4X2XA 4X8SH 4O06A 3O5NA 1GMHG 3BTME 2FOCA 3U69H 2DC2A 4IC6A 3GYMA 1TBQH 3K2UA 3PV4A 4TPYA 3HATH 4CHAB 1UVOA 2PTCE 5L6NH 2FI5E 1FC6A 2WPJS 3AW0A 4GPGA 1KY9A 1Q7XA 8GCHG 1O37A 2Z9LA 5HEBA 1EAXA 1FAKH 1DLEA 1BTWA 2P8OC 2OS6A 2ILNA 2Q1JA 1O35A 4Y8ZA 4O03A 1X45A 2ZO3H 2VGCB 1TAWA 2Z94A 1S84A 4BXSA 4U2WA 2A4GA 1O2WA 5HEYA 4X6MA 1NN6A 4Y7AA 2X7ZA 4GVCA 1HJAC 4RKOB 2JIKA 1F0TA 1DPOA 1O2PA 3UREA 2KAIA 4ISLA 4IW4E 3SU0A 5F8ZA 4KFWA 1BMLA 1YPHC 1P3EA 1BCUH 1QJ7B 2M3MA 1BMAA 1OBYA 1UEZA 1MTVA 2M5TA 3M36A 1QRZA 4RN6A 2ASUB 2Q6FA 1QLCA 2TRMA 3RXIA 1O2VA 1PQ7A 3NXPA 4TY6A 2EEGA 3RXRA 1A0JA 3MNBA 3SV7A 5E2OA 1GBLA 1HXFH 4ISNA 1GVKB 2SGAA 3SU5A 5B6LA 3SU6A 2P3TB 3BN9A 1TONA 1ESTA 2GDEH 3CBXA 3O8DA 1TB6H 1F5LA 2HALA 1MBQA 3QDOA 4OAJA 4ABJA 1NFXA 2I6VA 2PV9B 2C3SA 2K20A 4R2ZA 2G81E 5CE1A 3BG8A 2ALPA 1WYKA 4ZROA 2ZFRH 3GY2A 2ZIQH 2EV8A 1YGCH 3PTBA 3EGHC 3ZVFA 1G3EA 4AFUA 2CJIA 1Y5UT 1RS0A 2AIPA 1K28D 2KOJA 1O2YA 2PUQH 2G55A 5DTHA 4OS2A 2JWEA 1GJDB 1XX9A 2UWOA 4FGMA 2EJYA 3AXAA 3SU1A 5C20A 3DT0H 1BBRE 3PTNA 2QKVA 4JCNA 2SGEE 2I04A 1L1JA 6CHAB 2ZU1A 1C1WH 1C5PA 2P3UB 1Z1JA 3SI4H 1ZOKA 3MWIU 1HNEE 1HAIH 2GCHG 3ATMA 3U8RH 4K8YA 5TCAA 4AMHA 2BXUH 1P10A 1HAYB 1C4Y2 2EHRA 1S85A 1AE5A 1V2LT 1X5RA 2O8WA 1X5NA 2YUBA 3SHWA 1P2NA 2FYRA 4BTUB 4JOJA 4MPVA 1THPB 1UVTH 2D90A 1QJ6B 7LPRA 4KP0A 3ZVDA 2RDLA 4J1YA 2P16A 3SORA 4OS4A 2ZGXH 1WF7A 3T28A 4AFZA 1BDAA 1C1RA 1MD7A 3LDXH 2O8UA 4MQAA 3SJ9A 1O2ZA 2QF0A 4X2WA 1GHZA 2XC0A 2D8IA 3L6PA 3MO9A 2CHAB 5G1DA 1KTSB 1ZGVA 2QV1A 4AGKA 5JBAS 1UVUH 2AMPA 3P8FA 1ID5H 1O3OA 4IC5A 1L4ZA 2FTLE 2PKAA 3E1XB 1LQEA 1D3QB 3VQFA 1YCPH 3I29A 1UHBB 4I8HA 2KPKA 5DP6A 1P0SH 1QBVH 1FLEE 2Q6DA 4Y71A 1C5YB 4WXIA 1O5CB 3UUZA 2VB0A 2VVVA 5I46H 4NSYA 1PYTC 3SGBE 1AD8H 4HZHA 4F8KA 1RY4A 3T62A 2VIVA 6GCHF 1K1NA 1QBOA 1AUJA 2H3MA 1WG6A 1C5UA 1XVOA 2I6QA 1EXFA 1FY1A 2BDYA 4YLUA 4OS1A 4I8JA 3QLPH 4BAQB 5AHGH 4HOPB 3FAOA 2GT7A 1TBRH 1EZUC 1O5AB 3B8JA 1SVPA 1QB1A 3LKWA 1YPHE 1MU6B 2G8TA 1B0FA 1SGPE 3A8DA 3RMMH 1JWTA 3GISB 1DX5M 5E11A 4MDSA 4DJZB 4YT6H 1ZHPA 3MU5A 3RL8A 1ELVA 3E8LA 1KXBA 5FCRA 5ABWA 2UUYA 1WSSH 4Y76A 1GDQA 5GWZA 3TSVA 6LPRA 5FB8C 1EJMA 1WF8A 4R0IA 1J17T 3RC6A 2OBQA 1INCA 1BRUP 3PV5A 1A0HB 1C1PA 3SV2H 5LPEA 1C5XB 1QAVA 3Q3YA 3PM3A 4DGJA 1CGHA 5SGAE 1SGEE 3K65B 1WCZA 1TPSA 3R3GB 1XM1A 3QTVH 3H7OA 1P9UA 5ESTE 3SQEE 4DW2U 1N7TA 1O2TA 2HE4A 2H5CA 3O8CA 1AUTC 1U37A 5EQSA 3S9BA 2SGDE 1PDRA 3M7UA 3RMNH
chains in the Genus database with same CATH superfamily
5HF1A 1A0LA 4NA9H 2DE8A 1Q3PA 1K1JA 1NU9A 3ZVBA 2ZF0H 1VJAU 5AF9H 5HDYA 3CYYA 1GPZA 1NZQH 1Y8TA 2CSJA 1GWAA 2GZ7A 2K0QA 2KZ4A 2ZFTA 4NCYA 1UJ1A 1PJPA 1MD8A 1S6HA 4JOPA 4GUXA 1CBWC 2XCFA 3DCLA 5EXLA 1WIFA 3RC4A 3BSQA 1GBTA 2G4UA 2JSNA 4E3BA 5F8XA 1YPEH 2YUYA 1XVMA 4BAHB 2Z6BD 1GGDC 3A7TA 3AW1A 2CS5A 1P06A 2PFEA 1YP9A 1A5GH 4XBCA 4NSVA 1TP5A 4XDEA 2KBSA 1D3DB 1Q31A 1S5SA 4INHA 2Q6GA 3V3MA 4Q63A 1YWUA 3E3TA 3LGYA 3VB4A 1TGCA 3PDVA 2BB4A 1C2LA 3A84A 4CHAC 5L2ZH 4GHTA 2ZPQA 1AIXH 3SN8A 