3GDUA

Crystal structure of degs h198p/d320a mutant modified by dfp and in complex with yrf peptide
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
316
structure length
294
Chain Sequence
DSTDETPASYNLAVRRAAPAVVNVYNRGLNEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINPGNGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREQGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMAQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DegS protease
publication title OMP peptides activate the DegS stress-sensor protease by a relief of inhibition mechanism.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase activator
total genus 57
structure length 294
sequence length 316
chains with identical sequence B, C
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3gduA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gduA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gduA01
4I8KA 1V2QT 1ARBA 1Q2WA 1KTTB 5C67A 1ACBE 4X8TH 2TPIZ 3TSWA 1FY1A 3O46A 4U01A 3SU4A 1FN8A 1P2QA 1GI5A 2TGDA 3MWIU 1UEZA 2H5DA 1C2KA 1YPHC 3A87A 1GJ4H 3MH5A 1P3CA 4ZKRU 3SV8A 2GZ8A 2AMPA 1LPKB 2GCTC 2P93A 3QO6A 4JOGA 4NCYA 2BMGB 3SU1A 1GHBF 5E8EH 4GAWA 2JOAA 3V0XA 1C5YB 3M36A 1MU6B 1TRNA 2CHAC 4JOJA 1SBWA 1J14A 3O8CA 2UUFB 1ZPCA 2FOAA 1A5IA 1QLCA 1P06A 2SGDE 2RRMA 3AASA 4JMYA 1UTMA 3K50A 2ZPRA 1O3FA 2R2WU 1C1WH 1NM6A 3PDZA 1KY9A 1SGNE 4ZHLU 1BMAA 1GBEA 1GQ5A 1P2MA 3HPKA 3NCLA 4AORA 3B9FH 1X7AC 1C4Y2 5A0AE 1QQUA 3RL8A 2YOLA 2AWXA 3CBYA 2QYIA 4ZXXH 1W14U 2P8OB 1K32A 3GGEA 1G3BA 2CXVA 3JXTA 1C2DA 1EX3A 1HAZB 3KEEA 3LH3A 4MPUA 5T6GA 2VWMA 2OXSA 1GBCA 1OXGA 4IN1A 1HPGA 5T6FA 4YT7H 2GGVB 2FI4E 2FLBH 3A8BA 3UWIA 4Q7XA 4Y0YE 1TONA 4WYUA 1BT7A 1BFEA 1GBMA 3PO1B 5HFDA 5LGOA 1GDNA 4X2XA 2WINI 2ZPSA 4X8UH 1Z1JA 1UMAH 1K9OE 2Z7FE 5HFFA 2ZZUH 2LUIA 1O2MA 2BD8A 2ZGCA 1GJ5H 1QBOA 3CC0A 2BY7X 5DO4H 1G2MA 1TBZH 3F1SB 1IQHA 1LTOA 1HJ9A 3FP7E 1IQKA 3SV9A 2UWLA 4BTTB 1E36B 3VB4A 4F4OC 5AF9H 1V2UT 4FUDA 4LZ1H 2TGTA 3SU2A 2C8WB 3R0HA 1C5SA 1R6JA 1YKTA 1MCTA 4NMQA 1UHBA 4Q2KA 1GCTC 1IAUA 3O8RA 1O2WA 3S69A 1SC8U 4RN6A 2LC7A 1EJAA 1YGCH 2BHGA 4MNYA 1ZHRA 1MKWH 2JILA 1EZXC 5GWZA 1HJAB 1RIWB 1BTZA 1L4ZA 1RXPA 1GHAF 1K21H 2F9BH 5C5OA 1WF8A 4DW2U 1QAVA 1SMFE 1ZR0A 1GBKA 1UFXA 4OS1A 4NMTA 4ABGA 2KPKA 1ZSLA 4DIIH 2VU8E 7KMEH 1FNIA 1P3EA 3RDZA 2X7ZA 3RU4D 2PGBB 5FHTA 2PTCE 5DG6A 4B71A 5L30H 1INCA 1TBQH 1WTGH 1YBWA 4A92A 1ZYOA 3ZZAA 1AFQC 2BZ6H 1EJNA 1HAIH 4MPAA 4MPXA 3ATLA 4ZXYH 2XTTB 4I33A 3TGKE 3STJA 3QJNA 1FLEE 1D3TB 4DGJA 2ZECA 1UJDA 1XZ9A 1EAUA 1Z8JB 5EU8A 1DM4B 4FUIA 1SQTA 1Z8IB 1IQNA 1UK2A 2VNTA 3W94A 2AERH 3E0PB 2MX6A 5G1DA 2ILNA 1O31A 4WMDA 3UNRA 1RD3B 2D2DA 3RXCA 1GBFA 4H4FA 3UTUH 1C4V2 4ABEA 3M5LA 5A09A 1D6RA 1TRMA 3KNXA 1WUNH 5CE1A 1YC0A 1ARCA 1C5VA 2XBWA 1O3JA 2RCEA 1LMWB 4ABAA 1BJVA 4CRBA 1O30A 3UOUA 6GCHF 3MYWA 3S9BA 5A8XA 3EYDA 1ELGA 5DKMA 5B6OA 2WV5A 2Q6GA 5TCCA 1SGPE 5EQRA 3MHWU 3A85A 1NROH 1D5GA 4D7GA 1TLDA 1UTLM 1W0ZU 1G30B 2ODPA 2VPHA 2PKSB 4JZDH 2EGKA 2R3YA 5K7RA 2OBQA 1UK4A 1KSNA 1W3CA 4BTUB 1DANH 1WCZA 1UCYK 5C20A 3EGGC 2QY0B 4FUCA 4AFZA 1SHHB 1N1LA 1ELAA 2FO9A 1C2EA 3A86A 2L97A 3SJKA 4AMHA 4JCNA 1SG8B 1ZUBA 1EXFA 3DFLA 2FOBA 1PJPA 3PMBB 1K2I1 4BXWA 4UONA 4F8KA 1C2JA 2M0TA 1Z8GA 2Z3EA 3Q76A 5FCKA 1OZIA 1MH0A 2WPIS 1EB2A 4U32A 5E2PA 4INHA 1VR1H 1WI4A 2XC4A 2ZDMA 2L4SA 1ANEA 3TK9A 1MTUA 1GGDB 1O2LA 5E11A 2CJIA 4R2ZA 1ELEE 2OC8A 1O5CB 2Y7ZA 1C5QA 4B75A 2F9OA 1ELBA 3ESTA 1AVWA 1GI6A 3N7OA 2YNAA 4LK4A 2SNVA 2XC5A 3DD2H 1YPHE 4REYA 5E6PB 1G2LA 3TK6A 2G4UA 2O8WA 4LMMA 2CSJA 1NRRH 2FTMA 1MD8A 2GV7A 2OP9A 2UZCA 1N6YA 3U8RH 4Z33A 3P95A 1O3CA 1QRXA 1IQGA 2KQFA 3LGWA 3FZDA 1BMMH 4DJZB 3SNAA 4B2AA 1PYTC 2A7HA 1SL3A 4HZHA 1QURH 1MKXH 2ULLA 1IQFA 3PYHA 3QGJA 2EEGA 1O38A 3PROA 5GLJA 1C5WB 1NRSH 2DLUA 2BDCA 4GVCA 2VWOA 5DJ7A 2BQ6B 3HATH 2W5EA 4ZKOU 2I04A 1Y3XA 1AUJA 3ID1A 3A7XA 1DUEA 2ODYB 3ATKA 3M7UA 2G81E 4NNMA 1O3DA 3ITIA 3F9FA 2BX4A 1OSSA 2FNEA 2Q3GA 2QBWA 4K2YA 1GM1A 1QB6A 2CN0H 1LQDB 3SZNA 1O2JA 2XW9A 3A7YA 1ABIH 5FBEA 1C5LH 3DIWA 1GMHG 1N7FA 2G8TA 1OWIA 2QA9E 3A83A 1XVMA 1Z6JH 4BAOB 1IQIA 1N8OB 1BRCE 2OBOA 1HAXB 4K6YA 4K69A 1C5UA 1NY22 1QJ7B 3GDUA 4ABBA 2H1UA 2ZIQH 1ZTKA 3ZVCA 4ZKSU 2BTCE 1T2MA 1C2GA 1UJ1A 1TBRH 1TNLA 2W7UA 4K3JA 3UNSA 1ZTLA 4RKOB 4A1VA 4TY7A 4AYYB 1TNJA 5A2PA 2ZPLA 1D4PB 1K1IA 3ODDA 2ZPQA 2EHRA 1UITA 4FU9A 1ELDE 1HXFH 3RM2H 2Z17A 2Z9KA 3AVZA 2XRCA 2XWAA 1A0JA 2C90B 2M5TA 1EOJA 1S5SA 3MU8A 4AYVB 3A7TA 1GHZA 1GI8B 1V2MT 4OAJA 3SHAH 3GDVA 2P8OC 1FY4A 2ZDNA 4GVDA 1W0YH 1ZRBA 2FTLE 1VITH 1YPLH 4UEHH 1DUAA 3UNQA 4JOKA 1QFKH 2P94A 3M35A 2SGPE 1OS8A 1NTPA 2FOFA 5GCHG 3PV2A 1TALA 1YP9A 3TJNA 1PQ7A 4CRFA 2BDHA 4IN2A 3VB6A 1H8DH 2NU1E 3LIWA 5AVDA 3PO1C 1TA6A 3S7HB 2I0IA 1GHXH 3QTVH 4YTAA 3KF2A 1JBUH 2Y80A 1LVBA 2P59A 3SBKA 5HF4A 1RGWA 1JXPA 3DT0H 1NFWA 3C1KA 1FZZA 1KXBA 2W3KA 3QGNB 4B2CA 4X2VA 2YTWA 1YYY1 1GG6C 2ZHEH 1P2OA 3MNBA 2D92A 3HKJB 3IG6B 1O2PA 2A5AA 2G51A 3OYPA 1ZMLA 1OBZA 1TQ0B 4AGJA 2A32A 3LKWA 5JBAS 3T27A 3C27B 3RXRA 2FN5A 2V35A 3RLYH 1U6QA 2K1ZA 5EQQA 1P1EA 2CV3A 1X5NA 2QKTA 3QIKA 