3GDUA

Crystal structure of degs h198p/d320a mutant modified by dfp and in complex with yrf peptide
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
316
structure length
294
Chain Sequence
DSTDETPASYNLAVRRAAPAVVNVYNRGLNEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINPGNGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREQGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMAQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DegS protease
publication title OMP peptides activate the DegS stress-sensor protease by a relief of inhibition mechanism.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase activator
total genus 57
structure length 294
sequence length 316
chains with identical sequence B, C
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3gduA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gduA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gduA01
1C1MA 2XC4A 1MAYA 1DS2E 4FU8A 1EJMA 3KEEA 3TSZA 1AZZA 2BD9A 2JH5D 5HDYA 1V2WT 3MU8A 2KAIB 1GHWH 1O2RA 1HXFH 3NWUA 4WXIA 3UY9A 1GBLA 4G69A 3SHCH 3PMHB 2VWNA 2ZI2H 2P95A 4YDPA 4A92A 1PPBH 3UWIA 4KP0A 3M61U 3RC5A 4FXGH 3SNCA 3O5NA 3QDOA 2KJKA 1KXCA 3A7VA 1O3EA 1ELEE 3SU2A 2YUBA 2A32A 1UK4A 2GDEH 4ZKRU 4D9QA 1SC8U 3E8LA 4HTCH 2KJDA 2FESH 4GVDA 4CR5A 1TQ3A 1D4PB 1TOCB 1E35B 2PGBB 2WPLS 2DAZA 3B8JA 1W11U 1I16A 2WYJA 2BLQA 4A7IB 1HCGA 1GHYH 1ESBA 2THFB 4Q6HA 1D6WA 2LPRA 1GMHG 1NC6A 1FUJA 1WH1A 3BN9A 4NMPA 1QA0A 1SQOA 2EI7A 4JZIA 2JXOA 1ELTA 3GDVA 1V6DA 3BEUA 4Y6DA 3LGVA 3TIUA 3PLBA 1U3BA 1THSH 4BXSA 1AO5A 1BTXA 1SI5H 1HAIH 3HK3B 1C2MA 1B8QA 4IGDA 3SW2B 1EP6A 5DPAA 1MKXK 2SFAA 2CHAB 3SUFA 3VB4A 5HFBA 3F1SB 1C5LH 1RIWB 2PKTA 2WUBA 4X2WA 1ELAA 1ESAA 5SGAE 1QQUA 1MFGA 4ISIH 5L6NH 1L4DA 1UJUA 4X8TH 5K0HA 1G3EA 2ZHFH 2WPKS 1GBAA 1F0SA 1NZQH 5FPYA 2AS9A 1BBRH 1HUTH 1SQAA 2EGNA 2BD7A 1HV7A 1QGFA 3NFKA 4TPIZ 1CE5A 5A8XA 1GBKA 1FIWA 4I8JA 4WH8A 1XUJA 1VZQH 5T6DA 2PKAA 4KKDA 3ATMA 1GVZA 2EEKA 3GCHB 5LPEA 3CBYA 1UK2A 2G81E 1WHDA 2SGEE 3UOPA 3TJUA 2Z9JA 3FP6E 1PQAA 1EQ9A 3LH1A 2PTCE 1O30A 5G1EA 2H5DA 3OTPA 4K8YA 2VIDA 3BIUH 2OSGA 1G2LA 4BAOB 3OY5U 3PO1B 4Q2PA 3SJIA 4AG2A 2XC0A 1UTMA 2OC0A 1ANDA 3FZZA 3D62A 1GWAA 4Y7AA 3NKKA 5JYIA 2H3MA 1C5SA 2QXIA 1UHBA 1YPJH 3V13A 4K8BA 4A1TA 2OQUA 5JBAS 1UTKA 2YOLA 2OC8A 2G5MB 3TGKE 3UR6A 1ZMLA 4AYYB 3URDA 1PYTD 3QGNB 1O3OA 4Q80A 1UTJA 1IAUA 4JYVH 1N1LA 3SHWA 3SHUA 3AW1A 2BD8A 3H5CB 2PHBA 1DUEA 4NWLA 1BDAA 4CHAC 2FYQA 5GCHF 2Z3EA 1QRXA 5C2ZA 2O8MA 2FE5A 4FUIA 1JWTA 4X8VH 1C5NH 2HGAA 3LPRA 3OYPA 2P8OC 2LC6A 4ZUHA 1XUFA 1NRRH 1VJAU 1KXAA 3K65B 1UVOA 3UWJH 1LQDB 3ZZ7A 3TK5A 1O34A 2UWLA 1VGCC 4UEHH 3LGTA 1IHTH 2DJTA 2F5YA 1JRSA 2PKSC 3S0NA 2W4FA 1K2I1 1SQTA 2ZDNA 3Q77A 4Y10E 2ANKH 4O3TA 2VH6A 1WQVH 3MU0A 4ISLA 1ARCA 5AVDA 2PWXA 1CU1A 1AB9C 1J9CH 1UEQA 1ID5H 1C1NA 2FLBH 2R2MB 1BMNH 1PQ7A 2R9PA 1P1DA 2A2QH 2KA9A 1CGHA 3M5LA 1WHAA 2ZEBA 2ZTYA 2RCEA 4X1QU 1GVLA 1YGCH 4FUGA 5FCRA 1X7AC 4E7NA 3ZVGA 1O2KA 2PSXA 2QC2A 2GCTC 1YCPH 2BOKA 4XBCA 3VGCB 3GY3A 4KFWA 3TJOA 1MUEB 4H4FA 1MU6B 1F2SE 4BAHB 1O2XA 3CP7A 3LNYA 1NFYA 2KOHA 4K60A 3LC3A 2JWEA 1H4WA 2QF3A 1SL3A 1W7XH 4JOEA 1S6HA 4YYXA 5EQSA 1O2SA 3LC5A 3MO6A 4MPAA 1WF8A 2HNTC 3PMAB 1EUFA 3IITA 1KTSB 3TNSA 4NXPA 1O39A 4VGCC 2I0IA 5F8TA 1Y3YA 4NMVA 1AVGH 1LDTT 4X2XA 4D9RA 1KXEA 3URCA 1O2YA 1A5GH 2G00A 1QB6A 2QAAA 1K1PA 4NNMA 3S9AA 1KLJH 3A8CA 5HJ1A 3UUZA 7GCHF 1W9QA 2WV5A 3FAOA 2K1QA 4ZHAA 2J94A 1EB1H 4R8TB 3I1EA 1P8VC 2ZU2A 1L6OA 2JILA 1AUJA 3P95A 3TK6A 2FIRH 2FCFA 5IYTA 3RXIA 1O2HA 1GCTC 2VB0A 2R0LA 3SHAH 5HFCA 2OLGA 3TH2H 1SG8B 4AX9H 3GOVB 1VAEA 1L1NA 2D2DA 1QBOA 2VWRA 4TPYA 1OSSA 2XCFA 1G36A 1O32A 1TX6A 3KCGH 2QN5T 3L3TA 1E34B 3GICB 3PS4A 2FXRA 1UCYK 1GGDC 4XOJA 5H3JA 2A4QA 2O8TA 4X2VA 3P92A 4LXBH 1K1IA 1ZGIA 1GI8B 4E35A 3CH8A 5LGOA 4WJG2 1LKBA 1AI8H 1QJ7B 1UHPA 5HMAA 1N6FA 2BLOA 4Y79A 2BY5X 5EGMA 1GG6B 5GNDA 1BOQA 1C5TA 3ZV8A 1DWBH 1DFPA 5HM9A 1V5QA 3SGBE 4X6NA 1NFWA 3TSVA 1H9HE 2AERH 1OYQA 5E1YA 1W8BH 2HRVA 3E1XB 2BDYA 2GDDA 4I8GA 1CA8B 2FTLE 2FI3E 1GI1A 1W12U 1BUIA 4YOGA 1TRYA 1EZUC 1T7CA 4E05H 3S7HB 1K1JA 3K82A 1LVOA 1A61H 1U39A 4NXRA 1C2JA 2OPGA 1YC0A 2I04A 3ID1A 2BYAX 1W9EA 3SO3A 1SHYA 3MO9A 2ESTE 1FN6A 4GUXA 1TLDA 1YPGH 2BZ6H 2Z94A 4THNH 2A4RA 3U69H 1SGCA 1W2KH 1WG6A 3RXEA 2BDGA 3P70B 1UEWA 2EGKA 3A86A 3QN7A 4OS1A 1F5LA 1IQFA 1V2MT 1TWXB 3BIVH 3CENA 2OCVB 2Z6BD 4INLA 1K22H 1QBNA 1TRNA 2BDHA 3T26A 5C3NA 4NFEA 2C8YB 3QJNA 1TGTA 2DE9A 3FY5A 2WUCA 3MYWA 2BQ7B 3RC6A 4AB8A 4I31A 3T5FH 4U32A 3MU5A 1NT1A 2H2CA 3TITA 4YLUA 1UM7A 4NMSA 3GY8A 1IOEA 2G2LA 2KAIA 3TPIZ 1CT4E 2H5CA 4OS5A 1DANH 1HPGA 3SU5A 1WF7A 2REYA 3NFLA 1TBQH 2EEGA 3NZIA 2KV8A 1SLVB 1N6YA 1MTNB 1QFKH 5EXNA 1DLEA 2PLXA 2VH0A 3W95A 2VRFA 3RXOA 1ETSH 1K32A 1DX5M 2AINA 2C3SA 3P8FA 1YKTA 2BM2A 4AFUA 4BANB 1VCPA 2QYIA 3B23B 3RL8A 5FAHA 1GPZA 1YPMH 7LPRA 2ZIQH 5JXBA 2FS9A 1MZAA 2PDZA 2JINA 2Q6FA 5FCKA 1MTUA 2ILNA 2FWWA 2M0ZA 1BT7A 4MPXA 2O8UA 2IN2A 5A0CA 2AH4X 2CMYA 3KHVA 3A7XA 2OXSA 1Z71A 3RXCA 4O03A 1O5EH 1KXFA 2BX3A 2G5NA 2UWOA 2I6VA 1GHAG 3GCOA 2IPHA 1A0LA 1LKAA 3BTQE 