3GEBA

Crystal structure of edeya2
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
274
structure length
258
Chain Sequence
SHMERVFVWDLDETIIIFHSLLTGTFASRYGKDTTTSVRIGLMMEEMIFNLADTHLFFNDLEDCDQIHVDDVSSDDNGQDLSTYNFSADGFGGVDWMRKLAFRYRRVKEMYNTYKNNVGGLIGTPKRETWLQLRAELEALTDLWLTHSLKALNLINSRPNCVNVLVTTTQLIPALAKVLLYGLGSVFPIENIYSATKTGKESCFERIMQRFGRKAVYVVIGDGVEEEQGAKKHNMPFWRISCHADLEALRHALELEYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Eyes absent homolog 2
publication title Structure of edeya2
rcsb
source organism Homo sapiens
total genus 100
structure length 258
sequence length 274
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2009-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12350 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3gebA00
4EGCB 3GEBA 3HB0A 3HB1A
chains in the Genus database with same CATH superfamily
3KP1A 1GLVA 1D7OA 1K08A 1KZHA 1XHEA 4I1IA 3IXMA 3ZU3A 5JMOA 1WEKA 1GIAA 3CF6R 5JDIA 2X2FA 1ZP6A 1XTBA 1TK2A 4K9NA 4L0CA 4J90A 3RK1A 3RTCA 3OMLA 4DRYA 3A3OA 2WQ6A 2VK2A 1JB9A 4R0VA 2ZJYA 3QFRA 5EIWA 4Z2YA 3R7WA 1UMCA 1SR8A 4DCGA 1LPSA 3LX6A 4KFRA 4NVRA 5MGBA 2XMCA 4EOGA 3SYLA 2RHLA 1LI5A 3F7NA 5SV2A 4O4JB 1SBNE 8OHMA 5E7QA 5I45A 1Z6ZA 3ZTTA 3Q0IA 3Q5DA 2ZRBA 4DMGA 5ALVA 1JKJB 4HXGA 2EEPA 2PH1A 1NUAA 3IVAA 4L4RA 3UNXA 3UYLA 5CK4A 3QELB 5HCNA 3VZCA 2I0FA 1EINA 4CI9A 2H4HA 4NCBA 2XZDA 3ASYA 4FC7A 2V5AA 1IXYA 2XB2A 1KK3A 5K8VA 3H8VA 3NAMA 2DHQA 2FDRA 1XTVA 2NSJA 1U99A 4MKFA 4H1VA 1QZZA 3DPUA 3TNYA 4BB5A 1NVMB 2GYWA 3EHDA 4BVGA 3H04A 2WIJA 3H2JA 2HFKA 4XWGA 2PUEA 3D6FA 1GSIA 1TJ5A 4Y1RB 5FNVA 4E31A 5GVSA 1N9GA 2XECA 2VRBA 3LVFO 2WTMA 2ZRKA 3L7BA 2ZQZA 4G89A 2PRYA 4WESA 3TL2A 3CZ9A 1XKTA 4J6EA 1RWQA 3ORRA 3TRKA 4RD1A 4NYJQ 1FTWA 4LYGA 5TV2A 1KGDA 2D2EA 5HF6A 2ASEA 1JDJA 2VXBA 1L5RA 4HC4A 2I7CA 2KI5A 1VE6A 4QODA 1FVFA 2HSZA 1N6HA 4DMFA 4B85A 2B1RA 4DWWA 4QT4A 3K9FC 2Y0EA 2YJ5A 4IDAA 2G0AA 3S70A 4E94A 1OBCA 2PO5A 1JVNA 4WZBE 4RZQA 2R6R1 4FXPA 4OA8A 2VG8A 3UKOA 4UCWA 1T9BA 4BNIA 4EO9A 5IAOA 2DOKA 2KBFA 3WRYC 3D4IA 1LS1A 2EAUA 3HA2A 3H9BA 4H4EA 2JFXA 3Q72A 3DMFA 4M86A 4ASUD 3IIJA 5JMTA 2IZ6A 4UVHA 1N33B 1OWLA 2DUNA 5JAOA 1WS6A 1F12A 4LY9A 1V5IA 2V0CA 1CE8A 2Q6IA 4BRWA 1N77A 3IP9A 2VF7A 3BGSA 1HDOA 2Z6VA 1A9XA 2W98A 1LDEA 2V7VA 1XZJA 4D1YA 3LBHA 1NXVA 4R2WA 2CBZA 4WXMA 3FIUA 4CR7A 1T4MA 4R8KA 2GQ0A 3CRQA 3KQPA 3DLTA 4NE9A 2Z2XA 3A1CA 1QXSA 4GOXA 1U2DA 2VJMB 3RRFA 1GRNA 1T2EA 4LXUA 4DUGD 4BE4A 2WAAA 3DZDA 4UHKA 2A9JA 2R6AA 4JI5B 1KQNA 4BE7B 2RONA 2DBQA 1K98A 2ZJOA 4DSUA 5DASA 5KINB 3V8EA 4EB0A 2JLSA 2VYFA 1N1EA 3ANLA 3CF0A 4LMPA 5DGTA 3LP5A 2Q7OE 3JVEA 7MDHA 3AJEA 4W6QA 4OJQA 4D9MA 3K20A 4HN9A 1GUZA 2AC4A 1IC6A 3HN7A 2C1EA 2VDMB 1WDMA 2Z95A 1DIAA 2IA5A 5K0GA 2CXUA 1BVYF 2AQHA 4K86A 5HIJA 4BUZA 1P5JA 2FZWA 4NYJR 4FCWA 2WTNA 4ZAWA 2NZUG 2WICA 3FBWA 4YMWA 1TQ2A 2HF2A 4HNTA 4DV2B 4C76A 1GZDA 4EA8A 2QM0A 4D3ZA 1NNI1 2RHTA 4YCSA 4CV3A 4AG6A 1DKMA 1MOSA 1P5ZB 1IUKA 1PV2A 1RBMA 2JLAA 4MVJM 3UV7A 3I23A 4AJ4A 4BB9A 4XIGS 1OYOA 1ZH6A 1MO3A 2X1MA 5JH7A 2OZEA 2OB1A 2I6SA 2XVXA 3EMVA 3PVZA 2Q0SA 4GPD1 3SOZA 3G2JA 2JASA 3ANYB 3H5WA 4IMIB 1MNQA 2HPVA 3Q7RA 3P0HA 5MFPA 4QXPA 4WFQA 4DCPA 1LPBB 5H4HA 4OLBA 1W8IA 1YDMA 2QNIA 2Z8YA 1RYDA 1R8JA 3R6WA 3E61A 4AUKA 2BFAA 5B1IA 4MUFA 1TX4B 3G68A 4YRJA 2GYVA 4UNNA 1YE8A 4DZZA 4HSGA 4YRRA 1EQUA 2LKDA 2YHIA 1EFPA 2EKDA 4P7GA 3PFNA 4BNYA 4G0PA 1KA9H 5JISA 2PIAA 1OU0A 1PFYA 4P4LA 4IOKA 3A1DA 3VPBA 4PX3A 2GILA 1P72A 4GECA 5HDBB 2H2AA 1ZG3A 3OECA 1OLSA 1VZ3A 1W6UA 4CM6A 5ELXA 4JENA 2F17A 3SXJA 4ALJA 4UDYX 3R09A 4EDHA 1QO7A 5AVYA 1V8FA 1RXVA 1N2GA 1VLLA 2H7YA 4JJ4A 1X7ZB 4YJDA 1WUTA 2DY0A 5FWYA 3OY2A 4D9EA 2V7XA 3VNUA 3G5UA 2HJWA 2CVOA 2QTWB 2VSXA 5JCXA 2OCDA 1N7GA 4O4LF 3OHMA 3W8EA 4KFUA 2FDCA 5CU7A 2NP6A 1MXFA 3RRZA 3QI7A 4I55F 3TRJA 2AEMA 3ZD7A 5J5VA 2I6FA 2QD4A 3S6JA 4CKXA 2ATIA 1YDHA 2VYVD 3GWZA 3IEKA 2VHYA 4HLDA 4F12A 4LXIA 2Q9AA 5JNLA 2J3IA 4H3HB 4I14A 2NO0A 5HE8A 5JWHA 5K3SA 4Z0PA 5JLAA 3MM4A 1G8JA 2YVKA 3E8XA 1OY1A 3QOWA 4C6RA 1G4HA 4MWSA 4JYPA 2V6FA 1UXGA 4RXTA 3N6XA 3S8MA 1SQSA 3JVIA 2JLQA 3FHLA 3N2EA 5JBQA 1M75A 1I6WA 3MSCA 4QZVA 2D2VA 1N8SA 5EZYF 1B14A 2B99A 3BX1A 4EGJA 4HYTA 1HL7A 1G4UR 4XB6B 3E0QA 4BEBA 4OL0A 5CG2A 1AO0A 3S5UA 1FDOA 4DMHA 8ABPA 3UEOA 4FOLA 3KOWA 3ROKA 3OOHA 3QEOA 4D45A 2LCFA 2YFQA 4E7OA 4NIMA 4DYVA 4HNHA 2QY9A 2G25A 5A5EA 3PT9A 1EH5A 3JXEA 1F17A 1RQGA 1ZNQO 3BB3A 3BXFA 3ECSA 3WLQA 2PL1A 2R5FA 3WAKA 1H2XA 4TN5A 5EJIA 2P68A 4Q3EA 3G1UA 1F0YA 4EVSA 3DV0B 4PNHA 3RC1A 2QTGA 2FPRA 4WOJA 2IY7A 2XQKA 2W6PA 2YN2A 4ZVMA 4EEKA 4GVXA 2FA9A 3CZRA 4N0DA 5DNWA 4Y2UA 1CDOA 4BJ5A 1ORTA 4DANA 1IHDA 2WOJA 4X64B 4MW9A 1JP7A 2IEGA 2HUNA 2YN4A 4IXWA 1ZL2A 3H6HA 5CX1A 1T4BA 1KDZA 1RXWA 4GBED 1DV2A 3DAOA 3EIOA 2CZGA 3B9BA 2RI6A 1G21B 1XG5A 5LPNA 4KPYA 3RSSA 1KDTA 3SM9A 1WABA 3WLEA 4B46A 4RF3A 2G06A 3S81A 2OGUA 3BRWA 1NMZA 2NX2A 2DPHA 4DJDC 3F8WA 3QSYA 3WYFA 1YUBA 1RAFA 3PRYA 3EWIA 1MOPA 3K5IA 1QTQA 1T43A 3SN6A 4N3GA 1XL0A 4RNDB 4YACA 5JU6A 1CRQA 1YMUA 4M9ZA 1JFRA 5IJXA 4PQRA 3AJ8A 1SVIA 3AVQA 2XOKD 4MWTA 3UA4A 4GMKA 2BMEA 