1N6EA 1W2KH 3S9AA 1FMGA 4EDJA 2KM0A 1ZOMA 4D9QA 7ESTE 1FX0B 2BOKA 5FBIA 1C5TA 2HLCA 5ILBA 2L4SA 2F0AA 1OSSA 1TPPA 1NF3C 1YYY1 1EKBB 3U8OH 4LK4A 4MNXA 3RXPA 3STIA 4D8NA 2BLQA 1TMTH 2ZFPH 3F2GA 2FLBH 2LELA 1Y5AT 2BD2A 2JDID 2BY9X 3RDZA 3A7XA 3P92A 1O2KA 1PPCE 2Z3DA 1WDIA 2OC8A 1BBRK 5L30H 3SUGA 3P70B 1P2JA 3URDA 2OGPA 2EDZA 3TH3H 2FO9A 1HJAB 4J2YB 2H5DA 2V35A 4ABEA 1BUIA 3K6ZA 3UIRA 3HK3B 3A82A 1A61H 4JZFH 4UE7H 3TNTA 1LCYA 1SG8B 2FOAA 1IQEA 1MFLA 1P2MA 1P57B 1FJSA 5HETA 4MPAA 1BTHH 2Z3EA 4D7FA 3A8AA 2NU4E 1UTOA 1MKWH 1E37B 2OINA 5A0CA 1W9OA 1K2I1 1SHYA 3V12A 4AGJA 1N1LA 3ID4A 4ZMAH 1GBKA 4YESB 1UEQA 1PYTD 2FYQA 2QKUA 3TU7H 3CP7A 2OCSA 1XUJA 1O5GH 1X6DA 3MQKC 1CGIE 2PR3A 4GVDA 3GCTG 1Z8JB 1WBGB 3ITIA 1L1GA 4RSPA 1CU1A 4AYVB 4ZH8A 5J4SA 5H4IB 1SQRA 1AN1E 1C5OH 1VGCB 3MNSA 1TNIA 1UTPA 3DHKH 1AB9B 1ZR0A 4X1SU 3RM2H 2AFQB 4Q2NA 1V2PT 2FXRA 4UU6A 3CS0A 1LQDB 3GJ9A 4JYUH 4XOJA 1AVXA 3RXHA 1YPGH 1VGCC 2BVSH 1T7CA 1ELAA 2M0UA 1NU7B 1VITF 2JJ2D 4YOGA 2AHME 3ODDA 4K5ZA 2BMGB 3V7TA 3IWMA 3K6YA 4JZDH 5GPIB 2RCEA 1C2FA 4M7GA 3SJIA 1GBEA 4CRDA 1V2ST 2H2BA 1IHTH 5A09A 3GCHB 1OWHA 2QYIA 3ZZ9A 1YLDA 2KG2A 3K50A 1O36A 1ANBA 3SUDA 1OYQA 3K82A 4WH8A 1PQ8A 5C1YA 4CRAA 1TMBH 3PMAB 2ZA5A 4ABBA 2PSYA 1SOZA 2EI7A 2HNTF 2V90A 4MNWA 2R3UA 2VGCC 4F55A 1VITG 3KEEA 2JXOA 4B6FA 3RXVA 5HIYA 1OBZA 1HAHH 5EG4A 5E1YA 1L0ZA 1DM4B 1TRMA 4Q2KA 1C1NA 2SGPE 2BY5X 3NFLA 2V7QD 3BEUA 2ALVA 5GCHG 1V2RT 2AYWA 1GI9B 4JOKA 1P2OA 2L4TA 1P03A 5FXLA 1V2QT 3C1KA 3H7TA 3RXUA 5C0UA 2HVYB 3OE7D 4HFPB 1GJAB 1R6JA 1HAPH 2F9BH 1DUEA 2BYAX 6GCHG 2OUAA 2B7DH 3UR9A 3DJ1A 1MCTA 1P04A 1OOKB 2B8OH 1ZTKA 5EQRA 1K1PA 1BOQA 3PWCA 5F03A 1SLWB 3MU4A 1V5LA 1NBMD 1NRSH 2ZU5A 1MZDA 4AFQA 1O34A 2A4OA 2G2LA 2VINA 4E7NA 2ULLA 2AMQA 3DFLA 3GABA 1QA0A 1O3KA 2FZZA 2VPHA 1G37A 4O97A 1ANEA 2BZAA 1XUKA 1YKTA 4ABAA 3M3SA 2Q3GA 1O3BA 3TITA 1VJ6A 2ZG0H 3PLPA 1TGNA 4CREA 4Y10E 1ELDE 1FZZA 1MABB 2VIWA 1OBXA 1ZZZA 2BD7A 5HIZA 4Q7ZA 2QBWA 3W95A 3MI4A 2Y81A 2LC6A 1J16A 1I16A 3MFJA 5HM2A 1KDQB 2OQ5A 1DWBH 1P3CA 4OS5A 1DITH 2TBSA 4NMSA 2I0IA 2KYLA 2ZHEH 1BTUA 4FUCA 1U38A 1TA6A 4Y7BA 2QGRA 2ZEBA 2QXJA 2GMTB 6CHAC 3ATIA 5DKMA 4ABDA 1H9HE 3FN8A 4ISIH 1FI8A 3LNXA 2XWAA 3KF2A 4AFSA 5DJ7A 2XC4A 3BPUA 2QXHA 4N6XA 2DE9A 1BRAA 2C8ZB 1EASA 2BLOA 5E0JA 1KXDA 4K60A 2O8TA 2CK3D 1UFXA 2ZGJA 4CR9A 1OWEA 2VSVA 2KJDA 4ZCNA 1GMDF 1ZYOA 3DJAA 1SLXB 2Y6TA 4B71A 4AYYB 1CA0B 1Y7NA 3HPTB 2LNCA 3LOXA 1TWXB 5JBTA 3FANA 4Y6DA 3SGQE 1GL0E 1A3BH 3M5NA 1UEWA 1P12E 1BA8B 1RFNA 4CH8B 1HB0B 4PROA 4E34A 4YDPA 2NWNA 2PUXB 2AIQA 2FESH 5HGGA 2ZFFH 1DSUA 1YPLH 3KYGA 5EW2H 3F6UH 3TK9A 2WUBA 1GI2A 1O2LA 3RU4D 4FUFA 2VIDA 1FPCH 2W7UA 2VWMA 3NK8A 1F0UA 1ABJH 1FAXA 2PGQB 1J8AA 3RL7A 2H6MA 2GP9B 2FE5A 4IS5A 2OBOA 2EI6A 2VIOA 4X2YA 1S0QA 3VB3A 5EXMA 4YZUA 4XHVA 3KQEA 1DT2A 4XBBA 2G52A 2I0LA 4DIIH 1VAEA 1PPGE 2F9VA 4LOYH 3PS4A 3GY5A 1ZHMA 2P3WA 2FPZA 3TK5A 3F1SB 3SNAA 4MPUA 3F2HA 1ZJKA 4NFEA 2PZDA 2V1WA 3KHFA 5HYOA 3SGAE 1MAYA 4IN2A 2F43B 2FODA 1PQAA 