1M5ZA 2O9QA 1LHDH 1AY6H 1UTPA 4X6PA 1Y3UA 3KZDA 1CO7E 3M7TA 3O8RA 4ABEA 3BSQA 4FUCA 4K1SA 3GY6A 3RP2A 1MKWK 1NU7B 2FLRH 4NWKA 3GSLA 4K72A 2EEIA 1MD8A 3M5NA 4MDSA 1O3CA 3ZVAA 3EGHC 2J95A 5I25A 5C1XA 1QJ6B 1VITH 2J2UA 3GYLB 1FCFA 1X5RA 1GI6A 5DG6A 4X6MA 4DIIH 1P2MA 1N8OC 3VFEA 2ZDAH 3TJNA 3JZ2B 5EG4A 3VB6A 2UUKB 5G1DA 2QKTA 1CBWC 2DC2A 4XDEA 1C4Y2 3VXFH 1TMUH 1YLDA 2TGAA 1WYKA 2R3UA 2Q1JA 1OWKA 4UFDH 3V0XA 5ABWA 1CQQA 5BPEA 2ZDKA 3IG6B 1HIAB 3PROA 1O5DH 4B75A 1QJ1B 2O8LA 1GDNA 4UE7H 2FP7B 3MHWU 4AFZA 1LTOA 1UJVA 1HB0B 1TE0A 1AN1E 3B9FH 1RXPA 3I78A 4ZKSU 2M0VA 2GT8A 2B7DH 2ODYB 2BLVA 3PM3A 1AVXA 2M10A 2VWLA 4QT8C 5HGGA 3VQGA 2ZDMA 1ETRH 8ESTE 3RXHA 1ZYOA 4MNXA 1ZPZA 3ZZ4A 2RG3A 5TCAA 3SU4A 1A0JA 1UVSH 4Y11E 1X5NA 2R3YA 1T8OA 1C2HA 1SOTA 1C9PA 2VJ1A 3TLOA 3NK8A 4I33A 1SGFG 5T6FA 4K6YA 1C5YB 2Y5HA 1F0RA 1SBWA 4JORA 1V3XA 2FOGA 3GY2A 4FUDA 5HFDA 3QGJA 1DE7H 2OZFA 2HVXA 4K5ZA 1FPCH 1OPHB 1Q3OA 3LIWA 1EPTB 1GQ4A 3P17H 4ASHA 1WIFA 5EW1H 2Q6GA 1F0TA 3I18A 1TX8A 4DT7B 1O3DA 4ZHLU 5AFYH 2BLWA 1GJ7B 6LPRA 5HEDA 1GBTA 1VR1H 3ZVFA 1SGRE 3AAUA 1UVTH 5EZ0A 1DSTA 2H9TH 3ZZCA 1QL7A 4MG3A 3UQVA 4ZKNU 1G2MA 2FN5A 1C1TA 4U01A 3RXRA 4YOIA 5EODA 2XBXA 1O33A 2ODPA 2YT8A 2WPMS 4J2YB 4K3JA 1Y5BT 1LPGB 1IQNA 1SHHB 4DCDA 1C5QA 1LPZB 1C9TA 1C2DA 1BJUA 2AYWA 3A87A 5EPYA 1O2UA 3SJ9A 5ESBA 3DJ3A 3QX5H 4AGKA 2GV7A 2LUIA 3A80A 3HATH 4JZDH 1HAVB 1JBUH 3U98H 2Q3GA 3ESTA 2GMTB 1P2JA 2GZ9A 5AF9H 1FIZA 4A1VA 4MVNA 2EDVA 4WXVA 4K78A 9ESTA 5F8ZA 3GY4A 1GBDA 3ZVCA 2ZPMA 1L2EA 4ABHA 5F3XA 4L8NA 1WTHD 4BAMB 4MLFB 2FMJA 1Z1IA 1OBYA 2XWBI 5A2PA 1KY9A 5E2OA 1CT2E 2F9OA 2AEIH 2D26C 2IOTA 1P01A 3OY6U 1S5SA 1W13U 1PQ8A 1QL8A 1HJ9A 4TWWA 1K1OA 3CC0A 4FGMA 2ZFTA 8GCHF 3PV2A 1ARBA 8KME2 1V2ST 4NIXA 2VVCA 1V1TA 2PR3A 4RKJB 1X45A 2Z3DA 3HPMA 2ZA5A 5EQQA 1IQEA 1GJ9B 2A4GA 2ZGJA 4B2CA 1L1GA 1GBMA 1W0YH 3F68H 1QIXB 3KQEA 3Q3XA 1E0FD 5DKMA 1RGRA 1P3EA 1WOFA 3I77A 4B2BA 4JZ1A 2ZTXA 1SGDE 2FYRA 1SFIA 2ZC9H 3ZZ8A 4ABFA 2H2ZA 1QHRB 1MQ5A 2A1DB 2W5EA 6GCHG 4K76A 2BX4A 1OP8A 1UTLM 4CRGA 2FOAA 4Y71A 2XBYA 5FX5A 3U1IB 3TVJB 3VQFA 1Z8GA 1PPHE 1PYTC 2YTWA 3SV7A 4IC5A 1O3IA 2VWOA 4Z33A 3RMLH 1MU8B 1P06A 3ZZDA 3BTTE 1TGSZ 1PJPA 1PPGE 3RXGA 2V90A 1CA0C 1DDJA 4Y0YE 2CSJA 9LPRA 3ZYEA 1GBJA 2GT7A 2VIVA 1O3KA 1GDUA 3F9HA 4JK5A 2MX6A 5D13A 5HXFA 4MPWA 2PNTA 3BG4C 3LJOA 3M3TA 1QA7A 1GJCB 1P1EA 4NIVA 1A3EH 1VCWA 1VITG 1GJ8B 5FHTA 3BTWE 5K7RA 2A5AA 3BTEE 5EXLA 4PQWA 1C5WB 1U38A 2KRGA 5E21A 3DHKH 1O3PB 1G9IE 5F8XA 2Z7FE 3LKWA 2VGCB 4X1NU 1DOJA 2F3CE 1P11E 2EI8A 4YT7H 3SV6A 2GD4B 1RTKA 1QNJA 1BMLA 3KGPA 2ENOA 1T8LA 1GHVH 3U8OH 2FDAA 1SOZA 1AUTC 1DWCH 2ZQ2A 4A1XA 2FM2A 1BHXB 2GCHG 1LHFH 1B0FA 2BDAA 3GCTF 2M5TA 3GDUA 2NU4E 1D3TB 5GIBA 2GTBA 2IWNA 1S0RA 2BXUH 3MU1A 1LHCH 2A2XH 2D8IA 1OWEA 1QAUA 1THRH 1XUHA 2Z9IA 2CF8H 1U37A 3Q76A 4INHA 3SV9A 4Q7YA 4TY7A 4NA7A 1KEFA 2FPZA 1INCA 2A31A 3MH5A 1UEPA 3SI4H 1G3CA 2M0UA 4BXWA 4NZQA 2ZTZA 2KL1A 3BTKE 1O5BB 5E0HA 1T8MA 2EXGA 1LVBA 2FOFA 4DG4A 2XCNA 2DUCA 1MMJN 1A3BH 2VNTA 1RRKA 4YOJA 3LOXA 3SORA 2VIWA 3BG8A 4AORA 5JB8S 3KIDU 1O3HA 1Y3WA 3RC4A 1C5UA 5DK1A 1C1UH 1EAIA 2ZHDA 2OGPA 1N7FA 3RMMH 1N6XA 1SVPA 2H3LA 1T32A 4ZXXH 3S9CA 3K2UA 1K28D 3RM0H 4E3BA 3E17A 3RLYH 1T31A 3CYYA 3JXTA 1FY4A 2H9HA 2KJPA 4REYA 5E2PA 1GHBF 1FY1A 1AFQC 1QQ4A 1TAWA 1PFXC 2P59A 1Q7XA 1OBZA 4I8LA 1OOKB 2P3TB 1ORFA 2BVRH 2BYGA 2J92A 4IN2A 4U30A 2C8WB 1RTLA 2XRCA 3T2NA 4NMTA 1TRMA 4M7GA 2L4SA 1TONA 2A7CA 2Z9LA 1DLKB 1YBWA 4JK6A 3A85A 1WI2A 2F9PA 3V7TA 2CS5A 3RLWH 3K6YA 1GI9B 1AKSB 1V2TT 2ZCKP 1UO6A 3RXSA 5E8EH 3WY8A 1LO6A 1BTPA 1YPEH 1NPMA 1D5GA 2HPQH 1F0UA 3SJKA 2A5IA 1O2VA 2GZ8A 4HOPB 4ZH8A 4PROA 1EOLA 5CE1A 4WMFA 1OXGA 1F5KU 1IQHA 1MCTA 4X8UH 3ZZ9A 2ZGBH 4IMQA 2AMQA 1RTFB 1C5ZB 1ZUBA 5HETA 1OS8A 1CSOE 1KIGH 3HK6B 1ZTLA 3ZVBA 1GQ5A 2BVSH 5CHAC 1QURH 2LOBA 2EEHA 1SGFA 2M0TA 1HJ8A 1C5VA 2SGPE 4X8SH 4OEOA 2ZU1A 3TU7H 1W7GH 1Q2WA 3MU4A 1L0ZA 2CN0H 3AW0A 1G9OA 1Z87A 5HF1A 1G3BA 1Y8TA 2HNTE 1O2WA 1DM4B 3RXTA 1RD3B 4JYUH 2FEQH 1GMHF 1YPHC 1Q3PA 3SFJA 4WMEA 1P03A 4GHQA 3ATLA 1HIAA 2W26A 3KZEA 5HF4A 4AGJA 2ANWA 3RU4E 2I6SA 2QXGA 1GJAB 1O2TA 3CS7A 3E0NB 4H11A 1TBZH 1VJ6A 2ZP0H 3LGIA 3C1KA 3KF2A 2Y7XA 5E11A 2ANYA 2EGOA 3AVZA 1P10A 1ACBE 4LMMA 4BOHA 1O5CB 3BTHE 1RY4A 4XFQA 1AD8H 1HAXB 3DJ1A 2ZFRH 1YBOA 4Y8XA 6CHAC 2F83A 5DP9A 2V6NA 3ZZ3A 4DVAU 4AFQA 1FLEE 5ETXA 3D49H 2JIKA 1ELVA 2Y5GA 1MD7A 2P3UB 3A89A 3E6PH 2EHRA 3GDSA 4HGCA 5A0AE 3SBKA 2A4OA 2JETC 3F6UH 1C5RA 3TH4H 5FPSA 4U2WA 1TA2A 2ZWLH 2BY7X 1VB7A 2B0FA 1NY22 2FZZA 1AE5A 1JMOH 1MTWA 1ZHRA 2Y82A 2BD4A 4RKOB 1MCVA 5E6PB 1EPTA 1UMAH 1GI5A 1N7TA 3M5MA 1OWIA 3RXKA 4XSKU 2FI5E 5C5OA 3VB5A 4CHAB 1TOMH 1B5GH 2VU8E 1NRQH 1C1VH 1VA8A 1O3NA 3SJ8A 3RLEA 1SGEE 4GCHG 1WBGB 2AFQB 4KFVA 4GVUA 2G8TA 4Q2QA 1EASA 1VJ9U 2V3OH 2P8OB 5HM2A 3O8BA 2EDPA 1O2PA 1HLTH 4BTUB 3PYHA 1F7ZA 2TIOA 3LH3A 5LPFA 1XUIA 1VCQA 1FDPA 5DP5A 1VGCB 3A8BA 3SNAA 3V12A 3FANA 3MNBA 1ANBA 2B8OH 2PKSB 3OSYA 5FXLA 1CHOG 1NFXA 3DFLA 3QWCH 1FC6A 1TA6A 3UPEA 1HAVA 1P05A 1C5XB 4A5TS 1G37A 4TYDA 1IQLA 1Y5UT 2BXTH 4CRCA 1C2FA 1H9LB 1IU0A 5C1UA 1GHZA 1BZXE 