4YLQH 4FUEA 3ODFA 1HJAC 1RIWC 4FUGA 3T29A 2WPJS 3HK3B 1A61H 3VPKA 1TRYA 1GWAA 3TJVA 4BXSA 3RP2A 3GCOA 1GBJA 2XCFA 1EAXA 2ZQ1A 3OY5U 3K65B 1PPHE 2VWNA 2AYWA 3GOVB 2A4GA 1NU7B 1T32A 1Q3OA 5FAHA 2C4FH 3SFJA 2A5IA 3E8LA 4Q80A 3MO6A 1E35B 4XDEA 2VVUA 5JBBS 3TH2H 5HF1A 3UFAA 1CT4E 1AVXA 1YPKH 2AGIX 5C1XA 3EE0B 3DJ1A 1O35A 1ABJH 1GI4A 3R69A 2G5NA 4I8HA 4GHNA 2OTVA 2ZDVH 4GLYA 4NIYA 3M61U 3MH4A 3LONA 3E1XB 1O32A 2BX3A 3GDSA 2PZDA 2KL1A 2C93B 1YCPM 3UWJH 2OS6A 4IS5A 1BTXA 1DXPA 4JOPA 1KDQB 2AGEX 3BEUA 2FX4A 2EDPA 2VIOA 2EEKA 2SNWA 2NU4E 3EQ0H 4CBNA 1C2IA 2KAIB 4K8YA 1YBOA 3ATWA 2UWPA 5DTHA 3NKKA 3DHKH 1Q31A 3SGBE 1GBTA 3MNCA 1QNJA 3SU3A 3U1JB 4H6TA 1BE9A 3DORA 1P9UA 1J17T 1HAHH 4L8NA 3QJMA 3ZVAA 3VGCB 1MFLA 1SGQE 2BDIA 2PKSC 3I1EA 2FOEA 1U39A 1YM0A 5A0CA 1DWDH 2EJYA 2CMYA 2NU2E 3LGYA 2R2MB 5F03A 1O2NA 1VJ9U 4H6SB 1F0TA 1NESE 1TYNA 3QDZB 1ZPZA 1GJ7B 2D8WA 2ANYA 3T2NA 5EYZA 1C2HA 3BEIB 2EV8A 4NA8A 3L3TA 3BF6H 3UR6A 3NK8A 3MFJA 1O3NA 2ZPMA 2KOJA 1ETSH 1N6XA 1P01A 1MQ5A 1TPAE 2I0LA 1GMHF 4ZHAA 3NUMA 1VB7A 1GJDB 3PMHB 2H2BA 3RLWH 2IWOA 2G2LA 1IQLA 1BTPA 3G01A 3LPRA 1MQ6A 1LHDH 4KFWA 3U9AH 2QKVA 3FY5A 5DPAA 1L0ZA 2V90A 3P8OA 2ALVA 4CR5A 1GGDC 4AOQA 1B0EA 1HNEE 3CH8A 4BOHA 4I8LA 2OUAA 7GCHF 1LHFH 1TWXB 1N7TA 1PFXC 1ELVA 3T5FH 2HNTC 1HUTH 2FLRH 1GVKB 2GCHF 2JKHA 3A89A 2Y7XA 5E0JA 1C5TA 3PLPA 4D7FA 1EZQA 1JIMA 2Z9IA 1LVMA 2MHOA 1S82A 1DXWA 1TP3A 1V1TA 3RXEA 3HPMA 1V62A 2ALPA 1ZOMA 3FFGA 1MC7A 1KTSB 1SQAA 1U3BA 3D49H 3SHUA 4WH6A 2ZO3H 2VIDA 5GCHF 4MPWA 1ZRKA 1NC6A 2BVSH 3GCNA 1TIOA 4NIVA 8LPRA 3K1RA 1DSTA 2KRGA 1O2ZA 4B2BA 2KBSA 2DM8A 2KA9A 1Y3VA 1C1SA 4AG1A 1J16A 1X8SA 2J2UA 3BTKE 1E37B 1TMUH 3PMAB 2J92A 1K22H 2D1JA 2PR3A 1NN6A 2A31A 2FDAA 1C1TA 1P2IA 4I8JA 1BITA 2GT8A 2W4FA 2F9PA 8ESTE 2PSYA 1QBVH 4X1NU 2ZHFH 5A8YA 5LPFA 1O2YA 1S6FA 4Z8JA 1C1RA 4YESB 1P10A 8KME2 3PM3A 1AUTC 1LHGH 1YPGH 3Q3XA 2DC2A 1CGIE 2ZU5A 2GD4B 1VZQH 4OS7A 1CO7E 3RMOH 2FYQA 4E34A 1GBAA 4NG9H 1W9QA 1BTYA 1O5FH 3NGHA 1Y3YA 1GBLA 5TJXA 1N8OC 4NSVA 1BHXF 1ESAA 4PROA 3SW2B 4UDWH 3E17A 5JXBA 1NO9H 1V2RT 4D76A 1HAVB 1CU1A 2ZU2A 1VGCB 4ZH8A 1TMTH 2BD4A 1LO6A 3ID4A 1D6WA 4UFDH 3ZVEA 2HLCA 2AFQB 1L1NA 2ZFSA 3F68H 3A7VA 3SGAE 4CRDA 1E34B 1E38B 1GDQA 1QHRB 1NFXA 1QL7A 1TQ3A 4B1TA 1RGRA 2OQSA 1KYNA 4GSOA 3SORA 2Z94A 2P3UB 5JDUB 2FM2A 2HE4A 3KQEA 5F8TA 2VB0A 1O39A 2H3MA 1N6FA 1NZQH 1NF3C 4X6MA 1EJMA 1KDQA 5A8ZA 2TGPZ 1T4VH 4F49A 1TA2A 3KHFA 4UFFH 1KIGH 2KAIA 2ZFFH 1XX9A 1X5RA 1AVGH 4IBLH 4WMEA 2J34A 4GPGA 2ZWLH 4DVAU 1WG6A 5GDSH 1W7GH 1MD7A 2XC0A 1ESBA 3HGPA 1V5QA 4GHQA 2Y82A 2OC0A 5E21A 5EZ0A 2AGGX 2PKTA 3QX5H 1BBRE 2FEQH 4ZAEA 5EQSA 4K78A 1AZ8A 4MPVA 1LHCH 3LJJA 1HFDA 1IU0A 3URDA 2G4TA 4AFUA 3JZ1B 4XHVA 2P16A 3MOCA 4NGAH 5I46H 2ANWA 1L1GA 5IDKA 2HGAA 3ATMA 1GG6B 1K1JA 1DWBH 1F0UA 2FPZA 1HB0B 3RXJA 3RXGA 2BDAA 1O3BA 3O5NA 3SOSA 4CRAA 3MO9A 1MTNB 2AIQA 4BAMB 3P8GA 2DAZA 4CR9A 2IWNA 3VQGA 1SSXA 3BTWE 3U69H 2TGAA 2ZC9H 2QKUA 2ZFQH 4INKA 2JETB 5L2ZH 3UQVA 2A7JA 2J38A 2M10A 2SGFE 4NIXA 3PV4A 2HOBA 1AMHA 4Y11E 4B74A 1DX5M 3RXOA 1YPJH 1LHEH 1MTVA 5CHAB 2BY9X 3MO3A 3EAJA 1SGFA 3LGUA 1O2TA 4GUXA 4CBOA 2R0KA 1V2LT 3BN9A 1Z86A 1P9SA 1YPEH 3ZRTA 3QZQA 5EPYA 2CSSA 1VCQA 1EAWA 2G5VA 2A2XH 2H9TH 4JORA 2VGCB 2JREA 1O2IA 1KXDA 1O3IA 1FPHH 1UM7A 2FE5A 2G55A 2Y5GA 1W9OA 4UE7H 1U38A 2IN2A 1WJLA 3CENA 4CRCA 4UD9H 8GCHF 1FXYA 1WU1A 5HEBA 1C5OH 1QB1A 5ETXA 1A4WH 1JMOH 2ZDKA 1IQEA 1O2UA 3GYLB 1FC6A 4AG2A 1THRH 1A1RA 4MNWA 1PDRA 1RZXA 2LNCA 2BQWB 4RKJB 4WVPE 1H8IH 3RXKA 2ZCHP 5AFZH 3PDVA 2BOKA 4ABJA 5JBTA 4IMZA 4JZIA 3BTDE 1T8NA 2AINA 1W2KH 2A4OA 1CT2E 4WY3A 1A5HA 1SGRE 3PS4A 1AGJA 4Y6DA 5HDYA 2J95A 1T8LA 1UEPA 3RC5A 3VGCC 1CBWB 2HNTE 3BTTE 4K1SA 2FS8A 1RTKA 2RCZA 1A7SA 4E7NA 1GMDG 2FMJA 3P8NA 2FX6A 3QTOH 2B8OH 2HRVA 2WPMS 3UREA 3A7WA 2BY8X 2ZDLA 3I29A 1V2KT 1HAVA 3TNSA 2Y81A 3U98H 1K1NA 1N6DA 4Q2NA 1ZJDA 3DUXH 3FZZA 1GHWH 2Q6DA 5ESBA 5PTPA 2OD3B 1OOKB 4O3TA 3KCGH 2BD7A 5LPRA 3PV5A 2R3UA 1XVOA 3MU5A 2LOBA 2FOGA 2H5CA 2Q1JA 1HAOH 2KG2A 5EXMA 4WXVA 3GY5A 1MCVA 2KJDA 1G9IE 1TPOA 2A2QH 1MU8B 3ZYDA 1V2PT 3BSQA 2J9NA 4EDJA 1ANCA 3NXPA 3SV6A 5E22A 4KTSA 2RA3A 4TY6A 2WV4A 1LPZB 4HFPB 1O2VA 1AWHB 5EW1H 3RC4A 3BTME 1QJ6B 1C5NH 2M0ZA 1L4DA 3ZZ9A 1SGEE 1W11U 2F0AA 2BOHB 2R9PA 1PPGE 1VCWA 4Q2PA 4CHAB 2SFAA 1HRTH 1K1LA 7ESTE 2AWWA 1OYTH 1LKAA 4K60A 4KGAA 4ZKNU 4XSKU 4NZLA 2QG1A 1MTWA 5C5NA 2P95A 2GV6A 2O9QA 2W26A 1RY4A 1T7CA 3OTJE 2BLVA 2YNBA 3Q77A 2KOMA 1C9TA 1DITH 4D9RA 2OSGA 2ANMH 2K20A 3KL6A 3A8AA 5FPSA 2PV9B 1UTNA 2BB4A 3ZVFA 2Q6FA 1A5GH 1H4WA 5EG4A 3RXLA 1QRZA 1QIXB 2BXTH 3I78A 2RA0A 1RGQA 4AN7A 1S85A 2XWBI 2WL7A 1FAKH 1BMNH 1GHVH 3LH1A 1PQ8A 3LNXA 2H2ZA 3ATIA 1JRSA 1F7ZA 1UVOA 2ASUB 3RXVA 2WYGA 1UVTH 1VJAU 1JRTA 3ELAH 4GCHG 1LVYA 2JH5D 1BZXE 4OGYA 1W13U 1T8MA 2A5KA 2BZAA 1GVZA 3U1IB 4LZ4B 1O0DH 1MKWK 1A3BH 5ABWA 1GCDA 3CBXA 3BTHE 2PUXB 1ZMNA 3AW0A 1TAWA 4K1TA 1NTEA 1T4UH 1O3LA 2ENOA 2LC6A 3UPEA 2VSVA 3MH7A 4AB8A 3OU0A 1FDPA 2KYLA 1VGCC 2THFB 2F3CE 3TSVA 1WV7H 1WTHD 2OCSA 1GJAB 4A1TA 2DLSA 4YLUA 4XOJA 2BVRH 1MBMA 6LPRA 2CF8H 3H7OA 2KJPA 1HV7A 1V2JT 2QXJA 1KXFA 