5KEDA 1BHXB 4IN1A 5DP8A 3FOAA 4LXBH 1F5RA 1RGWA 2EAQA 1SI5H 1SGQE 3KDGA 2CF9H 1MQ5A 1F0RA 3UNSA 2LUIA 3FVFB 1ZUBA 1Z8GA 1S83A 2A32A 3EYDA 1C5QA 1H9LB 1H8IH 1NESE 4VGCB 1UTLM 3BIUH 1O3PB 1UJUA 1EPTA 3BG4C 3FP6E 4K8BA 2F91A 2KFWA 2BD3A 3LNYA 2G51A 4UFFH 3JXTA 4A5TS 5JB9S 1GM1A 1YPKH 2A0QB 2HWLB 1M9UA 2O2TA 1UTQA 4INLA 4MNYA 4CRGA 1ZLRA 1VB7A 4RKJB 1C1OA 1S82A 2OQUA 2D2DA 3K1RA 3RXBA 1RRKA 2K1QA 3UNRA 4NMRA 3A87A 2F9NA 1A2CH 2LOBA 4JZ1A 1FY4A 2NU2E 1GI3A 2BX3A 1ZRKA 2D92A 2JH5D 5C0TA 1SGFA 1V5QA 1DWDH 3LU9B 2ZNKH 2EEKA 1RTFB 4B2BA 5CMXH 1SQTA 3SUZA 1TOMH 4D9RA 1T32A 3QZQA 1BTPA 1FY3A 4X1RU 3N7DA 2ESTE 1TPAE 3SJKA 4L8NA 2F9PA 1G3BA 1WFGA 1OWDA 1WTGH 3ID1A 2ZDKA 4JJ0A 1ELTA 3SHAH 3KNXA 1O5EH 1YY3A 2JETC 2W5EA 2XTTB 1K1LA 2BDCA 4RT0A 1XKBC 1ZPZA 3PMBB 4AN7A 1BHXF 3D65E 3ZRTA 1C5LH 4K6YA 2YNAA 1TGSZ 3EDXB 3BF6H 2JETB 1EFRD 4ABGA 3QJMA 2H1UA 3NZIA 4R8TB 3GY7A 1GJCB 3V0XA 5F6MA 9LPRA 1SLUB 1B7XB 3SO3A 3S7KB 1TX8A 4Q2PA 1NY22 2OK5A 1SGCA 3DSPA 3T5FH 2BXTH 1WFVA 2FWWA 2JJ1D 3PMJA 2AEIH 2F4LA 4K72A 3DFJA 2R2MB 3EE0B 4BTTB 2OXSA 3E6PH 5A0AE 3ZVAA 3FFGA 4YO9A 5EQQA 3UWIA 4X6PA 1EJAA 3O8BA 4O3UA 1EAUA 1TNKA 1P8VC 2VVUA 1F5KU 3DA9B 4Y11E 4NIXA 2VBCA 1ZSJA 2ENOA 3SJ8A 2UZCA 2TPIZ 3F3BA 3ZZBA 2RA3A 1SOTA 3AASA 1KXCA 4JOGA 2CV3A 5HJ1A 3CBZA 3QGJA 4U01A 3L3TA 2C8YB 2GD4B 3DORA 1QL9A 1SGFG 3FZDA 3RXMA 4DVAU 4DURA 5TCCA 1EAWA 4B75A 2WPMS 5HEDA 2MX6A 4NZLA 3M5MA 4NXQA 2JOAA 1D9IA 5CHAC 4LZ4B 1C2HA 2UUFB 1SLVB 1P2KA 1G32B 4O9VA 1S0RA 2UWLA 5F8TA 5G4BA 1ZPCA 2QC2A 3MMGA 3E0NB 1LVOA 2ZZUH 1MC7A 2D1JA 3QJNA 3R0HA 1ARBA 2WPIS 2ZI2H 1UM7A 1HRTH 5JXBA 1A3EH 4GAWA 5FX5A 1G2MA 2YMSD 3PV2A 1GI1A 3NCVA 2BVRH 3BV9B 2QA9E 3E90B 1O3AA 3GCNA 1T8LA 1O3EA 5EIYA 5HM9A 4ABHA 3ODFA 1RTKA 2XBXA 1MKXK 1GQ5A 4P00A 1HAVB 4TYDA 1CHOG 4TWYA 5A8ZA 4Y0ZE 2R9PA 4MLFB 1GBMA 1V2VT 2UUKB 5HFCA 3UAIC 1K21H 2ZFSA 3A8BA 4HGCA 2FOBA 3ZVEA 1O2HA 2H9TH 4X8TH 2C4FH 2PTNA 2G4TA 4Z6AH 4F48B 1EOJA 1TNGA 5DP3A 1GI6A 1WJLA 4ISOA 3ID3A 3D23A 4I31A 4AOQA 5FCKA 1QQ4A 2J2UA 3BTKE 1MZAA 2Y7XA 3PLBA 1Y3UA 1O33A 1OHHD 4B74A 2I1NA 1GBIA 2Y80A 3QZRA 1ZTLA 2ANKH 1KIGH 1SB1H 2A5KA 1NTEA 3H5CB 3L33A 1Q3XA 2P59A 3MHWU 3TJUA 1IQHA 3HKIB 3SHCH 1Y3VA 2DAZA 1O31A 3TGIE 2IJD1 1GI5A 5FAHA 2FX4A 2AWXA 2WZQA 1L6OA 2IN2A 5DK1A 3WWFA 2GEFA 2J98B 1Y3YA 2OC1A 4XBDA 1VA8A 3TLOA 3A88A 5C1UA 2PKSB 3HK6B 1UCYE 1O3GA 2AGEX 2M2AA 2G5VA 4TWWA 2JILA 2O8MA 4K75A 4JJ3A 1NRNH 3F9FA 1DE7H 4KGAA 1QAUA 2B0FA 1CVWH 2PKSC 2GVFA 4GCHF 1IQMA 2FLRH 8KME2 1AFEH 1C1VH 1YCPM 1T4UH 5C94A 1W7XH 3RLYH 4UU5A 1EP6A 1WOFA 3OY6U 4FU9A 2IOTA 1UM1A 2W3IA 5T1VA 2VH6A 2O8LA 1FIWA 3SU4A 3LPRA 3OYPA 2ZHDA 1AVGH 2TGAA 5E22A 1VITH 1KXFA 1FY5A 5LH8A 1OZIA 2W26A 1AWFH 3ZYDA 1G3DA 3SHUA 3FP8E 4B2AA 2ZP0H 3MO6A 3MO3A 3STJA 1ZMNA 1BITA 2FI3E 2G5MB 2PSXA 3EAJA 1MFGA 2KOHA 5HFFA 3VXFH 1W0ZU 5HMAA 1MU8B 3MTYA 4NFFA 2XC5A 3P17H 1FC7A 1X7AC 3I78A 4ZKNU 1ETTH 1T31A 1QFKH 5HFEA 1KLIH 2RRMA 5F53A 2HNTC 1GMCG 2M0ZA 2QKTA 4RI0A 3MH7A 1QIXB 1ESAA 2YT7A 1GJ6A 