4GHTA 1GMCG 1BBRK 3HKJB 3E16B 4INKA 1QLCA 1N7EA 3A88A 3SJOA 3LGUA 1AB9B 2AMDA 1ELBA 2VIPA 5TCCA 1PPFE 1TQ0B 3DT0H 2LC7A 2ZPQA 3RXQA 1P0SH 1O5AB 2V1WA 4JL7A 4GHNA 1JIMA 2GCTB 1IHSH 3UR9A 3QIKA 1AU8A 1MTVA 1ZZZA 3SGAE 1Z86A 2QCYA 1BTYA 1P02A 2G4UA 3UTUH 2W3IA 1HAGE 2DLSA 1YM0A 5T3HA 4WVPE 3ZZBA 2FO9A 2TPIZ 5GPIB 4I8HA 3DA9B 3A81A 2B9LA 2CGAA 3M7QA 1RJXB 3Q3YA 4ISOA 2ZKSA 4UFFH 5HYOA 1GDQA 1CHGA 4VGCB 1TGBA 1KWAA 4OEPA 2OCSA 5LH8A 1A46H 1O2NA 2ZU3A 4Q7ZA 2WYGA 2QXJA 1GMDG 5EXMA 3SU1A 3SOEA 1NS3A 1SGYE 3UIRA 1RFNA 2ZDLA 2ZFSA 2AGEX 5F6MA 1P57B 2Y5FA 2FOBA 2NWNA 2PTNA 1KLIH 3IWMA 5A8YA 4B1TA 1GBEA 3RXUA 2WV4A 2AWUA 2X7ZA 3LT3A 1SSXA 3QE1A 1HAYB 3NGHA 2FX6A 2ZZUH 1FPHH 1TIOA 1F92A 1KDQB 1GCTB 1PQ5A 3HPKA 1RZXA 1IQGA 4AB9A 1TGNA 2K1ZA 2WL7A 2VIOA 1MBMA 1O2GH 2RRMA 2M3MA 3ENSB 4ABDA 1O37A 5C1YA 3EGKH 2EI6A 2QBWA 2EC9H 2ZPLA 3A82A 4OAJA 1GGDB 5EW2H 4UFEH 7ESTE 4GAWA 4OS2A 5C5NA 2EA3A 3SV2H 4CRBA 1BTWA 2BDIA 2H6MA 1EJAA 1O3LA 1V6BA 1GL1A 1X8SA 1EOJA 1NROH 1ZTJA 2BQWB 5EOKA 3T29A 5GJ4B 2HE2A 3TNTA 1UK3A 3UFAA 3NPSA 4CRDA 4GSOA 1ZRKA 2ANMH 3SNDA 3GY7A 1UVPA 1T8NA 1YCPK 4MQAA 1O5FH 2YT7A 3P8NA 1ETTH 1NRPH 1FI8A 5HFFA 1YF4A 2Y80A 2P3WA 3LJJA 1TNHA 1EATA 3TGIE 1TMBH 3GJ9A 1TFXA 2A7JA 1HFDA 1FAKH 1QL9A 3GYMA 1GJ5H 5B6OA 1G3DA 1MKXH 3FZDA 4IBLH 4YESB 3S7KB 4P2AB 1FQ3A 2QT5A 3MFJA 4YO9A 4KTSA 3O8CA 1HGTH 1CGJE 3SQEE 4R2ZA 3SNBA 1HYLA 2B5TB 2I6QA 1HJAC 3MMGA 1P2KA 5FB8C 1THPB 1BRUP 2F9UA 5FPTA 1AZ8A 1PDRA 1S83A 3T62A 3L4FD 1QR3E 4CH8B 2KYLA 2D8WA 3DORA 3BEFB 4ZAEA 3H7OA 5FX6A 1FV9A 2GX4A 2PUXB 4IW4E 3SN8A 2P3FH 2JH6D 1IQKA 1R6JA 2VPHA 1BFEA 1Y3XA 1WAYB 2I4SA 2ZFFH 1HAHH 4ISNA 1MTSA 2RDLA 1AFEH 1XM1A 2FI4E 1P2IA 1A5IA 1KLTA 2C8ZB 2CF9H 4E06H 4JYTA 3M3VA 5ESTE 4ABBA 1AQ7A 3UOUA 2JKHA 2YNAA 3HGPA 4AFSA 3ZYDA 1A7SA 3B76A 2ALPA 2E7KA 2Q6DA 1GMCF 1TALA 3MWIU 2K20A 3ZZ5A 1BRCE 1FC7A 2VWMA 4MNVA 4UU5A 1V2JT 5DJ7A 2XNIA 1XMNB 2SGFE 1W14U 1UF1A 1TPOA 3KQDA 1QY6A 3P6ZB 3BPUA 2QXHA 1YLCA 1ABJH 1ANCA 1RS0A 4H6SB 4O97A 1XZ9A 2MHOA 3VEQB 3A84A 3SZNA 1Z6EA 2SNWA 3QTOH 4DW2U 2VVUA 3BTDE 4MTBA 4CBNA 3PMBB 2BB4A 1BCUH 4RI0A 1V2QT 3V3MA 1SLWB 3R69A 1JXPA 1H1BA 1AKSA 2ZHEH 3SGQE 2P16A 5HFEA 4NMOA 2ZNKH 5H4IB 2QKUA 3MO3A 1O2LA 3VXEH 2W7RA 2ZGHA 1QRWA 3RXLA 1A4WH 1NU9A 2CHAC 3ID2A 2XTTB 4WH6A 2PA1A 1RIWC 4ZROA 4Z6AH 4HOPA 2PV9B 1OWJA 1NTEA 2VSVA 1A1RA 2PW8H 3M5OA 2WPJS 1DITH 1NM6A 1V2VT 1HAZB 1HRTH 2C8XB 4JOJA 3K9XB 5T6GA 2ZPSA 1SGNE 2RA3A 3PTBA 2O2TA 1DWDH 4FUHA 2KG2A 3PDZA 5F03A 1N6EA 2AWWA 2KPKA 2V3HH 5JBBS 1O2QA 2EAQA 3ID3A 4Z8JA 1A2CH 1C2KA 2AIQA 1UFXA 2OBQA 2A0QB 5L2ZH 5IDKA 3NXPA 1TQ7B 3GCHC 3RXMA 5HEYA 3KQCA 1Y3VA 3VB3A 1SR5C 4OS4A 3U8TH 4JMYA 1WUNH 2ODQA 2EDZA 2ZPRA 3KL6A 3G01A 1FXYA 3F9FA 4NA9H 2OTVA 1WI4A 1XX9A 5GCHG 3QDZB 1WU1A 1GJ4H 2OUAA 4E7RG 2AWXA 3QO6A 1EAXA 1ZSKA 2LNCA 1C4V2 3PO1C 1XKAC 4TWYA 1E37B 1V2OT 1O38A 1N8OB 1GHAF 1P12E 2SGAA 4IMZA 1IHJA 3FVFB 2UUYA 1CBWB 2G51A 1O31A 4JCNA 2EEJA 4ZMAH 1OBXA 5F67A 1DICA 1IQJA 1GBCA 3BTFE 3ITIA 2XW9A 1FY3A 2VSPA 3M36A 1B7XB 2SGDE 4NCYA 2F0AA 2P94A 2Z9KA 4KTUA 2C90B 1UJDA 1PPEE 1TB6H 3VB7A 1A0HB 1LVYA 2HGTH 1BMMH 2A45B 1LQEA 5JDUB 4X0WU 3TH3H 2JH0D 1GI7B 2KPLA 1UJ1A 3F9GA 1XUGA 3E91A 1BE9A 4YLQH 5JPMH 1O3JA 3SU0A 4BAKB 1YP9A 2C4FH 1WCZA 2IJOB 2UUJB 2WINI 4K1EA 1OZIA 4B76A 3OX7U 3WKLA 3TK9A 2CJIA 3SUDA 2W3KA 2QF0A 1C1SA 1D9IA 1ZJDA 1TP5A 4ABAA 5A09A 5JBCS 2Z17A 3M35A 1UCYH 5EYZA 3AXAA 1Z8IB 2XBWA 1AGJA 3D23A 1CGIE 3ATKA 1GM1A 3CBZA 3TMHA 4NXQA 5GDSH 3ATWA 1KTTB 2QV1A 4ESTE 4BAQB 3A7YA 2ZGCA 1T2MA 1C1QA 4D7GA 4MPUA 1S6FA 1SPJA 4FU7A 1QAVB 2XXLA 1UCYE 3VGCC 2GP9B 1GBIA 3R0FA 4FVDA 4GLYA 4X1SU 5EU8A 1B0EA 2QA9E 7GCHG 1Y59T 1TABE 2FOEA 3K50A 4P0CA 3EGGC 2STAE 3BEIB 2J38A 1FY8E 1GJBB 2G4TA 3ZZAA 1DY9A 5HEBA 4NGAH 3RXFA 1XKBC 3LONA 4BTIB 4WY3A 4X6OA 4MPVA 3P8GA 3O46A 2ZFQH 1HAOH 3DJAA 4ZXYH 3MI4A 4D76A 3BF6H 2G5VA 4NIWA 1MQ6A 2FNEA 3RUOA 3QLPH 4Q7XA 4Q2NA 5FBEA 3RL7A 1G30B 2BHGA 4WYTA 3KN2A 1ELCA 4NA8A 4FUBA 3K1RA 4AOQA 2RA0A 3O8DA 5DP6A 2BDBA 1YCPM 4ABIA 4UU6A 1TNGA 4K1TA 4Y8ZA 2PGQB 1Q31A 3A7ZA 2IWPA 1BBRE 1P2QA 1QTFA 1J8AA 2AIPA 4Y7BA 3LNXA 2BY9X 1SGTA 5GLJA 4CRAA 3ZVEA 5AFZH 1D6RA 1C1OA 2V35A 2TGTA 1KXDA 2FODA 2RCZA 4MNWA 2ASUB 4YTAA 3BV9B 3K6ZA 1FZZA 1DXWA 1BTZA 1EP5A 1TPPA 1C2GA 4JOHA 1O2ZA 2QY0B 2NU1E 1ELGA 1KDQA 1BMAA 1C2EA 3PLPA 2QGRA 4YZUA 1DSUA 1TPSA 3EYDA 3TJVA 5DTHA 4DJZB 4LOYH 1GG6C 1TGCA 4E34A 1KXBA 3GCNA 2CSSA 2ZO3H 3ATIA 3VPKA 3ZRTA 1AMHA 2ZCLP 5DP7A 2W7SA 2J4IA 3R3GB 2BDCA 1RGWA 4RN6A 4JOGA 1P9SA 1YYY1 4DOQA 1DPOA 2PUQH 1C4U2 1AVWA 2IWOA 4FUEA 1ANEA 1QRZA 2NU0E 5E22A 4NSYA 3HPTB 3FP8E 5JB9S 1K1LA 1L1JA 1AWFH 2F91A 3UNSA 2Z9GA 2H1UA 3HGNA 4HZHA 5EPNA 3I4WA 1CVWH 3R0HA 1CA0B 1N99A 2W7UA 1WFVA 4I8KA 2SNVA 5DP8A 5JBTA 1S84A 2F9BH 1NTPA 5DP3A 4F49A 4BNRA 1KYNA 1J16A 2A5KA 4ISHH 3EA8A 1HNEE 4Q2OA 3BG4B 1OWHA 6GCHF 1IU2A 1AHTH 2HWLB 1BTUA 2NU3E 3SNEA 3RXAA 1NFUA 3M37A 2JREA 3HVQC 4GPGA 4D8NA 1MKWH 1N6DA 2ZF0H 1UTQA 2I1NA 4R0IA 1LHEH 3ZVDA 1HDTH 1YPHE 3TSWA 1CT0E 1GVKB 2F9NA 2PSYA 3LGWA 4JZEH 2C93B 1WJLA 1ZMNA 2UUFB 3A7WA 2KOMA 4XE4A 3SQHE 3PTNA 1GBBA 