3GEDA

Fingerprint and structural analysis of a apo scor enzyme from clostridium thermocellum
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
245
structure length
242
Chain Sequence
NRGVIVTGGGHGIGKQICLDFLEAGDKVCFIDIDEKRSADFAKERPNLFYFHGDVADPLTLKKFVEYAMEKLQRIDVLVNNACRGSKGILSSLLYEEFDYILSVGLKAPYELSRLCRDELIKNKGRIINIASTRAFQSEPDSEAYASAKGGIVALTHALAMSLGPDVLVNCIAPGWINVTEFTQEDCAAIPAGKVGTPKDISNMVLFLCQQDFITGETIIVDGGMSKRMIYHGDWNWFYKID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Short-chain dehydrogenase/reductase SDR
publication title Sequence fingerprint and structural analysis of the SCOR enzyme A3DFK9 from Clostridium thermocellum.
pubmed doi rcsb
source organism Clostridium thermocellum atcc 27405
total genus 84
structure length 242
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gedA00
4OYRA 3PQEA 3U4CA 2G17A 1A72A 3RASA 1IYZA 2OOSA 2PR2A 1AHIA 3AWDA 4HNGA 3C8MA 1NYTA 1M2WA 2JCYA 1MXHA 3L07A 2HJSA 2JAHA 1LQUA 1WWKA 4PFJA 5C7IO 3PHHA 3KB6A 3PJDA 4WCFA 2X8LA 1B26A 4QEDA 4F6CA 4RCVA 3GDFA 2BGLA 3L4BA 2GZ2A 3H5RA 1A4IA 5IN4A 4E4YA 3PIIA 3ANNA 4D42A 1VJ1A 2YY7A 4E2WA 3U62A 4JP3A 3SEFA 1KEWA 1SZJG 3Q9NA 3QV1A 1ONPA 5JYEA 3H5AA 1R15A 1R4NB 4OSPA 1LSUA 2AQHA 1IZ0A 2EV9A 4CM3A 1LBEA 3EW7A 1X1TA 3K9QO 4BHTA 2IODA 4WLUA 2J5KA 1QYDA 1F12A 1N5DA 4O63O 4G5HA 4RPGA 1T2DA 2HKIA 4XYEA 4B3JA 3GOHA 5KTKA 1J5PA 1DAOA 4ZQEA 4JP2A 2C29D 4YJGA 3N7UA 3GNTA 4E5PA 1IPEA 5TLSA 2X5JO 3MWEB 3AY6A 1ZZEA 4PLCA 2HO5A 3ZW8A 3PGJA 1RM3A 4RLSA 1WMAA 1D1TA 5F5NA 1ZIDA 4CV2A 4L73A 2VUUA 2JCXA 2FRDA 1KS9A 2FPIA 3RUCA 1XIVA 3BMNB 3QJ5A 2NU7A 2D0IA 2BFOA 4CQMB 4G81A 2XXBA 4BNXA 5I8WA 3IKTA 4D7AA 2P5UA 2BI7A 3ZWOA 1DLJA 3HDHA 5FFFA 1ENZA 3GGOA 3OJ0A 2FY8A 2UV8A 4YAEA 1O5IA 4IZIA 4WOKA 5JMPA 1LSJA 4BMSA 1MA0A 1VL6A 4J7XA 2JFHA 4YB8A 1UXIA 4BNMA 9LDBA 5A4DA 5DBGA 1ZUD1 3ZWAA 1BTOA 2YYYA 2YHIB 4D3FA 4YJHB 5TT0A 3AU9A 3HSKA 1LDNA 3WOHA 2LDXA 1V3TA 2W8ZA 2NVUB 5KVVA 3R1IA 1QP8A 1ZK4A 3OA0A 1E7YA 4I5FA 4XYMA 1ISMA 4B3HA 1E0DA 3CZMA 1OZAA 2DTEA 3RUEA 1LSOA 4JBHA 5JAZA 4JK3A 3ON5A 4CM8B 3BTSA 2GR9A 3ANMA 1GEEA 1EQUA 1HYHA 3ONEA 2BI8A 3PLNA 4ND4A 2B5WA 3JYPA 4BNJA 4LSMA 3UN1A 4DC1A 4BO9A 2D1YA 