3GE2A

Crystal structure of putative lipoprotein sp_0198 from streptococcus pneumoniae
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
89
structure length
89
Chain Sequence
QPVAQPTDIDGTYTGQDDGDRITLVVTGTTGTWTELESDGDQKVKQVTFDSANQRMIIGDDVKIYTVNGNQIVVDDMDRDPSDQIVLTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoprotein, putative
publication title Crystal Structure of Putative Lipoprotein SP_0198 from Streptococcus pneumoniae
rcsb
source organism Streptococcus pneumoniae
molecule tags Lipoprotein
total genus 18
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12182 DUF3642 Bacterial lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.50 Mainly Beta Beta Barrel Lipocalin Lipocalin 3ge2A00
3GE2A 1EI5A 5CYBA
chains in the Genus database with same CATH superfamily
1SXYA 5BVQA 1LFOA 1SWUA 2CZTA 3OBLA 1LCWA 4YDAA 5B5GA 1N7YA 2NP1A 3MG5A 5HTEA 1GKAA 2OVAA 1U17A 2FTBA 3HTYA 4ARHA 2Y3EA 4ORRA 2OY7A 2JN3A 3TZSA 2OL7A 3K3LA 3ELXA 1TOUA 4GNYA 1O8VA 3STKA 3ZW1A 1KT4A 1X71A 3OD9A 3ZUIA 4A1HA 1STRB 2RTCB 1N43A 1S2PA 1SWFA 4D6BA 4C5PA 3VE1A 1SRFA 4QZUA 2GC9A 1OPBA 1QY2A 4HFOA 3FA8A 1SA8A 4GNWA 2A2GA 3F8AA 1JMZA 3HPEA 1NDJA 3L4RA 4GUZA 5B10O 3QQ2A 5BVSA 1SWCA 2A5BA 2RA6A 3O19A 1EPBA 4NW4A 4GGTA 4Y0QA 1N9YA 2FWVA 4YKOA 2AMMX 2W2FA 2P8GA 2W2AA 4TLJA 1NP1A 2GH7A 2I5VO 3VPJE 1FTPA 4I9SA 3NX1A 2JMBA 2FKJA 1U0XA 3MBTA 2RQ0A 3HK1A 4CPIA 1X8OA 1TXLA 3WBGA 3CQNA 1YP7A 3EW1A 4YBPA 3PH6A 3ZW1B 4Y0RA 1HXZA 1SWJA 2X32A 1E06A 2OY8A 1SY3A 2JW1A 3TGBA 1FE3A 3NR3A 1H91A 2LBVA 2OZQA 4KH8A 2C1SA 3C78X 3CR6A 1IKEA 1MM9A 5JD2A 1QWDA 1OBQA 1KL3A 2BSZA 3EBKA 2HMBA 4GH7A 4GE1A 4MVKA 1FELA 1KOIA 2GJ5A 3RBYA 3RE5A 3WJBA 4DCBA 1VWQB 1VWCB 1I04A 3FW4A 5K67A 4YCEA 1HMTA 1LNMA 2AT6X 3NBXX 2OL8O 1SXUA 2DM5A 3RDOA 3VG3A 1JV4A 2QOMA 2RTBB 3O22A 4HPDA 4BOEA 5LKEA 2RCTA 2RTAA 4O4OA 5FQ6E 5C0NA 1X8NA 3D9WA 1SWSA 5AQ6A 2RD7C 1A2DA 3HWFA 3VG5A 2IZFB 3CKGA 4TNNA 4B55A 4FBRA 1SRJA 4YGZA 5IO5A 2NNQA 2AVIA 1ERBA 3FA6A 1AB0A 1SXXA 3ZW0A 3WZQA 3MM0A 2CBRA 2X8SA 5B27A 1GXAA 2BS6A 4O3WA 4UU2A 1R0UA 2IZAA 1DV9A 3CKFA 1VWJB 5B11O 3T2XA 1NGLA 4YGGA 4COTA 1BJ7A 1RLBE 3D95A 1GX9A 5IO6A 5HCDC 2WEWA 1LCZA 2L67A 5EDCA 3S60A 3RY1A 1MUPA 1O1VA 1KT7A 1HY2A 3H3IA 1B8EA 3WJEA 1VWIB 2HNXA 1SY0A 1HQQA 4ON1A 1BRPA 3WYQA 1AVEA 1Y9LA 1GX3A 2FS7A 2QO4A 4ZHHA 5CSEA 2KTDA 1YUPA 1QY1A 2ZAGA 1MX8A 3AKMA 4OMWA 1WUBA 5CHKA 3TGAA 5D47A 1CBQA 1IKJA 2QM9A 3EW2A 5LJHA 4U9CA 3PECA 3S5XA 3VG2A 5AJCA 1LF7A 1LDOA 2X8TA 3VHMA 1Y55X 4QNIA 2RTQB 2RTRB 3LHNA 4CPFA 4CV7A 1DF8A 3JS1A 2WWPA 5B29A 1DF3A 1JQPA 1SWQA 4O3XB 1CBSA 5H9KA 1DC9A 4Z2VA 3HOEA 3UEXA 1VWMB 5FFHA 1YIVA 1OEKA 2MO5A 4IBAA 5HCEC 5HZ6A 4ALBA 1E00A 2BT9A 2IZBA 3WYPA 2Y3FA 2CM4A 1SY2A 2CAMA 3NADA 2BLGA 2O62A 2RTIB 2VFBA 4ZHFA 1HBQA 1Y9TA 1LUQA 4FQBB 1O1UA 2NNDA 1EUOA 5AEOA 2IZKA 4CPHA 1HMSA 4CSBA 1Z24A 1KQWA 1VWHB 5HA0A 3HWGA 5BYPA 4ZGFA 1VYGA 4I3DA 3CMPA 3FIQA 3WZNA 3X00A 4QYPA 3AUMO 1VWDB 1SLGB 2X45A 1NBXA 4INNA 5LJBA 1KZXA 1VWEB 3NQKA 1N9MA 1IW2A 4MEEA 5FENA 3RSWA 1I9HA 1QY0A 3T6LA 1UYNX 1E5PA 4YH0A 1B0OA 1B56A 1ZRYA 3BSZE 4L3RA 5AJBA 3RWXA 4DQ4A 5L3YA 4JHQA 2RTJA 4O49A 3WZPA 3D97A 3NP1A 4HPBA 3EYCA 1KT6A 1MX7A 1SWAA 4EKVA 3P24A 1GT3A 4GU8A 1CBIA 3O2YA 1FJ1E 4AYHA 4BX7A 1TOWA 1TW4A 1PBOA 1SWLA 1W4TA 2CZUA 3B2KA 4OS0A 1VWLB 2GTLN 2R73A 3P02A 2WPUA 1X8QA 3P6EA 3OE3A 3BS2A 2RTOB 2IFBA 2WR6A 3PDFA 3KFIA 3UEVA 3VG7A 1SMPI 1ZNLA 1QQSA 1SWEA 2KTSA 1JBHA 3VE2A 4BX7B 4ORYA 2XKLA 1EXSA 4GETA 3B2JA 4JNJA 4QGXA 5FAZA 4AZMA 5DPQA 4BX5A 1JJXA 4U8UN 3FEPA 3LV4A 1SLEB 4ZJ0A 1IJ8A 3WXQA 3SLJA 1LPJA 3FA7A 1IIUA 1SWBA 4IMOA 1ERXA 1D3SA 2OL6O 2RTKA 4PJ2A 3SAOA 1QG5A 4QYNA 1A57A 2K23A 1JJUA 1PEEA 4AW8A 4BX5B 2E4JA 1MK5A 2ACOA 1GT1A 4GZVA 2LB6A 2X8FA 3F6ZB 2MHDA 1ICMA 3KZAA 5F7GA 2KW1A 1SY1A 1OPAA 2MM3A 4LZUA 3TF6A 3V8UA 4AZNA 1E2TA 1YP6A 2BS5A 1SRGA 1W6FA 3GAQA 2OVEA 5FQ7E 2XSTA 5HCCC 3BX8A 1SWRA 4K19A 1SWOA 1ACDA 2C4IA 4IMNA 4DQ3A 5IO7A 3BLGA 2ZSCA 1OBUA 1YWDA 5H9LA 3AKNA 3ZW2A 1STSB 4IB7A 4ZFXA 1YWCA 4LKPA 4ES7A 2MF6A 4HPAA 4GJVA 2FR2A 4O4UA 2F73A 1MVGA 2MJIA 2Q2MA 1A3YA 4I3CA 4MVLA 