1ZJKA 1JIRA 4FUFA 1HAPH 1VITF 3C27B 1QB9A 2YUYA 5A2MH 2H2BA 1DVAH 2BD5A 1EZQA 4OS6A 2BQ6B 1IQMA 4SGAE 4CRFA 1NO9H 1UVUH 4Z0KA 2OP9A 1MTNC 3RDZA 3R68A 1TBRH 1O3BA 1RGQA 1ESTA 1V2PT 3S9BA 1PPZA 4CH2B 3EA7A 4UD9H 3UNRA 3DIWA 1SGPE 4NFFA 4WYUA 3RMOH 2EJYA 2J34A 2XC5A 1Z7KA 3PV4A 4WWYA 2GCHF 1A5HA 1BIOA 2DM8A 1Q3XA 5GXPA 2BMGB 3SUGA 3DUXH 2ZCHP 1K1NA 4KTCA 4B74A 3UQOA 2OQ5A 3MNXA 4FU9A 1TNLA 1TP3A 5TJXA 2G52A 2UWPA 3FP7E 2GGVB 4JOFA 1TNJA 1BRBE 2V0BA 3A8DA 1ZOMA 3RXVA 2FOMB 3BTME 3ODFA 2NU2E 6ESTA 1F5RA 1OP2A 5DGJA 3LGYA 1SGIB 2GVFA 3E0PB 1SB1H 1U6QA 1IQIA 2OMJA 3T25A 3RXPA 2HPPH 1AFQB 1LVMA 4XHVA 3OTJE 4JOKA 4OGYA 4I7YH 1NF3C 1EJNA 2ZECA 5I7ZA 1ZHPA 3UNQA 3PLKA 5DO4H 2H9EH 1J17T 4ABJA 5L2YH 1K9OE 2BOHB 4CREA 3EA9A 4H6TA 1GI4A 2IWQA 1Z8JB 3T28A 1V2NT 1C5PA 2DMZA 1K1MA 1XXFA 4ZKOU 1K21H 4X2YA 3RM2H 1EZSC 1SLXB 5LPRA 1GJDB 5C20A 4LZ1H 1O3AA 3GY5A 4YT6H 1BHXF 3H7TA 4DIHH 1TX7A 1EX3A 3P8OA 1NRNH 3GGEA 2LA8A 1D3PB 5FBIA 1LMWB 4KELA 4LZ4B 2TRMA 2Z3CA 2OBOA 1P04A 1P3CA 1W3CA 1ZTKA 1H8DH 3MNCA 3RU4D 2ZG0H 3SUEA 1P9UA 1ELDE 4O06A 3FFGA 2HOBA 4B71A 3JZ1B 4O3UA 1JRTA 5J4SA 1T4UH 3A83A 4B73A 1EAWA 2HALA 3SV8A 4DGJA 1WQSA 1UITA 1TPAE 4O9VA 1OWDA 2PKUA 5A0BA 5CHAB 1GHXH 1MZDA 1EKBB 1TNKA 1LHGH 3A7TA 3E3TA 1ZOKA 3RMNH 2PKAB 2I0LA 4ABGA 2GKVE 3LU9B 1V2KT 3MH6A 4NMRA 3CBXA 1L4ZA 2SGQE 1LCYA 1D3DB 1P2OA 4H42U 4LK4A 3QJMA 1XVMA 2BD3A 1GI2A 1DT2A 2BY8X 3QK1A 2JOAA 1DY8A 1HXEH 1DWEH 2VIQA 2FX4A 3AASA 4BTTB 3DFJA 2DLUA 1Z8RA 2DE8A 2TGDA 1ZHMA 3SU6A 2WPHS 1V2RT 4NSVA 1WV7H 1ZSLA 4X1PU 3U9AH 3EQ0H 1D3QB 4JZFH 1C1PA 3KHFA 1GBHA 1UHBB 2ALVA 4UFGH 2ZDVH 3Q00A 1I92A 1C2IA 2PFEA 4EDJA 4Y76A 1AE8H 6CHAB 1GJ6A 1NN6A 3EAJA 4OGXA 1EPTC 4K75A 3OU0A 3STIA 1ZPBA 1X6DA 4WF8A 3ZZ6A 3DD2H 1PPCE 1GI3A 4DY7B 1BA8B 1DUAA 1MBQA 3I29A 4UONA 4K2YA 1SGQE 2JETB 4HI3A 4Y8YA 2HE4A 2OINA 3BTGE 4UDWH 1XUKA 3QTVH 3M3SA 2L97A 1C5OH 1S85A 3S69A 2QKVA 1TMTH 1P2NA 4HFPB 3T27A 1E38B 1C5MD 3RXJA 7KMEH 1OP0A 3RU4T 1WSSH 2F9VA 1H8IH 2ZQ1A 3QUMP 2ZHWH 2KBSA 4DURA 1J15A 5G4BA 3PV5A 1O2MA 1EZXC 2YNBA 1QAVA 1GBFA 3ID4A 2TGPZ 3MOCA 2A7HA 4XBBA 5L30H 2KQFA 5BRRE 2AGGX 3QZRA 4Q6SA 2GMTC 2Y81A 1XXDA 8GCHG 4WMDA 3PDVA 1W0ZU 2KOJA 3M7UA 3QZQA 1O2OA 2FOHA 2HLCA 3A8AA 3CS0A 1BTHH 3EE0B 2EV8A 4D7FA 4AN7A 1NRSH 2DB5A 2XYAA 5AHGH 1W9OA 4AZ2B 4ZHMU 1ZPCA 1MFLA 5I46H 1O3GA 4F8KA 1V2UT 2O8WA 1Z1JA 2ZU5A 1BQYA 2CV3A 1V5LA 1BITA 3E90B 2D1JA 4KGAA 4XBDA 4GCHF 1YPLH 2Y6TA 2R0KA 1ZR0A 2FS8A 4X1RU 4CBOA 1P09A 1O0DH 4IS5A 2VVVA 5J4QA 3MNSA 2OC1A 2QG1A 2R2WU 3SI3H 3EDXB 1O2IA 2VZ5A 3NUMA 1O36A 3ZV9A 3ODDA 4IN1A 1XVOA 1ZGVA 3Q3KA 1C2LA 4NMQA 2ZHQH 4SGBE 4AYVB 1SLUB 3D65E 2FTMA 2PZDA 1CHOF 1S81A 1UTOA 3U1JB 2FOCA 2AGIX 3W94A 2ZU4A 4N6XA 1ZSJA 1FN8A 4Y0ZE 1BB0B 1MC7A 1M9UA 5B6LA 1NESE 3AAVA 3MTYA 3SU3A 2R4HA 3L33A 3UREA 4IC6A 1OKXA 2BY6X 1UTNA 1WFGA 3RXBA 2XWAA 2J9NA 4FVBA 4Q2KA 4FUJA 2OC7A 2Q9VA 3LDXH 1FAXA 1O3FA 4I32A 3U8RH 1FONA 1JOUB 8LPRA 5GWZA 2XBVA 2OS6A 2GZVA 5DP4A 5A8ZA 2OD3B 2VINA 1Y7NA 5E0GA 2BVXH 3L6PA 5EQRA 1KSNA 4GVCA 2DKRA 1V2LT 2UZCA 4A6LA 2D90A 1ABIH 1W10U 3TGJE 4Q3HA 1S82A 1H9IE 3GCTG 4MNYA 1ZLRA 1SFQB 2P93A 3PWBA 4RSPA 2BTCE 4AG1A 4OS7A 1SMFE 1BRAA 3MH7A 2BZAA 4NIYA 1O5GH 3MH4A 1WTGH 1FY5A 3WKMA 1GMDF 1O2JA 1C1WH 2VGCC 1QCPA 4B2AA 1QB1A 1FC9A 1ZRBA 1EB2A 3GISB 1QBVH 3HKIB 5E0JA 1T4VH 4JOPA 1FNIA 1MAXA 1O3MA 2ULLA 2CXVA 2L4TA 1OYTH 4NG9H 1UEZA 2D92A 2TBSA 1DXPA 4TY6A 2GV6A 1BJVA 1V62A 4NZLA 1Z6JH 1MH0A 3STJA 4NNLA 3ELAH 1OX1A 2BD2A 1TYNA 1TNIA 2OQSA 1GL0E 4J1YA 3PB1E 1YPKH 1LPKB 4YM9A 2GZ7A 1X5QA 3KQBA 1HBTH 2ZFPH 1EAUA 2STBE 3PMJA 1FJSA 1AWHB 2Y7ZA 1ZMJA 2AMPA 1UM1A 1C1RA 1O35A 2QIQA 5PTPA 1GHBG 2HNTF 5CMXH 1S0QA 3RXDA 4CR9A 3QGLA 4F4OC 3NCLA 1EXFA 1G32B 1J14A 3PWCA 3N7OA 3SOSA 1E36B 1HJAB 4AMHA 3KNXA 4K69A 2G55A 1FMGA 1ELFA 5C67A 1AIXH 3F9EA 2WPIS 2ZGXH 1GCDA 2KAWA 1Y5AT 1GI0A 3SUZA
chains in the Genus database with same CATH superfamily
1C1MA 2XC4A 1MAYA 1DS2E 4JJ3A 1EJMA 3KEEA 4FU8A 3TSZA 1AZZA 2BD9A 2JH5D 5HDYA 1V2WT 3MU8A 2KAIB 1GHWH 1O2RA 1HXFH 3NWUA 4WXIA 3UY9A 1GBLA 4G69A 3SHCH 3PMHB 2VWNA 1X9ZA 2ZI2H 2P95A 4YDPA 4A92A 1PPBH 3UWIA 4KP0A 3M61U 3RC5A 4FXGH 3SNCA 3O5NA 3QDOA 2KJKA 1KXCA 3A7VA 1O3EA 1ELEE 3SU2A 2YUBA 2A32A 1UK4A 2GDEH 4ZKRU 4D9QA 1SC8U 3E8LA 4HTCH 2KJDA 2FESH 4GVDA 4CR5A 1TQ3A 1D4PB 1TOCB 1E35B 2PGBB 2WPLS 2DAZA 3B8JA 1W11U 1I16A 2WYJA 2BLQA 4A7IB 1HCGA 1GHYH 1ESBA 2THFB 4Q6HA 1D6WA 2LPRA 1GMHG 1NC6A 4XD7D 1FUJA 1WH1A 3BN9A 4NMPA 1QA0A 1SQOA 2EI7A 4JZIA 2JXOA 1ELTA 3GDVA 1V6DA 3BEUA 4Y6DA 3LGVA 3TIUA 3PLBA 1U3BA 1THSH 4BXSA 1AO5A 1BTXA 3WWFA 4F55A 1SI5H 3DSPA 1HAIH 3HK3B 1C2MA 1B8QA 4IGDA 3SW2B 1EP6A 5DPAA 1MKXK 2JIZD 2CHAB 2SFAA 3SUFA 5HFBA 3F1SB 3VB4A 1C5LH 1RIWB 2PKTA 2WUBA 4X2WA 1ELAA 1ESAA 5SGAE 1QQUA 1MFGA 4ISIH 5L6NH 1L4DA 1UJUA 4X8TH 5K0HA 1G3EA 2ZHFH 2WHXA 2WPKS 1GBAA 1F0SA 1NZQH 5FPYA 2AS9A 1BBRH 1HUTH 1SQAA 2EGNA 2BD7A 1HV7A 1QGFA 3NFKA 4TPIZ 1CE5A 5A8XA 1GBKA 1FIWA 4I8JA 4WH8A 1XUJA 1VZQH 5T6DA 2PKAA 4KKDA 3ATMA 1GVZA 2EEKA 3GCHB 5LPEA 3CBYA 1UK2A 2G81E 1WHDA 2SGEE 3UOPA 3TJUA 2Z9JA 3FP6E 1PQAA 1EQ9A 3DCLA 3LH1A 