2NZWA 3E82A 4X9XA 5I7HA 3D5QA 1AQIA 2AMFA 4BYMA 1WOYA 4Q3OA 4O4LB 5LBTA 2TECE 3MINA 1W19A 3QTTA 1NTRA 3F9CA 3NBZC 4MJLA 4B40A 1LBIA 1ESEA 3RADC 3IP5A 4I55B 2CL6X 1PJTA 4DNPA 3Q5EA 1SU7A 3T9EA 3TKAA 2I9KA 1BD3A 3IHTA 1FLAA 2PT9A 3KYBA 4XFDA 4DJJA 3E1SA 5KNDD 1UBFA 2VJAA 1I7QB 3HO6A 4HNVA 1EVQA 1GU1A 2XYVA 2ZS8A 4Z4FA 1AKEA 4B3CA 4HKTA 4CM4B 3OIUA 5A7GA 4KLCA 4D41A 1D2HA 3ED5A 1F2UA 1C1DA 2H1VA 5AXBA 5B7GA 1BG6A 3HFGA 5HGJA 5ICCA 3SEFA 4KYVA 3P9PA 4ITVA 2DJIA 3IUSA 4NCHA 4ATNA 4QU9A 2XTJA 4OKSA 1FYDA 1VJGA 5EZYB 2RBEA 1E1QA 5ERXA 1AV7A 4B8YA 2PU7A 2DBRA 1YC5A 1V1JA 3KELA 2J9FA 1CQJA 1RWOA 2X40A 3PFKA 4IDPA 4YDHB 2FFRA 3Q9UA 4Q1CA 4BNUA 3K8QA 4BO8A 2PUAA 4C5AA 2RIPA 1WF6A 2HA2A 3ZJ5A 2CD9A 3I2GA 1EMDA 4JYBA 1JDUA 3VPXA 5JCPA 3TTSA 3PQCA 4O4HB 4YASA 2WQZA 1L7VC 3JRWA 3PBKA 3S28A 5K8JB 4F2GA 4XR9A 3QMWA 4FCTA 3C8UA 1AG9A 2LWIA 1LWNA 1Z28A 5JEDA 5D6NA 3O8CA 1BW9A 5C1DA 2WU4A 3MIZA 5P8WA 1XNHA 2VIIA 4YMVA 2X9GA 3BDVA 3H6KA 3GOQA 2CLSA 2JB9A 3ABZA 4WFJA 4EBFA 5K6AA 3RODA 3W2TA 1TUEA 4U5QA 4D9FA 5DT9A 3ZDAA 3K9CA 5JMWA 2JC3A 3A3NA 1PZMA 2ATEA 1UT5A 3IAEA 4F04A 5HZKA 4PYIA 4LSMA 4GRIA 3GZ4A 4PYRA 2P78A 4A2QA 2FEWB 2AEFA 1BXRB 3N7TA 4N9WA 4UBOA 1ULHA 3R20A 3TW0A 4GXRA 1BNCA 1EUDB 1XXHB 3A9VA 3NOQA 3PDWA 1VQ1A 4M8LA 4QX6A 2HW8A 1NBOA 1WY7A 3CLSC 1NQ5A 3H8JA 3QKTA 5CTAA 3LDUA 3KE9A 2H3HA 1TJ3A 1ZJJA 4FSXA 4KIJA 2XZTA 4TXLA 4UXIA 4BAGA 1QRUA 4AKHA 2FKAA 2HI0A 2XQVA 4JBIA 1T9HA 1JXMA 2B2XA 2ZK7A 3UV6A 1DIRA 3I4LA 4C1NA 1RLMA 1GEGA 2Q4BA 3G1WA 2XWSA 3IEIA 2CB9A 3A2NA 3JQ6A 3KLBA 3KO8A 4KQCA 2Q0QA 3HSKA 1VKHA 4PFKA 3RTDA 4C0JA 5I9NA 1WDTA 4FCCA 5JLJA 4BXOB 1U0BB 2X4DA 2NU8B 2Z2JA 1A4RA 4R9NA 2H9YA 2IVFA 1M54A 2XWPA 1V39A 3HYNA 1BE6A 1PYDA 3IEXA 4FEYA 5IARA 3GDWA 2EBHX 2AL7A 4R1UA 3TGLA 4WUVA 2WSSA 1M2VA 1CDZA 1MG0A 4M1QA 1A96A 3G88A 1E2UA 3O38A 3EGOA 1SD5A 1U1DA 3ZHXA 2Q21A 4MGZR 3LRXA 3QEJA 4PFJA 4TXMA 4XM0A 2QT9A 2I62A 3KOYA 3M1YA 3PFGA 3HJFA 1QONA 1VCMA 1W4RA 3JWHA 3QLVA 3RW9A 3AB7A 2B83A 3EWSA 3D81A 1J0AA 3MYYA 2Q3CA 3P96A 4MDHA 4UMDA 4A91A 1QQAA 2ZSBA 3K6SA 5L95A 1F2DA 3AJRA 3KU1A 1CQXA 4XM1A 1ZOIA 1JR3D 3OFND 4HH3C 3NLLA 2CN1A 1UEJA 1E9SA 2OA0A 3CVXA 1GVHA 1RE0A 4F6LA 2WRZA 4OGLA 4K05A 3Q0EA 1ZJ5A 4WXRA 2QUJA 2H07A 4EJSB 5D86A 1EXWA 4AJ2A 3QXGA 1X1TA 4G85A 2J41A 1MZPA 4PAQA 3UBTA 3N7UA 4EI7A 5LUAA 3U5TA 4NYMQ 3OWXA 1W87A 1HE5A 1MR3F 2Y1XA 4JLBA 3EXG1 3B36A 5EMJA 4B44A 3I2IA 1Y7HA 4J16A 1Z88A 3LKVA 1JQKA 3DB1A 4IGKA 1T3TA 2QDXA 3I34X 4L51A 5JRDS 1ODSA 3C3WA 1ZMBA 4EY7A 3A36A 2HTEA 4K40A 5DBHX 1YVRA 2DG2A 2DTDA 3QKUA 4IQ0A 2JVKA 1UC4B 4MS1A 2VBIA 4M6WB 1HRKA 1Z0AA 3FCXA 2CZCA 2XVMA 4Z49A 2QR5A 4HH4A 3LD9A 2ZVQX 3AZOA 1JVBA 4ZC8A 3T7DA 3FD8A 2B30A 3RTGA 1N4AA 3EMBA 3PIDA 4I4TF 1A95A 3OO0A 1LA2A 4RTNA 2AX3A 3SFTA 4UM9B 1SULA 3HXOA 4WBNA 2OCKA 1P4HA 3AETA 5F5NA 3R7BA 4NI5A 5E9QA 4MVJA 4HEJA 4EJMA 5JXJA 1IQPA 2H9IA 4MVXA 4OX9Y 3ETCA 5U9CA 4JV5B 3UJ3X 5FR2A 5K3EA 2VDPB 4RK4A 3RYHB 3WMXA 3CH7A 4EH1A 1I51A 5BSFA 3M34A 2E55A 1POXA 1GV1A 5KVAA 4OQZA 4RJ2A 4OATA 2IPXA 4GPZA 1PK9A 2VO1A 1WXFA 3O9MA 2GN2A 1IZZA 2EXXA 4UVEA 1BA2A 1JLRA 4CIBA 5FUQA 5HK9A 4G0VA 5C52B 1TO1E 3PQ3A 1NPTO 4ZU1X 1DTWB 1ZO8A 4YYEA 5JNWA 5AI5A 2XDAA 2F1RA 1YA8A 2GDZA 2JBHA 1BHQ1 2PS9A 3GFOA 4R31A 4Y30A 1HM5A 1AQNA 2QEQA 1UMDB 4HDRA 4RESA 2B5OA 2C07A 1YI1A 1LVHA 2BFBB 3FMVA 4KXWA 4F9TA 2V98A 2OBNA 4MYTA 3C24A 2D62A 3RAPR 5KWVA 5E4FA 3FUCA 2GRJA 4NYMR 3M1LA 5LZ2A 2JAPA 1MIOB 1RQXA 2H8GA 4DRXA 2F8SA 1KMNA 1ACJA 3B9QA 3C6KA 1JAXA 4HI0E 1X7WB 1I5RA 4LC9A 1IEXA 1XD2B 5BSMA 4O63O 1ZNYA 1M2OA 3ILHA 8MHTA 4BZZA 5I8PA 1JLLB 5K99A 1M9NA 5CDSA 2COUA 1TQ6A 1XDBA 2EQ5A 2B5WA 3SSAA 2JI7A 3KQQA 1DAGA 3OT1A 4H3VA 3TECE 1RRGA 3LLVA 4WNYA 3VZRA 4ETNA 4ARZB 3U39A 3QUBA 4KR6A 5K3AA 1HDCA 4NH4A 4G09A 5H16A 4QWWA 2YV5A 3RFFA 3RRYA 4QVKA 5IKOA 2PX6A 4G97A 2JCYA 3INRA 4U39A 5KTRA 3AI3A 3M5WA 2ECOA 1YASA 1T2NA 3BC1A 1ZOLA 2PM8A 3N58A 5LZ5A 2P35A 1QJCA 1X80B 2NZYA 3LJKA 4FNAA 4KGXA 3W4IA 4GI5A 3OJCA 4D8YA 1JFSA 1RYFA 3HBJA 1JBQA 4AYXA 3QU5A 4GYWA 3FCYA 4U7FA 3RHFA 2R1VB 5CIWA 4BX3A 4PG6A 1Y8RB 3SQWA 2QW8A 1LRLA 2B82A 4GIBA 1E79A 3QBEA 3LLCA 5D1HA 4J7CA 1K8ZB 3ABSB 3MUEA 4GR9A 4Y7DA 3EXFA 3ZNPA 4F4CA 1K6MA 3ZWWA 4B7CA 1NC3A 1EVJA 4G0OA 3SKYA 1ECCA 2BHSA 4KE7A 2PLAA 3R76A 1MFPA 3DSRA 1O97D 2J0VA 4C03A 4KH0A 2QUHA 3HCBA 2COEA 1D6NA 3EXHA 4D4LA 2OC9A 5DW0A 3TIVA 5CVTA 4PG7A 1ZJZA 2OORA 4I4TB 4MQLA 2WYUA 4Q1VA 5CYPA 1QIMA 3NFYA 1V43A 1VI6A 2D0PB 3UK0A 1B6TA 4AJJA 2JCVA 4ZEXA 4EW6A 3W7AA 3FMIA 2OAEA 1EB9A 5JAZA 4QJIA 4CVNA 3ICCA 2FWPA 3M4ZA 3VKWA 1YHZA 2XTNA 3C3KA 3JPYA 4XJTA 5H83A 3TLMA 1E62A 2W8ZA 1G8SA 1E9EA 3R0VA 1TU3A 4MJXA 5EVJA 4LYFA 3MS7A 1E4VA 1QAMA 2Q0XA 2V4UA 4HGQA 1C0KA 3K9HA 4KTVE 1U7WA 2QTFA 2GJ9A 2YIJA 3OEED 3BRQA 3VR3A 3T7JA 1WV0A 4KFSA 2YMQA 3MTIA 1L5HA 3NGXA 1NKVA 4QG3A 1DE0A 1CSEE 5BSUA 1ZM7A 3GYGA 3ZC3A 4CEJB 2PKYX 1DDGA 1AXGA 1T3HA 2Q5LA 3ZWYA 2A9QA 4A8JC 1JQLB 3C6YA 5H3HA 3WI7A 3C4QA 2QE7A 3G23A 4EM6A 1I7SB 2JFHA 5JSZB 3IIIA 3LA8A 2BHLA 5G41A 4ALNA 3U7IA 5HVNA 2JGIA 3R23A 4J0DA 5E9WA 2NYAA 3WIOA 2CXSA 4WINA 5A06A 5LYJF 2QYHA 