1ONOA 3I9KA 3AOGA 1T24A 5GZ3A 3F5SA 3EK2A 3EHEA 3PK0A 3DFUA 1MG0A 3GRPA 4DVJA 3LDHA 3AM4A 1M6WA 1EVYA 1DIHA 4TRRA 3WFJA 1LNQA 1TA4A 5TIIA 4ONEA 3UCEA 1Y9EA 3UVEA 4EJMA 5G0WA 1XELA 5BQFA 5FWNA 4BVAA 3S8MA 1C1DA 3C1OA 1C1XA 1Z7EA 2RH4A 2X0RA 4L76A 3NGXA 4J1SA 3FWNA 4R68A 4FC7A 3WYEA 1EBUA 1JLLA 3ETGA 2DFVA 4WASA 3KTDA 4J1QA 3VAZA 4DXHA 5HBRA 3ZU4A 4A73A 2Y05A 4P22A 4BNHA 5IAAA 4S1VA 4CUZA 2WDZA 2W4QA 1HZJA 2Y0CA 4R5MA 4RF2A 2QRLA 4ZQFA 5HM8A 3KM0A 3FNGA 3JV7A 5JS6A 1YJQA 1HLPA 3NJ8A 2IRWA 4NJMA 4R69A 2PTGA 1LSSA 4UVGA 1GYRA 3NKLA 4PZEA 3GVXA 3OMLA 4UVHA 1E7QA 2O3RA 1ZJYA 4CR8A 3GVCA 3H8VA 4W4TA 3M2TA 2Q46A 2BFPA 4YJGB 1XU9A 4XRGA 4CLRA 4AJKA 1DLIA 4PG4A 4NNJA 3FCOA 4YVFA 2G1UA 2NU6A 5TT1A 1U9JA 3O38A 2HJRA 4A7PA 1HYEA 4B4UA 1LUAA 1E6EA 1MC5A 4MKZA 4BGIA 2Q1WA 2I9PA 2O3QA 2O23A 2AEMA 1A7AA 1P1RA 3HZZA 2H1SA 3LC7O 4EITA 1H9BA 5MGBA 2I66A 5EN4A 1VL0A 1YWGO 1YQGA 3AJRA 3QVOA 1ARZA 4ID9A 3FF4A 4PVCA 3UFXA 3RC2A 4FOSA 2V7PA 3SLGA 2Q99A 1PJQA 3GNQA 3Q0EA 4NBTA 3UAGA 8LDHA 5JO0A 1PJ3A 5JAQA 4E6PA 1Y5MA 2O7SA 5F21A 4IQGA 1NVTA 5A03A 1YB4A 2BD0A 1BWSA 4RVSA 5EERA 3IOYA 3KYBA 3V8BA 5CFZA 4LISA 1ISGA 3U3XA 1V8BA 2JD0A 3RJ5A 1CERA 1PU2A 1ADBA 4ND3A 3I5MA 4OIMA 3QQPA 1Y7TA 4PLWA 4YACA 2GERA 4CV0A 2FWMX 5KKCA 4OSOA 1GR0A 4KP7A 2YHUA 2DT5A 1A71A 1DBVO 5DDIP 3RU9A 3V2HA 4D41A 4R9SA 3ZCXA 2EP5A 2PGLA 4IDFA 5EESA 2CUKA 2LDBA 3VH1A 1U3WA 3TOZA 3K92A 2WYVA 4CODB 4HV4A 4KWHA 3SXPA 4YXFA 4WKGA 4XIJA 3M2PA 1ISJA 1GUZA 4TMFA 4YAGA 5CDSA 3P2OA 4BUCA 4PZDA 2HK9A 2X5OA 4QECA 5DT9A 1E7RA 3EVNA 3B6ZA 4CLEA 4KUHA 4M54A 5HA5A 4AJ4A 1J0XO 2O3JA 3VKVA 5L95A 1C1DB 3QWFA 3WGGA 2Q50A 3DDNA 5G0VA 1PJBA 4WCFC 3U0BA 1OMOA 4AFNA 5KVSA 4OAQA 2EERA 2GPTA 3B1KA 4MVJI 1QR6A 1WVGA 3RJ9A 4LRTB 5BNFA 3LLSA 3RKRA 3RU7A 2HQ1A 2W98A 1C3VA 2OP1A 3KUXA 4IINA 1I5RA 1PS8A 4CUKA 3PYLA 3OETA 5I9NA 3BA1A 4FFNA 4MP6A 2YW9A 3C7AA 4J9VA 4IQ8A 3WSVA 2GZ3A 2CZCA 3VPGA 1H94A 1QKIA 3IQDB 4FQ8A 3WQQA 3HDYA 4J0FA 2CD9A 2DPGA 4F3YA 3DZHA 1PJLA 3GLQA 3PVZA 4O5OA 4MO2A 4MVJM 5DCWA 1X14A 4AJ1A 3H9UA 2DFDA 2O2SA 4DRYA 4IXWA 1PTJA 1WP4A 3R3JA 2Z1NA 4Z9YA 2ZYGA 3A14A 2FR0A 3JQ7B 1PL6A 1I33A 2Z5LA 2JD1A 3PJFA 2PLAA 1X0XA 5IZCA 3S2EA 