2PTCE 1O30A 5G1EA 2H5DA 3OTPA 4K8YA 2VIDA 3BIUH 2OSGA 1G2LA 4BAOB 3OY5U 3PO1B 4Q2PA 3SJIA 4AG2A 2XC0A 1UTMA 2OC0A 1ANDA 3FZZA 3D62A 1GWAA 4Y7AA 3NKKA 5JYIA 2H3MA 1C5SA 2QXIA 1UHBA 1YPJH 3V13A 4K8BA 4A1TA 2OQUA 5JBAS 1UTKA 2YOLA 2OC8A 2G5MB 3W1EA 3TGKE 3UR6A 1ZMLA 4AYYB 3URDA 2WPDD 1PYTD 3QGNB 1O3OA 4Q80A 1UTJA 1IAUA 4JYVH 1N1LA 3SHWA 3SHUA 3AW1A 4JJ0A 2BD8A 3H5CB 2PHBA 1DUEA 4NWLA 1BDAA 4CHAC 2FYQA 5GCHF 2Z3EA 1QRXA 5C2ZA 2O8MA 3ZIAD 4DT4A 2FE5A 4FUIA 1JWTA 4X8VH 1C5NH 2HGAA 3LPRA 3OYPA 2P8OC 2LC6A 4P00A 4ZUHA 1XUFA 1NRRH 1VJAU 1KXAA 3K65B 1UVOA 3UWJH 1LQDB 3ZZ7A 3TK5A 1O34A 2UWLA 1VGCC 4UEHH 3LGTA 1IHTH 2DJTA 2F5YA 1JRSA 2PKSC 4B6FA 3S0NA 2W4FA 1K2I1 1SQTA 2ZDNA 3Q77A 4Y10E 2ANKH 4O3TA 2VH6A 1WQVH 2K8IA 3MU0A 4ISLA 1ARCA 5AVDA 2PWXA 1CU1A 1AB9C 1J9CH 1UEQA 1ID5H 1C1NA 2FLBH 2R2MB 1BMNH 1PQ7A 2R9PA 2V7QD 1P1DA 2A2QH 2KA9A 1CGHA 3M5LA 1WHAA 2ZEBA 2ZTYA 2RCEA 4X1QU 1GVLA 1YGCH 4FUGA 5FCRA 1X7AC 4E7NA 3ZVGA 1O2KA 2PSXA 2QC2A 2GCTC 1YCPH 2BOKA 4XBCA 3VGCB 3GY3A 4KFWA 3TJOA 1MUEB 4H4FA 1MU6B 1F2SE 4BAHB 1O2XA 3CP7A 3LNYA 1NFYA 2KOHA 4K60A 3LC3A 2JWEA 1H4WA 2QF3A 1SL3A 1W7XH 4JOEA 3GS9A 1S6HA 4YYXA 5EQSA 1O2SA 3LC5A 3MO6A 4MPAA 1WF8A 2HNTC 3PMAB 1EUFA 3IITA 1KTSB 3TNSA 4NXPA 1O39A 4VGCC 2I0IA 5F8TA 1Y3YA 4NMVA 1AVGH 1LDTT 4X2XA 4D9RA 1KXEA 3URCA 1O2YA 1A5GH 2G00A 1QB6A 2QAAA 1K1PA 4NNMA 3S9AA 1KLJH 3A8CA 5HJ1A 3UUZA 1K0HA 1S6LA 7GCHF 1W9QA 2WV5A 3FAOA 2K1QA 4ZHAA 2J94A 1EB1H 4R8TB 3I1EA 1P8VC 2ZU2A 2QF5A 1L6OA 2JILA 1AUJA 3P95A 3TK6A 2FIRH 2FCFA 5IYTA 3RXIA 1O2HA 1GCTC 2VB0A 2R0LA 3N7EA 5HFCA 3SHAH 2OLGA 3TH2H 1SG8B 4AX9H 3GOVB 1VAEA 1L1NA 2D2DA 1QBOA 2VWRA 4TPYA 1OSSA 2LP6A 2XCFA 1G36A 1O32A 1TX6A 3KCGH 2QN5T 3L3TA 1E34B 3GICB 3PS4A 2FXRA 1UCYK 1GGDC 4XOJA 5H3JA 2A4QA 2O8TA 3NRLA 4X2VA 3P92A 4LXBH 1K1IA 1ZGIA 1GI8B 4E35A 3CH8A 3UAIC 5LGOA 4WJG2 3DSGA 1LKBA 1AI8H 1QJ7B 1UHPA 5HMAA 1N6FA 2BLOA 4Y79A 2BY5X 5EGMA 1GG6B 5GNDA 1BOQA 1C5TA 3ZV8A 1DWBH 1DFPA 5HM9A 1V5QA 3SGBE 4X6NA 1NFWA 3TSVA 1H9HE 2AERH 4FETA 1OYQA 5E1YA 1W8BH 2HRVA 3E1XB 2BDYA 1YLNA 2GDDA 4I8GA 1CA8B 2FTLE 2FI3E 1GI1A 1W12U 1BUIA 4YOGA 1TRYA 1EZUC 2W6ID 1T7CA 4E05H 3S7HB 1K1JA 3K82A 1LVOA 1A61H 1U39A 4NXRA 1C2JA 2OPGA 1YC0A 2I04A 3ID1A 5IK2D 2BYAX 1W9EA 3SO3A 1SHYA 3MO9A 2ESTE 1FN6A 4GUXA 1TLDA 2WSSD 1YPGH 2BZ6H 2Z94A 4THNH 2A4RA 3KQ5A 3U69H 1SGCA 1W2KH 3VG8A 1WG6A 3RXEA 2BDGA 3P70B 1UEWA 2EGKA 3A86A 3QN7A 4OS1A 1F5LA 2W6JD 1IQFA 1V2MT 1TWXB 3BIVH 2QE7D 3CENA 2OCVB 2Z6BD 4INLA 1K22H 1QBNA 1TRNA 2BDHA 3T26A 5C3NA 4NFEA 2C8YB 3QJNA 1TGTA 2DE9A 3FY5A 2WUCA 3MYWA 2BQ7B 3RC6A 4AB8A 4I31A 3T5FH 4U32A 3MU5A 1NT1A 2H2CA 3TITA 4YLUA 1UM7A 4NMSA 3GY8A 1IOEA 2G2LA 2KAIA 3TPIZ 1CT4E 2H5CA 4OS5A 1DANH 1HPGA 3SU5A 1WF7A 2REYA 3NFLA 1TBQH 2EEGA 3NZIA 2KV8A 1SLVB 1N6YA 1MTNB 1QFKH 5EXNA 1DLEA 2PLXA 2VH0A 3W95A 2VRFA 3RXOA 1ETSH 1K32A 3F2FA 1DX5M 4TT3D 2AINA 2HVYB 2C3SA 3P8FA 1YKTA 2BM2A 4AFUA 4BANB 1VCPA 2QYIA 3B23B 3RL8A 5FAHA 1GPZA 5EJLA 1YPMH 7LPRA 2ZIQH 5JXBA 3OFND 2FS9A 1MZAA 2PDZA 2JINA 2Q6FA 5FCKA 1MTUA 2ILNA 2FWWA 2M0ZA 1BT7A 4MPXA 2O8UA 2IN2A 5A0CA 4TSFD 2AH4X 2CMYA 3KHVA 3A7XA 2OXSA 1Z71A 3RXCA 2QF4A 4O03A 1O5EH 1KXFA 2BX3A 2G5NA 2UWOA 2I6VA 1GHAG 3GCOA 2IPHA 1A0LA 1LKAA 3BTQE 1M5ZA 2O9QA 1LHDH 1WXRA 1AY6H 1UTPA 4X6PA 1Y3UA 3KZDA 1CO7E 3M7TA 3O8RA 4ABEA 3BSQA 4FUCA 4K1SA 3GY6A 3RP2A 1MKWK 1NU7B 2JJ2D 2FLRH 4NWKA 3GSLA 4K72A 2EEIA 1MD8A 3M5NA 4MDSA 1O3CA 3ZVAA 3EGHC 2J95A 5I25A 5C1XA 1QJ6B 1VITH 2J2UA 3GYLB 1FCFA 1X5RA 1GI6A 5DG6A 2YMSD 4X6MA 4DIIH 1P2MA 1N8OC 3VFEA 2ZDAH 3TJNA 3JZ2B 5EG4A 3VB6A 2UUKB 5G1DA 2QKTA 1CBWC 2DC2A 4XDEA 1C4Y2 3VXFH 1TMUH 1YLDA 2TGAA 1WYKA 2R3UA 2Q1JA 1OWKA 4UFDH 3V0XA 5ABWA 1CQQA 5BPEA 2ZDKA 3IG6B 1HIAB 4Q63A 3PROA 1O5DH 4B75A 1QJ1B 2O8LA 1GDNA 4UE7H 2FP7B 3MHWU 4AFZA 1LTOA 1UJVA 1HB0B 1TE0A 1AN1E 3B9FH 1RXPA 3I78A 3KYGA 4ZKSU 2M0VA 2GT8A 2B7DH 2ODYB 2BLVA 3PM3A 1AVXA 2M10A 2VWLA 4QT8C 1KMHB 5HGGA 3VQGA 5FL7D 2ZDMA 1ETRH 8ESTE 3RXHA 1ZYOA 4MNXA 1ZPZA 3ZZ4A 2RG3A 5TCAA 3SU4A 1A0JA 2KCPA 1UVSH 4Y11E 1X5NA 2R3YA 1T8OA 1C2HA 1SOTA 1C9PA 2VJ1A 3TLOA 3NK8A 4I33A 1SGFG 5T6FA 2LELA 4K6YA 1C5YB 2Y5HA 1F0RA 1SBWA 4JORA 1V3XA 2FOGA 3GY2A 4FUDA 5HFDA 3QGJA 1DE7H 2OZFA 2HVXA 4K5ZA 1FPCH 1OPHB 1Q3OA 3LIWA 1EPTB 1GQ4A 3P17H 4ASHA 1WIFA 5EW1H 2Q6GA 1F0TA 3I18A 1TX8A 4DT7B 1O3DA 4ZHLU 5AFYH 2BLWA 1GJ7B 6LPRA 5HEDA 1GBTA 1VR1H 3ZVFA 1SGRE 3AAUA 1UVTH 5EZ0A 1DSTA 2H9TH 4RT0A 3ZZCA 1QL7A 4MG3A 3UQVA 4ZKNU 1G2MA 2FN5A 1C1TA 4U01A 3RXRA 4YOIA 5EODA 2XBXA 1O33A 2ODPA 3OEHD 2YT8A 2WPMS 4J2YB 4K3JA 1Y5BT 1LPGB 1IQNA 1SHHB 4DCDA 1C5QA 1LPZB 1C9TA 3GABA 1C2DA 1BJUA 2AYWA 3A87A 5EPYA 1O2UA 3SJ9A 5ESBA 3DJ3A 3QX5H 4AGKA 2GV7A 2LUIA 3A80A 3HATH 4JZDH 1HAVB 1JBUH 3U98H 2K0QA 2Q3GA 3ESTA 2GMTB 1P2JA 2GZ9A 5AF9H 2GJGA 2F4LA 5B42A 1FIZA 4A1VA 4MVNA 2EDVA 4WXVA 4K78A 9ESTA 5F8ZA 3GY4A 1GBDA 3ZVCA 2ZPMA 1L2EA 4ABHA 5F3XA 4L8NA 1WTHD 4BAMB 4MLFB 2FMJA 1Z1IA 1OBYA 2XWBI 5A2PA 1KY9A 5E2OA 1CT2E 2F9OA 2AEIH 2D26C 2IOTA 1P01A 3OY6U 1S5SA 1W13U 1PQ8A 1QL8A 1HJ9A 4TWWA 1K1OA 3CC0A 4FGMA 2ZFTA 8GCHF 3PV2A 1ARBA 3DSOA 8KME2 1V2ST 4NIXA 