3L3BA 5ARBA 5HW0A 2P9HA 1C3JA 3CLTC 2OILA 1QANA 4C78A 5KYUB 4GPAA 4LDZA 3VC2A 4DBLC 3I6MA 5CTJA 4RAQA 2GBIA 1Q83A 1UT8A 4RGBA 4LNUB 4PG8A 8LDHA 3TLKA 3W7BA 4PS0A 1Y1LA 4P7JA 1AKNA 4V1CB 1VMEA 4TYWA 3TIIA 1JLKA 3DW1X 1TVKB 1IRIA 2FRDA 2GVDC 1GM5A 4RK5A 4ML3A 3O4JA 5AI9A 1C3XA 3ZWPA 3FSGA 1PT5A 4Q34A 2PZJA 1WA5A 1KO1A 3PSAA 5HE9A 3HEBA 5ES4B 3GEBA 3LY7A 4Q9DA 4NCAA 2JFBA 4LOAA 4R2KA 3ROQA 2GXQA 1LNSA 3HY4A 1KZYC 4QASA 1SBZA 1NUQA 5G4KB 4JCCA 1O77A 1OI2A 2JHGA 3ZHSA 3AR8A 5AK3A 5JAPA 1WDWB 1I2ZA 3UFXA 5BWBA 2FX3A 2IXGA 1L5FA 4INPA 2IH4A 3HKDB 3AVWA 4DZRA 2XMRA 3AP1A 3QQPA 4ZV4A 1XQ1A 2B36A 2NU7A 3IPAA 3HLTA 1ZIPA 2VRCD 2C31A 2ZJ8A 2Q4OA 4F38A 1ZMTA 1T6XA 5K8CA 2HRBA 5KTSA 4LI0A 1EFUA 4DUZB 4WLFA 1Q6ZA 5C18A 3C6BA 4FJ1A 2YBEA 4OHYA 2FZEA 1JKJA 1DC6A 1P77A 2WU3A 1PJ4A 3U1TA 3EVCA 4NBWA 3WO1A 2ZBFA 1CRWG 1E8DA 4OHZA 5B7NA 4LV8B 3MGCA 1E9RA 2Z9CA 3BFJA 2UYOA 5CGQB 4J0EA 2CCKA 3AQIA 1PO7A 4AW9A 7AT1A 4EUKA 3ZDBA 2JGLA 3HY3A 2QN7A 2ZJ2A 3PG5A 5CA0A 3WMWA 4XGIA 1RJDA 3H42B 3PQ7A 4LQDA 1U3VA 3M7IA 3VJRA 2QQFA 3AGPA 1N5OX 1DX4A 4AQDA 1OX5A 4Z1OA 2X1HA 3FMFA 2ZBQA 1YGPA 3LFHA 2C2ZA 2D00A 1UBTS 1XQWA 3FBTA 4DLRA 4DBLE 2OB2A 3WGJA 5A4AA 3FJYA 3U4MA 3FKJA 3BD7A 1VP9A 1QTNA 4HLUA 4JZYA 4WA7A 4XWYA 1YFKA 3BK1A 1AQ6A 2YJTD 5FAXA 3AOEC 1EWYA 1PNVA 1ZJYA 5ILQA 3QLJA 2ZJ7A 3MWLA 3AL2A 3ONWA 4L3OA 1SHKA 2DTEA 4FMBB 5LUBA 2Z6QA 1N36B 2RHRA 3PUIA 2XLCA 5LYJB 3WA7A 1H8HD 4X93A 3GX1A 3R0IA 2Q4RA 4CWAA 3E53A 4CL0A 1J00A 2XPCA 1A9RA 4DIFA 3GEGA 5BYJA 2LVBA 3HXPA 3E0XA 4URFA 5FHRA 4AP5A 3FI0A 5JSQA 1RRCA 2JDID 4HJRA 4WKBA 4XTRA 3V46A 1SUAA 2J9XB 4MOWA 2I4TA 4HLCA 1WHSB 3F9RA 4X0EA 2Q2QA 1IN4A 3MN1A 1Q2XA 2BEJA 1TYEB 4HTAA 4BAZA 1T3ZA 3GROA 3H3FA 4Z4HA 3FRHA 5CBKA 4TYYA 3PUVA 1U6IA 1U98A 1II0A 3FGZA 1CIJA 4KV9A 2PZAA 4DWOA 2CUTA 5BNZA 4CTOA 1UQTA 3EFHA 2IH5A 2WIKA 1XLVA 5D6OA 2ZJ0A 1O5TA 1AKQA 2IYRA 2AG1A 1QGDA 1BTOA 2BEVA 2NTEA 2QW1A 3NUZA 3GCXA 1ZD2P 3O8BA 4MUMA 4GEKA 1EU1A 1QRRA 1KRXA 5LIRA 2QSYA 2VJMA 1T1RA 3A6DA 3AINA 3FTQA 3MCWA 2ZWMA 5AW3A 1MA0A 1NSTA 1GAJA 3IPCA 5AKGA 2Q5FA 1I24A 1M66A 4IIEA 3SIXA 3WFJA 4BQQA 2AZTA 4DLWA 4J03A 2YVLA 1BMDA 3VPAA 5LXTA 1G55A 1NMQA 4NATA 5HHTA 4BUJA 4BMXA 4DLTA 1ZD9A 4LRWA 3KJZA 2WIFA 3CKYA 3OTQA 2Y1WA 2ISQA 3PKJA 4JJFA 1GCIA 1MPXA 2C83A 5I4CA 1IZYA 1W4AA 2G08A 1ESDA 1IPFA 3QA9A 1X3LA 5AVTA 4FLFA 2EJUA 5H5JA 2OZVA 4XSVA 4EUEA 5FYQA 5JS6A 3HVRA 4NOMA 3Q4GA 7YASA 1PEKE 1MABB 4ZVPA 2WUEA 4NNOA 3PJFA 4OLHA 1RQRA 2AOUA 1CZKA 2IXFA 3UJNA 4ZO4A 4HADA 3TPZA 4K0KB 1KQPA 4BEWA 4G4IA 1YRYE 2P1RA 3BJIC 2FXIA 1UEXC 5DISB 1WNFA 5ADWA 4UKDA 5EWMB 4LSWA 4DSOA 1KJJA 1NR5A 3NONA 3R44A 3RFVA 1IULA 2ZS9A 3T5AA 3FKSD 5FWAA 2B3DA 4A23A 1ORHA 4XJXA 1G3MA 1EFAA 1NVWQ 3OCYA 3WK7A 1G7RA 1NFQA 1XZFA 3E5NA 4A8HA 3O21A 2Q3BA 4OMUA 3TR6A 3BJEA 1HE3A 2GAOA 3QMMA 4L6AA 1I3KA 5E8RA 3OJFA 5IHXA 1L5WA 1AKWA 1DWPA 4WNIA 4CEIA 1Z35A 3BH6A 2VT2A 2I65A 3HNRA 1XA0A 5C8VA 4MKGA 1WPRA 1OE0A 3VDQA 4JGBA 3AVOA 3H18A 3QVXA 1P73A 3UG7A 1GUYA 1UPTA 2YH2A 1W7AA 1XZMA 2X23A 1EE9A 4YP5A 1RPZA 1LQTA 1DRWA 3I0ZA 4OBEA 1GA4A 1LWOA 1WJGA 5KNLA 3E3OA 3E5MA 4GMHA 3WYNA 3GRUA 1P9WA 1UOQA 1EX9A 3D4PA 4JJ8A 2PWAA 4Q7LA 4QPJC 2FYTA 4QYIB 3AHIA 4Y9SA 1HWYA 1NX9A 2ZE7A 2ZIWB 3CX6A 4G5SA 4RENA 4QUDA 2Q3LA 2AK2A 4IJKA 3CUYA 2HLPA 3FBGA 3PTLA 4HGOA 2RGBA 3QXSA 4CZ2A 3MS4A 2B2CA 5EXSA 1CUZA 1UF9A 3WMEA 2HLDA 1XFDA 4A1FA 1FMCA 4DJFC 5FA6A 1HE2A 1RJEA 3DDHA 1YZQA 2WTAA 4NFLA 2FETA 3DNPA 3F71A 1H2AS 4I1OA 7GPBA 3SC2B 1WQ3A 3KQUA 1U8FO 1W581 2XF2A 4RDCA 5FUXA 2CE7A 4N5DA 4XDHA 1E2NA 4UNRA 3SYRA 4X6LA 1S2GA 2JFWA 3M5DA 5CBPA 4RJKA 2WWFA 4UTXA 3A2MA 4YMUA 3COSA 5KVVA 2GZ2A 3H05A 3NZEA 1VI5A 1S4QA 2RGEA 1A98A 1CNFA 3JAWA 1I6LA 2WM9B 1VIYA 2VNKA 5JBNA 2XNDA 2O8CB 4B3IA 1F8GA 1V48A 2PSFA 4ZMRA 2IHTA 3HM9A 1E5QA 3GC6A 3PNOA 3U48A 4EA7A 3OO1A 4PC6A 4C9BA 1GJRA 2UUOA 4FQ8A 3EY9A 4K9SA 1Q6YA 5FEMA 1P9LA 3HVIA 1OZGA 1PSWA 2Y4OA 3I9KA 1VDMA 1X1BA 4QFMA 4D56A 2B1IA 5FWDA 3S2ZA 5HJ2A 1TK9A 4UEWA 4P6VF 1KJZA 1C80A 2R96A 3KHUA 5LA6F 5G40A 1VRWA 1I0LA 5DI3B 4MV8A 4U63A 2WK1A 3FROA 4L72A 1FLNA 4BNTA 1GWNA 5C1OA 2J0UA 3UW3A 3O3NB 4BNWA 1BXZA 1WCIB 2FGJA 1CJMA 4QFCA 1E4OA 4AULA 1NN0A 1ZICA 2JIDA 1X7YA 2GH1A 3MRSA 1X9GA 2VDNB 4TRRA 3UOWA 3WGYA 4CHGA 1QBGA 2FR8C 1AU9A 4Q4AB 2J9ZB 3MGGA 1YB5A 5EP3A 4M1ZA 1G38A 3I73A 3QNUA 2C1XA 2V45A 5HIAA 4GLJA 3QYPA 2EJVA 1Z5ZA 3C3YA 1UK8A 3Q15C 3ZV7A 4OUDB 3V48A 1M1NB 2IE0A 2X6RA 2PE5A 3L1UA 3N87A 3V7YA 5IJ0A 4C01A 2RAUA 3A70A 3RK4A 2YZGA 4QRIA 5FBHA 1RPJA 4EQ6B 4V3BA 3P0FA 3W6ZA 1U6JA 2A5FA 4UEOA 5JATA 4XGRA 1N0VC 3TOSA 2IYQA 3QX7A 4IUDS 2HJVA 4PQGA 3GLUA 4E07A 3ZY4A 5KYTA 2JFNA 1KSGA 2AXQA 4RORA 1VHJA 3DKPA 4H1WA 5DGIA 4AT1A 1KQFA 3TBHA 5FUYA 1DUSA 5JY6A 3VX4A 2VOJA 1CJKC 1W5FA 2SBTA 1ECFA 5IN4A 4O02B 5E6SB 2DAPA 2P9EA 1LSOA 1I33A 1NHGA 1PDWA 3O8OA 2H1WA 1GGNA 2NPIA 5AVUA 1YDEA 3CVVA 5F2EA 3UMSA 3BCUA 4QELA 3HHEA 1Z6QA 2AXEA 4K03A 3EEIA 3OZGA 4FOPA 4Q24A 3DTVA 4RD2A 2NXJA 4JCOA 1PSZA 1M2GA 1V96A 4FFPA 3WLSA 1M5TA 2CCJA 1PL7A 1PR0A 4KNVA 4LZZA 1HFWA 3DMYA 1F4VA 1JQEA 4U6QA 1A5ZA 1XXLA 4P5EA 3Q1KA 5IZCC 3IBYA 4CT4B 