2EEJA 1L1NA 3RXCA 1LHGH 5AVDA 2F9UA 4Q6SA 3NCLA 3URCA 1N6XA 2JIZD 3LGVA 3SFJA 5E8EH 1KTTB 3EA7A 4YTAA 4A6LA 3OY5U 1FXYA 4X1PU 2ZU4A 4E7RG 1M5ZA 4JOFA 1GJ8B 5IDKA 1GHAF 1TA2A 1C9TA 1UITA 1FIZA 4FUIA 3GSLA 3T29A 1N8OC 1SL3A 3QX5H 3PROA 1TBZH 4WWYA 1OWJA 3I77A 2Z9KA 2OPGA 1AMHA 1V2WT 4K1EA 1HLTH 2W3KA 2DMZA 5C3NA 1TIOA 3F68H 1AFQB 1O2MA 4GVUA 4UD9H 3KQCA 1EX3A 3F9EA 4AORA 5GXPA 1WAYB 1HIAB 5F67A 2PNTA 1O2RA 3HGPA 5C2ZA 2FI4E 1Z8RA 5HFBA 1CBWB 3M7TA 3TK6A 2KA9A 2ZGBH 1N6DA 2JH0D 1AB9C 1L4DA 3TGJE 2ZDNA 4DOQA 2BDHA 1JBUH 3M3TA 1D3PB 2BVXH 4M9FA 5FPSA 3EGGC 1C5RA 1X8SA 1X5QA 5GDSH 2A4RA 4ABIA 1BMNH 3OSYA 1MTWA 4UFEH 3MYWA 1WTHD 2BQWB 1O3FA 1Z6JH 1C2MA 2H2ZA 2PKAB 4X1NU 2W4FA 1OX1A 5EPNA 5DP7A 5A8XA 3OEHD 4ZUHA 4H42U 1HAOH 1V2TT 3WW7A 2R0KA 3RXEA 5LGOA 2ZCHP 1IAUA 1Z6EA 5EOKA 4GSOA 4ASHA 1C9PA 2P95A 4JMYA 2ZQ1A 3UFAA 2CSSA 1TRNA 1K1MA 3MH5A 1VKYA 2BD4A 2CHAC 4BNRA 1KLTA 3T25A 2ANMH 4ISHH 3UR6A 1J15A 3HPKA 2RG3A 1TNHA 2WPHS 4ZKOU 1O3LA 2J94A 3LGWA 2DUCA 3UWJH 3MU1A 3QWCH 4OGXA 1TE0A 3RXFA 1LPKB 1NS3A 1C2DA 2W7SA 1G9OA 3WY8A 5JPMH 1MUEB 4X0WU 3NGHA 3GCTF 4MPXA 4JOEA 4MG3A 1TABE 1O0DH 2VZ5A 2B9LA 1F2SE 1UK3A 5E0HA 1H1BA 1QGFA 2BD5A 3V13A 1O3JA 2FOFA 2GJGA 3GY6A 3GY3A 3MH6A 1SC8U 3R69A 1QB9A 3TMHA 3SQHE 4DCDA 5CHAB 3EGKH 1W9QA 4JK6A 4B73A 1EPTC 2BY6X 4HOPA 2AGIX 3CC0A 2BY8X 2C8XB 3SUFA 3B76A 4ZKSU 4AB8A 3TJOA 4GHNA 1A1RA 2J38A 2QF3A 3DIWA 5J4QA 4K2YA 2Y7ZA 3UNQA 1A7SA 2EDVA 4F4OC 1ARCA 2OSGA 3JZ1B 1LKAA 1UVPA 4I32A 2QG1A 1GHXH 2J5UA 3A86A 3TIUA 1WI4A 5HXFA 2V3OH 3RXQA 3HPMA 1FONA 2AWUA 1QAVB 4XSKU 1CE5A 2CMYA 1SGIB 2WPDD 2EDPA 1LPGB 1OWIA 5EGMA 2AH4X 3UPEA 1TQ0B 1AKSA 3EQ0H 1NROH 1C5VA 1BRBE 4NMVA 4K1SA 3GDSA 2BLVA 1GBCA 1AFQC 3VEQB 2PKUA 1LHEH 4MPWA 4Q2OA 1J14A 1Y3XA 2V3HH 2ZTYA 4REYA 1GJ9B 2Y82A 5D13A 3RXGA 1E0FD 1GBBA 2A2XH 1FDPA 3W94A 1MAXA 1GHYH 1RTLA 1OS8A 1OXGA 4IMQA 1RGQA 4HI3A 4SGAE 3RXDA 1W8BH 4YYXA 1UTJA 3LGUA 3ZVCA 1QCPA 1U3BA 2KL1A 2FNEA 4CRBA 1GI4A 3BTWE 1XXFA 1KLJH 4AX9H 2PW8H 1HXEH 2KRGA 1Z8IB 3M5OA 2BD8A 3ZZ6A 2P94A 1T8MA 5C67A 1SGYE 3OAAD 1XUFA 3QTOH 2KJKA 3MH4A 2FTMA 8ESTE 3QO6A 3KIDU 1VZQH 3O46A 3KGPA 3SW2B 5E21A 3GS9A 3KQ5A 1DY9A 1MCVA 1QL7A 2THFB 2DLUA 1T2MA 2C93B 3SU3A 1OPHB 3CS7A 1G9IE 3RXSA 4FVBA 1AI8H 1HPGA 4Q6HA 2OP9A 3RLEA 2KV8A 4OEPA 1VCQA 1N99A 1TLDA 1W11U 5A2PA 1O3IA 4D7GA 4DT7B 1TFXA 1DY8A 1SGTA 4B1TA 2KJPA 5GJ4B 3KZDA 3NUMA 1BFEA 3KYFA 4U32A 1A5HA 1C2JA 4NNLA 1Z7KA 1ELBA 5GLJA 1AVWA 3UY9A 1U6QA 1ORFA 4O3TA 2XWBI 1GBJA 1A4WH 3NWUA 1WI2A 5HFDA 4FUBA 1C5SA 1DUAA 1GMCF 2TGPZ 3M61U 4Q4LA 1HFDA 3B9FH 2ZDMA 1G30B 1QRXA 2BQ6B 1TX6A 1QJ1B 2BHGA 1ACBE 1MMJN 4FU8A 2D26C 2SGFE 3VGCB 1GG6B 2VSPA 1ZMLA 2IWQA 2HVXA 3OX7U 2ZPMA 1SR5C 3GY4A 3GDUA 4NWLA 5A0BA 1W12U 1S6LA 1H8HD 1FN8A 3Q3KA 2PLXA 1EATA 2DLSA 3RXOA 5A2MH 3LJOA 2IJOB 4WXVA 1GVLA 1P9SA 3IITA 1C1SA 4BAKB 3EA9A 1ELFA 3BIVH 1TMUH 1GI8B 2PA1A 4NIWA 1QR3E 4X6NA 1T4VH 5IK2D 1MTUA 5CHBA 2HNTE 1W10U 5DG6A 1YC0A 3CH8A 2F83A 2VRFA 3ESTA 4WMEA 2VIPA 1H8DH 2FIRH 3G01A 