5C1UA 5HXFA 1DICA 1Z7KA 3L33A 1S0QA 3CP7A 5B6LA 2GP9B 1X45A 2WYJA 1AWFH 1TMBH 4XE4A 1FV9A 3GY6A 3KZEA 1C1PA 4MTBA 1FJSA 2Q9VA 2DUCA 1GHYH 4NXRA 1H9IE 4X6PA 4NWKA 3CBZA 1TNGA 1O2RA 2FOHA 2JH6D 1UK3A 4NFEA 5GPIB 5H4IB 3ZZDA 1EZUC 2EDVA 5DP4A 3P92A 5EXLA 2D26C 4FU7A 2XXLA 1BB0B 1GL1A 1O34A 3URCA 1G9OA 5T3HA 4WMFA 1W7XH 2OLGA 2STBE 3RU4E 4H42U 1NU9A 2BYAX 5G1EA 4JYVH 2VRFA 2XNIA 4A6LA 1P11E 1O5GH 3GCHB 2IPHA 3SU0A 1FY3A 1THPB 2B9LA 5BPEA 1TX8A 3K9XB 1MMJN 3MNSA 1CA8B 1O3MA 5BRRE 1Y3UA 4ESTE 3W95A 1ZJKA 1WOFA 2V0BA 3MI4A 1VCPA 2F9UA 2SGQE 3D65E 4O97A 1ANBA 2D90A 1D3DB 2ZI2H 2ZU1A 1QAUA 3KN2A 4AGKA 1BTHH 4JYTA 3HK6B 1TABE 1GJ9B 1UTPA 1MTNC 1RFNA 5DP6A 1BJUA 1GMDF 1VITG 1W10U 1DFPA 2GZ9A 3TGIE 1HXEH 4KELA 1SQOA 2JWEA 2JETC 2P3TB 3LJOA 1PPFE 2DE8A 1Y5BT 2HE2A 3UR9A 1GI9B 1E0FD 3SJOA 2B0FA 5HETA 3TSZA 3B23B 3ZV8A 1GQ4A 2TIOA 4X2WA 3RLEA 5CHAC 1P8VC 2NU0E 3UIRA 1O3EA 1ETRH 1DT2A 5GJ4B 4NMPA 1MTSA 3GICB 1GBBA 5JBCS 5HEYA 4YOJA 4DT7B 4Y10E 4JZEH 4H11A 1THSH 2QXHA 3SJIA 1ZOKA 4WWYA 4WJG2 1P04A 1QL8A 1UM1A 1L1JA 2VGCC 3FVFB 4X1PU 4A7IB 2IWQA 1BA8B 1KLJH 1ZHPA 4TWYA 1C1NA 4KTUA 3GY2A 2ZFTA 4SGBE 2C8XB 3P70B 1F0SA 2ZHWH 4THNH 1XXFA 2M3MA 3ZZCA 3V12A 1XUHA 1QTFA 1CHOG 2BDYA 3SUEA 1OBYA 4CH8B 5HYOA 4DURA 1FIZA 2RG3A 1AE5A 1SOTA 5HM2A 1EATA 5JB9S 1Y5UT 1IOEA 1SGIB 3PTBA 3TJOA 3ID3A 1GJ6A 1BDAA 2QV1A 1Z8RA 1N6EA 4VGCB 1TGSZ 4JOFA 5HJ1A 5DP8A 1P03A 4E35A 3RXIA 4I31A 3RUOA 1EAIA 5DK1A 2BLQA 1HDTH 1N99A 2ZTZA 1WFGA 2KJKA 4NMRA 2ZEBA 2W7SA 1BTWA 4BAHB 1BRAA 2L4TA 1BRUP 3KGPA 1QGFA 1OP0A 3ZVGA 5FXLA 1CBWC 2ZKSA 3D62A 3KQDA 2BDBA 2ZP0H 2AIPA 1GI0A 1DY9A 4K72A 4NNLA 1IU2A 3RM0H 2ODQA 2I1NA 1SOZA 4ABFA 1QA7A 2ZTYA 2OPGA 2O8UA 3BV9B 3E0NB 5E1YA 3AXAA 4K75A 4GCHF 2PW8H 4GHTA 1O3PB 1TE0A 3EA8A 2GDEH 4FUFA 3QZRA 3LU9B 1Y7NA 1GMCG 4OS5A 1XXDA 1EPTB 5FB8C 1ZSJA 3LGTA 1BIOA 4TPIZ 3F9HA 1FIWA 1ZZZA 1CGHA 1IQMA 1U37A 3SUDA 5HMAA 4NMOA 1GI1A 3TVJB 4YT6H 3Q00A 5G4BA 1P0SH 3B8JA 3SJ8A 3M5NA 2ZFPH 2REYA 1OWKA 1O33A 2VJ1A 1EQ9A 4O9VA 3SUGA 1OX1A 3D23A 2PA1A 3SU5A 5K0HA 1OKXA 3O8DA 1J9CH 2Z9GA 2FOCA 1AD8H 1CSOE 1IHTH 3BG4B 4CHAC 1O3GA 2CF9H 1Y59T 3PWCA 1CA0B 3RXAA 3AAVA 1EASA 2A7CA 1WQSA 3QK1A 2ZA5A 2IWPA 5HGGA 3NPSA 1LKBA 2HGTH 3LDXH 1GPZA 3I77A 3GSLA 1WYKA 1S6HA 2DKRA 1I92A 1C5PA 1DE7H 1AN1E 1Y3WA 4J1YA 1P05A 2BY6X 4ZUHA 4AZ2B 4YDPA 4U2WA 1MZDA 4E05H 1SHYA 4AFQA 2QF0A 2R4HA 1PQAA 3B76A 2VVCA 4NMVA 2EEHA 5H3JA 2GTBA 2PHBA 1C1OA 3MU0A 2WPLS 2H9HA 2PTNA 1QR3E 4KFVA 1AFEH 1FMGA 3EA7A 3KIDU 1BHXB 3FANA 1FC7A 3L4FD 3I18A 1P2KA 1V6DA 2EDZA 3UUZA 4AFSA 1QA0A 1YCPK 4O06A 4KTCA 1Y8TA 2OINA 2ZDAH 1O5BB 1YF4A 4X8SH 3ZVDA 1BMLA 1RJXB 3TGJE 2BQ7B 1Y5AT 3LGVA 1WIFA 6GCHG 1C9PA 5AFYH 2FYRA 4UU6A 4IGDA 5EW2H 1AI8H 1MZAA 1O2QA 2EEJA 1ETTH 3L6PA 1Z1IA 2AH4X 4Y7AA 2R0LA 4FVDA 3SQEE 1X6DA 1VITF 3SV2H 2OGPA 4LXBH 1SGYE 2HPPH 2F9VA 4NA9H 1A46H 4CREA 4INLA 1NRPH 1CGJE 1P12E 3R0FA 4FUBA 2B7DH 3VB5A 4ABDA 3WKMA 3M37A 1JWTA 1O3OA 3VEQB 1B7XB 3BTFE 1RTFB 4RSPA 3SHWA 2ZU4A 1F5KU 2BLOA 3PTNA 3HVQC 3CS7A 1TPPA 3RXHA 1O2XA 3M7QA 1WSSH 4X2YA 2Z3DA 4LOYH 4FXGH 2C8ZB 1UTQA 1UCYH 2PLXA 1NS3A 3PMJA 3CS0A 1DS2E 2I6QA 3DA9B 5E0HA 3RMMH 3QN7A 4DOQA 2J94A 4UFGH 3K82A 2AMQA 3TH4H 1DPOA 5EOKA 5DGJA 1G3CA 1AHTH 2BD2A 4I7YH 2XBYA 3BIUH 1C5RA 2F83A 1AB9B 1XMNB 2HALA 4P2AB 4OGXA 2H2CA 1P57B 4D9QA 1AZZA 3SGQE 2XCNA 4WH8A 1GJ8B 4KP0A 4X6NA 1CHOF 4Y8ZA 1L2EA 1EZSC 2CGAA 1RS0A 2QT5A 3KZDA 3S9AA 1MUEB 3GCHC 3A88A 5HFBA 3DJAA 4FUJA 2Z9LA 3SI4H 4KKDA 3SNBA 1SLWB 2H6MA 3OSYA 2SGAA 3SV7A 1WHAA 1P2NA 2JINA 1ELFA 4Q2OA 4O3UA 4ABIA 5I25A 3RXBA 1NT1A 1OWHA 2EC9H 2PWXA 2JXOA 2ZGXH 1EPTA 1SFIA 2H9EH 1HAPH 5HFEA 1ELTA 3M3TA 2PNTA 4YOIA 4Y8YA 5F6MA 4FU8A 2XYAA 1W12U 4WXIA 3SQHE 4TWWA 2ZCKP 4YZUA 1SLVB 5LH8A 5AHGH 2VSPA 4OS4A 3SU6A 1OP8A 1ESTA 2VVVA 4U30A 1TP5A 1W8BH 1K1PA 2GZ7A 5FX5A 3UQOA 3WY8A 1GMCF 1QY6A 3ENSB 5ESTE 3QWCH 2VWRA 3F6UH 1DDJA 4HOPB 1UVUH 1PPZA 3BEFB 5A2MH 4JZFH 4Y8XA 2BD3A 1SGDE 1HIAB 5EPNA 2ESTE 2QF3A 1AIXH 1SGCA 2EI8A 1B5GH 1FPCH 2Y6TA 2GVFA 2XBVA 1PPBH 1LCYA 2ZFRH 1BBRK 3A7ZA 3TIUA 1J8AA 3RXMA 3RXTA 4D8NA 2FI3E 3E91A 1AE8H 4P0CA 1FY5A 2PGQB 4SGAE 1CE5A 2ZGHA 3PWBA 1EKBB 3IITA 1O2OA 5GNDA 3TLOA 3TNTA 5F3XA 1TGCA 5DP3A 1XKBC 1SPJA 1CVWH 1SLXB 3MTYA 1C1UH 2OC1A 5J4SA 2TBSA 2ZG0H 4K8BA 3S0NA 2IOTA 3QUMP 1GBIA 4WF8A 4Q2QA 4B76A 1AY6H 3PB1E 3RMLH 1CQQA 2IJOB 1MFGA 1RTLA 4WYTA 1Q3PA 1UCYE 1WQVH 4XBBA 1UVSH 2GZVA 4Y79A 4VGCC 1Z71A 4JL7A 2ZF0H 9ESTA 3TJUA 3ZZ4A 3F9EA 1SLUB 2Z6BD 4OS2A 3ZYEA 1WH1A 2I6SA 4BANB 1NFUA 3RXDA 4ASHA 1T8OA 1L6OA 3SNEA 4IMQA 1ORFA 5FX6A 2ZQ2A 2P3WA 1DY8A 2AWUA 2FODA 3GY4A 1BUIA 3SN8A 1GVLA 1J15A 1QJ1B 4MVNA 1ZGVA 3SHCH 3QLPH 3QDOA 2AS9A 3UY9A 3R68A 2BYGA 2G5MB 1BRBE 3TK5A 2UUYA 5A0BA 1HJ8A 1EPTC 2FZZA 3VXEH 3VXFH 5JYIA 2ZHDA 2QN5T 4ISHH 2VIQA 1C1VH 4HTCH 1DVAH 4OEOA 3ID2A 1O5DH 2BDGA 1AKSB 2V3OH 3PLBA 4YM9A 2YT8A 1ANDA 3P8FA 4XBCA 1CT0E 2ZHQH 2UUJB 1TX6A 5EGMA 5F67A 1C5MD 1UF1A 1V2TT 1GI3A 4BTIB 2V6NA 1AU8A 2YUYA 5DP5A 1KXAA 2EAQA 2I4SA 1PQ5A 1FQ3A 5T6DA 1C2FA 2GMTB 1K1OA 1SR5C 4K5ZA 2EA3A 1O3KA 1IQJA 1WI2A 3ZZ6A 1HAYB 1WBGB 1PPCE 3BG4C 