1FX0B 2VVCA 1V1TA 2PR3A 4RKJB 3KDGA 1X45A 2Z3DA 3HPMA 2ZA5A 5EQQA 1IQEA 1GJ9B 2A4GA 2ZGJA 4B2CA 1L1GA 4B6EA 1GBMA 1W0YH 3F68H 1QIXB 3KQEA 3Q3XA 1E0FD 5DKMA 1RGRA 1P3EA 2KCOA 1WOFA 3I77A 4B2BA 4JZ1A 4F48B 2ZTXA 1SGDE 2FYRA 1SFIA 2ZC9H 3ZZ8A 4ABFA 2H2ZA 1QHRB 1MQ5A 2A1DB 5DN6D 2W5EA 6GCHG 4K76A 2BX4A 1OP8A 1UTLM 4CRGA 2FOAA 4Y71A 2XBYA 5FX5A 3U1IB 3TVJB 3VQFA 1Z8GA 1PPHE 1PYTC 2YTWA 4YXWD 3SV7A 4IC5A 1O3IA 5KGOA 2VWOA 4Z33A 3RMLH 1MU8B 1P06A 3ZZDA 3BTTE 1PJPA 1TGSZ 1PPGE 3RXGA 2V90A 1CA0C 1DDJA 4Y0YE 2CSJA 9LPRA 3ZYEA 1GBJA 2GT7A 2VIVA 1O3KA 1GDUA 3F9HA 4JK5A 2MX6A 5D13A 5HXFA 4MPWA 2PNTA 3BG4C 3LJOA 3M3TA 1WDIA 1QA7A 1GJCB 1P1EA 4NIVA 1A3EH 1VCWA 1VITG 1GJ8B 5FHTA 3BTWE 5K7RA 2A5AA 3BTEE 5EXLA 4PQWA 1C5WB 1U38A 2KRGA 5E21A 3DHKH 1O3PB 1G9IE 5F8XA 2Z7FE 3LKWA 2VGCB 4X1NU 1DOJA 1OHHD 2F3CE 1P11E 2EI8A 4YT7H 3SV6A 2GD4B 1RTKA 1QNJA 1BMLA 3KGPA 2ENOA 1T8LA 1GHVH 3U8OH 2FDAA 1SOZA 1AUTC 1DWCH 2ZQ2A 4A1XA 2FM2A 1BHXB 2GCHG 1EFRD 1LHFH 1B0FA 2BDAA 3GCTF 2M5TA 3GDUA 2NU4E 1D3TB 2WV9A 5GIBA 2GTBA 2IWNA 1S0RA 2M2AA 2BXUH 3MU1A 1LHCH 2A2XH 2D8IA 1OWEA 1QAUA 1THRH 1XUHA 2Z9IA 2CF8H 1U37A 3Q76A 4INHA 3SV9A 5HIZA 4Q7YA 4TY7A 4NA7A 1KEFA 2FPZA 1INCA 2A31A 3MH5A 1UEPA 3SI4H 1G3CA 2M0UA 4BXWA 4NZQA 2ZTZA 2KL1A 2IJD1 3BTKE 1O5BB 5E0HA 1T8MA 2EXGA 1LVBA 2FOFA 4DG4A 2XCNA 2DUCA 1MMJN 1A3BH 2VNTA 1RRKA 4YOJA 3LOXA 3SORA 2VIWA 3BG8A 4AORA 5JB8S 3KIDU 5C17A 1O3HA 5ILBA 1Y3WA 1H8ED 3RC4A 1C5UA 5DK1A 1C1UH 1EAIA 2ZHDA 2OGPA 1N7FA 3RMMH 1NBME 1N6XA 1SVPA 2H3LA 1T32A 4ZXXH 3S9CA 3K2UA 1K28D 3RM0H 4E3BA 3E17A 3RLYH 1T31A 3CYYA 3JXTA 1FY4A 2H9HA 2KJPA 4REYA 5E2PA 5C0TA 1GHBF 1FY1A 1AFQC 1QQ4A 1TAWA 1PFXC 2P59A 1Q7XA 1OBZA 4I8LA 1OOKB 2P3TB 1ORFA 2BVRH 2BYGA 2J92A 4IN2A 4U30A 2C8WB 1RTLA 2XRCA 3T2NA 4NMTA 1TRMA 4M7GA 2L4SA 1TONA 2A7CA 2Z9LA 1DLKB 1YBWA 4JK6A 4ZCNA 3A85A 1WI2A 2F9PA 3V7TA 2CS5A 3RLWH 3NCVA 3K6YA 1GI9B 1AKSB 1V2TT 2ZCKP 1UO6A 3RXSA 5E8EH 3SZEA 3WY8A 1QZ8A 1LO6A 1BTPA 1YPEH 1NPMA 1D5GA 2HPQH 1F0UA 3SJKA 2A5IA 1O2VA 2GZ8A 4HOPB 4ZH8A 4PROA 1EOLA 5CE1A 4WMFA 1OXGA 1F5KU 1IQHA 1MCTA 4X8UH 3ZZ9A 2ZGBH 4IMQA 2AMQA 1RTFB 1C5ZB 1ZUBA 5HETA 1OS8A 1CSOE 1KIGH 3HK6B 1ZTLA 3ZVBA 1GQ5A 2BVSH 5CHAC 1QURH 2LOBA 2EEHA 1SGFA 2M0TA 1HJ8A 1C5VA 2SGPE 4X8SH 4OEOA 2ZU1A 3TU7H 1W7GH 1Q2WA 3MU4A 1L0ZA 2CN0H 3AW0A 1G9OA 1Z87A 5HF1A 1G3BA 1Y8TA 2HNTE 1O2WA 4ASUD 1DM4B 3RXTA 1RD3B 4JYUH 2FEQH 1GMHF 1YPHC 1Q3PA 3SFJA 4WMEA 1P03A 4GHQA 3ATLA 5EJZA 1HIAA 2W26A 3KZEA 5HF4A 4AGJA 2ANWA 3RU4E 2I6SA 2QXGA 4RT1A 1GJAB 1O2TA 3CS7A 3E0NB 4H11A 1TBZH 1VJ6A 2ZP0H 3LGIA 3C1KA 3KF2A 1VKYA 2Y7XA 5E11A 2ANYA 3AK5A 2EGOA 3AVZA 1P10A 2IPQX 1ACBE 4LMMA 4OM9A 4BOHA 1O5CB 3BTHE 1RY4A 4XFQA 1AD8H 1HAXB 2L6OA 3DJ1A 2ZFRH 1YBOA 4Y8XA 6CHAC 2F83A 5DP9A 2V6NA 3ZZ3A 4DVAU 4AFQA 1FLEE 5ETXA 3D49H 5CHBA 2JIKA 1ELVA 2Y5GA 1MD7A 2P3UB 3A89A 3E6PH 2EHRA 3GDSA 4HGCA 5A0AE 3SBKA 2A4OA 2JETC 3F6UH 1C5RA 3TH4H 5FPSA 4U2WA 1TA2A 2ZWLH 2BY7X 1VB7A 2B0FA 3OE7D 1NY22 2FZZA 1AE5A 1JMOH 1MTWA 1ZHRA 2Y82A 2BD4A 4RKOB 1MCVA 2KR7A 5E6PB 1EPTA 1UMAH 1GI5A 1N7TA 3M5MA 1OWIA 3RXKA 4XSKU 2FI5E 5C5OA 3VB5A 4CHAB 1TOMH 1B5GH 2VU8E 1NRQH 1C1VH 1VA8A 1O3NA 3SJ8A 2J5UA 3RLEA 1SGEE 4GCHG 1WBGB 2AFQB 4KFVA 4GVUA 2G8TA 4Q2QA 1EASA 1VJ9U 2V3OH 2P8OB 5HM2A 3O8BA 5C94A 2EDPA 1O2PA 1HLTH 4BTUB 3PYHA 2JJ1D 1F7ZA 2TIOA 3LH3A 5LPFA 1XUIA 1VCQA 1FDPA 5DP5A 1VGCB 3A8BA 3SNAA 3V12A 3FANA 3MNBA 1ANBA 2B8OH 2PKSB 3OSYA 5FXLA 1CHOG 1NFXA 3DFLA 3QWCH 1FC6A 1TA6A 5DSFA 3UPEA 1HAVA 1P05A 1C5XB 4A5TS 1G37A 4TYDA 1IQLA 1Y5UT 2BXTH 4CRCA 1C2FA 1H9LB 1IU0A 5C1UA 1GHZA 1BZXE 4GHTA 1GMCG 1BBRK 3HKJB 3E16B 4INKA 1QLCA 1N7EA 3A88A 3SJOA 3LGUA 1AB9B 2AMDA 1ELBA 2VIPA 5TCCA 1PPFE 1TQ0B 3DT0H 4HG6A 2LC7A 2ZPQA 2JSNA 3RXQA 1P0SH 1O5AB 2V1WA 4JL7A 4GHNA 1JIMA 2GCTB 5F53A 1IHSH 3KYFA 3UR9A 3QIKA 1AU8A 1MTVA 1ZZZA 3SGAE 1Z86A 2QCYA 1BTYA 1P02A 2G4UA 3UTUH 2W3IA 1HAGE 2DLSA 2YMSC 1YM0A 5T3HA 4WVPE 3ZZBA 2FO9A 2TPIZ 5GPIB 4I8HA 3DA9B 3A81A 2B9LA 2CGAA 3M7QA 1RJXB 3Q3YA 4ISOA 2ZKSA 4UFFH 5HYOA 1GDQA 1CHGA 3F0OA 4VGCB 1TGBA 1KWAA 4OEPA 2OCSA 5LH8A 1A46H 1O2NA 2ZU3A 4Q7ZA 2WYGA 2QXJA 1GMDG 5EXMA 3SU1A 3SOEA 1NS3A 1SGYE 3UIRA 4XRNA 1RFNA 2ZDLA 2ZFSA 2AGEX 5F6MA 1P57B 2Y5FA 2FOBA 2NWNA 2PTNA 1KLIH 5EJ1A 3IWMA 5A8YA 4B1TA 1GBEA 3RXUA 2WV4A 2AWUA 2X7ZA 3LT3A 1SSXA 4M9FA 3QE1A 1HAYB 3NGHA 2FX6A 2ZZUH 1FPHH 1F92A 1KDQB 1TIOA 1GCTB 1PQ5A 3HPKA 1RZXA 1IQGA 4AB9A 1TGNA 2K1ZA 2WL7A 2VIOA 1MBMA 1O2GH 2RRMA 2M3MA 3ENSB 4ABDA 1O37A 5C1YA 3EGKH 2EI6A 2QBWA 2EC9H 2ZPLA 3A82A 4OAJA 1GGDB 5EW2H 4UFEH 7ESTE 4GAWA 4OS2A 5C5NA 2EA3A 3SV2H 4CRBA 1BTWA 2BDIA 2H6MA 1EJAA 1O3LA 1V6BA 1GL1A 1X8SA 1EOJA 1NROH 1ZTJA 2BQWB 5EOKA 3T29A 1E1QD 5GJ4B 2HE2A 3TNTA 1UK3A 3UFAA 3NPSA 4CRDA 4GSOA 1ZRKA 2ANMH 3SNDA 3GY7A 1UVPA 1T8NA 1YCPK 4MQAA 1O5FH 2YT7A 3P8NA 1ETTH 1NRPH 1FI8A 5HFFA 1YF4A 2Y80A 2P3WA 3LJJA 1TNHA 1EATA 3TGIE 1TMBH 3GJ9A 1TFXA 2A7JA 1HFDA 1FAKH 1QL9A 3GYMA 1GJ5H 1UW7A 5B6OA 1G3DA 1MKXH 3FZDA 4IBLH 4YESB 3S7KB 4P2AB 1FQ3A 2QT5A 3MFJA 4YO9A 4KTSA 3O8CA 1HGTH 1CGJE 3SQEE 4R2ZA 3SNBA 1HYLA 2B5TB 2I6QA 2HLDD 1HJAC 3MMGA 1P2KA 5FB8C 