1XU4A 3GNTA 1PE0A 3NHUA 1KSHA 3GN1A 1EQ2A 3NORA 3QVLA 3FDZB 1ZBQA 4PR0A 5FPQA 3TEJA 1DTSA 3TXYA 4F8YA 1OQAA 1MX9A 4F2PA 2W5UA 3ZGYA 2VYQA 3RYCA 2C3YA 2K4MA 4RVFA 1O4VA 3N07A 3A1TA 3U7RA 4NFSA 3T1YB 4Y1GA 3IPXA 2BGWA 4LDAA 1KYVA 1JMVA 4FYYA 2BM0A 2HSJA 4CMEC 4LF4B 2YHAA 3BMCB 1U1GA 2DWCA 2DF8A 2FVYA 1FU4A 5A0TA 2EJWA 3JVDA 2FPXA 5BV0A 4KRXA 4DC1A 1KXZA 4LBYA 3M0EA 2QRVB 1FUEA 4X44A 1S2OA 1GNLA 5LA6B 4MQEB 4J2OA 3GAZA 3PHBE 2C7OA 4N7MA 1A8IA 4G63A 5AI4A 5KDDA 1ULSA 2VYNA 1FFSA 4GMGA 2Q2WA 4KP7A 2B0JA 3MCVA 2BC9A 2C96A 3OKCA 2FWBA 3UMFA 2HZBA 2W6MA 4RHXA 3PQEA 4ZRMA 4NYIQ 3V3TA 3INGA 4ZI3A 1ZLXA 2A92A 1DEHA 3D1VA 3KFXA 3KM0A 2AA3A 1DKPA 1I0ZA 4MR8B 4IJVA 1V25A 3LHIA 3URMA 1QIIA 1XZ8A 5EG5A 1KGSA 1IZ9A 5U1PA 3B5JA 3E4CA 5HZMA 3LGSA 3RHSA 2G5GX 2DUMA 2Q6TA 3JAKA 4JC5A 3F8TA 3FXAA 1GZ5A 2B4QA 3OWOA 3K1AA 5AUNB 3CEPB 3Q8XB 3ENVA 4MWEA 1KAMA 3KKNA 5EEHA 1WMSA 4HQLA 5L3QA 4OUKX 2IS6A 3RAJA 2C7QA 1JLMA 4BXOA 4GRDA 4XVHA 1WTAA 2VHQA 2Z1NA 3MJVA 3W6PA 1RE1A 4ZC1A 3L7KA 2OP0A 2BSQA 3L93A 4LSGA 2E4AA 3EC7A 1KP3A 3IOCA 2Q1TA 3EUWA 4I3HA 1BX0A 3GLHE 2JLRA 4DR2B 5EIXA 1GNRA 2IXTA 3B9PA 2CBXA 4O3FA 4WE3A 5FORA 2LXNA 3WGMA 5J4VA 5TGDA 4F9EA 5LZ9A 1T2VA 2WHXA 3QXJA 1CXZA 4XGNA 5ER6A 1B8PA 1ZOSA 1DKQA 3UHAA 4U4AA 4A03A 1RYMA 4EBBA 4F4UA 2WT8A 3DFIA 4XVCA 3DWGA 2EQBA 1LH0A 3IQGX 3KQVA 1DCFA 5JQWA 4C0XA 4FDLA 1JWBB 4Y6QA 1QYDA 4RTSA 4OX9B 3TLGB 5F64A 2JJYA 3KQMA 2V3WA 3JSXA 5KCMA 1VLHA 4Q4LA 1NZJA 3F6CA 1J2TA 4QFDA 4XLLA 3WP1B 1WXGA 4YAOA 4Z3OA 1FP6A 1KS2A 2FLVA 2QTRA 4P2GA 4BV3A 4EAQA 2IDKA 3P4UA 4PAMA 5AW7A 5B36A 4F1KA 4G41A 1NXSA 1WXWA 3BB1A 3EF1A 2CJFA 5I48A 1YZLA 4NYIR 1KI7A 3CR8A 1ML3A 4OK3A 2E85A 3I9V6 4P86A 1V37A 1XMJA 3M4XA 1SBIA 1KE2A 4P53A 4TKVB 1A8SA 2EWVA 3BWEA 3V2IA 5T3YA 3UK6A 3CYFA 2XDWA 2Q6VA 2AJLI 2ADFA 4XPIA 1JR2A 4GI7A 2H59A 2VATA 4W5JA 3ZWOA 2O48X 1V71A 1ZAYA 1XLTA 4WCDA 2AFIE 2QMEA 3PCRB 1CIVA 4FDAA 1ZOPA 1CR0A 3CV3A 4P83A 1OASA 1PL6A 2GK3A 1Y8AA 5G0SA 5LYYA 1U04A 1U7PA 2QV7A 3R0XA 4YJFB 5IC6A 1ICEA 3C6QA 1CQIA 1VP3A 2DLDA 3L84A 4JD5A 1N2XA 1INLA 1Z13A 2FMFA 2ZU6A 3BPSA 5EUBA 4TXHA 3O1IC 16PKA 2D5IA 5BNTA 3P9QA 5K8TA 2BM9A 5IULC 2G76A 4CIVA 3UMYA 2PXHA 1T9AA 4U7JA 1XN4A 1U9ZA 3DT8A 4DLVA 3SVLA 5KYGA 4JWKA 1PR9A 2GTPA 1FUYB 2OECA 2XT9A 4AG3A 2UXBB 3PT5A 2NXWA 3NNNA 1JFFB 3X2EA 4I3GA 4M60A 3OQIB 3IPRA 3T3NA 5E38A 1ILEA 4KPUA 3T4XA 4BBAA 2CMKA 3DDZX 2YVUA 3NBKA 2O57A 5EYPB 3TNFA 3BE8A 4AC9A 2GFQA 3BA6A 1ID8A 4M1WA 2WQ7A 2WTBA 3T4UA 2BOVA 1XMIA 2DERA 2W37A 2V7QA 3ZGXA 5T4FA 1GAQA 1VLMA 4MA4A 3TLAA 4UNPA 4CCYB 3ZQ6A 2L82A 2QIPA 4J1TA 3SNKA 3L05A 4BLUA 1Z45A 2RAFA 2OAQ1 3B2EA 1PG0A 1NNLA 4BNHA 5LDGA 1R0ZA 1HKHA 1NQXA 1A77A 1A8UA 1T2AA 4PE5B 4V0ME 5ALJA 2WV7A 5KHLB 3GJXC 1SA0A 2AN9A 3BE5A 2A84A 3MLEA 1AHHA 2RGRA 4B83A 1LJ8A 1E61A 2CVQA 4FYVA 5CVDA 2R8EA 3VHXB 3NBXX 5FAKA 3N8IA 1Z5VA 4DCMA 2CNNA 4IX1A 2KLBA 3EIEA 2B4TO 3H5IA 4O08A 3RE1A 1XTIA 4YREA 2BGJA 3C14C 1NW7A 4Y8VA 4ZO6A 4WFIA 4KRGA 2WJ3A 3AEXA 3NALA 3KAQA 4LZAA 4TZ6A 4NCIA 1DC8A 2ZBEA 4RK6A 1NA5A 2VEOA 4Z3DA 1A9OA 1WUYA 3FCSB 4HB4A 4HGZA 4IIBA 2QD2A 4U6NA 2P9YA 4PN3A 3EAQA 4PTZA 3KWMA 4B81A 5HM6A 1M8GA 4PRYA 4OSOA 1OFUA 5AOCA 2NQ2C 3V4FA 4E1BA 4YRIA 4TL7A 4NX2A 4GX1A 1DFGA 1EK6A 1PX2A 1Y8RA 3KKEA 1DGQA 4NSNA 4BZXA 4RKQA 3W5UA 2Q3MA 3QI2A 1U7HA 4LTNA 4P5PA 4BV9A 3SR4A 3R7FA 4HH1A 1MH1A 1U2SA 3L8HA 4RVUA 5BWLA 4YECA 1S1CA 4OKNA 2ORYA 4B79A 2HHAA 2AE1A 1T8TA 4WQMA 1TKAA 1T2CA 1YJ5A 3HDGA 3PHJA 2O2CA 4FEEA 3H5LA 2BL4A 1OD6A 2YQZA 1U1IA 4TSFA 4B84A 4RF4A 5AOAA 3V3KA 2BI7A 4NAHA 4RD4A 2TS1A 1H1LA 2UAGA 3WNQA 1BWQA 1U0GA 2VJBA 1FJ2A 4F97A 1N2CB 2XDYA 1XDSA 2OYSA 4YCJA 3VBEA 1QKJA 3O2JA 1L4GA 5C1IA 1CUWA 3P9KA 4PPYA 2HMUA 3ZDCA 1QFZA 2QG4A 3LUHA 1NXXA 1X70A 2FN8A 4MAMA 4F5DA 4M2LA 3ADCA 3BT7A 4LSZA 4C14A 3KDPA 1US8B 1M0EA 1GPAA 1MB9A 3QVVA 5HTKA 3W1WA 3VSAA 4ZQBA 1E6UA 1Y3DE 1XF1A 1Q57A 5JJBA 2GN0A 3FTEA 4UDXX 5ALIA 3NM6B 4K9KA 4N0PA 3E6AA 2E48A 1ZKMA 3MEQA 5TGZA 4CM8A 4XH9B 3N0TA 2TMDA 5JSZA 1EK5A 2FMIA 3WS7A 3G8DA 2WP8J 3GH3A 4LDNA 4C4AA 4DKXA 1KY4A 1CG6A 3C3AA 4QDTA 2GJ4A 4PSUA 4J0QA 1AGYA 4LJ4A 2C4HA 1LS6A 1UXOA 2PV7A 1IWBB 2IXAA 3KLPX 4KGZA 1VGVA 4Q48A 2QVGA 4BRSA 2EERA 1O57A 3WFZA 1G18A 2G8NA 3PE6A 1KDOA 5HF8A 1HPLA 5CLJA 2CYAA 3H2KA 1YZGA 5CXUA 1U5AA 3VO8A 2BISA 2XUDA 4ZVTA 3WDLA 3GFPA 3IURA 4L6IA 4BN0A 1G5HA 1X1QA 1T2UA 2F8LA 1RPTA 3KHTA 3A4NA 3NP9A 2QTCA 4FEAA 1HTWA 3HMQA 1XYYA 3RABA 1H22A 2PVCA 3BFPA 9LDTA 1YIAA 4OFWA 1QPGA 4QLAA 5BMVF 5JR3A 3TSWA 2XZPA 4KXMA 1E4EA 3SGLA 1ZOOA 4QHSA 1A69A 3ZUGA 4A8JB 5FFFA 4BEJA 3UGJA 3GJTA 1TGVA 3LXRA 4E08A 1A2QA 4Q3AA 4COKA 4K3VA 3W6NA 4G5XA 2E2WA 2F3QA 1F1JA 2ZXFA 4FW9A 4M76B 3PCTA 1JFLA 1U1CA 1R4NA 1XOIA 4JI6B 5CB0A 3A6EA 2O8EB 3T3HA 1BA3A 1D2EA 1ESNA 1QH0A 1T5DX 1I3MA 3KJXA 4MDFA 3R6GA 4Q4HB 4QU8A 1E77A 3JCZA 1FDIA 2J8ZA 2HFJA 3EY4A 3Q11A 2AOWA 4IMJB 1W2WB 2FQWA 2W9XA 3JD1A 3KEQA 1PVDA 3QVOA 3JYPA 4FIDA 2VBCA 2M6LA 4DA7A 1B1AA 2IZZA 1HTTA 1NJSA 3H86A 5KBYA 3N8HA 2HNBA 4QTTB 1W46A 3WL3A 2VP0A 2RFLA 2OBLA 2C2YA 2PJDA 1EJ6A 2REQB 3OQJA 4PLCA 1VBFA 2EF1A 1J2EA 1EUCB 4KACA 2Q6OA 