1Z71A 1O2OA 5FHTA 3GY8A 1ELCA 4BAOB 1B0EA 4FUEA 4A7IB 1W0YH 2WPKS 1G36A 1RZXA 3LJJA 1O2UA 4ZHAA 3S9CA 2J98A 5DSFA 3BEFB 1B8QA 2DM8A 4SGBE 1QBNA 2F9OA 5HKKD 1LDTT 2MHOA 5PTPA 2SNVA 1V3XA 2ZDVH 4XE4A 1YPJH 1FQ3A 3PO1B 3D62A 4FUJA 3PYHA 1HYLA 5T6FA 1S6FA 1D3TB 2ZTXA 4YOJA 1O3NA 1SSXA 3PWBA 2WYJA 2A5AA 1CT4E 3LONA 3UOUA 4NA8A 1TPOA 3TJVA 1E79D 2J9NA 3ID2A 2KCPA 3RM0H 2P3FH 3SUEA 2NU0E 1E34B 1ZRBA 1MTSA 3BTFE 1AU8A 5EXNA 2XYAA 1HV7A 4JK5A 1ZGIA 3S7HB 2FS8A 5EZ0A 4WVPE 3OTPA 2WUCA 1MBMA 3ZZAA 1AE8H 4UONA 1W13U 1SGNE 3SOSA 3TPIZ 5JBCS 4FU7A 2R2WU 1V2UT 4Z8JA 5F3XA 3RMOH 1ZSLA 3KL6A 4K3JA 1V62A 1P01A 5BPEA 1GL1A 1Z87A 4Z33A 5EYZA 2L97A 1WQSA 3TSWA 3WKMA 1BE9A 4CBOA 3A7ZA 1DWCH 4X2VA 1SGDE 2JKHA 2ZCKP 4E05H 2IPQX 3BEIB 2BX4A 3AVZA 1AZ8A 3ZZ5A 2OC0A 3ZVGA 1GHBF 1A5IA 3A80A 2YMSB 1LKBA 1JIMA 4I8LA 2GZVA 2VWNA 3RLWH 1Y5BT 1E36B 1ZTJA 3L4FD 4WY3A 5AFZH 1GBFA 4NMTA 4TPIZ 1OP0A 1Q2WA 2HE2A 2ZKSA 4VGCC 1W0JD 2YMSC 3ATWA 2A5IA 1C2EA 2CXVA 2ANWA 4F49A 1LMWB 5EJLA 5FX6A 2ZPLA 4CR5A 3T2NA 1CT2E 4Z0KA 4GCHG 1XUHA 4TY7A 3LGIA 1GCTC 2XBWA 2EI8A 4K78A 3KQDA 1QRWA 1KYNA 2ANYA 1GJ4H 1KDQA 2H2CA 2NU3E 3FY5A 2EC9H 1C5NH 1QB6A 2Z9JA 5IYTA 2LC7A 1GJBB 2KAIB 3RP2A 1UVSH 4YLQH 2CN0H 2KCYA 2V3MA 1XKAC 1P02A 3QGNB 2GMTC 4PQWA 1SBWA 1HDTH 2PGBB 5CDFE 5JYIA 3P6ZB 4ASUD 3T26A 1WHAA 1P11E 2IWOA 3KHVA 4GLYA 2Z17A 1O3HA 2FOHA 1O2NA 1SGRE 1DDJA 4NMOA 1Y3WA 3DD2H 4Y0YE 4ZHLU 1O2GH 2LPRA 3C27B 4Y8XA 3QGLA 4NG9H 4KELA 4ZXXH 3EE7A 1RXPA 2G5NA 3AAVA 4NMPA 3SU2A 2L74A 2OZFA 3M5LA 2KPLA 1D6RA 1YBOA 1GDUA 1O38A 1VCPA 2BDIA 3P95A 1E35B 2STBE 1SMFE 2KQFA 1BTYA 3M35A 4NIYA 2EGNA 2E7KA 1K9OE 5L2YH 1PPEE 3EA8A 1JIRA 5C5OA 1GJ7B 2EY4C 4D76A 4AC9A 1C5MD 5IL9A 4OS6A 1C2KA 2KOMA 1GHAG 1TRYA 1AGJA 3ZZ8A 2L6OA 3TVJB 5G1EA 1QA7A 2SNWA 2ZHQH 1ETSH 1UK2A 2RCZA 2Y5FA 3PRDA 4JYTA 5DP5A 2AINA 4H11A 5K0HA 1QY6A 3RC5A 3A7WA 5EW1H 1I92A 2GGVB 3QDZB 2VIQA 4IGDA 3ZV9A 1V2JT 3ZZ7A 1EZSC 2ZU3A 4WYUA 4K1TA 4E06H 5C1XA 1OP2A 1GBDA 3RXAA 2IWNA 2WV9A 3NRLA 1NPMA 3KCGH 1OP8A 1QZ8A 4OS7A 9ESTA 1PPFE 1A46H 1SQAA 4A1XA 1Z86A 1VCWA 2TIOA 2WL7A 1TOCB 2WV5A 4AG2A 3SV8A 4ACAA 2A45B 2FS9A 1TALA 2WPLS 1IQNA 4NA7A 2QT5A 3SJOA 2XXLA 1AQ7A 2KAWA 1BB0B 3E0PB 3IG6B 5C17A 1BT7A 4KTSA 4TSFD 1CO7E 1O39A 2YTWA 4XFQA 1YBWA 3U28C 2OCVB 2ODQA 1D6WA 2OLGA 1TNJA 2STAE 1Q3OA 3NFKA 1T8NA 1QHRB 2J34A 3SNEA 2A7HA 2Y5HA 1C2IA 3DSOA 1XXDA 2GT8A 1EZQA 1V2KT 3FP7E 2A1DB 1BRCE 1C4V2 2ZHWH 3I1EA 4Q7XA 1E38B 3UQVA 4CBNA 2ZWLH 2BDAA 1SPJA 3LC5A 1COWD 1FC9A 1RD3B 1HAVA 2BY7X 1FNIA 1W3CA 3ZYEA 1N6YA 3F9HA 6ESTA 3BTEE 1RJXB 2K1ZA 1G2LA 3P8NA 1FUJA 4YOIA 2QIQA 2FM2A 3PLKA 1SFIA 2F3CE 5BRRE 1KWAA 1O3MA 1WQVH 3A89A 2QAAA 3U98H 1TP3A 1NO9H 4BTIB 1BJVA 1JXPA 3ATKA 1O30A 4B2CA 4DY7B 2DB5A 1CGJE 1L2EA 2HLDD 2KCAA 4Q3HA 3PB1E 2QF5A 4RT1A 4BOHA 3F9GA 2ZC9H 2EQNA 3LH3A 4XD7D 1KXAA 4FUHA 1HUTH 1LVBA 1C1QA 1AHTH 1MTNB 2ODPA 1CHGA 2BOHB 2GKVE 4I8GA 4CRFA 1WHDA 2EXGA 3CBYA 3KDKA 1LVMA 1UCYH 1K1OA 5DPAA 1WH1A 1EQ9A 3KZEA 1DOJA 4FLNA 3LGTA 1CT0E 