2J98B 1THPB 1BRUP 3UB0A 2F9UA 5FPTA 1AZ8A 1W0KD 1PDRA 1S83A 3T62A 3L4FD 1QR3E 4CH8B 2KYLA 2D8WA 3DORA 3BEFB 4ZAEA 3H7OA 5FX6A 2VBCA 1FV9A 2GX4A 2PUXB 4IW4E 3SN8A 2P3FH 2JH6D 1IQKA 1R6JA 2VPHA 1BFEA 1Y3XA 1WAYB 2I4SA 2ZFFH 1HAHH 4ISNA 1MTSA 2RDLA 1AFEH 1XM1A 2FI4E 1P2IA 2V3MA 1A5IA 1KLTA 2C8ZB 2CF9H 4E06H 4JYTA 3M3VA 5ESTE 4ABBA 1AQ7A 3UOUA 2JKHA 2YNAA 3HGPA 4AFSA 3ZYDA 1A7SA 3B76A 2ALPA 2E7KA 2Q6DA 1GMCF 1TALA 3MWIU 2K20A 3ZZ5A 1BRCE 1FC7A 2VWMA 4MNVA 4UU5A 1V2JT 5DJ7A 2XNIA 1XMNB 2SGFE 1W14U 1UF1A 2CK3D 1TPOA 3KQDA 1QY6A 3KDKA 3P6ZB 3BPUA 2QXHA 1YLCA 1ABJH 1ANCA 1RS0A 4H6SB 5HIYA 4O97A 1XZ9A 2MHOA 3VEQB 3A84A 3SZNA 1Z6EA 2SNWA 3QTOH 4DW2U 2VVUA 3BTDE 4MTBA 4CBNA 3PMBB 2BB4A 1BCUH 4RI0A 1V2QT 3V3MA 1SLWB 3R69A 1JXPA 1H1BA 1AKSA 2ZHEH 1SKYE 3SGQE 2P16A 5C0UA 5HFEA 4NMOA 2ZNKH 5H4IB 4AC9A 2QKUA 3MO3A 1O2LA 3VXEH 2W7RA 2ZGHA 1QRWA 3RXLA 1A4WH 1NU9A 2CHAC 3ID2A 2XTTB 4WH6A 2PA1A 1RIWC 4ZROA 4Z6AH 4HOPA 1E1RD 2PV9B 1OWJA 1NTEA 2VSVA 1A1RA 2PW8H 3M5OA 2WPJS 1DITH 1NM6A 1V2VT 1HAZB 1HRTH 2C8XB 4JOJA 3K9XB 5T6GA 2ZPSA 1SGNE 2RA3A 3PTBA 2O2TA 1DWDH 4FUHA 2KG2A 3PDZA 5F03A 1N6EA 2AWWA 3FOAA 2KPKA 2V3HH 3FO8D 5JBBS 1O2QA 2EAQA 3ID3A 4Z8JA 1A2CH 1C2KA 2AIQA 1UFXA 2OBQA 3N99A 2A0QB 5L2ZH 5IDKA 3NXPA 1TQ7B 3GCHC 3RXMA 5CDFE 5HEYA 3KQCA 1Y3VA 3VB3A 1SR5C 4OS4A 3U8TH 4JMYA 1WUNH 2ODQA 2EDZA 2ZPRA 3KL6A 3G01A 1FXYA 3F9FA 4NA9H 2OTVA 1WI4A 1XX9A 5GCHG 3QDZB 1WU1A 1GJ4H 2OUAA 4E7RG 2AWXA 3QO6A 1EAXA 1ZSKA 2LNCA 1C4V2 3PO1C 1XKAC 4TWYA 1E37B 1V2OT 1O38A 1N8OB 1GHAF 1P12E 2SGAA 4IMZA 1IHJA 3FVFB 2UUYA 1CBWB 2G51A 1O31A 4JCNA 2EEJA 4ZMAH 1OBXA 5F67A 1DICA 1IQJA 1GBCA 3BTFE 3ITIA 2XW9A 1FY3A 5KEDA 2VSPA 1COWD 3M36A 1B7XB 2SGDE 4NCYA 2F0AA 2P94A 2Z9KA 4KTUA 2C90B 1UJDA 1PPEE 1TB6H 3VB7A 1A0HB 1LVYA 2HGTH 1BMMH 2A45B 1LQEA 5JDUB 4X0WU 3TH3H 2JH0D 1GI7B 2KPLA 1UJ1A 3F9GA 1XUGA 3E91A 1BE9A 4YLQH 5JPMH 1O3JA 2XNDD 3SU0A 4BAKB 1YP9A 2C4FH 1WCZA 2IJOB 2UUJB 2WINI 4K1EA 1OZIA 4B76A 3OX7U 3WKLA 3TK9A 2CJIA 2KZ4A 3SUDA 2W3KA 2QF0A 1C1SA 1H8HD 1D9IA 1ZJDA 1TP5A 1E79D 4ABAA 5A09A 5JBCS 2Z17A 3M35A 1UCYH 5EYZA 3AXAA 1Z8IB 2XBWA 1AGJA 3D23A 1CGIE 3ATKA 4FLNA 1GM1A 3CBZA 3TMHA 4NXQA 5GDSH 3ATWA 1KTTB 2QV1A 4ESTE 4BAQB 3A7YA 2ZGCA 1T2MA 1C1QA 4D7GA 4MPUA 1S6FA 1SPJA 4FU7A 1QAVB 2XXLA 2RDEA 1UCYE 3VGCC 2GP9B 1GBIA 3R0FA 4FVDA 4GLYA 3OAAD 4X1SU 5EU8A 1B0EA 2QA9E 7GCHG 1Y59T 1TABE 2FOEA 3K50A 4P0CA 3EGGC 2KM0A 2STAE 3BEIB 2J38A 1FY8E 1GJBB 2G4TA 3ZZAA 1DY9A 5HEBA 4NGAH 3RXFA 1XKBC 3LONA 4BTIB 4WY3A 4X6OA 4MPVA 3P8GA 3O46A 2ZFQH 1HAOH 3DJAA 3MQKC 4ZXYH 3MI4A 4D76A 3BF6H 2G5VA 4NIWA 3U28C 1MQ6A 2FNEA 3RUOA 3QLPH 4Q7XA 4Q2NA 5FBEA 3RL7A 1G30B 2BHGA 4WYTA 3KN2A 3WWBA 1ELCA 4NA8A 4FUBA 3FKSD 3K1RA 4AOQA 2RA0A 3O8DA 5DP6A 2BDBA 1YCPM 4ABIA 4UU6A 1TNGA 4K1TA 4Y8ZA 2PGQB 1Q31A 2PP6A 3A7ZA 2IWPA 1BBRE 1P2QA 1QTFA 1J8AA 2AIPA 4Y7BA 3SYJA 3LNXA 2BY9X 1SGTA 5GLJA 4CRAA 3ZVEA 5AFZH 1D6RA 1C1OA 2V35A 2TGTA 1KXDA 2FODA 3F0PA 2OK5A 2RCZA 4MNWA 2ASUB 4YTAA 3BV9B 3K6ZA 1FZZA 1DXWA 1BTZA 1EP5A 1TPPA 1C2GA 4JOHA 1O2ZA 2QY0B 2NU1E 1ELGA 1KDQA 3OEED 1BMAA 1C2EA 3PLPA 2QGRA 4YZUA 1DSUA 2KCAA 1TPSA 3EYDA 3TJVA 5DTHA 4DJZB 4LOYH 1GG6C 4E34A 1TGCA 1KXBA 3GCNA 2CSSA 2ZO3H 3ATIA 3VPKA 3ZRTA 2JDID 1AMHA 3WW7A 2ZCLP 5DP7A 2W7SA 2J4IA 3R3GB 2BDCA 1RGWA 4RN6A 4JOGA 1P9SA 1YYY1 4DOQA 1DPOA 2PUQH 1C4U2 1AVWA 2IWOA 4FUEA 1ANEA 1QRZA 2NU0E 5E22A 4NSYA 3HPTB 3FP8E 5JB9S 1K1LA 1L1JA 1AWFH 2F91A 3UNSA 2Z9GA 1SQRA 2H1UA 3HGNA 4HZHA 3I4WA 1CVWH 3R0HA 1CA0B 3F2HA 5EPNA 1N99A 2W7UA 1WFVA 4I8KA 2SNVA 5DP8A 5JBTA 1S84A 3CNRA 2F9BH 1NTPA 5DP3A 4F49A 4BNRA 1KYNA 1J16A 2A5KA 2EQNA 4ISHH 2KFWA 1HNEE 3EA8A 4Q2OA 3BG4B 1OWHA 6GCHF 1IU2A 1AHTH 2HWLB 1BTUA 2NU3E 3SNEA 3RXAA 1NFUA 3M37A 2JREA 3HVQC 4GPGA 4D8NA 1MKWH 1N6DA 2ZF0H 1UTQA 4FOUC 2I1NA 4R0IA 2J98A 1LHEH 3ZVDA 1HDTH 1YPHE 3TSWA 1CT0E 1GVKB 2F9NA 2PSYA 3LGWA 4JZEH 2C93B 1WJLA 1ZMNA 2UUFB 3A7WA 2KOMA 4XE4A 3SQHE 3PTNA 1GBBA 1ZJKA 1JIRA 4FUFA 1HAPH 1VITF 3C27B 1QB9A 2YUYA 5A2MH 3N7DA 2H2BA 1DVAH 2BD5A 1EZQA 4OS6A 5IL9A 2BQ6B 1IQMA 1NBMD 4SGAE 4CRFA 1NO9H 1UVUH 4Z0KA 2OP9A 1MTNC 3RDZA 3R68A 1TBRH 1O3BA 1RGQA 1ESTA 1V2PT 3S9BA 1PPZA 4CH2B 3EA7A 5KECA 4UD9H 3UNRA 3DIWA 1SGPE 4NFFA 4WYUA 3RMOH 2EJYA 2J34A 2XC5A 1Z7KA 3PV4A 4WWYA 2GCHF 1A5HA 1BIOA 2DM8A 1Q3XA 5GXPA 2BMGB 3SUGA 3DUXH 2ZCHP 1K1NA 4KTCA 4B74A 3UQOA 2OQ5A 3MNXA 4FU9A 1TNLA 1YWUA 1TP3A 5TJXA 1BMFD 2G52A 2UWPA 3FP7E 2GGVB 4JOFA 1TNJA 1BRBE 2V0BA 3A8DA 1ZOMA 3RXVA 2FOMB 3BTME 3ODFA 2NU2E 6ESTA 1F5RA 1OP2A 5DGJA 3LGYA 1SGIB 2GVFA 3E0PB 1SB1H 1U6QA 1IQIA 2OMJA 3T25A 3RXPA 2HPPH 1AFQB 2XOKD 1LVMA 4XHVA 3OTJE 4JOKA 4OGYA 4I7YH 1NF3C 1EJNA 2ZECA 5I7ZA 1ZHPA 3UNQA 3PLKA 5DO4H 2H9EH 1J17T 4ABJA 2KX4A 5L2YH 1K9OE 2WZQA 3H09A 2BOHB 4CREA 3EA9A 3EE7A 4H6TA 1GI4A 2IWQA 1Z8JB 3T28A 1V2NT 1C5PA 2DMZA 1K1MA 1XXFA 4ZKOU 1K21H 4X2YA 3RM2H 1EZSC 1SLXB 5LPRA 1GJDB 5C20A 4LZ1H 1O3AA 3GY5A 4YT6H 1BHXF 3H7TA 2F43B 4DIHH 1TX7A 1EX3A 3P8OA 1NRNH 3GGEA 2LA8A 1D3PB 5FBIA 1LMWB 4Q4LA 4KELA 4LZ4B 2TRMA 2Z3CA 2OBOA 1P04A 1P3CA 1W3CA 1ZTKA 1H8DH 3MNCA 3RU4D 2ZG0H 3SUEA 1P9UA 1ELDE 4O06A 3FFGA 2HOBA 4B71A 4ACBA 3JZ1B 4O3UA 1JRTA 5J4SA 1T4UH 1W0JD 3A83A 1EAWA 2HALA 4B73A 3SV8A 4DGJA 1WQSA 1UITA 1TPAE 4O9VA 1OWDA 2PKUA 5A0BA 5CHAB 1GHXH 1MZDA 3F2GA 1EKBB 1TNKA 1LHGH 3A7TA 3E3TA 1ZOKA 3RMNH 2PKAB 2I0LA 4ABGA 2GKVE 3LU9B 1V2KT 3MH6A 4NMRA 3CBXA 1L4ZA 2SGQE 1LCYA 1D3DB 1P2OA 4H42U 4LK4A 3QJMA 1XVMA 2BD3A 1GI2A 1DT2A 2BY8X 3QK1A 4Z1MD 2JOAA 1DY8A 1HXEH 1DWEH 2VIQA 5T1VA 2FX4A 3AASA 4BTTB 3DFJA 2DLUA 1Z8RA 2DE8A 2TGDA 1ZHMA 3SU6A 2WPHS 1V2RT 4NSVA 1WV7H 1ZSLA 4X1PU 3U9AH 3EQ0H 1D3QB 4JZFH 1C1PA 3KHFA 1GBHA 1UHBB 2ALVA 4UFGH 2ZDVH 3Q00A 1I92A 1C2IA 2PFEA 4EDJA 4Y76A 1AE8H 6CHAB 1GJ6A 1NN6A 3EAJA 4OGXA 1EPTC 4K75A 3OU0A 3STIA 1ZPBA 1X6DA 4WF8A 3ZZ6A 3DD2H 1PPCE 1GI3A 4DY7B 1BA8B 1DUAA 1MBQA 3I29A 4UONA 4K2YA 1SGQE 2JETB 2AHME 4HI3A 4Y8YA 2HE4A 2OINA 3BTGE 4UDWH 1XUKA 3QTVH 3M3SA 2L97A 1C5OH 1S85A 3S69A 2QKVA 1TMTH 1P2NA 4HFPB 3T27A 1E38B 1C5MD 3RXJA 7KMEH 1OP0A 3RU4T 1WSSH 2F9VA 1H8IH 2ZQ1A 3QUMP 2ZHWH 2KBSA 4DURA 1J15A 5G4BA 3PV5A 1O2MA 1EZXC 2YNBA 2RFKC 1QAVA 1GBFA 3ID4A 2TGPZ 3MOCA 2A7HA 4XBBA 5L30H 2KQFA 5BRRE 2AGGX 3QZRA 4Q6SA 2GMTC 2Y81A 1XXDA 8GCHG 4WMDA 3PDVA 1W0ZU 2KOJA 3M7UA 3QZQA 1O2OA 2FOHA 2HLCA 3A8AA 3CS0A 1BTHH 3EE0B 2EV8A 4D7FA 4AN7A 1NRSH 2DB5A 2XYAA 5AHGH 1YY3A 1W9OA 4AZ2B 2GEFA 4ZHMU 1ZPCA 1MFLA 5I46H 1O3GA 4F8KA 1V2UT 2O8WA 1Z1JA 2ZU5A 1BQYA 2CV3A 1V5LA 1BITA 3E90B 2D1JA 4KGAA 4XBDA 4GCHF 1YPLH 2Y6TA 2R0KA 1ZR0A 2FS8A 4X1RU 4CBOA 1P09A 1O0DH 4IS5A 2VVVA 5J4QA 3MNSA 2OC1A 2QG1A 2R2WU 3SI3H 3EDXB 1O2IA 2VZ5A 3NUMA 1O36A 3ZV9A 3ODDA 4IN1A 1XVOA 1ZGVA 3Q3KA 5HKKD 1C2LA 4NMQA 2ZHQH 4SGBE 4AYVB 1SLUB 3D65E 2FTMA 2PZDA 1CHOF 1S81A 1UTOA 3U1JB 3PRBA 2FOCA 2AGIX 3W94A 2ZU4A 4N6XA 1ZSJA 1FN8A 4Y0ZE 5EIYA 1BB0B 1MC7A 2YMSB 1M9UA 5B6LA 1NESE 3AAVA 3MTYA 3SU3A 2R4HA 3L33A 3UREA 4IC6A 1OKXA 2BY6X 1UTNA 1WFGA 3RXBA 2XWAA 2J9NA 4FVBA 4Q2KA 4FUJA 2OC7A 2Q9VA 3LDXH 1FAXA 1O3FA 4I32A 3U8RH 1FONA 1JOUB 8LPRA 5GWZA 2XBVA 2OS6A 2GZVA 5DP4A 5A8ZA 2OD3B 2VINA 1Y7NA 5E0GA 2BVXH 3L6PA 5EQRA 1KSNA 4I86A 1MABB 4GVCA 2DKRA 1V2LT 2UZCA 4ACAA 4A6LA 2D90A 1ABIH 1W10U 3TGJE 4Q3HA 1S82A 1H9IE 3GCTG 4MNYA 1ZLRA 1SFQB 2P93A 3PWBA 4RSPA 2BTCE 4AG1A 4OS7A 1SMFE 1BRAA 3MH7A 2BZAA 4NIYA 1O5GH 3MH4A 1WTGH 1FY5A 3WKMA 1GMDF 1O2JA 3F3BA 1C1WH 2VGCC 1QCPA 4B2AA 1QB1A 1FC9A 1ZRBA 2J97A 2EY4C 3FN8A 1EB2A 3GISB 1QBVH 3HKIB 5E0JA 1T4VH 4JOPA 1FNIA 1MAXA 1O3MA 2ULLA 2CXVA 2L4TA 1OYTH 4NG9H 1UEZA 2D92A 2TBSA 1DXPA 4TY6A 2GV6A 1BJVA 1V62A 4NZLA 1Z6JH 1MH0A 3STJA 4NNLA 3ELAH 1OX1A 2KCYA 2BD2A 1TYNA 1TNIA 2OQSA 1GL0E 4J1YA 3PB1E 1YPKH 1LPKB 2L74A 4YM9A 2GZ7A 1X5QA 3KQBA 1HBTH 2ZFPH 1EAUA 2STBE 3PMJA 1FJSA 1AWHB 2Y7ZA 1ZMJA 4P02A 2AMPA 1UM1A 1C1RA 1O35A 2QIQA 5PTPA 1GHBG 2HNTF 5CMXH 1S0QA 3RXDA 4CR9A 3QGLA 4F4OC 3NCLA 1EXFA 1G32B 1J14A 3PWCA 3N7OA 3SOSA 1E36B 1HJAB 4AMHA 3KNXA 4K69A 3PRDA 2G55A 1FMGA 1ELFA 5C67A 1AIXH 3F9EA 2WPIS 2ZGXH 1GCDA 2KAWA 1Y5AT 1GI0A 3SUZA
chains in the Genus database with same CATH topology
1C1MA 2XC4A 1MAYA 1DS2E 4JJ3A 1EJMA 3KEEA 4FU8A 3TSZA 1AZZA 2BD9A 2JH5D 5HDYA 1V2WT 3MU8A 2KAIB 1GHWH 1O2RA 1HXFH 3NWUA 4WXIA 3UY9A 1GBLA 4G69A 3SHCH 3PMHB 2VWNA 1X9ZA 2ZI2H 2P95A 4YDPA 4A92A 1PPBH 3UWIA 4KP0A 3M61U 3RC5A 4FXGH 3SNCA 3O5NA 3QDOA 2KJKA 1KXCA 3A7VA 1O3EA 1ELEE 3SU2A 2YUBA 2A32A 1UK4A 2GDEH 4ZKRU 4D9QA 1SC8U 3E8LA 4HTCH 2KJDA 2FESH 4GVDA 4CR5A 1TQ3A 1D4PB 1TOCB 1E35B 2PGBB 2WPLS 2DAZA 3B8JA 1W11U 1I16A 2WYJA 2BLQA 4A7IB 1HCGA 1GHYH 1ESBA 2THFB 4Q6HA 1D6WA 2LPRA 1GMHG 1NC6A 1FUJA 1WH1A 3BN9A 4NMPA 1QA0A 1SQOA 2EI7A 4JZIA 2JXOA 1ELTA 3GDVA 1V6DA 3BEUA 4Y6DA 3LGVA 3TIUA 3PLBA 1U3BA 1THSH 4BXSA 1AO5A 1BTXA 1SI5H 1HAIH 3HK3B 1C2MA 1B8QA 4IGDA 3SW2B 1EP6A 5DPAA 1MKXK 2SFAA 2CHAB 3SUFA 3VB4A 5HFBA 3F1SB 1C5LH 1RIWB 2PKTA 2WUBA 4X2WA 1ELAA 1ESAA 5SGAE 1QQUA 1MFGA 4ISIH 5L6NH 1L4DA 1UJUA 4X8TH 5K0HA 1G3EA 2ZHFH 2WPKS 1GBAA 1F0SA 1NZQH 5FPYA 2AS9A 1BBRH 1HUTH 1SQAA 2EGNA 2BD7A 1HV7A 1QGFA 3NFKA 4TPIZ 1CE5A 5A8XA 1GBKA 1FIWA 4I8JA 4WH8A 1XUJA 1VZQH 5T6DA 2PKAA 4KKDA 3ATMA 1GVZA 2EEKA 3GCHB 5LPEA 3CBYA 1UK2A 2G81E 1WHDA 2SGEE 3UOPA 3TJUA 2Z9JA 3FP6E 1PQAA 1EQ9A 3LH1A 2PTCE 1O30A 5G1EA 2H5DA 3OTPA 4K8YA 2VIDA 3BIUH 2OSGA 1G2LA 4BAOB 3OY5U 3PO1B 4Q2PA 3SJIA 4AG2A 2XC0A 1UTMA 2OC0A 1ANDA 3FZZA 3D62A 1GWAA 4Y7AA 3NKKA 5JYIA 2H3MA 1C5SA 2QXIA 1UHBA 1YPJH 3V13A 4K8BA 4A1TA 2OQUA 5JBAS 1UTKA 2YOLA 2OC8A 2G5MB 3TGKE 3UR6A 1ZMLA 4AYYB 3URDA 1PYTD 3QGNB 1O3OA 4Q80A 1UTJA 1IAUA 4JYVH 1N1LA 3SHWA 3SHUA 3AW1A 4JJ0A 2BD8A 3H5CB 2PHBA 1DUEA 4NWLA 1BDAA 4CHAC 2FYQA 5GCHF 2Z3EA 1QRXA 5C2ZA 2O8MA 2FE5A 4FUIA 1JWTA 4X8VH 1C5NH 2HGAA 3LPRA 3OYPA 2P8OC 2LC6A 4ZUHA 1XUFA 1NRRH 1VJAU 1KXAA 3K65B 1UVOA 3UWJH 1LQDB 3ZZ7A 3TK5A 1O34A 2UWLA 1VGCC 4UEHH 3LGTA 1IHTH 2DJTA 2F5YA 1JRSA 2PKSC 3S0NA 2W4FA 1K2I1 1SQTA 2ZDNA 3Q77A 4Y10E 2ANKH 4O3TA 2VH6A 1WQVH 3MU0A 4ISLA 1ARCA 5AVDA 2PWXA 1CU1A 1AB9C 1J9CH 1UEQA 1ID5H 1C1NA 2FLBH 2R2MB 1BMNH 1PQ7A 2R9PA 1P1DA 2A2QH 2KA9A 1CGHA 3M5LA 1WHAA 2ZEBA 2ZTYA 2RCEA 4X1QU 1GVLA 1YGCH 4FUGA 5FCRA 1X7AC 4E7NA 3ZVGA 1O2KA 2PSXA 2QC2A 2GCTC 1YCPH 2BOKA 4XBCA 3VGCB 3GY3A</