3C3EA 3EN0A 1VCNA 4K8RB 4KQXA 3S27A 3ZE0B 3NTOA 5AW9A 5HJ7A 1COWA 3IL2A 1CYEA 1KF0A 1OIXA 5TPWA 3ND6A 1N5RA 3DFZA 3SFVA 1MBZA 3TZKA 4AZTA 4EJFA 1JUDA 4M53A 1U8UA 2ZBDA 1Q0PA 2OFOA 4WZBA 2F9MA 4TTIA 1DWOA 5DBOA 2OYCA 1WSWA 3KD2A 3K9NA 4OGWA 4ROTA 3UIEA 3PNSA 1HDRA 1PI3A 2AEEA 3CZMA 3AX6A 3FYUC 3VUFA 4AZ0B 4EY4A 5K0LA 4WXPA 1GQYA 1PGNA 3FDIA 3QHPA 4AN1A 4QQNA 2FN3A 5ULLA 1UWVA 4YV1A 1FP7A 4CQNA 1EWQA 4DM3A 2P3LA 5IXJA 4HZGA 4DT1B 4ZV7A 2QXTA 5J63A 4RLSA 1YOVA 4M38A 1ZSNA 2LCQA 3N75A 1E63A 3M9XA 2FQYA 4BZQA 5B7QA 1ACLA 3EGVA 3UXMA 3BWBA 2QK4A 4B8ZA 4ZN6A 2ZUVA 5A9SA 1QX3A 4JBWA 2WPNA 1II8A 1O6BA 1GLNA 3FLAA 3BMQB 4ZYZA 1VG9B 3W90A 4E30A 1IOLA 2W48A 5LP6F 4A7PA 3T5PA 2JLUA 4ZT3A 3FB4A 2IDJA 4MZDA 1FIUA 4CQLB 1NVDA 2P7IA 4DQVA 2CFSA 3OCJA 4U00A 3GUHA 4PCAA 3TOCA 3QVJA 3FPSA 4OQYA 5ECGC 3GRPA 4GM0A 4QXRA 1WCWA 4K9DA 1SGWA 5LSAA 2QJFA 4XRRA 3CRRA 1LPMA 3PR3A 3USCS 1MQAA 5THQA 4UMVA 5A3JA 1QCCA 3OD1A 5KIAA 4F9FA 3DE6X 3GJ3A 3GLGB 3IDQA 4WCFB 5B4TA 3DC7A 1UOPA 4OJKA 3PGVA 3AERB 3G2HA 3RKUA 1W29A 2H2HA 4BJ1A 2Y1EA 1XJ5A 3GEMA 4G0ZA 3S3TA 1XC7A 2AFHE 4RL6A 4R9RA 1JWLA 2B6NA 4RANA 4HX2A 4GOLD 3RREA 3PGKA 1V1RA 1NW6A 4L5IA 2NTVA 4OAQA 4YJGB 3RJMA 1ZR4A 2YHBA 4F4JA 3X1KA 2OMKA 1FFXB 1NM5C 1YT5A 2BM8A 3KSDO 3D6JA 4GWKA 4O4IF 2O3RA 5AI8A 1O5IA 1Y3IA 2UUAB 5H0IA 2PX4A 4IDQA 3UBMA 3W0LB 4FB5A 1J24A 2PUGA 4U9HS 2XR1A 1SOUA 3ZCSA 2KLHA 1GG2A 4MCAA 3WL5A 2K7FA 1UJBA 2X0RA 2YXEA 2V6IA 4UVGA 2ODWA 3QVMA 4N6GA 5B53A 3T94A 3ONFA 1ZAKA 1WMEA 5DCLA 4BZWA 2D13A 3WRYA 5J43A 1B23P 3VBCA 1MB0A 4ZRNA 2JLVA 4GHWA 3WK5A 1J8VA 2GBCA 2R4UA 1LQUA 2YWXA 3ZG6A 4X3PA 4LDPA 1X9HA 1GPNA 1P1HA 1R0WA 4LWZA 2IYPA 5JO0A 5EIEA 2JD0A 4MAAA 1CF9A 3C3BA 4UHBA 4RJIA 3QW2A 3WLFA 3T9BA 4QO7A 1ATZA 3ZU2A 1DXHA 1S1MA 3O5AA 5JAIA 1GP2A 3DOCA 4ROSA 3VDNB 1JU9A 1PYOA 2G1UA 2W2KA 1JZSA 4UEJA 4BO1A 4CF6A 1NVKA 1J0DA 3H9EO 3C5WP 4KEAA 3TAXA 2ECQA 2IL1A 3ZGOA 6NULA 5KYKA 1SHTX 4TXJA 3QEAZ 2PSSA 3U4DA 3EK2A 4O5AA 2NNWB 3DVAA 4RLHA 1YV9A 4HV4A 2ZSDA 3JWIA 4Z7QB 1R66A 2JAWA 3QPCA 3K4PA 3ZWVA 4ENWA 1GUDA 3FFXA 5M3BA 5JXWA 3F3SA 3GZTB 1BWSA 3L2OB 2NTJA 3VKFA 5LP6B 2ALJA 3Q2OA 4JC0A 5LNK1 4DREA 1Z0IA 4BQPA 5B3KA 4LCEA 4IVPA 1CBUA 3NDIA 4LJKA 1FMFA 3BRWD 3HDJA 4DCCA 4ZMBA 1JPVA 1E2QA 2JEYA 2IJGX 2QIOA 1R0XA 3BXHA 1AGXA 5IYZF 2ZIAA 3DDNA 1V1MA 2W2PA 5AOBA 1DG9A 1BSVA 3ZK8A 3WV4A 1EK1A 2WF8A 3QVGA 4CMBA 4FWTA 3EPKA 1XTQA 2M9MA 3DE5X 2ZSFA 1NI4B 4MRAA 2WTEA 3LW8A 3K1ZA 5GADl 1Q0ZA 3WMFA 4KOEC 1LJLA 5DK6A 2YMPA 3K70C 3D8RA 1W36C 1VKOA 3ZBUA 5K0TA 2QLMA 3AEKB 2AF4C 2C9YA 3HO1A 4ZPJA 1D2AA 4ENTA 2FF7A 2BFDA 2GF0A 3NIBA 2H4YA 5EIFA 3TX2A 4HWOA 3L7LA 1YKSA 3OAAA 4WIAA 2P4SA 2OCLA 3GGPA 4CRWB 3UC5A 1W34A 3QTLA 4O4IB 4YPFA 5HR5A 5LJIA 2H85A 4Y2JA 3FHTA 1I2CA 3ZWQA 4EG5A 1NBMD 3AR7A 4HPXB 1XZQA 4JH0A 4N5LA 1DXOA 3AEUA 2HRZA 3DAYA 4HDOB 4LV6A 2VDQB 2VTVA 3VPCA 3CRZA 4Q12A 5JASA 1I3NA 1I4TD 3DE1X 3ROEA 1X6VA 3DL7A 5TVGA 4JOCA 1NW5A 4JLUA 2H3EA 2JGDA 2XVZA 5HFNA 3K5HA 3W78A 1C8BA 2JVJA 3KT0A 2NM0A 3G9XA 2OLEA 4AYTA 4D5EA 3EEOA 4XLTA 2OFXA 4PFQA 4X6XA 3SIWA 2VTKA 5B55A 5JS1A 2Z9BA 5BPFA 4LY0A 4GI1A 5IAGA 4PY2A 5BWNA 3S2EA 3OZ7A 5EIBC 5K2MA 6REQA 3FZQA 1GTJ1 4YAEA 2OKCA 2CFTA 1R7RA 2VUHB 3DCNA 3MB8A 1VBNA 1XDUA 2FUG1 3QFHA 4P3KA 2ZSJA 3G17A 3TVTA 1NUSA 1XEXB 4JJ7A 4EW2A 2LCIA 2ZPTX 3ENQA 3HVJA 4UPDA 4PVCA 4ZU6X 1XZBA 1SUCA 3RAGA 3C43A 3V7NA 4MINA 4GD3Q 2BGUA 3HSSA 4KQ2A 4GOKA 1G8AA 4JJIA 4FZ5A 3A11A 1WZ2A 4D9HA 3OPYI 4D92A 4TKMA 4N54A 1JEQB 5B1DA 1JBKA 4EGFA 3JQFC 3N8NA 2C0PA 1G5IA 1E5VA 5TEWA 1NR1A 5BN5A 1LBHA 4JI8B 5F1KA 4WVLA 4C4OA 1LPAB 2RHJA 2VSOA 2F8TA 1E32A 2P9FA 1E3DA 5IS2A 3AV0B 3WIUA 1PVOA 4KN9S 4Q4AA 1C9MA 3RS2A 2X4IA 2IW3A 5KYYA 3LZDA 4QVIA 1PNTA 4G1VA 5G53C 3KXPA 2J5QA 2YVAA 5D5QA 5EIOA 3VM6A 1V35A 2IXDA 3KOMA 2D4AA 1AVTA 2VHEA 1DC7A 2Z08A 4WEOA 4DJTA 3CUKA 1Q1ZA 1JXAA 5B6IA 4OP3A 5IYZB 1X42A 1NF8A 3CCCA 5K0CA 4NP6A 2YN0A 1DVRA 2AMJA 2WUFA 5FQOA 4AM8A 4B7UA 3T3MB 4PZLA 3EVFA 4JYAB 2C99A 4FT2A 3G82C 2BKUA 2QUKA 3BMOB 1C1XA 1JXOA 2H1RA 1HQYE 3BCRA 1RCFA 1VLJA 4FYJA 2AZXA 4UXHA 4JI0B 3QJYA 4BQIA 1GAEO 4ZI7F 3V8RA 4I46A 3OHSX 2W2TA 2ZVDA 4G4JA 5J2UA 3AHHA 5I7RA 2WSSD 1GPMA 5B64A 4WTOA 1QAQA 3WGLA 3D2CA 4KQGA 1ECGA 3UHOA 4BMSA 5CK5A 3C7AA 2OXRA 1G17A 2HADA 2WJYA 3TB6A 3CPEA 1ZH4A 1T4CA 5E6SA 5IT4A 1QYCA 1OZAA 5JNRA 2ADMA 4Z9YA 4NXNB 3AL0C 1FYFA 3RIXA 3A8TA 1VKNA 4O1MA 2C8KA 5F12A 1HBJA 5GJBA 2FWNA 2B34A 1R5JA 3ZWNA 1CS4C 2FWIA 1T0UA 4UUOA 2GM4A 3AUUA 5IUKC 1FDUA 2DTXA 3O6VA 1ECPA 1DIBA 2OK7A 4RIIA 3DB2A 3ET5A 3UWSA 3VHRA 3WK8A 5EFOA 3R7SA 3V55A 4MK4A 1W75A 2W4MA 1JEYA 4GQIA 4MR9A 3CEHA 3PD0A 2I7XA 5JS2A 3CLRD 4AWAA 3L8CA 1JSRA 2ZUDA 5A0VA 2GT1A 1IHYA 4Z9FA 3LLSA 5AW0A 3NH9A 5A5DA 5AT1A 3SS8A 1QWOA 1KR2A 4XWAA 1G7SA 1UBEA 1JYSA 2NO5A 4ZQGA 4EMTA 4ZDJA 5IHPA 1DIHA 5EKSA 1L7XA 1ZI9A 1WU8A 3OC6A 3AKYA 4H35A 4JS0A 1U2GC 4JVSB 4LDRA 4X90A 5CMLA 1T5OA 4EF5A 3O9VA 3GJZA 4P2BA 3K0HA 3GAFA 5TVKA 1AF4A 2FMTA 4EYQA 4HQKA 3QF7A 3L43A 4OH1A 2P4QA 4RQUA 3COPA 5EWJA 2AHOA 3GPIA 1ZD5A 1P17A 5H9VA 4RY8A 1Y6GA 1NIPA 5LA6A 4LXGA 1TD1A 1TC1A 3ZWAA 1RZRA 1IBMB 3PNYA 