4X1QU 1OYTH 4ABFA 2Q9VA 1ELEE 3ZZ3A 1EP5A 2GV7A 3UOPA 3SI3H 1O5FH 4DIHH 2BLWA 4NNMA 2PWXA 3VQGA 1PPHE 1GBAA 1YLCA 2VJ1A 5FBEA 4NZQA 3U9AH 5LPRA 1V2MT 7GCHG 1LHDH 1U39A 4FVDA 8LPRA 3ZZCA 2J97A 3QN7A 1NRPH 1UJDA 3OEED 3SNDA 1UHPA 1XUGA 4BANB 4HTCH 1YCPK 5T3HA 4G69A 4DG4A 1ELGA 1LTOA 1P05A 3VB7A 3SNCA 1NT1A 4K69A 3LIWA 2V6NA 2VH0A 1PPBH 1NC6A 3SV9A 2GCTC 3KQBA 1EUFA 3DSGA 3A83A 2Z3CA 3GICB 4BXWA 4JL7A 1QURH 3ATLA 2XNDD 1TQ7B 1PFXC 4GHQA 1EB1H 5DGJA 2WSSD 3P8OA 1YF4A 2R0LA 1P09A 1O3CA 1C5ZB 4B76A 5ETXA 1MH0A 4AZ2B 1D5GA 2W7RA 2FEQH 2GCTB 2XW9A 4WF8A 2ZECA 3TNSA 5I25A 1C4U2 2OD3B 1GHWH 5JDUB 2JH6D 2M0TA 2I4SA 3S0NA 1MKWK 1E1RD 1EB2A 3UB0A 4YT7H 1PQ5A 3VB6A 2ODYB 1RIWC 4H4FA 3ZV8A 4FOUC 3TH4H 3I18A 1O5DH 2HOBA 2ZPSA 1VJ9U 3RXKA 2AMDA 2EEHA 1JRTA 1ESBA 1JOUB 4A92A 4YM9A 2GCHF 4CH2B 2C90B 4ZXYH 1AY6H 2ZTZA 1HAZB 1TNLA 2BDBA 1IU0A 2LA8A 1S81A 2A31A 1TGBA 1NTPA 2G00A 1UF1A 2HRVA 5GNDA 1GDNA 1AWHB 3PRBA 4OGYA 1LPZB 2P93A 2WINI 3BTHE 4ACBA 3M37A 5GCHF 4NXRA 1IOEA 2BQ7B 1FY8E 1N8OB 2ZCLP 4UEHH 2QF4A 4FUDA 1ZJDA 2FN5A 4JORA 3Q00A 2FX6A 1TYNA 2QY0B 2CGAA 2BYGA 2ZFQH 3LH1A 2FDAA 4X8UH 2IPHA 3B23B 4FXGH 1W0KD 2GZ9A 3QE1A 3VG8A 3RMLH 4IBLH 2EEIA 3GDVA 3SYJA 2JREA 4TT3D 1GI7B 4ZAEA 2H9HA 1XMNB 3A7VA 4A1TA 5EODA 1V6BA 1UK4A 1QL8A 1UTNA 2GTBA 5H3JA 2YNBA 4NGAH 1IU2A 4JZIA 3MNCA 2VWRA 3PO1C 3E17A 4YXWD 1DWEH 5DP4A 3JZ2B 3RU4E 3TJNA 1LHFH 1SHHB 1NRRH 2XBYA 1N6FA 1W9EA 3PDZA 1RGRA 4WH6A 1IQIA 1C1MA 3OTJE 2ZGHA 1ZHRA 1GMHF 4I7YH 2EGOA 3RU4T 2P8OB 3UTUH 5HF4A 2B5TB 1EOLA 2FOGA 1UTMA 1OKXA 1O3DA 1YM0A 1KXEA 3A7YA 3BTDE 2UWPA 3GYLB 4KTCA 3U8TH 3RUOA 4X8VH 4Q7YA 4HG6A 3QK1A 2FCFA 1N7FA 4H6TA 1N7EA 1LO6A 8GCHF 1HCGA 1GQ4A 2CF8H 1PPZA 1GJ5H 3HGNA 2AS9A 3VFEA 3M7QA 1VR1H 1THRH 3LC3A 4KTUA 1K32A 1G3CA 2A7CA 2Y5GA 1GCDA 2I6SA 2Z7FE 3PMHB 3QUMP 1V2NT 1J9CH 4U30A 1DXPA 1GHVH 1IQJA 1QNJA 2GV6A 4KKDA 5T6GA 1AZZA 1MQ6A 2DJTA 5E0GA 1C5WB 2XNIA 4FUGA 2ZU2A 3SZNA 2D8WA 1O2IA 1NFWA 5A8YA 1IQGA 2FOMB 2GZ8A 2UUJB 3F0PA 1GCTB 3RXTA 2TGDA 1RIWB 1NM6A 2QXGA 3SOEA 1C1UH 2F5YA 4JOHA 2WYGA 3WWBA 1IQKA 4NIVA 3SV6A 4OEOA 1ABIH 4IMZA 5JB8S 2O9QA 5TJXA 1BTXA 1DSTA 2Z9GA 1AO5A 2J95A 1EZXC 1EJNA 3CENA 2PHBA 2YT8A 4I33A 1BIOA 1HBTH 3I4WA 3S69A 3TSZA 3NKKA 4P2AB 2R4HA 4WYTA 2V0BA 3VGCC 3Q76A 1GVZA 3GGEA 3Q3XA 1YPMH 3VPKA 1UO6A 3MU8A 3BTQE 2OQSA 2QE7D 1UMAH 3SBKA 1IQLA 4ESTE 3O8RA 1XZ9A 3GCOA 1UCYK 4ZKRU 1EPTB 1LVYA 1AKSB 3VXEH 1D4PB 2TGTA 3VB5A 2YOLA 4UFDH 1LHCH 1V6DA 3D49H 5AFYH 4BAMB 4DT4A 3SNBA 1HJ9A 1NBME 1THSH 2BDGA 3RXLA 2BTCE 1P2QA 1CSOE 3E91A 1DANH 1MKXH 1TQ3A 2ZGCA 3GCHC 1SFQB 1Z1IA 2QCYA 4INKA 1HIAA 1MTNC 1CQQA 5FPTA 4UDWH 3MU0A 4Y79A 3R0FA 1SKYE 2VNTA 2ZQ2A 1BBRH 3M3VA 2EA3A 5K7RA 3OU0A 1WV7H 2XCNA 1BMMH 1P1DA 1DVAH 3MNXA 3A8CA 3KN2A 7GCHF 2VWLA 3SZEA 1O32A 2OTVA 1ZPBA 1E1QD 1GI0A 1NRQH 3FKSD 1CA0C 1TX7A 1F92A 4Y8YA 4LMMA 1JMOH 4Q2QA 1DLKB 1IHJA 4Z1MD 1ZMJA 5LPFA 5B6OA 1ANDA 2J4IA 1BMFD 1K22H 4JZEH 2GDDA 3HKJB 4MVNA 5E2PA 5C5NA 2HGAA 1EAIA 2GX4A 1C1TA 1O2XA 1H4WA 