4NNSA 3S26A 3STMX 4Z27A 4AZQA 2OF8A 1EIIA 2OFMX 4FGIB 1VWFB 1RXKA 2WQAE 2GTLM 4IAXA 1K24A 5LJCA 1RSTB 2OYBO 5JR8A 2FGSA 1VWRB 4A1YA 2HZRA 1RXJA 3I17A 1BWYA 3E3CA 1ICNA 2JOZA 3T2WA 3VHIA 1D2UA 4CPEA 1LELA 4KC8A 4U8UM 1SRIA 4OKAA 4RUNA 5HWZA 2A8GA 3JSQA 3KFHA 3CBSA 3RKGA 3ZZVA 5L8OA 2AT5X 2CM9A 2A3FX 4EDEA 4NLIA 1EW3A 1CRBA 2Q4NA 5DG4A 4KT5A 1LIFA 4PSQA 1SREA 1XCAA 2AT3X 1G74A 1S7DA 3B2HA 4XMHA 5EEEA 1S44A 3QKGA 2F09A 3P6CA 3SZJA 1JIWI 2JGSA 3ZI8A 1BSQA 1SWKA 2IZCB 1Y52X 4Y0PA 1EALA 1HN2A 2L9CA 3EC5A 4QZTA 2AKQA 3RDMA 4XMCA 1BEBA 2NNEA 1N4JA 3BU9A 3Q6LA 1P6PA 2POAA 3PEDA 2K62A 4A8ZA 1KZWA 1GM6A 4WHIA 1ZNGA 2ZAIA 4JGLA 3WJDA 2IZDB 2OFBA 4DNEA 1KL5A 3S5VA 1SWTA 3B2IA 4ZHCA 4BVMA 3Q34A 4BBOA 1G7NA 2FR3A 2QCBA 2X34A 4NYQA 1DFVA 2FHLA 5D45A 3VG4A 4EQAC 4ZHGA 1VWGB 1YWBA 1SWNA 2MWHA 3IFBA 4YFPA 2ALLX 3OJYC 4YGHA 4A60A 5L8IA 2HLVA 3PK2A 4GK9A 2LBAA 3B2LA 1SWHA 4NV8A 3RZYA 3NX2A 4HWMA 1ADLA 4Y0SA 3FELA 2FHNX 1DZJA 3NQ9A 4N7CA 1GX8A 4NLJA 2QO6A 2ANSA 4NYRA 4TQ2A 5HA1A 4KIIA 3KFGA 2IZLB 5F2BA 4BX6B 4N7DA 5EPQA 3WZOA 4EFGA 2F01A 2RTLA 5LJEA 3HOLA 2JU7A 4CDEA 1T8VA 2RTMA 4Z28A 2I5ZO 3DSZA 4GDZA 3UAQA 4GGRA 2RTFB 4AZPA 1GT4A 4FBVA 4KCAA 5D48A 2LKKA 1JYJA 4Z2OA 1JJJA 2PY1A 3VGWA 2G78A 4ZCBA 1AQBA 1VYOA 1HBPA 1X8PA 3D4RA 3WJCA 1FDQA 1ML7A 3FR4A 4OS3A 4YCHA 3VU1A 2Z4IA 5H9AA 4TKBA 5KIDA 1CJ5A 4XMFA 1OBPA 2RTPB 1LDQA 1VWPB 2PI3O 3C77X 2OY5O 2C1QA 5LJKA 4TJZA 4YBUA 3HWEA 4GKCA 3WJGA 1X89A 3WOVA 3SOTA 1LIBA 2G8CO 2GTLO 3PP6A 4I60A 4ORXA 4XMGA 3ZQ3A 1Y53X 2FLJA 1LCVA 4OMXA 3ELZA 5EDBA 1I06A 3FLLA 4GRJA 4IRWA 5CE4A 3JQOA 2QMIA 1PMPA 1ZNKA 3FR5A 2IZIA 2AT0X 4U8UO 1OEJA 2R56A 1GGLA 3PH5A 5HZ9A 1SWPA 1B4MA 1RXHA 2A5CA 1KQXA 3MVFA 2M4LA 3U0DA 1JZUA 1UYOX 1GT5A 1RSUB 2L5PA 3STNA 2AT8X 2A2UA 4IB8A 1EQDA 4QQ1A 1CBRA 2OF9A 2BC3A 5F6BA 1LIEA 3I0AA 3P6FA 1BBPA 4LQZA 3WJFA 5LKFA 1T0VA 4ALOA 1XKIA 1FENA 5EEDA 4R0BA 5L8NA 4GDAA 2UZ2A 4AZOA 4CK4A 1HXLA 2IZJA 3RY2A 3SZHA 1GKAB 1IFCA 2FKGA 1G5WA 1EPAA 1OSPO 4I9RA 1KXOA 4OEMA 1ALBA 1Y0GA 4ODDA 4YDBA 4XMEA 4YVBA 3T6FA 1MEPA 2RTNB 3SLOA 2FS6A 2DJFA 2OVDA 4IABA 1HMRA 2RN4A 4KC7A 4MIRA 2WEXA 4ML7B 5B5FA 1UREA 5EZ2A 2R74A 4O3ZA 4QGVA 4GD9A 5D8JA 2RTDB 3KFFA 1ZNEA 3FR2A 4ZH9A 5K06A 3FMZA 3FW5A 2VDFA 2G5LA 2Q39A 4QRLA 5F1EA 4ORSA 1SWGA 4ORUA 1L6MA 1SRHA 4D6AA 3PQUA 2RTEB 2HYSA 2UYWA 4QGWA 5HZ8A 1HQPA 2RTGB 4M6SA 1I4UA 2YG2A 1TVQA 4OS8A 2IZEB 4LKTA 5IRWA 1KT5A 3P6DA 4ZR2A 1STPA 2HZQA 3APXA 5LJGA 4I6SA 1DZKA 5H9NA 4ZGUA 4ZHDA 4O9SA 1PM1X 1BLRA 3F9DA 4WFUA 4CDFA 2G79A 1SLDB 4NV7A 1U18A 1FEMA 4HPCA 4TKJA 2GTFX 4QAEA 5D4AA 3RDUA 1NQMA 1BM5A 2L68A 4ORWA 3FEKA 2X4MA 3APVA 1NC9A 3MX7A 2WQ9A 1KT3A 1QABE 2AF5A 3KQ0A 1BSOA 3PPTA 4MVIA 4UU3A 5F6ZA 4ZH6A 4IB9A 1VWBB 5IXGA 4I3BA 1MOYA 1KGLA 2FRSA 4I95A 4OELA 2OFRX 4Y59A 4Z2PA 1KFFA 2AH7X 1NQNA 5KICA 3FIDA 1EI5A 2DJGA 1SWDA 2LA7A 2OVSA 2RTHB 3DTQA 1A18A 2Q9SA 3FENA 4YKMA 5K68A 3SZIA 3U03A 3BY0A 4CDDA 4IAWA 2QO5A 5IRUA 3AEHA 5HBSA 4BCSA 1QFVA 5HZQA 4U3QA 3P6HA 1I05A 3CBCA 5HAEA 1WBIA 4M7MA 2A13A 5HTDA 1RAVA 4Y5DA 5LJDA 1VWNB 3ZWEA 4O4SA 4GGZA 2IZHB 1G85A 3VG6A 3ZW0B 1PBYA 3D96A 3EMMA 3CWKA 4BJ8A 2Z4HA 2G7BA 3BX7A 5B2AO 1VWKB 3NQ3A 1VYFA 1MDCA 4YFRA 1W5RA 2OFAA 4EEJA 1AELA 3RDQA 4BX6A 2YMSA 4AZRA 4BQUA 2OY1O 1JMXA 1PTSA 1VPRA 2X46A 2JU3A 4MISA 4MVEA 2A0AA 2VFCA 5IRAA 4IB6A 5KHPA 3C76X 4U46A 1T68X 1KL4A 4ID2A 3T1DA 1OEEA 3BRNA 1JYDA 1BSYA 2QOSC 4JO6A 4Z6JA 2ACPX 4LZVA 4FBOA 1RBPA 3BU1A 3APWA 4O3YA 1BRQA 3TGCA 1VWAB 1LIDA 3FDCA 5B3MO 4YFQA 1UZ2X 2IZGB 2WUTA 4NP1A 4TKHA 2LFOA 4L1NA 1SLFB 4YMYA 2KD2A 2N93A 2RCQA 3SLTA 2HKDA 1SXWA 2X55A 4XMDA 3UEUA 1AVGI 3VHHA 1LKEA 1YWAA 1IFBA 3LTWA 4RUUA 2WSJA 3P6GA 3GE2A 4GJSA 1AVDA 1LICA 1ZNDA 3UEWA 3APUA 1DZPA 5BVTA 5F58A 4CDCA 3HWDA 2Y32A 2FT9A 2JU8A 2AL0X 4O4XA 3EBWA 5H8TA 2KT4B 3BDRA 3EM0A 3FYFA 3KVNA 3N91A 3G7XA 3FA9A 1K3BA 3RDXA 2BHVA 2X56A 2EU7X 1EIOA 1DZMA 4BGFA 1N0SA 4NNTA 3CQRA 2Q2PA 3IA8A 4WFVA 1ZNHA 1E02A 3PQSA 1NP4A 2W2BA 5FQ8E 3U9PC 1I78A 4WBKA 5CYBA 3ZUOA 4EXZA 1VWOB 4CPHB 3WVMA 2ASNX 1QFTA 5HZ5A 1X8UA 3RDSA 3NPOA 2CBSA 3RE6A
chains in the Genus database with same CATH topology