4C2UA 3WNBA 1WD7A 1EPUA 2RKBA 3EZLA 2YS6A 3EC2A 1B1CA 1Q74A 1UKEA 4YUZA 1YJAA 2X0KA 4RACA 4MJ7A 3SQDA 1JS1X 3ROGA 1R6AA 1ZC4A 5AVQA 1UFKA 2F1IA 3MLBA 4MVJD 1I4EB 4IYJA 1CZRA 1HURA 1S9DA 3G9UA 3MF4A 4RQTA 1IHOA 4L8VA 2FE4A 4ZAYA 3HWSA 4TLMB 5LKRA 3KB2A 3P9ZA 4KQWA 3K2QA 3T7SA 2BDTA 1XZDA 2BFCB 5EUMA 2A1UB 2AIRA 3C6MA 4FS8A 2UUCB 3GCZA 3CLUC 4WECA 5LB2A 2PZLA 3C3CA 2FNAA 2FEPA 1JTFA 4BCCA 1CR6A 5EMHA 1RNLA 5J1TB 1FX1A 3HVUA 3W2HA 1SKMA 2YJ4A 1RI3A 5KC9A 4JZKA 6AT1A 2FR0A 1OMOA 4REOA 3JD3A 1RQPA 1SCDA 3LY5A 2VF8A 2Z2ZA 2NTNA 3EGDB 3ZJ4A 5HKKA 4ZFNA 4DLKA 4ZI7B 2IP1A 2PZEA 3A31A 5E2BA 2ZAMA 4K6MA 2DQYA 3TQHA 2RHOA 3PDCA 4MUXA 4W7SA 3PNLA 2VRWA 5EWLA 2KJQA 3VTZA 1NU8A 1SC3A 4H7EA 1X1AA 1VYTA 2ISSD 4N9QA 4HTFA 4RHEA 4WMLA 1C7JA 5JYBA 4XPZA 4I50F 1J70A 1PKXA 2HCRA 5DTIA 4R7TA 1L4NA 1NP7A 3VR4A 5BQFA 1CP3A 2IUSA 1K7SN 1JPUA 4NEQA 3ZE9A 13PKA 1P0FA 1HEYA 4NBRA 2NWQA 1CHNA 1DQSA 1OREA 3CJTA 4G9EA 4MRMB 1OPXA 4Q01A 5HKOA 5L4SA 4LF5B 2DB3A 1JG6A 4PX2A 4P5DA 3HI4A 3I53A 3OIFA 2CEKA 5J40A 4DDKA 2X2PA 3BTUA 1KP9A 3CX4A 1A8QA 4RTOA 2ACKA 3NANA 1EBFA 3K30A 2BTQA 1VG0B 1Y5IA 1TXGA 3JRXA 3W3ZB 2ZZNA 3O82A 3DBVO 4KQFA 3ZOKA 5LZ4A 3L5OA 3PITA 3VJKA 4Q47A 5DHQA 2BBWA 2CLCX 3EG5A 3KSUA 2P41A 3PPYA 4IDNA 3AF6A 1OJ7A 2BFOA 3SBOA 3KHKA 3LHKA 4JNKA 4FFLA 1M0SA 4BFWA 5KQGA 2XYQA 2W2NA 2CKDA 3EXEA 4TVKA 1EVIA 2MSKA 1AK2A 2GRUA 2R68A 1AM4D 4M4SA 2Y27A 2EFHB 2Q3EA 1E79D 3SDBA 2IU4A 2DU8A 1GITA 1QOPB 5DH9A 1Z29A 2XMGA 8AT1A 5DMXA 2B0CA 2YW2A 2HZ7A 4F5YA 5K0NA 3EDMA 5A3SA 4EYOA 3OKAA 2GUWA 5TMDA 2X86A 4L16A 4E09A 1Y6FA 2L17A 2MT9A 3WGIA 2ZJ1A 4KXQA 2WJ4A 1GZ3A 3B53X 3K2EA 4EY8A 2P2GA 3KS9A 3N74A 3TYXA 4LYJA 3JQGB 2Q9BA 3OE7A 4RVNA 3AM5A 4R5MA 1NL3A 3VVLA 3G5TA 5EUQB 4IOJA 1JDZA 3UHFA 3NBFA 1YRAA 3PUJA 5BO5A 1FQOA 1I7LA 2BELA 4L22A 2OGZA 4O8ZA 1J25A 3GWGA 2BR3A 4PZDA 1L4LA 3L6DA 3ZNQA 1GD1O 4TUYF 2IC5A 1ZN2A 3EYAA 3RIMA 4G3XA 2ZEJA 4RHCA 3AL3A 1FFEA 2IUFA 3OFVA 2XA2A 4RBNA 1T5SA 3V1MA 1XTPA 2Q6KA 4FE4A 4XUDA 4QGSA 2XCRB 3VR3D 3I1IA 4KCGA 1FYXA 1ISRA 4MKIA 4AYWA 3ICEA 3K35A 3BL8A 4BNDA 3LO8A 5AVJA 1FJGB 5JTTA 3H11A 4CKWA 3NG1A 2ZGVA 1PK7A 2QE7D 1ZSVA 1KMHB 4HGPA 2C58A 1ZS9A 5REQA 1NDUA 2ZANA 3PEYA 1H4TA 3GLRA 5ALYA 2C54A 4PXSA 4CKBB 1MB4A 2R7KA 3DEKA 3D6VA 4UCFA 2WJWA 3AWIA 4Q9LA 1JG4A 1U0NA 2VP3A 1JE0A 3X43A 3G0HA 1WHTB 2O1WA 2GBGA 5EXEA 1M1YB 3RSZA 4NV1A 4HPJB 4I50B 1U5BA 1P5RA 2AUTA 2PEYA 3BICA 4KJXA 1M8JA 3O91A 4US2R 3P94A 1RW4A 4IX9A 2JJQA 2QTAA 2G88A 1IQUA 1YBHA 3EZNA 4OIFA 2QVLA 3NKLA 4HYEA 3RIEA 4BS9A 1NV9A 2FZ4A 3MT9A 2NZJA 2XXJA 1ODCA 2B4AA 2JFGA 5L3SB 3RGGA 2C9DA 2OXFA 1MW8X 2OKGA 1JVSA 3FSGD 3G7NA 3R5HA 3T9FA 1OT3A 3USZA 3I2FA 3MA0A 3CVJA 1BKYA 2WYVA 3GFVA 3LOQA 1G41A 4RJTA 5JT1A 3JY6A 1SG9A 4BVKA 3B60A 1Z62A 4X61A 2V7EA 4H77A 4AVYA 5K8LA 2P2CA 3TQFA 1ULBA 5KYWB 3RUPA 1VJ1A 5FOSA 821PA 1E1CA 3GYBA 1JIVA 3BWDD 4KXUA 2GAFA 4FGSA 5FI5A 4AUMA 3H3JA 4PBTA 1M2EA 2FP3A 2JKVA 2WU0A 3O2QB 5L3RA 4ARBA 5DGCA 2OTCA 1W2HA 2MHCA 1NOJA 3BWXA 1SC1A 5ESWA 4ZYUA 3FRIA 1IY1A 3ADBA 2JHAA 3QENA 3ICQB 1FFAA 2UYQA 2QL9A 3WWDA 3O4RA 4AZ3B 3TQIA 3L8DA 1KVQA 5GM2A 5J23A 1WU7A 4A6XA 4BIIA 2XWBF 3JWEA 1QLWA 4IHJA 3U4GA 2H18A 3FTCA 2FJUA 4BKPA 3G2IA 1TCUA 1O6GA 2OHGA 3DD1A 2GPWA 1QV9A 3LDHA 3NM4A 1JJBA 4HAIA 1C9NA 4KN6A 1Z15A 3PDIA 3QU9A 1V9LA 5F4ZA 5AXAA 3VOAA 4YMGA 2GM9A 1GHTA 4R1NA 5TGTA 2HC9A 2CWDA 2J85A 1JALA 1BE0A 3F8SA 2ZSAA 4ND8B 4NLLA 4TUYB 4JBHA 3GIDA 5BWCA 2GVZC 1X1CA 4OBBA 3WAGA 1RS0A 1H0KA 2IP4A 2ZTLA 3TQCA 2ZRHA 1L4FA 1O5OA 3HBAA 3NDPA 4I8DA 4WERA 4WNAA 1O58A 1XDGA 4UDOA 2BKVA 1QIJA 2XQGA 3ZE7A 5JCZA 1LV7A 1QTRA 5T67A 3S7TA 3ZE8A 3T0FA 3HCAA 2PGNA 4IO0A 4YBRA 4OXIA 5F3WB 2BR5A 1GPWB 2O8BA 4ZVQA 1NPYA 1FTSA 5HUJA 5KOHB 1P3JA 4FBMA 4ENQA 4C7OA 3R77A 1FQKA 3V1NA 3IE2A 1H2HA 4EHAA 1PSDA 1T3SA 2MDTA 4I0WB 4PZ9A 3TS1A 4RKRA 3ZX4A 1EE1A 1XF9A 2C00A 3P32A 4QAJA 4RA6B 2C94A 2X8LA 2VK1A 3KTAA 4MXDA 2VAMA 1Q21A 5JDCC 4C30A 3RVSA 4BTLA 4V24A 1OX6A 1JIJA 2NVUA 1H5QA 4YJ2F 5KWEA 3TL6A 1Q84A 2W6JA 2O6LA 3HYSA 1YK0A 3WYBA 2JAXA 3HB1A 1I94B 1SVOA 2OO3A 3L1IA 1X1RA 3RU2A 4UBNA 1UINA 3TNJA 4M1YA 1XMQB 2NYRA 2Y1GA 5D1NA 2LP4Y 3GJYA 4LE1A 3DNMA 3TCNA 2ZS7A 1Z3IX 1TZBA 4HXEB 1MAUA 4IPTA 3ZLVA 5CLHA 1OILA 3RDPA 5CITA 2ZI4A 1NBIA 1DQZA 1G9TA 1OFUX 1I3OA 3ZVLA 4BNXA 3OZSA 1ZONA 4LQCA 2E9SA 3NDJA 4LEIA 4OI2A 4XQGA 2VZ8A 2PRSA 5DEOA 5FXMA 4AO6A 1X7XA 1WZEA 3BHIA 4P3OA 3DVRX 4ZTBA 4YLYA 4INOA 3C3JA 3IESA 3OM1A 3LPNA 1W0CA 3OOSA 4LK2A 4DJAA 1MTOA 3EZ6A 2WWGA 1XROA 1Y4UA 2CLOB 3DXFA 3SICE 4ZYYA 4KQJA 2ZITA 1MOZA 4TTSA 4IIGA 3K73O 4Q7EA 4ZYTA 5SY9A 3BL6A 1F9EA 2SKEA 3S55A 3CUEF 4BWYA 4KXYA 3VAYA 4UTNA 2O8DB 4WZZA 3GQVA 4MQ6A 1H85A 5ER9A 4BZPA 2ZTSA 2NZ2A 4BFCA 4EYSA 1BOOA 1K7XB 4L1KA 4S2EA 1CFZA 1DXQA 1RJGA 2ZRFA 3GMSA 4YCAA 4B17A 4X84A 4XARA 4YFVA 4ZD6A 3RC2A 2PGJA 5LBUA 4H7PA 4ACAA 4MW2A 2BHRA 4OQNA 4JN6B 5EJ9A 1AXEA 1HDIA 1J6UA 3WYDA 3GA5A 5DJ5A 1SUFA 3OFJA 2Z30A 3ESRA 1MGOA 2KSQA 4CXMA 3MB5A 4RS4A 1EUCA 1QH1A 3PUWA 1DG3A 3KALA 5H8WA 1QQBA 3C3XA 3HA3A 1EX1A 5IKMA 3BRSA 2A30A 1VE7A 4HNAB 5EJ7A 3BIWA 1MRSA 1QYWA 1QC5B 2R8BA 1GCUA 