4MG3A 5FBIA 4X1RU 3K6ZA 1NRNH 1H9HE 1CA0C 2OQ5A 3WKLA 3A84A 3DJ3A 1TB6H 2FIRH 1C5ZB 3GCTG 3R3GB 1BCUH 1UTOA 3AW1A 5IYTA 1XKAC 2KAWA 2B5TB 3LNYA 1DOJA 1BTUA 6CHAB 2I6VA 1UTJA 1KWAA 2BVXH 1SVPA 2OCVB 1OBXA 5C3NA 4BAKB 4Q3HA 1A3EH 5J4QA 1W9EA 3DFJA 4OS6A 3RXFA 1V6BA 5JPMH 2FWWA 1Q7XA 2O8LA 3M3SA 5GIBA 2KV8A 3MMGA 2ZGJA 1DLKB 3E6PH 3U8OH 1TPSA 2O8MA 4ABHA 1TNIA 2DJTA 1TQ7B 3SI3H 4Q6SA 3BPUA 1V2OT 1KXEA 1UJUA 5JB8S 3BTGE 4QT8C 5EXNA 2EEIA 3TH3H 4FUHA 4Y71A 1V2WT 2PKUA 1RRKA 3KQCA 2PDZA 2W7RA 3FP6E 2A45B 2JH0D 3LGIA 1DLEA 3OY6U 1X5QA 1FONA 2FI5E 4HOPA 1S84A 3TPIZ 4OEPA 3SOEA 2OQUA 2W3IA 1F5LA 2ZCLP 3V13A 3OX7U 1HIAA 3GISB 5F8XA 2BY5X 1V2ST 1UJVA 4M7GA 1MAYA 1PYTD 2HNTF 4G69A 1V2VT 2GDDA 2QGRA 2C8YB 2FS9A 4HGCA 4NXQA 1C2LA 4PQWA 4CH2B 2PFEA 2VINA 4NWLA 3FAOA 3CYYA 1KLIH 1Z6EA 3H5CB 3OTPA 1A0LA 2Y5FA 1CHGA 4K76A 2TRMA 2FOMB 1D9IA 1F5RA 2PKAB 3T25A 1S81A 2NWNA 4ISLA 3M5MA 3S7KB 2LPRA 2FP7B 1P1DA 2ZNKH 2GCTB 5E2OA 3SUFA 2WUBA 2GX4A 3A8DA 3BTQE 4B73A 3TMHA 2EGOA 1XUGA 1G32B 3MH6A 5EODA 2CHAB 4DG4A 4XBDA 1O2GH 3SO3A 1LQEA 2ZGBH 3SJ9A 1B0FA 5I7ZA 1AB9C 1GJCB 2G00A 3MU1A 1XUJA 3SNDA 4A5TS 2SGEE 7GCHG 1HCGA 2AMDA 6ESTA 1TGBA 1O2SA 2QC2A 3JZ2B 4BAQB 3BIVH 2GCHG 1OPHB 3M5OA 2D8IA 3RC6A 1UTKA 4FGMA 1UVPA 2Z3CA 1MAXA 3M7TA 2RDLA 1G36A 1XUKA 4TYDA 3HKIB 2EI7A 4J2YB 4YO9A 4TPYA 3T28A 1YLCA 1B8QA 5L2YH 1C5XB 2PUQH 3SNCA 3VFEA 4X1QU 1QRWA 4Z0KA 2A1DB 1JOUB 2Z9JA 4NA7A 4I32A 1O2HA 1T31A 1WAYB 3ZV9A 3FP8E 2O2TA 4DCDA 3RXSA 2DMZA 1M5ZA 1AKSA 1V5LA 1N7EA 5E0GA 1HAGE 1ZGIA 1EP5A 1TOMH 1C2MA 2GT7A 1ZMJA 2O8TA 1WHDA 4R8TB 1GI7B 3TITA 1ZLRA 1SGFG 3ZVBA 1SI5H 3EGKH 1G3EA 3LOXA 3ZZ8A 2HVXA 3LT3A 1FY8E 4RI0A 2YT7A 3GY8A 2DB5A 1YCPH 3LC5A 1YPMH 4O03A 1O5AB 1OWEA 2HWLB 1QQ4A 1WF7A 5HFCA 1NPMA 5FPTA 1O3HA 1GI2A 1O5EH 1DSUA 4ZMAH 3IWMA 3T26A 1LDTT 1UEWA 2YUBA 1GBDA 1S0RA 1EP6A 1GCTB 1GHBG 1G3DA 3A8CA 1GDUA 1TX7A 1SFQB 1OYQA 1XUIA 3EDXB 3S9CA 1SGTA 1QB9A 4Q7ZA 4MDSA 1BQYA 1OWJA 1YLDA 4Z6AH 1TNKA 1XUFA 5SGAE 2M0UA 4AX9H 4X8VH 3RXPA 4AB9A 3M3VA 1HYLA 1MBQA 1V3XA 1G37A 3GCTF 4N6XA 1C4U2 1KXCA 5LPEA 3I4WA 3F9GA 2OMJA 2M0VA 4Y7BA 1FC9A 3TU7H 2GKVE 3V7TA 4Q7YA 2VWLA 9LPRA 4IW4E 1AFQB 5GXPA 1ID5H 2EI6A 2ANKH 1TFXA 1GJBB 3GYMA 1UEQA 5HEDA 4ISNA 1GBHA 5HM9A 1MKXK 5FPYA 1EOLA 3A82A 1LVOA 1SB1H 1A2CH 2HPQH 2J4IA 4MNVA 4HI3A 2UWOA 3ZZ5A 4NIWA 3ZZ7A 4GVUA 1FUJA 4MQAA 2VIPA 1P02A 4I8GA 1K1MA 2WUCA 5D13A 4JOHA 4YOGA 3VB7A 3ZZBA 3NFKA 1O36A 2WPKS 2OZFA 1PPEE 2QIQA 3RU4T 2ZTXA 2VH6A 3GY3A 3MU4A 3E3TA 2FXRA 4JYUH 1ZTJA 1ZPBA 1KLTA 2BD9A 4JK6A 1D3QB 1QCPA 2A4QA 1NRQH 4E3BA 4UU5A 4X0WU 5TCAA 1O37A 1EB1H 3T62A 2PKAA 3GJ9A 1TGNA 1QBNA 4FVBA 1AO5A 1A0HB 1HBTH 2F91A 1HLTH 1EUFA 3RXQA 2BLWA 5C2ZA 1ZSKA 5DP9A 3RMNH 4K1EA 4Q6HA 4NFFA 2ZU3A 4ZHMU 5F8ZA 3KQBA 3STIA 1LPGB 2XBXA 1I16A 1Z87A 2GMTC 5DP7A 4IC6A 1IHSH 1AQ7A 2EGNA 3H7TA 2JIKA 2C3SA 2KPLA 3LC3A 2VZ5A 4JZ1A 1GHAG 4E06H 7LPRA 4YYXA 2VIVA 1F92A 4CRGA 4R0IA 3NZIA 2AEIH 4BNRA 2BXUH 1VJ6A 1VA8A 1C1QA 1UHPA 4IC5A 4ISIH 2QXGA 4E7RG 3Q3KA 2BM2A 4MLFB 3VB3A 1UHBB 2DE9A 2F5YA 1XM1A 4UFEH 3NFLA 1IHJA 3EGHC 3QE1A 3HPTB 3V3MA 2QXIA 1P09A 6CHAC 2QAAA 1QL9A 1C1MA 1OWDA 2OC7A 2Y5HA 2UUKB 4X6OA 1Q3XA 1ZHMA 4NMSA 1FI8A 3U8TH 2CS5A 3RL7A 1BBRH 1QAVB 1UO6A 1ELCA 2V3HH 1O2KA 3Q3YA 1F0RA 4NSYA 2P3FH 2NU3E 3SUZA 5C1YA 8GCHG 3PLKA 5L6NH 4JK5A 3NWUA 5FCRA 1S83A 1HGTH 2QCYA 3EA9A 4MNXA 2FCFA 1TGTA 2KOHA 1FN6A 3O8BA 2VH0A 1V2NT 1JIRA 4DY7B 1VAEA 2A0QB 4NZQA 5CMXH 3P6ZB 1FCFA 3K2UA 1O3AA 1FAXA 1OP2A 3RXUA 4DIHH 2H3LA 2E7KA 1D3PB 2PSXA 3AAUA 1KEFA 3E90B 1TOCB 1DWCH 4Y0ZE 2LA8A 4Y76A 2FESH 3A80A 2EXGA 1WFVA 3GY7A 4JOEA 1F2SE 3QGLA 3BTEE 1H1BA 1TNHA 3HGNA 4X1SU 2F9NA 2G52A 2K1QA 1BOQA 2WPHS 1NFYA 2STAE 3VQFA 3KHVA 4ZROA 1K28D 1H9LB 4NXPA 3MNXA 1P2JA 4XFQA 3UOPA 2BD5A 2VIWA 3BG8A 3ZZ3A 1GL0E 3P17H 3A81A 3K6YA 4ISOA 1DWEH 2V1WA 3E16B 2A4RA 1M9UA 4A1XA
chains in the Genus database with same CATH superfamily
4I8KA 1V2QT 1ARBA 1Q2WA 1KTTB 5C67A 1ACBE 4X8TH 2TPIZ 3TSWA 1FY1A 3O46A 4U01A 3SU4A 1FN8A 1P2QA 1GI5A 2TGDA 3MWIU 1UEZA 2H5DA 1C2KA 1YPHC 3A87A 1GJ4H 3MH5A 1P3CA 4ZKRU 3SV8A 2GZ8A 2AMPA 1LPKB 2GCTC 2P93A 3QO6A 4JOGA 4NCYA 2BMGB 3SU1A 1GHBF 1WDIA 5E8EH 4GAWA 2JOAA 3V0XA 1C5YB 3M36A 1MU6B 1TRNA 2CHAC 4JOJA 1SBWA 1J14A 2KR7A 2UUFB 1ZPCA 3UAIC 3O8CA 2FOAA 1A5IA 1QLCA 1P06A 2SGDE 2RRMA 3AASA 4JMYA 1UTMA 3K50A 2ZPRA 1O3FA 2R2WU 1C1WH 1NM6A 3PDZA 1KY9A 1SGNE 4ZHLU 1BMAA 1GBEA 1GQ5A 1P2MA 3HPKA 3NCLA 4AORA 3B9FH 3OE7D 1X7AC 1C4Y2 5A0AE 1QQUA 3RL8A 2YOLA 2AWXA 3CBYA 2QYIA 4ZXXH 1W14U 2P8OB 1K32A 3GGEA 1G3BA 2CXVA 3JXTA 1C2DA 1EX3A 1HAZB 3KEEA 5HKKD 3LH3A 4MPUA 5T6GA 2VWMA 2OXSA 1GBCA 1OXGA 4IN1A 1HPGA 5T6FA 4YT7H 2GJGA 2GGVB 2FI4E 2FLBH 3A8BA 3UWIA 4Q7XA 4Y0YE 1TONA 4WYUA 1BT7A 1BFEA 1GBMA 3PO1B 5HFDA 2JJ2D 5LGOA 1GDNA 4X2XA 2WINI 2ZPSA 4X8UH 1Z1JA 1UMAH 1K9OE 2Z7FE 5HFFA 2ZZUH 2LUIA 1O2MA 2BD8A 2ZGCA 1GJ5H 1QBOA 3CC0A 2BY7X 5DO4H 1G2MA 1TBZH 3F1SB 1IQHA 1LTOA 1HJ9A 3FP7E 1IQKA 3SV9A 2UWLA 4BTTB 1E36B 3VB4A 4F4OC 5AF9H 1V2UT 4FUDA 3PRDA 4LZ1H 2TGTA 3SU2A 2C8WB 3R0HA 1C5SA 1R6JA 1YKTA 1MCTA 4NMQA 1UHBA 4Q2KA 1GCTC 1IAUA 