1SXYA 5BVQA 1LFOA 2CZTA 3OBLA 4YDAA 5HTEA 2NP1A 1GKAA 2OVAA 1U17A 2FTBA 3HTYA 4ARHA 4ORRA 2JN3A 3TZSA 3K3LA 3ELXA 1TOUA 4GNYA 1O8VA 3STKA 3ZW1A 1KT4A 1X71A 3OD9A 3ZUIA 4A1HA 1S2PA 4D6BA 3VE1A 4QZUA 2GC9A 1OPBA 1QY2A 4HFOA 3FA8A 1SA8A 4GNWA 2A2GA 3F8AA 5BVSA 3L4RA 2RA6A 3O19A 4NW4A 1EPBA 4Y0QA 2FWVA 4YKOA 2AMMX 2W2FA 2P8GA 2W2AA 4TLJA 1NP1A 3VPJE 1FTPA 4I9SA 3NX1A 2JMBA 1U0XA 3MBTA 2RQ0A 3HK1A 1X8OA 1TXLA 3WBGA 3CQNA 1YP7A 4YBPA 3PH6A 4Y0RA 1E06A 1SY3A 2JW1A 3TGBA 1FE3A 3NR3A 1H91A 2LBVA 2OZQA 4KH8A 3C78X 3CR6A 1IKEA 1QWDA 1OBQA 3EBKA 4GH7A 4MVKA 2HMBA 3RBYA 4GE1A 3WJBA 1FELA 1KOIA 2GJ5A 1I04A 3FW4A 4YCEA 1HMTA 1LNMA 2AT6X 3NBXX 1SXUA 2DM5A 3VG3A 1JV4A 4HPDA 3O22A 4BOEA 5LKEA 2RCTA 4O4OA 5FQ6E 5C0NA 1X8NA 5AQ6A 2RD7C 1A2DA 3HWFA 3VG5A 4TNNA 4FBRA 4YGZA 5IO5A 2NNQA 1ERBA 3FA6A 1AB0A 1SXXA 3ZW0A 2CBRA 2X8SA 5B27A 1GXAA 2BS6A 4O3WA 4UU2A 1R0UA 1DV9A 1NGLA 4YGGA 4COTA 1BJ7A 1RLBE 3D95A 1GX9A 5IO6A 5HCDC 2WEWA 2L67A 5EDCA 3S60A 1MUPA 1O1VA 1KT7A 3H3IA 1B8EA 3WJEA 2HNXA 1SY0A 4ON1A 1BRPA 1Y9LA 2FS7A 2QO4A 4ZHHA 2KTDA 1YUPA 1QY1A 2ZAGA 1MX8A 3AKMA 4OMWA 3TGAA 5D47A 1CBQA 1IKJA 2QM9A 5LJHA 4U9CA 3PECA 3S5XA 3VG2A 5AJCA 1LF7A 2X8TA 4QNIA 3LHNA 4CV7A 3JS1A 2WWPA 1DF3A 4O3XB 1CBSA 5H9KA 1DC9A 3HOEA 3UEXA 5FFHA 1YIVA 1OEKA 2MO5A 4IBAA 5HCEC 5HZ6A 4ALBA 1E00A 2BT9A 2CM4A 1SY2A 3NADA 2BLGA 2O62A 4ZHFA 1HBQA 1Y9TA 4FQBB 1O1UA 2NNDA 1EUOA 5AEOA 1HMSA 4CSBA 1Z24A 1KQWA 5BYPA 5HA0A 3HWGA 4ZGFA 1VYGA 4I3DA 3CMPA 3FIQA 4QYPA 2X45A 4INNA 1KZXA 5LJBA 3NQKA 1IW2A 5FENA 3RSWA 1QY0A 1E5PA 4YH0A 1B0OA 1B56A 1ZRYA 3BSZE 4L3RA 5AJBA 3RWXA 4DQ4A 4O49A 3D97A 3NP1A 4HPBA 3EYCA 1KT6A 1MX7A 3P24A 1GT3A 4GU8A 1CBIA 3O2YA 4AYHA 1TOWA 1TW4A 1PBOA 2CZUA 3B2KA 4OS0A 2GTLN 3P6EA 2R73A 3P02A 1X8QA 3OE3A 3BS2A 3UEVA 2IFBA 2WR6A 3KFIA 3VG7A 1SMPI 1ZNLA 1QQSA 2KTSA 1JBHA 3VE2A 4ORYA 2XKLA 1EXSA 4GETA 3B2JA 4QGXA 5FAZA 4AZMA 1JJXA 5DPQA 4U8UN 3FEPA 3LV4A 4ZJ0A 3WXQA 1LPJA 3FA7A 1IIUA 4IMOA 1ERXA 1D3SA 4PJ2A 3SAOA 1QG5A 4QYNA 1A57A 2K23A 1PEEA 4AW8A 2E4JA 2ACOA 1GT1A 4GZVA 2LB6A 2X8FA 3F6ZB 2MHDA 1ICMA 3KZAA 5F7GA 2KW1A 1SY1A 1OPAA 2MM3A 4LZUA 3TF6A 3V8UA 4AZNA 1YP6A 2BS5A 3GAQA 2OVEA 5FQ7E 2XSTA 5HCCC 3BX8A 4K19A 1ACDA 4IMNA 4DQ3A 5IO7A 3BLGA 1OBUA 1YWDA 5H9LA 3AKNA 3ZW2A 4IB7A 4ZFXA 1YWCA 4LKPA 4ES7A 4HPAA 2FR2A 4O4UA 2F73A 1MVGA 2MJIA 2Q2MA 1A3YA 4I3CA 4MVLA 4NNSA 3S26A 3STMX 4AZQA 1EIIA 2OFMX 4FGIB 2WQAE 2GTLM 4IAXA 5LJCA 5JR8A 4A1YA 2HZRA 3I17A 1BWYA 3E3CA 1ICNA 2JOZA 1D2UA 4KC8A 4U8UM 4RUNA 5HWZA 3JSQA 3KFHA 3CBSA 3RKGA 3ZZVA 5L8OA 2AT5X 2CM9A 2A3FX 4EDEA 4NLIA 1EW3A 1CRBA 2Q4NA 5DG4A 4KT5A 1LIFA 4PSQA 1XCAA 2AT3X 1G74A 1S7DA 3B2HA 4XMHA 5EEEA 1S44A 3QKGA 2F09A 3P6CA 1JIWI 3ZI8A 1BSQA 4Y0PA 1EALA 1HN2A 2L9CA 4QZTA 2AKQA 4XMCA 1BEBA 2NNEA 3BU9A 3Q6LA 1P6PA 2POAA 3PEDA 2K62A 4A8ZA 1KZWA 1GM6A 4WHIA 1ZNGA 2ZAIA 4JGLA 3WJDA 3S5VA 3B2IA 4ZHCA 4BVMA 1G7NA 2FR3A 4NYQA 4ZHGA 1DFVA 5D45A 4EQAC 1YWBA 2MWHA 3IFBA 4YFPA 2ALLX 3OJYC 4YGHA 4A60A 5L8IA 2HLVA 4GK9A 2LBAA 3B2LA 3RZYA 3NX2A 4HWMA 1ADLA 4Y0SA 3FELA 3NQ9A 1DZJA 4N7CA 4NLJA 1GX8A 4NYRA 2QO6A 2ANSA 4TQ2A 5HA1A 4KIIA 3KFGA 4N7DA 5EPQA 4EFGA 5LJEA 3HOLA 2JU7A 1T8VA 3DSZA 4GDZA 3UAQA 4AZPA 1GT4A 4FBVA 4KCAA 5D48A 2LKKA 1JYJA 1JJJA 2PY1A 2G78A 4ZCBA 1AQBA 5B29A 1HBPA 1X8PA 3D4RA 3WJCA 1FDQA 1ML7A 3FR4A 4OS3A 4YCHA 3VU1A 2Z4IA 5H9AA 4TKBA 5KIDA 1CJ5A 4XMFA 1OBPA 3C77X 5LJKA 4TJZA 4YBUA 3HWEA 4GKCA 3WJGA 1X89A 3WOVA 3SOTA 1LIBA 2GTLO 3PP6A 4ORXA 4XMGA 3ZQ3A 2FLJA 4OMXA 3ELZA 5EDBA 1I06A 3FLLA 4GRJA 5CE4A 3JQOA 2QMIA 1PMPA 1ZNKA 3FR5A 2AT0X 4U8UO 1OEJA 2R56A 1GGLA 3PH5A 5HZ9A 1B4MA 1KQXA 3MVFA 2M4LA 3U0DA 1JZUA 1GT5A 2L5PA 3STNA 2AT8X 2A2UA 4IB8A 1EQDA 4QQ1A 1CBRA 5F6BA 1LIEA 3I0AA 3P6FA 1BBPA 4LQZA 3WJFA 5LKFA 1T0VA 4ALOA 1XKIA 1FENA 5EEDA 4R0BA 5L8NA 4AZOA 4CK4A 1GKAB 1IFCA 1G5WA 1EPAA 4I9RA 1KXOA 4YDBA 1ALBA 4ODDA 4XMEA 2FS6A 4IABA 2OVDA 3ZW1B 1HMRA 2RN4A 4KC7A 4MIRA 2WEXA 4ML7B 1UREA 5EZ2A 2R74A 4O3ZA 4QGVA 5D8JA 3KFFA 1ZNEA 3FR2A 4ZH9A 3FMZA 3FW5A 2Q39A 4QRLA 5F1EA 4ORSA 4ORUA 4D6AA 1L6MA 3PQUA 2HYSA 4QGWA 5HZ8A 