1KIAA 2BY4A 3I52A 3NRJA 2GN1A 1L0BA 2CUNA 1AGNA 1OIWA 1SHLA 1VPTA 2DECA 1Y0BA 3WX0A 4E70A 4PZEA 1PUIA 4ZVSA 3STUA 4EW3A 5IMSA 3EG9B 1JMKC 2REOA 3L7MA 3QZUA 4IIFA 5CIYA 2GLUA 2ZCVA 1RHQA 1USIA 2R60A 4NCXA 3DP9A 1M34B 2XRFA 3GVIA 1TEXA 2XOXA 2BR4A 1VG1A 2WVJA 1ML4A 3F6RA 5ICFA 3WTBA 4DMMA 2VWQA 4II7A 3TUZC 2GHQA 3O4HA 3CX7A 3D0RA 3W6OA 2AFHB 3HO8A 2EF0A 3RI3A 1O03A 2VNAA 3EQ9A 3KYDB 4RMJA 5G3ZA 5G1PA 3R75A 2JA2A 3UC9A 5KAPA 4DQLA 4F4HA 1JTVA 5HOEA 5JROA 4OQPA 1XMSA 4YJ2B 3E5HA 4DCUA 1EGAA 1GPBA 1SH7A 5JXIA 2WG0A 2NPFA 1N92A 4KG7A 2ZRAA 1DKRA 1N5KA 1PWXA 1WL8A 3L0SA 2RB4A 1EJBA 1LC3A 4H4CA 1HDEA 2Q5CA 2BHTA 1IEWA 4LBVA 4I1YA 2FSHA 3LT1A 4D79A 3OY7A 4WKCA 4B3FX 4L4SA 1AF7A 3FYUB 3QK7A 4ZO8A 2CV0A 1XO1A 3ODGA 3REGA 3R4VA 3IKMB 3NRCA 3JX9A 4TMXA 4GE0A 1LBSA 1MQ9A 2ID8A 2I1WA 2VTEA 3R6LA 4LOJA 3TXAA 3ZHRA 3F46A 5IVPA 3EXIB 1TZ2A 3JVUA 5BMVA 2JGKA 2OHFA 1ADGA 2HLDD 2KPOA 4FHDA 1K8QA 4MI1A 4E14A 2V7PA 2FTKE 1GT6A 2QXYA 1TPZA 3TNDA 3AOEA 2R6HA 2Z2KA 3EE6A 4ICIA 5AIBA 4MVJH 5AW6A 4RCZA 4JL8A 3MMZA 2YC2C 3ODPA 1K92A 2QUBA 4L0MA 4LHYA 4LXQA 2W43A 2R86A 2H4FA 4DN6A 4ZZ0A 1X0VA 3CLKA 2GETA 3CY6A 4YO8A 5ALRA 3LSTA 2BWJA 4W1QA 1SCIA 3RVMA 1J97A 4LMAA 2XDQB 3REQB 4HDNA 2NT3A 3F6SA 3OIWA 1RBZA 3CEJA 3UQYS 3IIEA 3NC0C 3P7MA 4R2HA 3KFLA 3PDUA 2PS1A 4JLAA 2OO5C 1HT1E 4CKCA 4H16A 2PL3A 4FX5A 5FA8A 2A94A 4F06A 2WR8A 4N8DA 3JQRA 4BMNA 2DFVA 1KEWA 5EHXA 3I5XA 4Z86A 1KKLA 4ZAXA 4DNQA 4PGMA 2ZR7A 3N28A 5AKHA 3W8FA 1GFZA 1RFLA 2GVNA 1IBKB 3D8BA 3WKCA 3ZW7A 2XIJA 2ZYHA 3KCQA 5J4YA 3T5CA 5D7BA 5K05A 3ZDYB 1MD9A 1ZZGA 3AZPA 1OZ0A 3ZI0A 2ZUFA 4RE5A 4LNHA 3OF5A 2ZRJA 4DCSA 2EQAA 2ZIEA 3QEKA 5CDFE 2YDYA 5IDQA 4I9GA 4BWVA 2RG1A 2LZ0A 4M22A 4QXAA 4ZVRA 2M98A 4EDFA 1IY8A 3MJDA 1JJFA 4FFRA 3Q3GE 3TBFA 4LYDA 3EB9A 3LFTA 1O3YA 1QGUB 3OBIA 1IN1A 2WBLC 4OF4A 4YBZA 3SJUA 4FYKA 1KI4A 2H65A 3Q9LA 4FFNA 3HM2A 1CX9B 3NWEA 3X1MA 1XMOB 4JELA 1NE7A 3EPHA 5ILOA 2NZXA 1D04A 4ZZIA 2GAAA 2PCJA 4GKJB 2O8FB 2OY0A 1QU3A 1RMYA 2FZ5A 2HA5A 2W2LD 3WRVA 1FSPA 2F3SA 2OFFA 2OQVA 1ZPDA 1CDDA 4LWQA 1ARZA 2VN8A 2OHJA 4V0SA 2AC7A 1NURA 3I2HA 4NMWA 1PTJA 4M1TA 3L8EA 1CUIA 4ZYVA 1VJCA 3DZGA 3HDYA 3NAZA 3QY9A 3VMFA 1WXDA 2WJAA 3WLHA 3TIFA 1A82A 4QGFA 8GPBA 2X7HA 5KYXB 3N2YA 3PQDA 1D2RA 3L77A 3KSRA 4JL6A 4QO8A 2N46A 5DCUA 4CQMB 5FFNA 2JJMA 4BWGA 2FG6C 2DQ4A 3LSYA 4MMZB 1V9SA 1Z25A 2PGIA 3E4DA 1YMVA 5DU2A 4M8IA 1SNYA 2HBYA 1U8CB 3GHHA 1IEVA 2LE0A 3SS7X 3WBFA 3IBGA 2VQEB 4DUYB 1RJFA 1SCKA 3L0DA 3LC0A 1SVWA 1MAVA 4UARA 1PNOA 3U3OA 1CVRA 3EDRA 3OZUA 5AIAA 1GZUA 3BGVA 3USES 2VT6A 1ZM2A 4Z1MD 1SG6A 1SCUB 2X7JA 4NAVA 3WQHA 1BS1A 4MQUA 1OYYA 3DTVD 4FGUA 1RBYA 3RSOA 3PDJA 3T7IA 3MERA 2GEUA 2A67A 3AK4A 2FRVA 1Z4JA 4D99A 4MKXA 2H63A 2QROA 3P71T 3EYWA 2NUPB 2HMAA 3E81A 3FM9A 2QY6A 4M36A 3OEHA 3U7QA 2WAMA 3WZ2A 2Z8XA 4B3BA 1UJ4A 1RPNA 5EJ2A 4LF8B 1RMTA 1XAJA 4J4TA 2AXPA 1ONSA 4TLCA 3UB3A 2FW8A 3DL0A 1AB6A 4NZYA 4PX5A 4R2IA 3TNLA 5HUQA 3EBLA 3BEOA 4PQFA 1WB9A 1IJEA 3K6JA 3H1FA 1W36B 5AICA 2WTUA 1XEFA 4J0JA 1RHKA 1XRPA 1O96B 4GGMX 4BLWA 5IH3A 2XB9A 1KBZA 1XEXA 3C7TA 4FS3A 4J8PA 4EHJA 4KWIA 4MUAA 4QUAA 4P1ZA 3H0KA 3VYRB 2FZGA 2HY7A 1LKZA 1Q0TA 3G5AA 5FJIA 5A05A 1RAGA 4KO1S 1VECA 1ZXLA 4KQEA 1P8JA 1DPGA 3E8MA 2JK1A 2VYND 4Z8XA 3QXCA 3QWIA 5AJHA 4RPGA 1CB0A 2O0HA 1UK6A 1FSGA 1Y9EA 2X9NA 4RE6A 5JIBA 4IGFA 1QQ5A 2QVXX 3E3AA 3PUZA 3QITA 4K6FA 4RJJA 3J7AC 1D09A 3PI6A 4GBMA 2IPAB 3K72B 2I6TA 2LW7A 3HZZA 2I7DA 1K7YA 1X1EA 3DDWA 2VLBA 4IEFB 3CVWA 3D31A 2O8NA 3F5SA 2VUIB 4UAGA 3FNRA 5KJFA 3B6JA 4RTMA 4ECAA 1HYBA 1GXSA 1T0PA 2QMOA 2PYIA 5KMGB 2Y0BA 1JL3A 2RGAA 1N3IA 2HDHA 4B2IA 5U4XA 1FW8A 3WYEA 4D74A 2B4RO 4OXNA 1LZKA 4INZA 3V8VA 5H3LA 2ZBVA 5AHOA 4JXXA 2F9LA 4MUHA 5SICE 1YZ3A 4L27A 4BNVA 4ESOA 1EHIA 3WGHA 5IABA 1JHZA 1G98A 1PLLA 1PZEA 4YI3A 3GF4A 5IJZA 4CHTA 5C37A 2FSUA 3JQ8B 3BHMA 2VUTA 3MJFA 1W73A 4AKSA 3PXCX 1K7CA 4D5GA 3D7RA 3TSCA 4Y6RA 3U17A 2OK8A 1JQBA 3CX8A 1ZA2A 2FPLA 3THXA 1KZ4A 1PZXA 1WX1A 1YBAA 2OR3A 1KNQA 2NU6A 3V1LA 2WWXA 5BW4A 1Y42X 2CT8A 2ZZMA 1DC3A 1QG4A 4G81A 2FR8A 1KQGA 3U4QB 1G1MA 2IPNA 3CW8X 4NZOA 4AXXA 4LMRA 3LUJA 3E9DA 3LQKA 3TCKA 4MGYR 4JP2A 4L5BA 3WLKX 4ZYWA 2AZDA 2DJ5A 1XKQA 5IT0A 1E2JA 3ZD6A 3CZCA 3A1FA 4FD2A 3RVQA 3BAZA 3ISVA 3S0JA 4D9BA 3COYA 3F5MA 2Q3JA 4GGOA 1TK3A 4TL6A 4DBZA 2PFKA 4JI4B 1FDRA 5D3MA 3N39C 1RP1A 4KBGA 3I4CA 4AZVA 5KTNA 4IJ5A 4CIDA 1EFVA 1BCRB 1XQ9A 4KGVA 5JQGA 3R7NA 3C1OA 1AKVA 3QY0A 4LZPA 3TQTA 4AUNA 4EX7A 1IE3A 2QYOA 3GRCA 3HBFA 4ZCIA 2XMSA 5FBZA 4X7BA 4YUAA 2J3HA 1LSSA 5BURA 3ZLUA 2N1MA 1LDMA 3UGTA 3P52A 2JIZD 4IOMA 3II6X 1Y8CA 3U9TA 3ONVA 3GDGA 3HJAA 4US0R 2PX8A 4IQFA 1GR1A 4ZCTA 2R62A 4K81B 4DEYA 3CURA 1U3UA 4GRAA 3ENKA 4WJZA 2HQOA 1KFEB 4M9UA 5FPYA 3PGLA 4WT7A 2ZIFA 2ZI6A 3EFOB 4U5XA 2ONKA 5DO9A 1FZTA 5EQJB 1J7KA 1GQQA 1JHMA 1HG0A 2O2XA 3EW9A 4C0BA 2XMDA 1QK3A 1SO8A 2AZ4A 2G5CA 2BFEB 4NL4H 3BKWA 7REQA 3BWYA 3UMMA 5E7MA 2PMBA 3FOFC 2IEIA 1MGPA 3HRIA 3KNZA 1C5KA 3NIDB 4OPMA 2ERCA 2GK7A 1U3CA 2YXNA 1GZ4A 1SBTA 2JATA 3GLHA 3OMWA 1M72A 1VB5A 4Q3CA 4QEZA 3WYGA 3HCNA 3LYHA 2ERYA 3OEYA 1A9YA 2JCXA 5J59A 3NX4A 5K0JA 