1NFYA 4NMQA 3T27A 1HJ8A 4WJG2 2SGQE 2AERH 2LP6A 2XRCA 1ANCA 1HAGE 3N7OA 3BTTE 1DXWA 3TH2H 4NWKA 2OC7A 3R68A 5DP9A 1K1IA 3ZZDA 1BZXE 3AAUA 5T6DA 4WMFA 3U1IB 1FN6A 1O2QA 4H6SB 2NU1E 2H3LA 1O2JA 2VU8E 5KGOA 1O2SA 2BZ6H 2REYA 2J92A 1T8OA 1H8ED 4QT8C 4B6EA 2WHXA 3E16B 1P2IA 4WMDA 3ZIAD 3HVQC 1GBHA 1YLNA 2Z9IA 1K0HA 1HAXB 1H9IE 3DUXH 5DO4H 4LZ1H 2SFAA 1CHOF 2PKTA 2QN5T 2WV4A 4JYVH 2RA0A 2W6JD 1W14U 2A2QH 3CNRA 5ESBA 2M10A 3QIKA 2DKRA 1W7GH 2BM2A 1BJUA 4OM9A 2AGGX 5JBBS 3BG4B 2A4QA 2KCOA 4UFGH 3MOCA 5E6PB 1FPHH 5I7ZA 1BQYA 1WU1A 3W1EA 4A1VA 3U1JB 3RXJA 2FP7B 2EGKA 2H9EH 2PDZA 1KMHB 1F7ZA 4X6OA 1V1TA 1KSNA 3BTGE 2XBVA 1C2GA 1JRSA 4I8KA 2JINA 5FPYA 2BD9A 3ZZ4A 1B5GH 1ETRH 3N99A 3WKLA 1GG6C 2HPQH 3FZZA 7KMEH 2IWPA 1ZSKA 2HPPH 4K76A 5EJZA 1HGTH 1UHBA 1XUIA 3A81A 1UJVA 3UQOA 2OMJA 1IQFA 1OWKA 1V2OT 1UEPA 2AWWA 1O5BB 5EPYA 5FL7D 1SQOA 4NXPA 2M0VA 1WUNH 2QXIA 2RDEA 2ZHFH 4P0CA 3ENSB 3TGKE 3NPSA 2PP6A 4Q80A 1TGTA 3Q77A 3GOVB 5EU8A 4E35A 1QTFA 3AK5A 1UTKA 3ELAH 1DICA 2VVCA 2ZPRA 4ZHMU 1GMDG 1QQUA 3LT3A 1CA8B 1NFUA 3DJ3A 2FOEA 1KEFA 4AB9A 4MNVA 1FCFA 1Y59T 4MTBA 4CRCA 1FV9A 2ZDLA 3A85A 2VWOA 2R3YA 2A7JA 3P8GA 3K9XB 2FMJA 1DS2E 4KFVA 1F0SA 2ZDAH 1P1EA 2HGTH 1BTZA 4THNH 5GIBA 1DFPA 1GGDB 1GHBG 1IHSH 4AG1A 2C8WB 4X2XA 4X8SH 4O06A 3O5NA 4XRNA 1GMHG 3BTME 2FOCA 3U69H 3OFND 2DC2A 4IC6A 3GYMA 1TBQH 3K2UA 3PV4A 4TPYA 3HATH 2KR7A 3F0OA 4CHAB 1UVOA 2PTCE 5L6NH 2FI5E 1FC6A 2WPJS 3AW0A 4GPGA 1KY9A 1Q7XA 8GCHG 1O37A 2Z9LA 5HEBA 1EAXA 1FAKH 1DLEA 1BTWA 2P8OC 2OS6A 2ILNA 2Q1JA 1O35A 4Y8ZA 3N7EA 4O03A 1X45A 2K8IA 2VGCB 2ZO3H 4RN6A 1TAWA 2Z94A 1S84A 4BXSA 4U2WA 2A4GA 1O2WA 5HEYA 1WXRA 4X6MA 1NN6A 4Y7AA 2X7ZA 4GVCA 1HJAC 4RKOB 2JIKA 1F0TA 1DPOA 1O2PA 3UREA 2KAIA 4ISLA 5DN6D 4IW4E 3SU0A 5F8ZA 4KFWA 1BMLA 1YPHC 1P3EA 1BCUH 1QJ7B 2M3MA 1BMAA 1OBYA 1UEZA 1MTVA 2M5TA 2W6ID 1QRZA 3M36A 2ASUB 2Q6FA 3FO8D 1QLCA 2TRMA 3RXIA 1O2VA 1PQ7A 3NXPA 4TY6A 2EEGA 3RXRA 1A0JA 3MNBA 3SV7A 5E2OA 1GBLA 1HXFH 4ISNA 1GVKB 2SGAA 3SU5A 5B6LA 3SU6A 2P3TB 3BN9A 1TONA 1ESTA 2GDEH 3CBXA 3O8DA 1TB6H 1F5LA 2HALA 1MBQA 3QDOA 4OAJA 4ABJA 1NFXA 2I6VA 2PV9B 2C3SA 2K20A 4R2ZA 2G81E 5CE1A 3BG8A 2ALPA 1WYKA 4ZROA 2ZFRH 5B42A 3GY2A 2ZIQH 2EV8A 1YGCH 3PTBA 3EGHC 3ZVFA 1G3EA 4AFUA 2CJIA 1Y5UT 4FETA 1RS0A 2AIPA 1K28D 2KOJA 1O2YA 2PUQH 2G55A 5DTHA 4OS2A 2JWEA 1GJDB 1XX9A 2UWOA 4FGMA 2EJYA 3AXAA 3SU1A 5C20A 3DT0H 1BBRE 3PTNA 2QKVA 4JCNA 2SGEE 2I04A 1L1JA 6CHAB 2ZU1A 1C1WH 1C5PA 2P3UB 1Z1JA 3SI4H 1ZOKA 3MWIU 1HNEE 1HAIH 2GCHG 2KX4A 3ATMA 3U8RH 4K8YA 5TCAA 4AMHA 2XOKD 2BXUH 1P10A 1HAYB 1C4Y2 2EHRA 1S85A 1AE5A 1V2LT 1X5RA 2O8WA 1X5NA 2YUBA 3SHWA 1P2NA 4I86A 2FYRA 4BTUB 4JOJA 4MPVA 1THPB 1UVTH 2D90A 1QJ6B 7LPRA 4KP0A 3ZVDA 2RDLA 4J1YA 2P16A 3SORA 4OS4A 2ZGXH 1WF7A 3T28A 4AFZA 1BDAA 1C1RA 1MD7A 3LDXH 2O8UA 1X9ZA 4MQAA 3SJ9A 1O2ZA 2QF0A 4X2WA 1GHZA 2XC0A 2D8IA 3L6PA 3MO9A 2CHAB 5G1DA 1KTSB 1ZGVA 2QV1A 4AGKA 5JBAS 1UVUH 2AMPA 3P8FA 1ID5H 1O3OA 4IC5A 1L4ZA 2FTLE 3H09A 2PKAA 3E1XB 1LQEA 1D3QB 3VQFA 1YCPH 