1HQPA 4M6SA 4OS8A 1I4UA 2YG2A 1TVQA 4LKTA 1KT5A 3P6DA 4ZR2A 3APXA 2HZQA 5LJGA 4I6SA 1DZKA 5H9NA 4ZGUA 4ZHDA 4O9SA 1PM1X 1BLRA 3F9DA 4WFUA 2G79A 1U18A 1FEMA 4HPCA 4TKJA 2GTFX 4QAEA 5D4AA 1BM5A 2L68A 4ORWA 3FEKA 3APVA 3MX7A 2WQ9A 1KT3A 1QABE 3KQ0A 4MVIA 1BSOA 3PPTA 4UU3A 5F6ZA 4ZH6A 4IB9A 4I3BA 1KGLA 2FRSA 4I95A 2OFRX 2AH7X 5KICA 1EI5A 2LA7A 2OVSA 3DTQA 3FENA 5K06A 1A18A 2Q9SA 4YKMA 3U03A 3BY0A 4IAWA 2QO5A 5HBSA 1QFVA 5HZQA 4U3QA 3P6HA 1I05A 3CBCA 5HAEA 5HTDA 4M7MA 2A13A 5LJDA 3ZWEA 4O4SA 1G85A 3VG6A 3ZW0B 3D96A 3EMMA 3CWKA 2Z4HA 2G7BA 3BX7A 3NQ3A 1VYFA 1MDCA 4YFRA 1AELA 4EEJA 2YMSA 4AZRA 4BQUA 1VPRA 2X46A 2JU3A 4MISA 4MVEA 2A0AA 4IB6A 5KHPA 3C76X 1T68X 4ID2A 3T1DA 1OEEA 3BRNA 1JYDA 1BSYA 2QOSC 2ACPX 4LZVA 4FBOA 1RBPA 3BU1A 3APWA 4O3YA 1BRQA 3TGCA 1LIDA 4YFQA 1UZ2X 2WUTA 4NP1A 4TKHA 2LFOA 4L1NA 4YMYA 2KD2A 2N93A 2RCQA 4XMDA 1SXWA 3UEUA 1AVGI 1LKEA 1YWAA 1IFBA 4RUUA 2WSJA 3P6GA 3GE2A 1LICA 1ZNDA 3UEWA 3APUA 1DZPA 5BVTA 5F58A 3HWDA 2FT9A 2JU8A 2AL0X 4O4XA 3EBWA 5H8TA 2KT4B 3BDRA 3EM0A 3FYFA 3N91A 3G7XA 3FA9A 2BHVA 2EU7X 1EIOA 1DZMA 1N0SA 4NNTA 3CQRA 2Q2PA 3IA8A 4WFVA 1ZNHA 1E02A 3PQSA 1NP4A 2W2BA 5FQ8E 3U9PC 4WBKA 3ZUOA 5CYBA 4EXZA 3WVMA 2ASNX 1QFTA 5HZ5A 1X8UA 3NPOA 2CBSA 3VG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GE2 A;  1EI5 A;  5CYB A; 
#chains in the Genus database with same CATH topology
 1SXY A;  5BVQ A;  1LFO A;  1SWU A;  2CZT A;  3OBL A;  1LCW A;  4YDA A;  5B5G A;  1N7Y A;  2NP1 A;  3MG5 A;  5HTE A;  1GKA A;  2OVA A;  1U17 A;  2FTB A;  3HTY A;  4ARH A;  2Y3E A;  4ORR A;  2OY7 A;  2JN3 A;  3TZS A;  2OL7 A;  3K3L A;  3ELX A;  1TOU A;  4GNY A;  1O8V A;  3STK A;  3ZW1 A;  1KT4 A;  1X71 A;  3OD9 A;  3ZUI A;  4A1H A;  1STR B;  2RTC B;  1N43 A;  1S2P A;  1SWF A;  4D6B A;  4C5P A;  3VE1 A;  1SRF A;  4QZU A;  2GC9 A;  1OPB A;  1QY2 A;  4HFO A;  3FA8 A;  1SA8 A;  4GNW A;  2A2G A;  3F8A A;  1JMZ A;  3HPE A;  1NDJ A;  3L4R A;  4GUZ A;  5B10 O;  3QQ2 A;  5BVS A;  1SWC A;  2A5B A;  2RA6 A;  3O19 A;  1EPB A;  4NW4 A;  4GGT A;  4Y0Q A;  1N9Y A;  2FWV A;  4YKO A;  2AMM X;  2W2F A;  2P8G A;  2W2A A;  4TLJ A;  1NP1 A;  2GH7 A;  2I5V O;  3VPJ E;  1FTP A;  4I9S A;  3NX1 A;  2JMB A;  2FKJ A;  1U0X A;  3MBT A;  2RQ0 A;  3HK1 A;  4CPI A;  1X8O A;  1TXL A;  3WBG A;  3CQN A;  1YP7 A;  3EW1 A;  4YBP A;  3PH6 A;  3ZW1 B;  4Y0R A;  1HXZ A;  1SWJ A;  2X32 A;  1E06 A;  2OY8 A;  1SY3 A;  2JW1 A;  3TGB A;  1FE3 A;  3NR3 A;  1H91 A;  2LBV A;  2OZQ A;  4KH8 A;  2C1S A;  3C78 X;  3CR6 A;  1IKE A;  1MM9 A;  5JD2 A;  1QWD A;  1OBQ A;  1KL3 A;  2BSZ A;  3EBK A;  2HMB A;  4GH7 A;  4GE1 A;  4MVK A;  1FEL A;  1KOI A;  2GJ5 A;  3RBY A;  3RE5 A;  3WJB A;  4DCB A;  1VWQ B;  1VWC B;  1I04 A;  3FW4 A;  5K67 A;  4YCE A;  1HMT A;  1LNM A;  2AT6 X;  3NBX X;  2OL8 O;  1SXU A;  2DM5 A;  3RDO A;  3VG3 A;  1JV4 A;  2QOM A;  2RTB B;  3O22 A;  4HPD A;  4BOE A;  5LKE A;  2RCT A;  2RTA A;  4O4O A;  5FQ6 E;  5C0N A;  1X8N A;  3D9W A;  1SWS A;  5AQ6 A;  2RD7 C;  1A2D A;  3HWF A;  3VG5 A;  2IZF B;  3CKG A;  4TNN A;  4B55 A;  4FBR A;  1SRJ A;  4YGZ A;  5IO5 A;  2NNQ A;  2AVI A;  1ERB A;  3FA6 A;  1AB0 A;  1SXX A;  3ZW0 A;  3WZQ A;  3MM0 A;  2CBR A;  2X8S A;  5B27 A;  1GXA A;  2BS6 A;  4O3W A;  4UU2 A;  1R0U A;  2IZA A;  1DV9 A;  3CKF A;  1VWJ B;  5B11 O;  3T2X A;  1NGL A;  4YGG A;  4COT A;  1BJ7 A;  1RLB E;  3D95 A;  1GX9 A;  5IO6 A;  5HCD C;  2WEW A;  1LCZ A;  2L67 A;  5EDC A;  3S60 A;  3RY1 A;  1MUP A;  1O1V A;  1KT7 A;  1HY2 A;  3H3I A;  1B8E A;  3WJE A;  1VWI B;  2HNX A;  1SY0 A;  1HQQ A;  4ON1 A;  1BRP A;  3WYQ A;  1AVE A;  1Y9L A;  1GX3 A;  2FS7 A;  2QO4 A;  4ZHH A;  5CSE A;  2KTD A;  1YUP A;  1QY1 A;  2ZAG A;  1MX8 A;  3AKM A;  4OMW A;  1WUB A;  5CHK A;  3TGA A;  5D47 A;  1CBQ A;  1IKJ A;  2QM9 A;  3EW2 A;  5LJH A;  4U9C A;  3PEC A;  3S5X A;  3VG2 A;  5AJC A;  1LF7 A;  1LDO A;  2X8T A;  3VHM A;  1Y55 X;  4QNI A;  2RTQ B;  2RTR B;  3LHN A;  4CPF A;  4CV7 A;  1DF8 A;  3JS1 A;  2WWP A;  5B29 A;  1DF3 A;  1JQP A;  1SWQ A;  4O3X B;  1CBS A;  5H9K A;  1DC9 A;  4Z2V A;  3HOE A;  3UEX A;  