3O8RA 1O2WA 3N7EA 1SC8U 3S69A 4RN6A 2LC7A 1EJAA 1YGCH 2BHGA 4MNYA 1ZHRA 1MKWH 2JILA 1EZXC 5GWZA 1HJAB 1RIWB 1BTZA 1L4ZA 1RXPA 1GHAF 1K21H 2F9BH 5C5OA 1WF8A 4DW2U 1QAVA 1SMFE 4ZCNA 1ZR0A 1GBKA 1UFXA 4OS1A 4NMTA 4ABGA 2KPKA 1ZSLA 4DIIH 2VU8E 4Q63A 7KMEH 1FNIA 1P3EA 3RDZA 2X7ZA 3RU4D 2PGBB 5FHTA 2PTCE 5DG6A 4B71A 5L30H 1INCA 1TBQH 1WTGH 1YBWA 4A92A 1ZYOA 3ZZAA 2QF4A 1AFQC 2J98A 2BZ6H 1EJNA 1HAIH 4MPAA 4MPXA 3ATLA 4ZXYH 2XTTB 4I33A 3TGKE 3STJA 3QJNA 1FLEE 1D3TB 4DGJA 2ZECA 5CDFE 1UJDA 1XZ9A 1EAUA 1Z8JB 5EU8A 2LELA 1DM4B 4FUIA 1SQTA 1Z8IB 1IQNA 1UK2A 2VNTA 3W94A 2AERH 3E0PB 2MX6A 5G1DA 2ILNA 1O31A 4WMDA 3WWFA 3UNRA 1RD3B 2D2DA 3RXCA 1GBFA 4H4FA 3UTUH 1C4V2 4ABEA 3M5LA 5A09A 2M2AA 1D6RA 1TRMA 3KNXA 1WUNH 5CE1A 1YC0A 1ARCA 1C5VA 2XBWA 5F53A 1O3JA 2RCEA 1LMWB 4ABAA 1BJVA 4CRBA 1O30A 3UOUA 4ACAA 3MYWA 6GCHF 3S9BA 5A8XA 3EYDA 1ELGA 5DKMA 5B6OA 2WV5A 1NBMD 2Q6GA 5TCCA 1SGPE 5EQRA 3MHWU 3A85A 1NROH 1D5GA 4D7GA 1TLDA 1UTLM 1W0ZU 1G30B 2ODPA 2VPHA 2PKSB 4JZDH 2EGKA 2R3YA 5K7RA 2OBQA 1UK4A 1KSNA 1W3CA 4BTUB 1DANH 1WCZA 2WPDD 1UCYK 5C20A 3EGGC 2QY0B 4FUCA 4AFZA 1SHHB 1N1LA 1ELAA 2FO9A 1C2EA 3A86A 2L97A 3SJKA 4AMHA 4JCNA 1SG8B 1ZUBA 1EXFA 3DFLA 2FOBA 1PJPA 3PMBB 1K2I1 4BXWA 4OM9A 4UONA 4F8KA 1C2JA 2M0TA 1Z8GA 2Z3EA 3Q76A 5FCKA 1OZIA 1MH0A 2WPIS 1S6LA 1EB2A 4U32A 5E2PA 4INHA 2KZ4A 1VR1H 1WI4A 2XC4A 2ZDMA 2L4SA 1W0JD 1ANEA 3TK9A 1MTUA 1GGDB 1O2LA 5E11A 2CJIA 4R2ZA 1ELEE 2OC8A 1O5CB 2Y7ZA 1C5QA 4B75A 2F9OA 1ELBA 3ESTA 1AVWA 1GI6A 3N7OA 2YNAA 5B42A 4LK4A 2SNVA 2XC5A 3DD2H 1YPHE 4REYA 5E6PB 1G2LA 3TK6A 2G4UA 2O8WA 1SKYE 4LMMA 2CSJA 1NRRH 2FTMA 1MD8A 2GV7A 2OP9A 2UZCA 3FO8D 1N6YA 3U8RH 4Z33A 3P95A 1O3CA 1QRXA 1IQGA 2KQFA 3LGWA 4ACBA 3FZDA 1BMMH 4DJZB 3SNAA 4B2AA 1PYTC 2A7HA 1SL3A 4HZHA 1QURH 1MKXH 2ULLA 1IQFA 3PYHA 5EJZA 3QGJA 2EEGA 1O38A 3PROA 5GLJA 1C5WB 1NRSH 2DLUA 2BDCA 4GVCA 2VWOA 5DJ7A 2BQ6B 3HATH 2W5EA 4ZKOU 2I04A 1Y3XA 1AUJA 3ID1A 3A7XA 1DUEA 2ODYB 3ATKA 3M7UA 2G81E 4NNMA 1O3DA 3N7DA 3ITIA 3F9FA 2BX4A 1OSSA 2FNEA 2Q3GA 2QBWA 4K2YA 1GM1A 1QB6A 2CN0H 1LQDB 3SZNA 1O2JA 2XW9A 3A7YA 1ABIH 5FBEA 1C5LH 3DIWA 3U28C 1GMHG 1N7FA 2G8TA 1OWIA 2QA9E 3A83A 1XVMA 1Z6JH 4BAOB 1IQIA 1N8OB 1BRCE 2OBOA 1HAXB 4K6YA 4K69A 3OEHD 1C5UA 1NY22 1QJ7B 3GDUA 4ABBA 2H1UA 2ZIQH 1ZTKA 3ZVCA 4ZKSU 2BTCE 1T2MA 1C2GA 1UJ1A 1TBRH 1TNLA 2W7UA 4K3JA 3UNSA 1ZTLA 4RKOB 4A1VA 4TY7A 4AYYB 1TNJA 5A2PA 2ZPLA 1D4PB 1K1IA 3ODDA 2ZPQA 2EHRA 1UITA 4FU9A 1ELDE 2WV9A 1HXFH 3UB0A 3RM2H 2Z17A 2Z9KA 3AVZA 2XRCA 2XWAA 1A0JA 2C90B 2M5TA 1EOJA 1S5SA 3MU8A 4AYVB 3A7TA 1GHZA 1GI8B 1V2MT 4OAJA 3SHAH 3GDVA 5DN6D 2P8OC 1FY4A 2ZDNA 4GVDA 1W0YH 1ZRBA 2FTLE 1VITH 1YPLH 4UEHH 1DUAA 3UNQA 4JOKA 1QFKH 2P94A 3OFND 3M35A 2SGPE 1OS8A 1NTPA 2FOFA 5GCHG 5FL7D 3PV2A 1TALA 1YP9A 3TJNA 1PQ7A 2QF5A 4CRFA 2BDHA 4IN2A 3VB6A 1H8DH 2NU1E 3LIWA 5AVDA 3PO1C 1TA6A 3S7HB 2I0IA 1GHXH 3QTVH 4YTAA 3KF2A 1JBUH 2Y80A 1LVBA 2P59A 3SBKA 5HF4A 1RGWA 1JXPA 3DT0H 1NFWA 3C1KA 1FZZA 1KXBA 2W3KA 2WHXA 3QGNB 4B2CA 4X2VA 2YTWA 1YYY1 1GG6C 2ZHEH 1P2OA 3F3BA 3MNBA 2D92A 3HKJB 3IG6B 1O2PA 2KX4A 2A5AA 2G51A 3OYPA 1ZMLA 1OBZA 1TQ0B 4AGJA 3VG8A 2A32A 3LKWA 5JBAS 3T27A 3C27B 3RXRA 2FN5A 2V35A 3RLYH 1U6QA 2K1ZA 5EQQA 1P1EA 2CV3A 1X5NA 2QKTA 3QIKA 4YLQH 3H09A 5KGOA 4FUEA 3ODFA 1HJAC 1RIWC 4FUGA 3T29A 2WPJS 3HK3B 1A61H 3VPKA 1TRYA 1GWAA 3TJVA 4BXSA 3RP2A 3GCOA 1GBJA 2XCFA 1EAXA 2ZQ1A 3OY5U 3K65B 1PPHE 2VWNA 2AYWA 3GOVB 2A4GA 1NU7B 1T32A 1Q3OA 5FAHA 2C4FH 3SFJA 2A5IA 3E8LA 4Q80A 3MO6A 1E35B 4XDEA 1MABB 2VVUA 5JBBS 3TH2H 5HF1A 3UFAA 1CT4E 1AVXA 2OK5A 1YPKH 2AGIX 5C1XA 3EE0B 3DJ1A 1O35A 1ABJH 1GI4A 3R69A 2G5NA 4I8HA 4GHNA 2OTVA 2ZDVH 4GLYA 4NIYA 3M61U 3MH4A 3LONA 3E1XB 1O32A 2BX3A 3GDSA 2PZDA 2KL1A 2C93B 1YCPM 3UWJH 2OS6A 4IS5A 1BTXA 1DXPA 4JOPA 1KDQB 2AGEX 3BEUA 2FX4A 2EDPA 2VIOA 2EEKA 2SNWA 2NU4E 3EQ0H 4CBNA 1C2IA 2KAIB 4K8YA 1YBOA 3ATWA 2UWPA 5DTHA 3NKKA 3DHKH 1Q31A 3SGBE 1GBTA 3MNCA 1QNJA 4TT3D 1H8HD 3SU3A 3F0PA 3U1JB 4H6TA 1BE9A 3DORA 3NCVA 1P9UA 1J17T 1HAHH 4L8NA 3QJMA 3ZVAA 3VGCB 1MFLA 1SGQE 2BDIA 2PKSC 3I1EA 2FOEA 2WSSD 4FOUC 1U39A 1YM0A 5A0CA 1DWDH 2EJYA 2CMYA 2NU2E 3LGYA 2R2MB 5F03A 1O2NA 1VJ9U 4H6SB 1F0TA 1NESE 1TYNA 3QDZB 1ZPZA 1GJ7B 2D8WA 2ANYA 5DSFA 3T2NA 5EYZA 1C2HA 3BEIB 2EV8A 4NA8A 3L3TA 3BF6H 3UR6A 3NK8A 3MFJA 1O3NA 2ZPMA 1WXRA 2KOJA 1ETSH 1N6XA 1P01A 1MQ5A 1TPAE 2I0LA 1GMHF 2J97A 3NUMA 4ZHAA 1VB7A 1GJDB 3PMHB 2H2BA 3RLWH 2IWOA 2G2LA 1IQLA 1BTPA 3G01A 3LPRA 1MQ6A 1LHDH 4KFWA 3U9AH 2QKVA 3FY5A 5DPAA 1L0ZA 2V90A 3P8OA 2ALVA 4CR5A 1GGDC 4AOQA 1UW7A 1B0EA 1HNEE 3CH8A 4BOHA 4I8LA 2OUAA 7GCHF 1LHFH 1TWXB 1N7TA 1PFXC 1ELVA 3T5FH 3ZIAD 2HNTC 1COWD 5C17A 2FLRH 1GVKB 2GCHF 2JKHA 3A89A 1HUTH 2Y7XA 5E0JA 4B6EA 1C5TA 3PLPA 4D7FA 1EZQA 1JIMA 2Z9IA 1LVMA 1YWUA 2MHOA 1S82A 5KEDA 1TP3A 1V1TA 1DXWA 3RXEA 3HPMA 1V62A 2ALPA 1ZOMA 3FFGA 1MC7A 1KTSB 1SQAA 1U3BA 4FETA 3DSGA 3D49H 2HLDD 3SHUA 4WH6A 2ZO3H 2VIDA 5GCHF 4MPWA 1ZRKA 1NC6A 2BVSH 3GCNA 1TIOA 4NIVA 8LPRA 3K1RA 1DSTA 2KRGA 1O2ZA 4B2BA 2KBSA 2DM8A 2KA9A 1Y3VA 1C1SA 4AG1A 1J16A 1X8SA 2J2UA 3BTKE 1E37B 1TMUH 3PMAB 2J92A 1K22H 2D1JA 2PR3A 1NN6A 