3I29A 1UHBB 4I8HA 2KPKA 5DP6A 5EJ1A 1P0SH 1QBVH 1FLEE 2Q6DA 4Y71A 1C5YB 4WXIA 1O5CB 3UUZA 2VB0A 2VVVA 5I46H 4P02A 4NSYA 1PYTC 3SGBE 1AD8H 4HZHA 4F8KA 1RY4A 3T62A 2VIVA 6GCHF 1K1NA 1QBOA 1AUJA 2H3MA 2RFKC 1WG6A 1C5UA 1XVOA 2I6QA 1EXFA 1FY1A 2BDYA 4YLUA 4OS1A 4I8JA 3QLPH 4BAQB 5AHGH 4HOPB 3F2FA 3FAOA 2GT7A 1TBRH 1EZUC 1O5AB 3B8JA 1SVPA 1QB1A 3LKWA 1YPHE 1MU6B 2G8TA 1B0FA 1SGPE 3A8DA 3RMMH 1JWTA 3GISB 1DX5M 5E11A 4MDSA 4DJZB 4YT6H 1ZHPA 3MU5A 3RL8A 1ELVA 3E8LA 1KXBA 5FCRA 5ABWA 2UUYA 1WSSH 4Y76A 1GDQA 5GWZA 3TSVA 6LPRA 5FB8C 1EJMA 1WF8A 4R0IA 1J17T 3RC6A 2OBQA 1INCA 1BRUP 3PV5A 1A0HB 1C1PA 1UW7A 3SV2H 1C5XB 1QAVA 3Q3YA 3PM3A 5LPEA 5KECA 4DGJA 1CGHA 5SGAE 1SGEE 3K65B 1WCZA 1TPSA 3R3GB 1XM1A 3QTVH 3H7OA 1P9UA 5ESTE 3SQEE 4DW2U 1N7TA 1O2TA 2HE4A 2H5CA 3O8CA 1AUTC 1U37A 5EQSA 3S9BA 2SGDE 1PDRA 3M7UA 3RMNH
chains in the Genus database with same CATH topology
5HF1A 1A0LA 4NA9H 2DE8A 1Q3PA 1K1JA 1NU9A 3ZVBA 2ZF0H 1VJAU 5AF9H 5HDYA 3CYYA 1GPZA 1NZQH 1Y8TA 2CSJA 1GWAA 2GZ7A 2ZFTA 4NCYA 1UJ1A 1PJPA 1MD8A 1S6HA 4JOPA 4GUXA 1CBWC 2XCFA 5EXLA 1WIFA 3RC4A 3BSQA 1GBTA 2G4UA 2JSNA 4E3BA 5F8XA 1YPEH 2YUYA 1XVMA 4BAHB 2Z6BD 1GGDC 3A7TA 3AW1A 2CS5A 1P06A 2PFEA 1YP9A 1A5GH 4XBCA 4NSVA 1TP5A 4XDEA 2KBSA 1D3DB 1Q31A 1S5SA 4INHA 2Q6GA 3V3MA 3E3TA 3LGYA 3VB4A 1TGCA 3PDVA 2BB4A 1C2LA 3A84A 4CHAC 5L2ZH 4GHTA 2ZPQA 1AIXH 3SN8A 1N6EA 1W2KH 3S9AA 1FMGA 4EDJA 7ESTE 1ZOMA 4D9QA 2BOKA 5FBIA 1C5TA 2HLCA 5ILBA 2L4SA 2F0AA 1OSSA 1TPPA 1NF3C 1YYY1 1EKBB 3U8OH 4LK4A 4MNXA 3RXPA 3STIA 4D8NA 2BLQA 1TMTH 2ZFPH 2FLBH 1Y5AT 2BD2A 2BY9X 3RDZA 3A7XA 3P92A 1O2KA 1PPCE 2Z3DA 2OC8A 1BBRK 5L30H 3SUGA 3P70B 1P2JA 3URDA 2OGPA 2EDZA 3TH3H 2FO9A 1HJAB 4J2YB 2H5DA 2V35A 4ABEA 1BUIA 3K6ZA 3UIRA 3HK3B 3A82A 1A61H 4JZFH 4UE7H 3TNTA 1LCYA 1SG8B 2FOAA 1IQEA 1MFLA 1P2MA 1P57B 1FJSA 5HETA 4MPAA 1BTHH 2Z3EA 4D7FA 3A8AA 2NU4E 1UTOA 1MKWH 1E37B 2OINA 5A0CA 1W9OA 1K2I1 1SHYA 3V12A 4AGJA 1N1LA 3ID4A 4ZMAH 1GBKA 4YESB 1UEQA 1PYTD 2FYQA 2QKUA 3TU7H 3CP7A 2OCSA 1XUJA 1O5GH 1X6DA 1CGIE 2PR3A 4GVDA 3GCTG 1Z8JB 1WBGB 3ITIA 1L1GA 4RSPA 1CU1A 4AYVB 4ZH8A 5J4SA 5H4IB 1AN1E 1C5OH 1VGCB 3MNSA 1TNIA 1UTPA 3DHKH 1AB9B 1ZR0A 4X1SU 3RM2H 2AFQB 4Q2NA 1V2PT 2FXRA 4UU6A 3CS0A 1LQDB 3GJ9A 4JYUH 4XOJA 1AVXA 3RXHA 1YPGH 1VGCC 2BVSH 1T7CA 1ELAA 2M0UA 1NU7B 1VITF 4YOGA 3ODDA 4K5ZA 2BMGB 3V7TA 3IWMA 3K6YA 4JZDH 5GPIB 2RCEA 1C2FA 4M7GA 3SJIA 1GBEA 4CRDA 1V2ST 2H2BA 1IHTH 5A09A 3GCHB 1OWHA 2QYIA 3ZZ9A 1YLDA 2KG2A 3K50A 1O36A 1ANBA 3SUDA 1OYQA 3K82A 4WH8A 1PQ8A 5C1YA 4CRAA 1TMBH 3PMAB 2ZA5A 4ABBA 2PSYA 1SOZA 2EI7A 2HNTF 2V90A 4MNWA 2R3UA 2VGCC 1VITG 3KEEA 2JXOA 3RXVA 1OBZA 1HAHH 5EG4A 5E1YA 1L0ZA 1DM4B 1TRMA 4Q2KA 1C1NA 2SGPE 2BY5X 3NFLA 3BEUA 2ALVA 5GCHG 1V2RT 2AYWA 1GI9B 4JOKA 1P2OA 2L4TA 1P03A 5FXLA 1V2QT 3C1KA 3H7TA 3RXUA 4HFPB 1GJAB 1R6JA 1HAPH 2F9BH 1DUEA 2BYAX 6GCHG 2OUAA 2B7DH 3UR9A 3DJ1A 1MCTA 1P04A 1OOKB 2B8OH 1ZTKA 5EQRA 1K1PA 1BOQA 3PWCA 5F03A 1SLWB 3MU4A 1V5LA 1NRSH 2ZU5A 1MZDA 4AFQA 1O34A 2A4OA 2G2LA