1VWM B;  5FFH A;  1YIV A;  1OEK A;  2MO5 A;  4IBA A;  5HCE C;  5HZ6 A;  4ALB A;  1E00 A;  2BT9 A;  2IZB A;  3WYP A;  2Y3F A;  2CM4 A;  1SY2 A;  2CAM A;  3NAD A;  2BLG A;  2O62 A;  2RTI B;  2VFB A;  4ZHF A;  1HBQ A;  1Y9T A;  1LUQ A;  4FQB B;  1O1U A;  2NND A;  1EUO A;  5AEO A;  2IZK A;  4CPH A;  1HMS A;  4CSB A;  1Z24 A;  1KQW A;  1VWH B;  5HA0 A;  3HWG A;  5BYP A;  4ZGF A;  1VYG A;  4I3D A;  3CMP A;  3FIQ A;  3WZN A;  3X00 A;  4QYP A;  3AUM O;  1VWD B;  1SLG B;  2X45 A;  1NBX A;  4INN A;  5LJB A;  1KZX A;  1VWE B;  3NQK A;  1N9M A;  1IW2 A;  4MEE A;  5FEN A;  3RSW A;  1I9H A;  1QY0 A;  3T6L A;  1UYN X;  1E5P A;  4YH0 A;  1B0O A;  1B56 A;  1ZRY A;  3BSZ E;  4L3R A;  5AJB A;  3RWX A;  4DQ4 A;  5L3Y A;  4JHQ A;  2RTJ A;  4O49 A;  3WZP A;  3D97 A;  3NP1 A;  4HPB A;  3EYC A;  1KT6 A;  1MX7 A;  1SWA A;  4EKV A;  3P24 A;  1GT3 A;  4GU8 A;  1CBI A;  3O2Y A;  1FJ1 E;  4AYH A;  4BX7 A;  1TOW A;  1TW4 A;  1PBO A;  1SWL A;  1W4T A;  2CZU A;  3B2K A;  4OS0 A;  1VWL B;  2GTL N;  2R73 A;  3P02 A;  2WPU A;  1X8Q A;  3P6E A;  3OE3 A;  3BS2 A;  2RTO B;  2IFB A;  2WR6 A;  3PDF A;  3KFI A;  3UEV A;  3VG7 A;  1SMP I;  1ZNL A;  1QQS A;  1SWE A;  2KTS A;  1JBH A;  3VE2 A;  4BX7 B;  4ORY A;  2XKL A;  1EXS A;  4GET A;  3B2J A;  4JNJ A;  4QGX A;  5FAZ A;  4AZM A;  5DPQ A;  4BX5 A;  1JJX A;  4U8U N;  3FEP A;  3LV4 A;  1SLE B;  4ZJ0 A;  1IJ8 A;  3WXQ A;  3SLJ A;  1LPJ A;  3FA7 A;  1IIU A;  1SWB A;  4IMO A;  1ERX A;  1D3S A;  2OL6 O;  2RTK A;  4PJ2 A;  3SAO A;  1QG5 A;  4QYN A;  1A57 A;  2K23 A;  1JJU A;  1PEE A;  4AW8 A;  4BX5 B;  2E4J A;  1MK5 A;  2ACO A;  1GT1 A;  4GZV A;  2LB6 A;  2X8F A;  3F6Z B;  2MHD A;  1ICM A;  3KZA A;  5F7G A;  2KW1 A;  1SY1 A;  1OPA A;  2MM3 A;  4LZU A;  3TF6 A;  3V8U A;  4AZN A;  1E2T A;  1YP6 A;  2BS5 A;  1SRG A;  1W6F A;  3GAQ A;  2OVE A;  5FQ7 E;  2XST A;  5HCC C;  3BX8 A;  1SWR A;  4K19 A;  1SWO A;  1ACD A;  2C4I A;  4IMN A;  4DQ3 A;  5IO7 A;  3BLG A;  2ZSC A;  1OBU A;  1YWD A;  5H9L A;  3AKN A;  3ZW2 A;  1STS B;  4IB7 A;  4ZFX A;  1YWC A;  4LKP A;  4ES7 A;  2MF6 A;  4HPA A;  4GJV A;  2FR2 A;  4O4U A;  2F73 A;  1MVG A;  2MJI A;  2Q2M A;  1A3Y A;  4I3C A;  4MVL A;  4NNS A;  3S26 A;  3STM X;  4Z27 A;  4AZQ A;  2OF8 A;  1EII A;  2OFM X;  4FGI B;  1VWF B;  1RXK A;  2WQA E;  2GTL M;  4IAX A;  1K24 A;  5LJC A;  1RST B;  2OYB O;  5JR8 A;  2FGS A;  1VWR B;  4A1Y A;  2HZR A;  1RXJ A;  3I17 A;  1BWY A;  3E3C A;  1ICN A;  2JOZ A;  3T2W A;  3VHI A;  1D2U A;  4CPE A;  1LEL A;  4KC8 A;  4U8U M;  1SRI A;  4OKA A;  4RUN A;  5HWZ A;  2A8G A;  3JSQ A;  3KFH A;  3CBS A;  3RKG A;  3ZZV A;  5L8O A;  2AT5 X;  2CM9 A;  2A3F X;  4EDE A;  4NLI A;  1EW3 A;  1CRB A;  2Q4N A;  5DG4 A;  4KT5 A;  1LIF A;  4PSQ A;  1SRE A;  1XCA A;  2AT3 X;  1G74 A;  1S7D A;  3B2H A;  4XMH A;  5EEE A;  1S44 A;  3QKG A;  2F09 A;  3P6C A;  3SZJ A;  1JIW I;  2JGS A;  3ZI8 A;  1BSQ A;  1SWK A;  2IZC B;  1Y52 X;  4Y0P A;  1EAL A;  1HN2 A;  2L9C A;  3EC5 A;  4QZT A;  2AKQ A;  3RDM A;  4XMC A;  1BEB A;  2NNE A;  1N4J A;  3BU9 A;  3Q6L A;  1P6P A;  2POA A;  3PED A;  2K62 A;  4A8Z A;  1KZW A;  1GM6 A;  4WHI A;  1ZNG A;  2ZAI A;  4JGL A;  3WJD A;  2IZD B;  2OFB A;  4DNE A;  1KL5 A;  3S5V A;  1SWT A;  3B2I A;  4ZHC A;  4BVM A;  3Q34 A;  4BBO A;  1G7N A;  2FR3 A;  2QCB A;  2X34 A;  4NYQ A;  1DFV A;  2FHL A;  5D45 A;  3VG4 A;  4EQA C;  4ZHG A;  1VWG B;  1YWB A;  1SWN A;  2MWH A;  3IFB A;  4YFP A;  2ALL X;  3OJY C;  4YGH A;  4A60 A;  5L8I A;  2HLV A;  3PK2 A;  4GK9 A;  2LBA A;  3B2L A;  1SWH A;  4NV8 A;  3RZY A;  3NX2 A;  4HWM A;  1ADL A;  4Y0S A;  3FEL A;  2FHN X;  1DZJ A;  3NQ9 A;  4N7C A;  1GX8 A;  4NLJ A;  2QO6 A;  2ANS A;  4NYR A;  4TQ2 A;  5HA1 A;  4KII A;  3KFG A;  2IZL B;  5F2B A;  4BX6 B;  4N7D A;  5EPQ A;  3WZO A;  4EFG A;  2F01 A;  2RTL A;  5LJE A;  3HOL A;  2JU7 A;  4CDE A;  1T8V A;  2RTM A;  4Z28 A;  2I5Z O;  3DSZ A;  4GDZ A;  3UAQ A;  4GGR A;  2RTF B;  4AZP A;  1GT4 A;  4FBV A;  4KCA A;  5D48 A;  2LKK A;  1JYJ A;  4Z2O A;  1JJJ A;  2PY1 A;  3VGW A;  2G78 A;  4ZCB A;  1AQB A;  1VYO A;  