2A31A 2FDAA 1C1TA 1P2IA 4I8JA 1BITA 2GT8A 2W4FA 2F9PA 8ESTE 2PSYA 1QBVH 4X1NU 2ZHFH 3N99A 5A8YA 5LPFA 1O2YA 1S6FA 4Z8JA 1C1RA 4YESB 1P10A 8KME2 3PM3A 1AUTC 1LHGH 1YPGH 3Q3XA 2DC2A 1CGIE 2ZU5A 2GD4B 1VZQH 4OS7A 1CO7E 3RMOH 2FYQA 4E34A 1SQRA 2V3MA 1GBAA 4NG9H 1W9QA 1BTYA 1O5FH 3NGHA 1Y3YA 1GBLA 5TJXA 3ZZBA 1N8OC 4NSVA 1BHXF 1ESAA 4PROA 3SW2B 4UDWH 3E17A 5JXBA 1NO9H 1V2RT 4D76A 1HAVB 1CU1A 2ZU2A 1VGCB 2LP6A 4ZH8A 1TMTH 2BD4A 1LO6A 3ID4A 1D6WA 4UFDH 3ZVEA 2HLCA 2AFQB 1L1NA 2ZFSA 3F68H 3A7VA 5CHBA 3SGAE 4CRDA 1E34B 1E38B 1GDQA 1QHRB 1NFXA 1QL7A 1TQ3A 4B1TA 1RGRA 2OQSA 1KYNA 4GSOA 3SORA 3EE7A 2Z94A 2P3UB 5JDUB 2FM2A 2HE4A 3KQEA 5F8TA 2VB0A 1O39A 2H3MA 1N6FA 1NZQH 1NF3C 4X6MA 1EJMA 1KDQA 5A8ZA 2TGPZ 1T4VH 4F49A 4XD7D 2W6ID 1TA2A 3KHFA 4UFFH 1KIGH 2KAIA 2ZFFH 1XX9A 1X5RA 1AVGH 4IBLH 4WMEA 2J34A 4GPGA 2ZWLH 3MQKC 2KCYA 5C94A 4DVAU 1WG6A 1QZ8A 1W7GH 1MD7A 5GDSH 2XC0A 1ESBA 3HGPA 3FKSD 1V5QA 4GHQA 2Y82A 2OC0A 5E21A 5EZ0A 2AGGX 2PKTA 3QX5H 1BBRE 2FEQH 4ZAEA 5EQSA 4K78A 1AZ8A 4MPVA 1LHCH 3LJJA 1HFDA 1IU0A 3URDA 2G4TA 4AFUA 3JZ1B 4XHVA 2P16A 3MOCA 4NGAH 5I46H 2ANWA 1L1GA 5IDKA 2HGAA 3ATMA 1GG6B 1K1JA 1DWBH 1F0UA 2FPZA 1HB0B 3RXJA 3RXGA 2BDAA 1O3BA 3O5NA 3SOSA 4CRAA 3GABA 3MO9A 2VBCA 1MTNB 2AIQA 4BAMB 3P8GA 2DAZA 4CR9A 2IWNA 3VQGA 1SSXA 5IK2D 3BTWE 3U69H 2TGAA 2ZC9H 2QKUA 2ZFQH 4INKA 2JETB 5L2ZH 3UQVA 2A7JA 2J38A 2M10A 2SGFE 4NIXA 3PV4A 2HOBA 1AMHA 4Y11E 4B74A 1DX5M 3RXOA 1YPJH 3SZEA 1LHEH 1MTVA 5CHAB 2BY9X 3MO3A 2L6OA 3EAJA 5HIZA 1SGFA 3LGUA 1O2TA 4GUXA 4CBOA 2R0KA 1V2LT 3BN9A 1Z86A 1P9SA 1YPEH 3ZRTA 3QZQA 5EPYA 2CSSA 1VCQA 1EAWA 2G5VA 2A2XH 2H9TH 4JORA 2VGCB 2JREA 1O2IA 1KXDA 1O3IA 1FPHH 4F48B 1UM7A 2FE5A 2G55A 2Y5GA 1W9OA 4UE7H 1U38A 2IN2A 1WJLA 2IJD1 3CENA 4CRCA 4UD9H 8GCHF 1FXYA 1WU1A 5HEBA 1C5OH 1QB1A 5ETXA 1A4WH 1JMOH 2ZDKA 1IQEA 1O2UA 3GYLB 3F2GA 2EY4C 1FC6A 4AG2A 1THRH 1A1RA 4MNWA 4RT1A 1PDRA 1RZXA 2LNCA 2BQWB 4RKJB 4WVPE 1H8IH 3RXKA 2ZCHP 5AFZH 3PDVA 2BOKA 4ABJA 5JBTA 4IMZA 4JZIA 3BTDE 1T8NA 2AINA 1W2KH 2A4OA 1CT2E 4WY3A 1A5HA 1SGRE 3PS4A 1AGJA 4Y6DA 5HDYA 2J95A 1T8LA 1UEPA 3RC5A 3VGCC 1CBWB 2HNTE 3BTTE 4K1SA 2FS8A 1RTKA 2RCZA 1A7SA 4E7NA 1GMDG 2FMJA 3P8NA 2FX6A 3QTOH 2B8OH 2HRVA 2WPMS 3UREA 3A7WA 2BY8X 2ZDLA 3I29A 1V2KT 1HAVA 3TNSA 2Y81A 3U98H 1K1NA 1N6DA 4Q2NA 1ZJDA 3DUXH 3FZZA 1GHWH 2Q6DA 5ESBA 5PTPA 2OD3B 1OOKB 4O3TA 3KCGH 2BD7A 5LPRA 3PV5A 2R3UA 1XVOA 3MU5A 2LOBA 2FOGA 2H5CA 2Q1JA 1HAOH 2KG2A 5EXMA 4WXVA 3GY5A 1MCVA 2KJDA 1G9IE 1TPOA 2A2QH 1MU8B 3ZYDA 1V2PT 3BSQA 2J9NA 4EDJA 1ANCA 3NXPA 3SV6A 5E22A 4KTSA 2RA3A 4TY6A 2WV4A 1LPZB 4HFPB 1O2VA 1AWHB 5EW1H 3RC4A 3BTME 1QJ6B 1C5NH 3WW7A 2M0ZA 1L4DA 3ZZ9A 1SGEE 1W11U 2F0AA 2BOHB 2R9PA 1PPGE 1VCWA 4Q2PA 3GS9A 4CHAB 2SFAA 1HRTH 1K1LA 7ESTE 2AWWA 1OYTH 1LKAA 4K60A 4KGAA 4ZKNU 4XSKU 4NZLA 2QG1A 1MTWA 5C5NA 2P95A 2GV6A 2O9QA 2W26A 1RY4A 1T7CA 3OTJE 2BLVA 1OHHD 2YNBA 3KYFA 3Q77A 2KOMA 1C9TA 1DITH 2F4LA 4D9RA 2OSGA 2ANMH 2K20A 3KL6A 3A8AA 5FPSA 2PV9B 1UTNA 2BB4A 3ZVFA 2Q6FA 1A5GH 1H4WA 5EG4A 3RXLA 1QRZA 1QIXB 2BXTH 3I78A 2RA0A 1RGQA 4AN7A 1S85A 2XWBI 2WL7A 1FAKH 5KECA 1BMNH 1GHVH 3LH1A 1PQ8A 3LNXA 2H2ZA 3ATIA 1JRSA 1F7ZA 1UVOA 2ASUB 3RXVA 2WYGA 1UVTH 1VJAU 5C0UA 1JRTA 3ELAH 4GCHG 1LVYA 2JH5D 1BZXE 4OGYA 1W13U 1T8MA 1EFRD 2A5KA 2BZAA 1GVZA 3U1IB 4LZ4B 1O0DH 1MKWK 1A3BH 5ABWA 1GCDA 3CBXA 3BTHE 2PUXB 1ZMNA 3AW0A 1TAWA 4K1TA 1NTEA 1T4UH 1O3LA 2ENOA 2LC6A 3UPEA 2VSVA 3MH7A 4AB8A 3OU0A 1FDPA 2KYLA 1VGCC 2THFB 2F3CE 3TSVA 1WV7H 3AK5A 1WTHD 2OCSA 1GJAB 4A1TA 2DLSA 4YLUA 4XOJA 2BVRH 1MBMA 6LPRA 2CF8H 3H7OA 4M9FA 2KJPA 1HV7A 1V2JT 2QXJA 1KXFA 5C1UA 5HXFA 1DICA 1Z7KA 3L33A 4I86A 1S0QA 3CP7A 5B6LA 2GP9B 1X45A 2WYJA 1AWFH 1TMBH 3KQ5A 4XE4A 1FV9A 3GY6A 3KZEA 1C1PA 4MTBA 1FJSA 2Q9VA 2DUCA 1GHYH 2HVYB 4NXRA 1H9IE 4X6PA 4NWKA 3CBZA 1TNGA 1O2RA 2FOHA 2RFKC 2JH6D 1UK3A 4NFEA 5GPIB 5H4IB 3ZZDA 4P00A 1EZUC 2EDVA 5DP4A 3P92A 5EXLA 2D26C 4FU7A 2XXLA 1BB0B 1GL1A 1O34A 3URCA 1G9OA 5T3HA 4WMFA 1W7XH 2OLGA 2STBE 3RU4E 4H42U 1NU9A 2BYAX 5G1EA 4JYVH 2VRFA 2XNIA 4A6LA 1P11E 1O5GH 3GCHB 2IPHA 3SU0A 1FY3A 1THPB 2B9LA 5EJ1A 5BPEA 1TX8A 3K9XB 1MMJN 3MNSA 1CA8B 1O3MA 5BRRE 1Y3UA 4ESTE 3W95A 1ZJKA 1WOFA 2V0BA 3MI4A 1VCPA 2F9UA 2SGQE 3D65E 4O97A 1ANBA 2D90A 1D3DB 2ZI2H 2ZU1A 1QAUA 3KN2A 3SYJA 4AGKA 1BTHH 4JYTA 3HK6B 1TABE 1GJ9B 1UTPA 1MTNC 1RFNA 5DP6A 1BJUA 1GMDF 1VITG 1W10U 1DFPA 2GZ9A 3TGIE 1HXEH 4KELA 1SQOA 2JWEA 2JETC 2P3TB 3LJOA 1PPFE 1BMFD 2DE8A 1Y5BT 2HE2A 3UR9A 1GI9B 1E0FD 3KDKA 3SJOA 2B0FA 5HETA 3TSZA 1NBME 3B23B 3ZV8A 1GQ4A 2TIOA 4X2WA 3RLEA 5CHAC 1P8VC 2NU0E 3UIRA 1O3EA 1ETRH 1DT2A 5GJ4B 4NMPA 1H8ED 1MTSA 3GICB 1GBBA 5JBCS 5HEYA 4YOJA 4DT7B 4Y10E 4JZEH 4H11A 1THSH 2QXHA 3SJIA 1ZOKA 4WWYA 4WJG2 1P04A 1QL8A 5EJLA 1UM1A 1L1JA 2VGCC 3FVFB 4X1PU 4A7IB 2IWQA 1BA8B 1KLJH 1ZHPA 4TWYA 1C1NA 4KTUA 3GY2A 2ZFTA 4SGBE 3PRBA 2C8XB 3P70B 1F0SA 2ZHWH 4THNH 1XXFA 2M3MA 3ZZCA 3V12A 1XUHA 2YMSD 1QTFA 1CHOG 2BDYA 3SUEA 1OBYA 4CH8B 5HYOA 4DURA 1FIZA 2RG3A 1AE5A 1SOTA 5HM2A 1EATA 5JB9S 1Y5UT 1IOEA 1SGIB 3PTBA 3TJOA 3ID3A 1GJ6A 1BDAA 2QV1A 1Z8RA 1N6EA 4VGCB 1TGSZ 4JOFA 5HJ1A 5DP8A 1P03A 