6LDHA 3D1JA 2WWWA 4V2IA 4EUFA 4D98A 5LIPA 1XHFA 2AT1A 2VA8A 2BH9A 4NC9A 3M4JA 3DEYX 2A1UA 4Q02A 4CMEA 4TVSA 2H7XA 3OA0A 3T3EA 2GOYA 2GFIA 3AB3A 4HL6A 4MS4B 4P7FA 3IV9A 4U2FA 4A5OA 4A0GA 1HYGA 4EL0A 3JD0A 3NOXA 2CL5A 5CLGA 1KMCA 3D1LA 4D4MA 4Y1EA 1B6GA 4XQ9A 4ZCQA 2QVYX 1XTTA 4K9OA 2VVTA 1WP4A 2XEDA 3ASUA 5G0VA 1KARA 1NIJA 1Y1PA 1KH2A 3TF5A 4GBGA 1E1DA 3ZGVA 1Y6JA 2V7QD 4MGIR 4CQJA 4RABA 3FWKA 4LDJA 1QRDA 1GGKA 2C84A 1YRWA 1EEXB 3H83A 3WMRA 1KRWA 3G85A 1XFAA 1KY3A 4JQOA 3HFRA 2I3ZA 4ZT2A 3GLIB 3HVHA 3UFBA 5EKDA 5FTKA 4KUEA 3R0QA 1KJWA 4FGLA 5E1OA 1M74A 1G5RA 1TZKA 2AFIA 3N8KA 4PTLA 2ASVA 2XNKA 1Z8DA 1Y1RA 2I2CA 3D6TB 1WMAA 1DINA 1YJQA 1DQYA 1IN5A 1ZH0A 1R10A 1HLPA 3KQOA 1IH8A 1ZGZA 3OOEA 5FBWB 2PV0A 2NO4A 3W9UA 3SZLA 3NIWA 4CR8A 2IZOA 1H2ZA 3LUDA 4CM5A 2ZETA 1YVPA 2MJLA 3IULA 1ABFA 5U4QA 4MVCA 2EIXA 3W7VA 2FQQA 4D8UA 2OVBA 3T4EA 3QVUA 4Y1FA 1LFAA 4IF6A 1ZISA 2Q4TA 3IUJA 5L6LB 3MJRA 2YWEA 5HOQA 3CMMA 3QHAA 3AFNA 5BNFA 3F9IA 1TAGA 5K6AC 2I3DA 1TRHA 2AMLA 5AR1A 2WHPA 2XKJE 4EMUA 1FSZA 1IXRC 4MIKA 3RHTA 2RG7A 3U3ZA 2NGRA 2W2VA 4F6RB 4HFRA 5I01A 3A0RB 1S8OA 1RTTA 2AEJA 4F1JA 2IOQA 4KAAA 3JZFA 1CJUC 4TSFD 1BWRA 2HJGA 4X60A 1NKTA 2HXYA 2OCGA 5DSZA 4E0BA 3JZDA 5GZ1A 1M1ZA 2RBKA 2W83A 2C7RA 3T3IA 2CSUA 4JI2B 5M04A 3BREA 3U26A 3COWA 1RWKA 2ZB8A 1KVUA 1W4ZA 5DX8A 2RHGB 3STYA 1P9RA 2UZ1B 4GX2A 4HK4A 4P4SB 4V0MA 2QN3A 4WN9B 5CA1B 3ZWXA 4PQYA 1MRZA 3MOSA 3DT6A 2QP3A 3GLQA 4GVLA 5I9BA 5TJHA 4BOYA 1G9SA 5B57C 2VTBA 1PEAA 2BMDA 3DXYA 1IYZA 2HWUA 5AMXA 4ZK6A 4GMFA 4POAA 1WLSA 1L7OA 2K87A 1EK0A 1Q7EA 2RK3A 3EW7A 4GOMD 1ETUA 2D2XA 1SHJA 3NT2A 4EPYA 1JIUA 1LK0A 2VZEA 1B3RA 5I51A 4N48A 4LE0A 1CZUA 1ND6A 4HZUB 3D59A 3HMKA 2JI6A 1AZLA 4B31A 1A27A 5TQ2A 1JA0A 4YRZA 3VVCA 2OXEA 3HXLA 3WFIA 2PSEA 4FJ0A 3N8DA 1B8NA 4EKYA 4C0AC 4FOTA 5JI2E 3V8MA 2HJ9A 1KZ1A 1LY1A 3N2GB 3ZXUB 3FCCA 2FH5B 2HPAA 1YMQA 3G89A 5KO2A 2AKYA 2X19A 4YI5A 1L5GB 5EZ6B 4C0LA 3QPUA 1UBOS 2RH9B 3R3HA 3EGIA 4FNGA 4BFLA 2QAJA 1USUA 1CEQA 1S02A 3ZWCA 4R8RA 1OYWA 3ZCTA 2IHJA 3NYIA 3OTOB 2ZFUA 1QVVA 4KMRA 3EZ7A 1Y81A 3HP1A 3KV1A 3DQPA 2AW5A 1OCEA 1VM6A 5HF9A 1T0BA 1ZUWA 1RCTE 2G17A 2I54A 3OOYA 1JEEA 1UIMA 4JLPA 3RSCA 3T0IA 3VOSA 1MAAA 3FG9A 4J16C 2JLCA 3LLMA 2Z56A 1B74A 2C95A 1FXWF 1G291 1FX0B 2F67A 2GO7A 3OZAA 1NOKA 4S04A 5G4LA 1A72A 5I4BA 1YIOA 4UTOA 3GQBA 3OPVA 4DTIA 3BSYA 1NZFA 2WM3A 3VTAA 2AC2A 1ZMXA 2AG8A 2YV4A 3EXG2 1ADJA 3N0XA 3JQAB 2QD5A 3KJIA 1MG5A 2QN1A 2D2IA 3ETJA 3ZJUA 1DTEA 1Q5PA 1OKKA 2V7TA 3ESAA 3GUZA 3IBTA 4LXTA 4Y2RA 3UJ8A 1GEEA 4FOSA 5CDGA 4B3MB 2IDMA 3JR3A 4UE6A 4US1R 2ZIGA 1FFWA 1G7TA 1W44A 2C5GA 2D59A 3SEAA 4LHWA 4P81A 3TVYA 3FOBA 4JQZA 1DAHA 1Q0UA 3BGIA 1COWD 1X15A 2PRIA 4L3VA 2B2NA 2EZUA 3B85A 2IELA 4BO2A 3PQ6A 2PYDA 1BKDR 1JDPA 4HWTA 4RWEA 1JFVA 5FOVA 5H1YA 3SMVA 5T5QA 1VCOA 4AKEA 4NDAA 1RI1A 1ZUNA 2PMDA 1SC9A 2YV2A 3PQFA 4HMQA 1DIOB 4HT3B 1SCBA 1YZTA 3RSLA 3RWOA 4C89A 3UMJA 2UVPB 3IP6A 1USGA 4IV0A 5IWCA 5CXSA 2GLXA 1FSFA 3QF4A 4M0KA 3UA3A 4YEDA 1Q0HA 2PWYA 5LMZA 4DLXA 1JAHA 4NENA 4ZXFA 4IGEA 1C1YA 3NOOA 4DPLA 4EFKA 4HEHA 1CNEA 3VU9A 2IP2A 1GADO 3C97A 4RTLA 3I0NA 1SHZA 2VYCA 2AYXA 3OIGA 3QJ5A 4MKRA 3FF4A 3ES9A 4O2RA 5G3YA 1LFDB 3TSZA 1ENOA 3GB9A 4RA6A 5CT9A 1O87A 2WDPA 4INJA 1X8JA 4E13A 4H0FA 2XY4A 3PJGA 2J5XA 1YR9A 5DLEA 4WUTA 2DXIA 1YVUA 2C2OA 3KC2A 1DMRA 4ZJYA 1DBIA 1TW3A 3GJQA 3OCCA 4PC3A 4D8XA 4BKQA 3GGCA 3DCYA 4EATA 5CCXA 4RHFA 3ZWDA 1U2EA 3NJ8A 1P75A 3MRXA 4BBJA 4GE3A 3G8AA 4BKUA 3FFBA 4F6CA 5FBRB 3BF8A 4X1KA 2Q1YA 3OZCA 2JNWA 5EXTA 4J4BA 4AY5A 1Z4LA 3WLPA 4AO7A 5FF9A 1V26A 4CU2A 5TMEA 4H17A 1KZ9A 1P1RA 4NV3A 4Y2YA 2UU9B 4RWZA 4BLVA 3BWCA 4MSUA 5AI0A 1N3LA 2C2MA 3SJ7A 4QNRA 4BE9A 1GYQA 3H1GA 4R8SA 5F73A 3BZUA 2QSJA 2J32A 5K0SA 1C29B 2OUKA 2X58A 3BH7A 4IUYA 4RW0A 5DM70 2BTEA 1HZJA 4Q37A 5AKKA 4ZVKA 3Q3EA 2ABWA 4M0EA 4QTXA 5C2JB 3K0FA 1P7YA 1RXYA 2AFRA 2VH5R 1VI2A 3LQFA 3ZDFA 3A6JA 1DAEA 4LHXA 3MT7A 3LFUA 4J3FA 2HN9A 4OQDA 2IZ7A 4MP6A 2PANA 3P19A 5TXGA 4DQUA 1IPHA 3ILYA 3UV3A 5F7XA 2RGUA 2CK3A 5IVHA 1XRMA 1EVKA 1FA9A 2QJTA 2DZDA 5CXXA 1UKCA 2I33A 4PF1A 4XR4A 4BX0A 1LJUA 2CYCA 1CU1A 4LKOA 1NNSA 3DUFB 3I5YA 4AJHA 1SB8A 3PVSA 4IIYA 1XVAA 2JD2A 4AO8A 1BQEA 3DOEA 1TMKA 3SHFA 3H7IA 5FIUA 5L8VA 3UN1A 5F1YA 4DA0A 5J2TA 2C98A 4UVDA 4KWTA 1SOMA 1X8KA 3HUDA 4IJMA 2W0MA 1OI4A 2NACA 5TQJA 2ZJFA 3S1AB 4L9WA 4LQ4A 5KX5A 1OX4A 4P34A 1B41A 3DAFA 1QH8A 3RJ9A 4EFMA 1OWNA 3DAGA 2G9NA 1XRJA 1JBEA 1WB4A 1GZ7A 1ZL0A 2H31A 1U8TA 2P65A 3I04M 5JSYA 2AK3A 4DEVA 3F1KA 2R25B 4Z9XA 1A7AA 3DXXA 1HLDA 5KKNB 4B2LA 3EMDA 3VU3A 1MT0A 5HZHA 1CUBA 4XDZA 5JALA 3PTZA 2UXDB 4ARUA 1W88A 3OCUA 3TQSA 1AQYA 1KJ9A 3EGXB 3THWA 1EDZA 5KJCA 5J9FA 4HY3A 1AN9A 1I2DA 3L9XA 4K6GA 2GASA 5AUQA 3WYCA 2A0YA 5K0BA 4XUGB 1JEAA 3QPVA 4S0XA 3KTDA 4KPFC 5JE8A 4ESVA 1SZPA 1M1XB 3SXUB 5DXAA 1R6VA 2X8JA 2GPBA 2Y68A 3RTBA 2PMEA 4KLRA 4YRLA 3W5CA 2FRDC 4XGKA 5JXHA 5KTKA 2C9MA 3T38A 3N86A 3U31A 4B5KA 2HB6A 3HZHA 5B5SA 3QE9Y 1M2FA 3CZ4A 4ZT6A 1WPQA 5IT5A 1X77A 3L1KA 5JS7A 4NOKA 3K8OE 1UKVY 3NWOA 5FNVF 5TEVA 3SZMA 1AQLA 3DQZA 2ZYSA 4CFYA 5AHXA 5JFOA 1I5EA 2QYTA 1DUVG 4CMIA