1HBP A;  1X8P A;  3D4R A;  3WJC A;  1FDQ A;  1ML7 A;  3FR4 A;  4OS3 A;  4YCH A;  3VU1 A;  2Z4I A;  5H9A A;  4TKB A;  5KID A;  1CJ5 A;  4XMF A;  1OBP A;  2RTP B;  1LDQ A;  1VWP B;  2PI3 O;  3C77 X;  2OY5 O;  2C1Q A;  5LJK A;  4TJZ A;  4YBU A;  3HWE A;  4GKC A;  3WJG A;  1X89 A;  3WOV A;  3SOT A;  1LIB A;  2G8C O;  2GTL O;  3PP6 A;  4I60 A;  4ORX A;  4XMG A;  3ZQ3 A;  1Y53 X;  2FLJ A;  1LCV A;  4OMX A;  3ELZ A;  5EDB A;  1I06 A;  3FLL A;  4GRJ A;  4IRW A;  5CE4 A;  3JQO A;  2QMI A;  1PMP A;  1ZNK A;  3FR5 A;  2IZI A;  2AT0 X;  4U8U O;  1OEJ A;  2R56 A;  1GGL A;  3PH5 A;  5HZ9 A;  1SWP A;  1B4M A;  1RXH A;  2A5C A;  1KQX A;  3MVF A;  2M4L A;  3U0D A;  1JZU A;  1UYO X;  1GT5 A;  1RSU B;  2L5P A;  3STN A;  2AT8 X;  2A2U A;  4IB8 A;  1EQD A;  4QQ1 A;  1CBR A;  2OF9 A;  2BC3 A;  5F6B A;  1LIE A;  3I0A A;  3P6F A;  1BBP A;  4LQZ A;  3WJF A;  5LKF A;  1T0V A;  4ALO A;  1XKI A;  1FEN A;  5EED A;  4R0B A;  5L8N A;  4GDA A;  2UZ2 A;  4AZO A;  4CK4 A;  1HXL A;  2IZJ A;  3RY2 A;  3SZH A;  1GKA B;  1IFC A;  2FKG A;  1G5W A;  1EPA A;  1OSP O;  4I9R A;  1KXO A;  4OEM A;  1ALB A;  1Y0G A;  4ODD A;  4YDB A;  4XME A;  4YVB A;  3T6F A;  1MEP A;  2RTN B;  3SLO A;  2FS6 A;  2DJF A;  2OVD A;  4IAB A;  1HMR A;  2RN4 A;  4KC7 A;  4MIR A;  2WEX A;  4ML7 B;  5B5F A;  1URE A;  5EZ2 A;  2R74 A;  4O3Z A;  4QGV A;  4GD9 A;  5D8J A;  2RTD B;  3KFF A;  1ZNE A;  3FR2 A;  4ZH9 A;  5K06 A;  3FMZ A;  3FW5 A;  2VDF A;  2G5L A;  2Q39 A;  4QRL A;  5F1E A;  4ORS A;  1SWG A;  4ORU A;  1L6M A;  1SRH A;  4D6A A;  3PQU A;  2RTE B;  2HYS A;  2UYW A;  4QGW A;  5HZ8 A;  1HQP A;  2RTG B;  4M6S A;  1I4U A;  2YG2 A;  1TVQ A;  4OS8 A;  2IZE B;  4LKT A;  5IRW A;  1KT5 A;  3P6D A;  4ZR2 A;  1STP A;  2HZQ A;  3APX A;  5LJG A;  4I6S A;  1DZK A;  5H9N A;  4ZGU A;  4ZHD A;  4O9S A;  1PM1 X;  1BLR A;  3F9D A;  4WFU A;  4CDF A;  2G79 A;  1SLD B;  4NV7 A;  1U18 A;  1FEM A;  4HPC A;  4TKJ A;  2GTF X;  4QAE A;  5D4A A;  3RDU A;  1NQM A;  1BM5 A;  2L68 A;  4ORW A;  3FEK A;  2X4M A;  3APV A;  1NC9 A;  3MX7 A;  2WQ9 A;  1KT3 A;  1QAB E;  2AF5 A;  3KQ0 A;  1BSO A;  3PPT A;  4MVI A;  4UU3 A;  5F6Z A;  4ZH6 A;  4IB9 A;  1VWB B;  5IXG A;  4I3B A;  1MOY A;  1KGL A;  2FRS A;  4I95 A;  4OEL A;  2OFR X;  4Y59 A;  4Z2P A;  1KFF A;  2AH7 X;  1NQN A;  5KIC A;  3FID A;  1EI5 A;  2DJG A;  1SWD A;  2LA7 A;  2OVS A;  2RTH B;  3DTQ A;  1A18 A;  2Q9S A;  3FEN A;  4YKM A;  5K68 A;  3SZI A;  3U03 A;  3BY0 A;  4CDD A;  4IAW A;  2QO5 A;  5IRU A;  3AEH A;  5HBS A;  4BCS A;  1QFV A;  5HZQ A;  4U3Q A;  3P6H A;  1I05 A;  3CBC A;  5HAE A;  1WBI A;  4M7M A;  2A13 A;  5HTD A;  1RAV A;  4Y5D A;  5LJD A;  1VWN B;  3ZWE A;  4O4S A;  4GGZ A;  2IZH B;  1G85 A;  3VG6 A;  3ZW0 B;  1PBY A;  3D96 A;  3EMM A;  3CWK A;  4BJ8 A;  2Z4H A;  2G7B A;  3BX7 A;  5B2A O;  1VWK B;  3NQ3 A;  1VYF A;  1MDC A;  4YFR A;  1W5R A;  2OFA A;  4EEJ A;  1AEL A;  3RDQ A;  4BX6 A;  2YMS A;  4AZR A;  4BQU A;  2OY1 O;  1JMX A;  1PTS A;  1VPR A;  2X46 A;  2JU3 A;  4MIS A;  4MVE A;  2A0A A;  2VFC A;  5IRA A;  4IB6 A;  5KHP A;  3C76 X;  4U46 A;  1T68 X;  1KL4 A;  4ID2 A;  3T1D A;  1OEE A;  3BRN A;  1JYD A;  1BSY A;  2QOS C;  4JO6 A;  4Z6J A;  2ACP X;  4LZV A;  4FBO A;  1RBP A;  3BU1 A;  3APW A;  4O3Y A;  1BRQ A;  3TGC A;  1VWA B;  1LID A;  3FDC A;  5B3M O;  4YFQ A;  1UZ2 X;  2IZG B;  2WUT A;  4NP1 A;  4TKH A;  2LFO A;  4L1N A;  1SLF B;  4YMY A;  2KD2 A;  2N93 A;  2RCQ A;  3SLT A;  2HKD A;  1SXW A;  2X55 A;  4XMD A;  3UEU A;  1AVG I;  3VHH A;  1LKE A;  1YWA A;  1IFB A;  3LTW A;  4RUU A;  2WSJ A;  3P6G A;  3GE2 A;  4GJS A;  1AVD A;  1LIC A;  1ZND A;  3UEW A;  3APU A;  1DZP A;  5BVT A;  5F58 A;  4CDC A;  3HWD A;  2Y32 A;  2FT9 A;  2JU8 A;  2AL0 X;  4O4X A;  3EBW A;  5H8T A;  2KT4 B;  3BDR A;  3EM0 A;  3FYF A;  3KVN A;  3N91 A;  3G7X A;  3FA9 A;  1K3B A;  3RDX A;  2BHV A;  2X56 A;  2EU7 X;  1EIO A;  1DZM A;  4BGF A;  1N0S A;  4NNT A;  3CQR A;  2Q2P A;  3IA8 A;  4WFV A;  1ZNH A;  1E02 A;  3PQS A;  1NP4 A;  2W2B A;  5FQ8 E;  3U9P C;  1I78 A;  4WBK A;  5CYB A;  3ZUO A;  4EXZ A;  1VWO B;  4CPH B;  3WVM A;  2ASN X;  1QFT A;  5HZ5 A;  1X8U A;  3RDS A;  3NPO A;  2CBS A;  3RE6 A; 