4E35A 3RXIA 4I31A 3RUOA 1EAIA 5DK1A 2BLQA 1HDTH 1N99A 2ZTZA 2QE7D 1WFGA 2KJKA 4NMRA 2ZEBA 2W7SA 1BTWA 4BAHB 1BRAA 2L4TA 1BRUP 3KGPA 1QGFA 1OP0A 3ZVGA 5FXLA 2XOKD 1CBWC 2ZKSA 3D62A 3KQDA 2BDBA 2ZP0H 2AIPA 1GI0A 1DY9A 4K72A 4NNLA 1IU2A 3RM0H 2ODQA 2I1NA 1SOZA 4ABFA 1QA7A 2ZTYA 2OPGA 2O8UA 3BV9B 3E0NB 5E1YA 3AXAA 4K75A 4GCHF 2PW8H 4GHTA 1O3PB 1TE0A 3EA8A 2GDEH 4FUFA 3QZRA 3LU9B 1Y7NA 1GMCG 4OS5A 1XXDA 1EPTB 5FB8C 1ZSJA 3LGTA 1BIOA 4TPIZ 3F9HA 1FIWA 1ZZZA 1CGHA 1IQMA 1U37A 3SUDA 5HMAA 4NMOA 1GI1A 3TVJB 4YT6H 3Q00A 5G4BA 1P0SH 3B8JA 3SJ8A 3M5NA 2ZFPH 2REYA 1OWKA 1O33A 2VJ1A 1EQ9A 4O9VA 3SUGA 1OX1A 3D23A 2PA1A 3SU5A 5K0HA 1OKXA 3O8DA 1J9CH 4FLNA 2Z9GA 2FOCA 2J5UA 1AD8H 1CSOE 1IHTH 3BG4B 4CHAC 1O3GA 2CF9H 1Y59T 3PWCA 1CA0B 3RXAA 3AAVA 1EASA 2A7CA 1WQSA 3QK1A 2ZA5A 2IWPA 5HGGA 3NPSA 3OEED 1LKBA 2HGTH 3LDXH 1GPZA 3I77A 3GSLA 1WYKA 1S6HA 2DKRA 1I92A 1C5PA 1DE7H 1AN1E 1Y3WA 4J1YA 1P05A 2BY6X 4ZUHA 4AZ2B 4YDPA 4U2WA 1MZDA 1X9ZA 4E05H 1SHYA 2K0QA 4AFQA 2RDEA 2QF0A 2R4HA 1PQAA 3B76A 2VVCA 4NMVA 2EEHA 5H3JA 2GTBA 2PHBA 1C1OA 3MU0A 2WPLS 2H9HA 2PTNA 4ASUD 1QR3E 4KFVA 1AFEH 1FMGA 3EA7A 3KIDU 1BHXB 3FANA 1FC7A 3L4FD 3I18A 1P2KA 1V6DA 2EDZA 3UUZA 4AFSA 1QA0A 1YCPK 4O06A 4KTCA 1Y8TA 2OINA 2ZDAH 1O5BB 1YF4A 4X8SH 3ZVDA 1BMLA 1RJXB 3TGJE 2BQ7B 1Y5AT 3LGVA 1WIFA 5HIYA 6GCHG 1C9PA 5AFYH 2FYRA 4UU6A 4IGDA 5EW2H 1AI8H 1MZAA 1O2QA 2EEJA 1ETTH 3L6PA 1Z1IA 2AH4X 4Y7AA 2R0LA 4FVDA 3SQEE 1X6DA 1VITF 3SV2H 2OGPA 4LXBH 1SGYE 2HPPH 2F9VA 4NA9H 1YY3A 1A46H 4CREA 4INLA 1NRPH 1CGJE 1P12E 3R0FA 4FUBA 2B7DH 3VB5A 4ABDA 1E79D 3WKMA 3M37A 1JWTA 1O3OA 3VEQB 1B7XB 3BTFE 1RTFB 4RSPA 5EIYA 3SHWA 2ZU4A 1F5KU 2BLOA 3PTNA 3HVQC 3CS7A 1TPPA 3RXHA 1O2XA 3M7QA 1WSSH 4X2YA 2Z3DA 4LOYH 4FXGH 2C8ZB 1UTQA 1UCYH 2PLXA 1NS3A 3PMJA 3CS0A 1DS2E 2I6QA 3DA9B 5E0HA 3RMMH 3QN7A 4DOQA 2J94A 4UFGH 3K82A 2AMQA 3TH4H 1DPOA 5EOKA 5DGJA 1G3CA 1AHTH 2BD2A 2IPQX 4I7YH 2XBYA 3BIUH 1C5RA 2AHME 2F83A 1AB9B 1XMNB 2HALA 2KCOA 4P2AB 3CNRA 4OGXA 2H2CA 1P57B 1KMHB 4D9QA 1AZZA 3SGQE 2XCNA 4WH8A 1GJ8B 4KP0A 4X6NA 1CHOF 4Y8ZA 1L2EA 1EZSC 2CGAA 1RS0A 1K0HA 2QT5A 3KZDA 3S9AA 1MUEB 3GCHC 3A88A 5HFBA 3DJAA 4FUJA 2Z9LA 3SI4H 3F0OA 4KKDA 3SNBA 1SLWB 3W1EA 2H6MA 3OSYA 2SGAA 3SV7A 1WHAA 1P2NA 2JINA 4JJ3A 4Q2OA 1ELFA 4O3UA 4ABIA 5I25A 3RXBA 1NT1A 1OWHA 2EC9H 2PWXA 2JXOA 2ZGXH 1EPTA 1SFIA 2H9EH 1HAPH 5HFEA 1ELTA 3M3TA 2PNTA 4YOIA 4TSFD 4Y8YA 5F6MA 4FU8A 2XYAA 1W12U 4WXIA 3SQHE 4TWWA 2ZCKP 4YZUA 1SLVB 5LH8A 1W0KD 2JIZD 5AHGH 2VSPA 4OS4A 3SU6A 1OP8A 1ESTA 2VVVA 4U30A 1TP5A 1W8BH 1K1PA 2GZ7A 5FX5A 3UQOA 3WY8A 1GMCF 3WWBA 1QY6A 3ENSB 5ESTE 3QWCH 2VWRA 4P02A 3F6UH 1DDJA 4HOPB 1UVUH 1PPZA 3BEFB 5A2MH 4JZFH 4Y8XA 2BD3A 1SGDE 1HIAB 5EPNA 2ESTE 2QF3A 1AIXH 1SGCA 2EI8A 1B5GH 1FPCH 2Y6TA 4YXWD 2GVFA 2XBVA 1PPBH 1LCYA 2ZFRH 1BBRK 3A7ZA 3TIUA 1J8AA 3RXMA 3RXTA 4D8NA 2FI3E 3E91A 1AE8H 4P0CA 1FY5A 2PGQB 2XNDD 1CE5A 4SGAE 2ZGHA 3PWBA 1EKBB 3IITA 1O2OA 5GNDA 3TLOA 3TNTA 2YMSB 5F3XA 4HG6A 2JDID 1TGCA 5DP3A 1XKBC 1SPJA 1CVWH 1E1RD 1SLXB 3MTYA 1C1UH 2OC1A 5J4SA 2TBSA 2ZG0H 4K8BA 3S0NA 2IOTA 3QUMP 1GBIA 4WF8A 4Q2QA 4B76A 1AY6H 3PB1E 3RMLH 1CQQA 2IJOB 1MFGA 1RTLA 4WYTA 1Q3PA 1UCYE 1WQVH 4XBBA 1UVSH 2GZVA 4Y79A 4VGCC 1Z71A 4JL7A 2ZF0H 9ESTA 3TJUA 3ZZ4A 3F9EA 1SLUB 2Z6BD 4OS2A 3ZYEA 1WH1A 2I6SA 4BANB 1NFUA 3RXDA 4ASHA 1T8OA 1L6OA 3SNEA 4IMQA 1ORFA 5FX6A 2KCPA 2ZQ2A 2P3WA 1DY8A 2AWUA 2FODA 3GY4A 1BUIA 3SN8A 1GVLA 1J15A 1QJ1B 4MVNA 1ZGVA 3SHCH 3QLPH 3QDOA 2AS9A 3UY9A 3R68A 2BYGA 2G5MB 1BRBE 3TK5A 2UUYA 5A0BA 1HJ8A 1EPTC 2FZZA 3VXEH 3VXFH 5JYIA 2ZHDA 2QN5T 4ISHH 2VIQA 1C1VH 4HTCH 1DVAH 4OEOA 3ID2A 1O5DH 2BDGA 2GEFA 1AKSB 2V3OH 3PLBA 4YM9A 2YT8A 1ANDA 3P8FA 4XBCA 1CT0E 2ZHQH 2UUJB 1TX6A 5EGMA 5F67A 1C5MD 1UF1A 1V2TT 1GI3A 4BTIB 2V6NA 1AU8A 2YUYA 5DP5A 1KXAA 2EAQA 2I4SA 1PQ5A 1FQ3A 5T6DA 1C2FA 2GMTB 1K1OA 1SR5C 4K5ZA 2EA3A 1O3KA 1IQJA 1WI2A 3ZZ6A 1HAYB 1WBGB 1PPCE 3BG4C 4MG3A 5FBIA 2F43B 4X1RU 3K6ZA 1NRNH 1H9HE 1CA0C 2OQ5A 3WKLA 3A84A 3DJ3A 1TB6H 2FIRH 1C5ZB 3GCTG 3R3GB 1BCUH 1UTOA 3AW1A 2WZQA 5IYTA 1XKAC 2KAWA 2B5TB 3LNYA 1DOJA 1BTUA 6CHAB 2I6VA 2K8IA 1UTJA 1KWAA 2BVXH 1SVPA 2OCVB 3DSOA 1OBXA 5C3NA 4BAKB 4Q3HA 1A3EH 5J4QA 1W9EA 3DFJA 4OS6A 3RXFA 1V6BA 5JPMH 2FWWA 1Q7XA 2O8LA 3M3SA 5GIBA 2KV8A 2CK3D 3MMGA 2ZGJA 1DLKB 3E6PH 3U8OH 1TPSA 2O8MA 4ABHA 1TNIA 2DJTA 1TQ7B 3SI3H 4Q6SA 3BPUA 1V2OT 1KXEA 1UJUA 5JB8S 3BTGE 4QT8C 5EXNA 2EEIA 3TH3H 4FUHA 4Y71A 1V2WT 2PKUA 1RRKA 3DCLA 3KQCA 2PDZA 2W7RA 3FP6E 2A45B 2JH0D 3LGIA 1DLEA 3F2FA 3OY6U 1X5QA 1FONA 5T1VA 2FI5E 4HOPA 1E1QD 1S84A 3TPIZ 4OEPA 3SOEA 2OQUA 2W3IA 4B6FA 1F5LA 2ZCLP 3V13A 3OX7U 1HIAA 3GISB 2KM0A 2BY5X 5F8XA 1V2ST 3KDGA 1UJVA 4M7GA 1MAYA 3FN8A 1PYTD 2HNTF 4G69A 1V2VT 2GDDA 2QGRA 2C8YB 2FS9A 4HGCA 4NXQA 1C2LA 4PQWA 4CH2B 2PFEA 2VINA 4NWLA 3FAOA 3CYYA 1KLIH 1Z6EA 3H5CB 3OTPA 1A0LA 2Y5FA 1CHGA 4K76A 2TRMA 2FOMB 1D9IA 1F5RA 2PKAB 3T25A 1S81A 2NWNA 4ISLA 3M5MA 3S7KB 2LPRA 2FP7B 1P1DA 2ZNKH 2GCTB 5E2OA 3SUFA 2WUBA 2GX4A 3A8DA 3BTQE 4B73A 3TMHA 2EGOA 1XUGA 1G32B 3MH6A 5EODA 2CHAB 4DG4A 4XBDA 1O2GH 3SO3A 1LQEA 2ZGBH 3SJ9A 1B0FA 5I7ZA 1AB9C 1GJCB 2G00A 3KYGA 3MU1A 1XUJA 3SNDA 4A5TS 2SGEE 7GCHG 1HCGA 2AMDA 6ESTA 1TGBA 1O2SA 2QC2A 3JZ2B 4BAQB 3BIVH 2GCHG 1OPHB 3M5OA 2EQNA 2D8IA 3RC6A 1UTKA 4FGMA 1UVPA 2Z3CA 1MAXA 3M7TA 2RDLA 1G36A 1XUKA 4TYDA 3HKIB 2EI7A 4J2YB 4YO9A 4TPYA 3T28A 1YLCA 1B8QA 5L2YH 5C0TA 1C5XB 2PUQH 3SNCA 3VFEA 4X1QU 1QRWA 4Z0KA 2A1DB 4Q4LA 1JOUB 2Z9JA 4NA7A 4I32A 1O2HA 1T31A 1WAYB 3ZV9A 3FP8E 2O2TA 4DCDA 3RXSA 2DMZA 1M5ZA 1AKSA 1V5LA 1N7EA 5E0GA 1HAGE 1ZGIA 1EP5A 1TOMH 1C2MA 2GT7A 2W6JD 1ZMJA 2O8TA 5IL9A 1WHDA 4R8TB 1GI7B 3TITA 1ZLRA 1SGFG 3ZVBA 1SI5H 3EGKH 1G3EA 3LOXA 3ZZ8A 2HVXA 3LT3A 1FY8E 4RI0A 2YT7A 3GY8A 2DB5A 1YCPH 3LC5A 1YPMH 4O03A 1O5AB 1OWEA 2HWLB 1QQ4A 4XRNA 1WF7A 5HFCA 1NPMA 5FPTA 1O3HA 1GI2A 1O5EH 1DSUA 4ZMAH 3IWMA 3T26A 1LDTT 1UEWA 4RT0A 2YUBA 1GBDA 1S0RA 2PP6A 1EP6A 1GCTB 4JJ0A 1GHBG 1G3DA 3A8CA 1GDUA 1TX7A 1YLNA 1SFQB 1OYQA 1XUIA 3EDXB 3S9CA 2YMSC 1SGTA 1QB9A 4Q7ZA 4MDSA 1BQYA 1OWJA 1YLDA 4Z6AH 1TNKA 1XUFA 5SGAE 2M0UA 4AX9H 4X8VH 3RXPA 4AB9A 3M3VA 1HYLA 1MBQA 1V3XA 1G37A 3GCTF 4N6XA 1C4U2 1KXCA 2L74A 5LPEA 3I4WA 3F9GA 2OMJA 2M0VA 4Y7BA 1FC9A 3TU7H 2GKVE 3V7TA 4Q7YA 2VWLA 9LPRA 4IW4E 1AFQB 5GXPA 1ID5H 2EI6A 2ANKH 1TFXA 1GJBB 3GYMA 1UEQA 5HEDA 4ISNA 1GBHA 5HM9A 1MKXK 5FPYA 1EOLA 3A82A 1LVOA 1SB1H 1A2CH 2HPQH 2J4IA 4MNVA 4HI3A 2UWOA 3ZZ5A 4NIWA 3ZZ7A 3DSPA 4GVUA 1FUJA 4MQAA 2VIPA 1P02A 4I8GA 1K1MA 2WUCA 5D13A 4JOHA 4YOGA 3FOAA 3VB7A 3NFKA 1O36A 2WPKS 2OZFA 1PPEE 2QIQA 2JJ1D 3RU4T 2ZTXA 2VH6A 3GY3A 3MU4A 3E3TA 2FXRA 4JYUH 1ZTJA 1ZPBA 1KLTA 2BD9A 3F2HA 4JK6A 1D3QB 1QCPA 5ILBA 2A4QA 1NRQH 4E3BA 4UU5A 4X0WU 5TCAA 1O37A 1EB1H 3T62A 2PKAA 3GJ9A 1TGNA 1QBNA 4FVBA 1AO5A 1A0HB 1HBTH 2F91A 1HLTH 1EUFA 4F55A 3RXQA 2BLWA 5C2ZA 1ZSKA 5DP9A 3RMNH 4K1EA 4Q6HA 4NFFA 2ZU3A 4ZHMU 5F8ZA 3KQBA 3STIA 1LPGB 2XBXA 1I16A 1Z87A 2GMTC 5DP7A 4IC6A 1IHSH 1AQ7A 2EGNA 3H7TA 2JIKA 2C3SA 2KPLA 3LC3A 2VZ5A 4JZ1A 1GHAG 3OAAD 4E06H 7LPRA 4YYXA 1FX0B 2VIVA 1F92A 4CRGA 4R0IA 3NZIA 2AEIH 4BNRA 2BXUH 1VJ6A 1VA8A 1C1QA 1UHPA 4IC5A 4ISIH 2QXGA 4E7RG 4DT4A 3Q3KA 2BM2A 4MLFB 3VB3A 1UHBB 2DE9A 2F5YA 1XM1A 4UFEH 3NFLA 1IHJA 3EGHC 3QE1A 3HPTB 3V3MA 2QXIA 1P09A 6CHAC 2QAAA 1QL9A 1C1MA 1OWDA 2OC7A 2Y5HA 2UUKB 3NRLA 4X6OA 1Q3XA 1ZHMA 4NMSA 1FI8A 3U8TH 2CS5A 3RL7A 1BBRH 1QAVB 1UO6A 2JSNA 1ELCA 2V3HH 1O2KA 3Q3YA 1F0RA 4NSYA 2P3FH 2NU3E 3SUZA 5C1YA 8GCHG 3PLKA 5L6NH 4JK5A 3NWUA 5FCRA 1S83A 1HGTH 2QCYA 3EA9A 4MNXA 2FCFA 1TGTA 2KOHA 1FN6A 3O8BA 2VH0A 1V2NT 1JIRA 1VKYA 4DY7B 1VAEA 2A0QB 4NZQA 5CMXH 3P6ZB 1FCFA 2J98B 3K2UA 1O3AA 1FAXA 1OP2A 3RXUA 4DIHH 2H3LA 2E7KA 1D3PB 2PSXA 3AAUA 1KEFA 3E90B 1TOCB 1DWCH 4Y0ZE 2LA8A 4Y76A 2FESH 4Z1MD 3A80A 2EXGA 1WFVA 3GY7A 4JOEA 1F2SE 3QGLA 3BTEE 1H1BA 1TNHA 3HGNA 4X1SU 2F9NA 2G52A 2K1QA 2KFWA 1BOQA 2WPHS 1NFYA 2STAE 3VQFA 3KHVA 4AC9A 4ZROA 1K28D 1H9LB 4NXPA 3MNXA 1P2JA 4XFQA 3UOPA 2BD5A 2VIWA 3BG8A 3ZZ3A 1GL0E 3P17H 3A81A 3K6YA 2KCAA 4ISOA 1DWEH 2V1WA 2V7QD 2A4RA 3E16B 1M9UA 4A1XA
chains in the Genus database with same CATH topology
4I8KA 1V2QT 1ARBA 1Q2WA 1KTTB 5C67A 1ACBE 4X8TH 2TPIZ 3TSWA 1FY1A 3O46A 4U01A 3SU4A 1FN8A 1P2QA 1GI5A 2TGDA 3MWIU 1UEZA 2H5DA 1C2KA 1YPHC 3A87A 1GJ4H 3MH5A 1P3CA 4ZKRU 3SV8A 2GZ8A 2AMPA 1LPKB 2GCTC 2P93A 3QO6A 4JOGA 4NCYA 2BMGB 3SU1A 1GHBF 5E8EH 4GAWA 2JOAA 3V0XA 1C5YB 3M36A 1MU6B 1TRNA 2CHAC 4JOJA 1SBWA 1J14A 3O8CA 2UUFB 1ZPCA 2FOAA 1A5IA 1QLCA 1P06A 2SGDE 2RRMA 3AASA 4JMYA 1UTMA 3K50A 2ZPRA 1O3FA 2R2WU 1C1WH 1NM6A 3PDZA 1KY9A 1SGNE 4ZHLU 1BMAA 1GBEA 1GQ5A 1P2MA 3HPKA 3NCLA 4AORA 3B9FH 1X7AC 1C4Y2 5A0AE 1QQUA 3RL8A 2YOLA 2AWXA 3CBYA 2QYIA 4ZXXH 1W14U 2P8OB 1K32A 3GGEA 1G3BA 2CXVA 3JXTA 1C2DA 1EX3A 1HAZB 3KEEA 3LH3A 4MPUA 5T6GA 2VWMA 2OXSA 1GBCA 1OXGA 4IN1A 1HPGA 5T6FA 4YT7H 2GGVB 2FI4E 2FLBH 3A8BA 3UWIA 4Q7XA 4Y0YE 1TONA 4WYUA 1BT7A 1BFEA 1GBMA 3PO1B 5HFDA 5LGOA 1GDNA 4X2XA 2WINI 2ZPSA 4X8UH 1Z1JA 1UMAH 1K9OE 2Z7FE 5HFFA 2ZZUH 2LUIA 1O2MA 2BD8A 2ZGCA 1GJ5H 1QBOA 3CC0A 2BY7X 5DO4H 1G2MA 1TBZH 3F1SB 1IQHA 1LTOA 1HJ9A 3FP7E 1IQKA 3SV9A 2UWLA 4BTTB 1E36B 3VB4A 4F4OC 5AF9H 1V2UT 4FUDA 4LZ1H 2TGTA 3SU2A 2C8WB 3R0HA 1C5SA 1R6JA 1YKTA 1MCTA 4NMQA 1UHBA 4Q2KA 1GCTC 1IAUA 3O8RA 1O2WA 3S69A 1SC8U 4RN6A 2LC7A 1EJAA 1YGCH 2BHGA 4MNYA 1ZHRA 1MKWH 2JILA 1EZXC 5GWZA 1HJAB 1RIWB 1BTZA 1L4ZA 1RXPA 1GHAF 1K21H 2F9BH 5C5OA 1WF8A 4DW2U 1QAVA 1SMFE 1ZR0A 1GBKA 1UFXA 4OS1A 4NMTA 4ABGA 2KPKA 1ZSLA 4DIIH 2VU8E 7KMEH 1FNIA 1P3EA 3RDZA 2X7ZA 3RU4D 2PGBB 5FHTA 2PTCE 5DG6A 4B71A 5L30H 1INCA 1TBQH 1WTGH 1YBWA 4A92A 1ZYOA 3ZZAA 1AFQC 2BZ6H 1EJNA 1HAIH 4MPAA 4MPXA 3ATLA 4ZXYH 2XTTB 4I33A 3TGKE 3STJA 3QJNA 1FLEE 1D3TB 4DGJA 2ZECA 1UJDA 1XZ9A 1EAUA 1Z8JB 5EU8A 1DM4B 4FUIA 1SQTA 1Z8IB 1IQNA 1UK2A 2VNTA 3W94A 2AERH 3E0PB 2MX6A 5G1DA 2ILNA 1O31A 4WMDA 3UNRA 1RD3B 2D2DA 3RXCA 1GBFA 4H4FA 3UTUH 1C4V2 4ABEA 3M5LA 5A09A 1D6RA 1TRMA 3KNXA 1WUNH 5CE1A 1YC0A 1ARCA 1C5VA 2XBWA 1O3JA 2RCEA 1LMWB 4ABAA 1BJVA 4CRBA 1O30A 3UOUA 6GCHF 3MYWA 3S9BA 5A8XA 3EYDA 1ELGA 5DKMA 5B6OA 2WV5A 2Q6GA 5TCCA 1SGPE 5EQRA 3MHWU 3A85A 1NROH 1D5GA 4D7GA 1TLDA 1UTLM 1W0ZU 1G30B 2ODPA 2VPHA 2PKSB 4JZDH 2EGKA 2R3YA 5K7RA 2OBQA 1UK4A 1KSNA 1W3CA</