#chains in the Genus database with same CATH homology
 1SXY A;  5BVQ A;  1LFO A;  2CZT A;  3OBL A;  4YDA A;  5HTE A;  2NP1 A;  1GKA A;  2OVA A;  1U17 A;  2FTB A;  3HTY A;  4ARH A;  4ORR A;  2JN3 A;  3TZS A;  3K3L A;  3ELX A;  1TOU A;  4GNY A;  1O8V A;  3STK A;  3ZW1 A;  1KT4 A;  1X71 A;  3OD9 A;  3ZUI A;  4A1H A;  1S2P A;  4D6B A;  3VE1 A;  4QZU A;  2GC9 A;  1OPB A;  1QY2 A;  4HFO A;  3FA8 A;  1SA8 A;  4GNW A;  2A2G A;  3F8A A;  5BVS A;  3L4R A;  2RA6 A;  3O19 A;  4NW4 A;  1EPB A;  4Y0Q A;  2FWV A;  4YKO A;  2AMM X;  2W2F A;  2P8G A;  2W2A A;  4TLJ A;  1NP1 A;  3VPJ E;  1FTP A;  4I9S A;  3NX1 A;  2JMB A;  1U0X A;  3MBT A;  2RQ0 A;  3HK1 A;  1X8O A;  1TXL A;  3WBG A;  3CQN A;  1YP7 A;  4YBP A;  3PH6 A;  4Y0R A;  1E06 A;  1SY3 A;  2JW1 A;  3TGB A;  1FE3 A;  3NR3 A;  1H91 A;  2LBV A;  2OZQ A;  4KH8 A;  3C78 X;  3CR6 A;  1IKE A;  1QWD A;  1OBQ A;  3EBK A;  4GH7 A;  4MVK A;  2HMB A;  3RBY A;  4GE1 A;  3WJB A;  1FEL A;  1KOI A;  2GJ5 A;  1I04 A;  3FW4 A;  4YCE A;  1HMT A;  1LNM A;  2AT6 X;  3NBX X;  1SXU A;  2DM5 A;  3VG3 A;  1JV4 A;  4HPD A;  3O22 A;  4BOE A;  5LKE A;  2RCT A;  4O4O A;  5FQ6 E;  5C0N A;  1X8N A;  5AQ6 A;  2RD7 C;  1A2D A;  3HWF A;  3VG5 A;  4TNN A;  4FBR A;  4YGZ A;  5IO5 A;  2NNQ A;  1ERB A;  3FA6 A;  1AB0 A;  1SXX A;  3ZW0 A;  2CBR A;  2X8S A;  5B27 A;  1GXA A;  2BS6 A;  4O3W A;  4UU2 A;  1R0U A;  1DV9 A;  1NGL A;  4YGG A;  4COT A;  1BJ7 A;  1RLB E;  3D95 A;  1GX9 A;  5IO6 A;  5HCD C;  2WEW A;  2L67 A;  5EDC A;  3S60 A;  1MUP A;  1O1V A;  1KT7 A;  3H3I A;  1B8E A;  3WJE A;  2HNX A;  1SY0 A;  4ON1 A;  1BRP A;  1Y9L A;  2FS7 A;  2QO4 A;  4ZHH A;  2KTD A;  1YUP A;  1QY1 A;  2ZAG A;  1MX8 A;  3AKM A;  4OMW A;  3TGA A;  5D47 A;  1CBQ A;  1IKJ A;  2QM9 A;  5LJH A;  4U9C A;  3PEC A;  3S5X A;  3VG2 A;  5AJC A;  1LF7 A;  2X8T A;  4QNI A;  3LHN A;  4CV7 A;  3JS1 A;  2WWP A;  1DF3 A;  4O3X B;  1CBS A;  5H9K A;  1DC9 A;  3HOE A;  3UEX A;  5FFH A;  1YIV A;  1OEK A;  2MO5 A;  4IBA A;  5HCE C;  5HZ6 A;  4ALB A;  1E00 A;  2BT9 A;  2CM4 A;  1SY2 A;  3NAD A;  2BLG A;  2O62 A;  4ZHF A;  1HBQ A;  1Y9T A;  4FQB B;  1O1U A;  2NND A;  1EUO A;  5AEO A;  1HMS A;  4CSB A;  1Z24 A;  1KQW A;  5BYP A;  5HA0 A;  3HWG A;  4ZGF A;  1VYG A;  4I3D A;  3CMP A;  3FIQ A;  4QYP A;  2X45 A;  4INN A;  1KZX A;  5LJB A;  3NQK A;  1IW2 A;  5FEN A;  3RSW A;  1QY0 A;  1E5P A;  4YH0 A;  1B0O A;  1B56 A;  1ZRY A;  3BSZ E;  4L3R A;  5AJB A;  3RWX A;  4DQ4 A;  4O49 A;  3D97 A;  3NP1 A;  4HPB A;  3EYC A;  1KT6 A;  1MX7 A;  3P24 A;  1GT3 A;  4GU8 A;  1CBI A;  3O2Y A;  4AYH A;  1TOW A;  1TW4 A;  1PBO A;  2CZU A;  3B2K A;  4OS0 A;  2GTL N;  3P6E A;  2R73 A;  3P02 A;  1X8Q A;  3OE3 A;  3BS2 A;  3UEV A;  2IFB A;  2WR6 A;  3KFI A;  3VG7 A;  1SMP I;  1ZNL A;  1QQS A;  2KTS A;  1JBH A;  3VE2 A;  4ORY A;  2XKL A;  1EXS A;  4GET A;  3B2J A;  4QGX A;  5FAZ A;  4AZM A;  1JJX A;  5DPQ A;  4U8U N;  3FEP A;  3LV4 A;  4ZJ0 A;  3WXQ A;  1LPJ A;  3FA7 A;  1IIU A;  4IMO A;  1ERX A;  1D3S A;  4PJ2 A;  3SAO A;  1QG5 A;  4QYN A;  1A57 A;  2K23 A;  1PEE A;  4AW8 A;  2E4J A;  2ACO A;  1GT1 A;  4GZV A;  2LB6 A;  2X8F A;  3F6Z B;  2MHD A;  1ICM A;  3KZA A;  5F7G A;  2KW1 A;  1SY1 A;  1OPA A;  2MM3 A;  4LZU A;  3TF6 A;  3V8U A;  4AZN A;  1YP6 A;  2BS5 A;  3GAQ A;  2OVE A;  5FQ7 E;  2XST A;  5HCC C;  3BX8 A;  4K19 A;  1ACD A;  4IMN A;  4DQ3 A;  5IO7 A;  3BLG A;  1OBU A;  1YWD A;  5H9L A;  3AKN A;  3ZW2 A;  4IB7 A;  4ZFX A;  1YWC A;  4LKP A;  4ES7 A;  4HPA A;  2FR2 A;  4O4U A;  2F73 A;  1MVG A;  2MJI A;  2Q2M A;  1A3Y A;  4I3C A;  4MVL A;  4NNS A;  3S26 A;  3STM X;  4AZQ A;  1EII A;  2OFM X;  4FGI B;  2WQA E;  2GTL M;  4IAX A;  5LJC A;  5JR8 A;  4A1Y A;  2HZR A;  3I17 A;  1BWY A;  3E3C A;  1ICN A;  2JOZ A;  1D2U A;  4KC8 A;  4U8U M;  4RUN A;  5HWZ A;  3JSQ A;  3KFH A;  3CBS A;  3RKG A;  3ZZV A;  5L8O A;  2AT5 X;  2CM9 A;  2A3F X;  4EDE A;  4NLI A;  1EW3 A;  1CRB A;  2Q4N A;  5DG4 A;  4KT5 A;  1LIF A;  4PSQ A;  1XCA A;  2AT3 X;  1G74 A;  1S7D A;  3B2H A;  4XMH A;  5EEE A;  1S44 A;  3QKG A;  2F09 A;  3P6C A;  1JIW I;  3ZI8 A;  1BSQ A;  4Y0P A;  1EAL A;  1HN2 A;  2L9C A;  4QZT A;  2AKQ A;  4XMC A;  1BEB A;  2NNE A;  3BU9 A;  3Q6L A;  1P6P A;  2POA A;  3PED A;  2K62 A;  4A8Z A;  1KZW A;  1GM6 A;  4WHI A;  1ZNG A;  2ZAI A;  4JGL A;  3WJD A;  3S5V A;  3B2I A;  4ZHC A;  4BVM A;  1G7N A;  2FR3 A;  4NYQ A;  4ZHG A;  1DFV A;  5D45 A;  4EQA C;  1YWB A;  2MWH A;  3IFB A;  4YFP A;  2ALL X;  3OJY C;  4YGH A;  4A60 A;  5L8I A;  2HLV A;  4GK9 A;  2LBA A;  3B2L A;  3RZY A;  3NX2 A;  4HWM A;  1ADL A;  4Y0S A;  3FEL A;  3NQ9 A;  1DZJ A;  4N7C A;  4NLJ A;  1GX8 A;  4NYR A;  2QO6 A;  2ANS A;  4TQ2 A;  5HA1 A;  4KII A;  3KFG A;  4N7D A;  5EPQ A;  4EFG A;  5LJE A;  3HOL A;  2JU7 A;  1T8V A;  3DSZ A;  4GDZ A;  3UAQ A;  4AZP A;  1GT4 A;  4FBV A;  4KCA A;  5D48 A;  2LKK A;  1JYJ A;  1JJJ A;  2PY1 A;  2G78 A;  4ZCB A;  1AQB A;  5B29 A;  1HBP A;  1X8P A;  3D4R A;  3WJC A;  1FDQ A;  1ML7 A;  3FR4 A;  4OS3 A;  4YCH A;  3VU1 A;  2Z4I A;  5H9A A;  4TKB A;  5KID A;  1CJ5 A;  4XMF A;  1OBP A;  3C77 X;  5LJK A;  4TJZ A;  4YBU A;  3HWE A;  4GKC A;  3WJG A;  1X89 A;  3WOV A;  3SOT A;  1LIB A;  2GTL O;  3PP6 A;  4ORX A;  4XMG A;  3ZQ3 A;  2FLJ A;  4OMX A;  3ELZ A;  5EDB A;  1I06 A;  3FLL A;  4GRJ A;  5CE4 A;  3JQO A;  2QMI A;  1PMP A;  1ZNK A;  3FR5 A;  2AT0 X;  4U8U O;  1OEJ A;  2R56 A;  1GGL A;  3PH5 A;  5HZ9 A;  1B4M A;  1KQX A;  3MVF A;  2M4L A;  3U0D A;  1JZU A;  1GT5 A;  2L5P A;  3STN A;  2AT8 X;  2A2U A;  4IB8 A;  1EQD A;  4QQ1 A;  1CBR A;  5F6B A;  1LIE A;  3I0A A;  3P6F A;  1BBP A;  4LQZ A;  3WJF A;  5LKF A;  1T0V A;  4ALO A;  1XKI A;  1FEN A;  5EED A;  4R0B A;  5L8N A;  4AZO A;  4CK4 A;  1GKA B;  1IFC A;  1G5W A;  1EPA A;  4I9R A;  1KXO A;  4YDB A;  1ALB A;  4ODD A;  4XME A;  2FS6 A;  4IAB A;  2OVD A;  3ZW1 B;  1HMR A;  2RN4 A;  4KC7 A;  4MIR A;  2WEX A;  4ML7 B;  1URE A;  5EZ2 A;  2R74 A;  4O3Z A;  4QGV A;  5D8J A;  3KFF A;  1ZNE A;  3FR2 A;  4ZH9 A;  3FMZ A;  3FW5 A;  2Q39 A;  4QRL A;  5F1E A;  4ORS A;  4ORU A;  4D6A A;  1L6M A;  3PQU A;  2HYS A;  4QGW A;  5HZ8 A;  1HQP A;  4M6S A;  4OS8 A;  1I4U A;  2YG2 A;  1TVQ A;  4LKT A;  1KT5 A;  3P6D A;  4ZR2 A;  3APX A;  2HZQ A;  5LJG A;  4I6S A;  1DZK A;  5H9N A;  4ZGU A;  4ZHD A;  4O9S A;  1PM1 X;  1BLR A;  3F9D A;  4WFU A;  2G79 A;  1U18 A;  1FEM A;  4HPC A;  4TKJ A;  2GTF X;  4QAE A;  5D4A A;  1BM5 A;  2L68 A;  4ORW A;  3FEK A;  3APV A;  3MX7 A;  2WQ9 A;  1KT3 A;  1QAB E;  3KQ0 A;  4MVI A;  1BSO A;  3PPT A;  4UU3 A;  5F6Z A;  4ZH6 A;  4IB9 A;  4I3B A;  1KGL A;  2FRS A;  4I95 A;  2OFR X;  2AH7 X;  5KIC A;  1EI5 A;  2LA7 A;  2OVS A;  3DTQ A;  3FEN A;  5K06 A;  1A18 A;  2Q9S A;  4YKM A;  3U03 A;  3BY0 A;  4IAW A;  2QO5 A;  5HBS A;  1QFV A;  5HZQ A;  4U3Q A;  3P6H A;  1I05 A;  3CBC A;  5HAE A;  5HTD A;  4M7M A;  2A13 A;  5LJD A;  3ZWE A;  4O4S A;  1G85 A;  3VG6 A;  3ZW0 B;  3D96 A;  3EMM A;  3CWK A;  2Z4H A;  2G7B A;  3BX7 A;  3NQ3 A;  1VYF A;  1MDC A;  4YFR A;  1AEL A;  4EEJ A;  2YMS A;  4AZR A;  4BQU A;  1VPR A;  2X46 A;  2JU3 A;  4MIS A;  4MVE A;  2A0A A;  4IB6 A;  5KHP A;  3C76 X;  1T68 X;  4ID2 A;  3T1D A;  1OEE A;  3BRN A;  1JYD A;  1BSY A;  2QOS C;  2ACP X;  4LZV A;  4FBO A;  1RBP A;  3BU1 A;  3APW A;  4O3Y A;  1BRQ A;  3TGC A;  1LID A;  4YFQ A;  1UZ2 X;  2WUT A;  4NP1 A;  4TKH A;  2LFO A;  4L1N A;  4YMY A;  2KD2 A;  2N93 A;  2RCQ A;  4XMD A;  1SXW A;  3UEU A;  1AVG I;  1LKE A;  1YWA A;  1IFB A;  4RUU A;  2WSJ A;  3P6G A;  3GE2 A;  1LIC A;  1ZND A;  3UEW A;  3APU A;  1DZP A;  5BVT A;  5F58 A;  3HWD A;  2FT9 A;  2JU8 A;  2AL0 X;  4O4X A;  3EBW A;  5H8T A;  2KT4 B;  3BDR A;  3EM0 A;  3FYF A;  3N91 A;  3G7X A;  3FA9 A;  2BHV A;  2EU7 X;  1EIO A;  1DZM A;  1N0S A;  4NNT A;  3CQR A;  2Q2P A;  3IA8 A;  4WFV A;  1ZNH A;  1E02 A;  3PQS A;  1NP4 A;  2W2B A;  5FQ8 E;  3U9P C;  4WBK A;  3ZUO A;  5CYB A;  4EXZ A;  3WVM A;  2ASN X;  1QFT A;  5HZ5 A;  1X8U A;  3NPO A;  2CBS A;  3VG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...