3Q3CA 3LU1A 3TZ6A 3DHYA 4B3IA 3DAFA 3OQ1A 4Z0TA 1XR3A 1N8KA 5IJZA 1DFGA 1FK8A 2AXQA 2NTNA 4IZHA 3WGTA 2BELA 4NZ9A 1HDGO 1JKJA 2PKQO 5CP8A 1XDWA 3AM3A 1NTOA 2AG5A 1BG6A 5JMWA 3I9NA 4HX5A 1R12A 1LRLA 1MGOA 3GPDG 4UREA 3NRCA 3PZBA 3I52A 2EEZA 2VHYA 2X58A 4R54A 1FDSA 1NFRA 2A4KA 3BAZA 2Y66A 1OAAA 3GUYA 2NM0A 1VL8A 2Y1CA 2WWRA 1DC6A 4J4BA 1HYGA 1YBAA 1BDBA 4JIGA 4CMEA 2JL1A 4CM4B 1ZXLA 1X0VA 2A92A 1Q0HA 2PGJA 4J90A 4TRNA 3RD5A 4AJJA 1P33A 2X7HA 3H2ZA 3SBOA 1ZVMA 2FHSA 4ALIA 1JN0A 3DBLA 3L9WA 5I9MA 1K3TA 3TRIA 3W8DA 2B35A 2AA3A 1DO8A 2CF5A 3CEAA 4UVDA 5JCJD 2GN4A 3GT0A 2EWMA 3KOUA 4PLHA 4PLVA 1WPQA 1UXJA 2RHRA 3D7LA 3KYCA 1QORA 3H9QA 4DPMA 4RVDA 3SLKA 4CMIB 1DC5A 1O89A 2HRBA 3JQGB 2BHLA 1HSOA 1B2LA 1LLCA 5KCZA 2I99A 4R4JA 4B7UA 2P5YA 4YT5A 4PLTA 3GZNB 4IGEA 1K89A 4CM9D 4GVXA 1F8GA 3ORFA 3IKVA 3WYCA 3ASVA 3OJEA 5ER6A 2G82A 5GMOA 4L8VA 1VPDA 1AUPA 1XA0A 2NTJA 5C37A 2IYPA 4A0SA 3PWZA 5EJ2A 3W6ZA 2O48X 3MTGA 1QYCA 3VDQA 5HWSA 3HB5X 1B8VA 4J6FA 2O3UA 2OMEA 1K2WA 1O8CA 5TSDA 3CPSA 3K30A 2IYOA 4LMPA 3ZN2A 1CDOA 3GF4A 3MOGA 3O03A 1CF2O 1PGQA 1ZO8A 3INRA 1HF3A 1UAGA 3VPXA 3ABIA 3DZGA 2ZB8A 2GRAA 3ZWBA 1QLHA 1K6JA 4FFOA 3E8XA 5A02A 1LU9A 5JE8A 4Q3EA 2DU8A 3WJAA 2ZB4A 4BNWA 1I2CA 1GL3A 1JDJA 4KWIA 3JQBA 4J4HA 3ASUA 2B5VA 4D44A 4I5DA 3DXFA 4UUOA 3GMSA 3PHIA 1GADO 3ENNA 3ONFA 1XKQA 4MKXA 5CG1A 3INTA 1MV8A 2RCYA 4EDFA 2XXJA 1Y6JA 1FMCA 1NR1A 2G76A 4BL5A 1QLJA 4GAEA 5KVCA 2C2YA 2C54A 2EW2A 5U9CA 3W4IA 1VKOA 1KOLA 4WEOA 1BXKA 3ZI0A 1EDZA 4IS2A 1JQBA 2VRCA 5TJ9A 2UUOA 3SC6A 4BNZA 4YRAA 2H6EA 3VC7A 4IS3A 4UEKA 2AQ8A 5B4TA 3VPHA 5A06A 4B7XA 4I9HA 3OEWA 5DZSA 3RVDA 1BXGA 1X7DA 2QW8A 5I7SA 4RVUA 1UR5A 3QVWA 3MJCA 3ZGYA 1PS0A 3V5NA 1PX0A 2DTXA 3C1AA 4AICA 4YT2A 1HRDA 2X86A 1DIAA 2TMDA 2C59A 2J3JA 1I8TA 4YA6A 2IE0A 3LZ6A 2GF2A 1K5HA 4Z9FA 1DIGA 3AUTA 4GWKA 1DC3A 1EVZA 1GPDG 3DBLB 2CMDA 2Y1EA 3EY4A 3GK3A 3GY0A 3MJSA 5FI3A 1NHGA 3E1KA 4Q3BA 3DBHA 3ETDA 5THQA 4A03A 1PR3A 3MTJA 1LEHA 1FF9A 4ZICA 1Z75A 3MJ4A 3I3OA 4P38A 3WLFA 1KC1A 4GBJA 4R1NA 4E33A 4GGOA 4IQ0A 2GLXA 2PD3A 2HMVA 2FZWA 1SEPA 5F1KA 2C5AA 4RF5A 4IPTA 5A9SA 3WB9A 4TROA 2VYND 4RPJA 1YRLA 3JD1A 3WWYA 2J3HA 1V3VA 4GX1A 2W2LD 1YXMA 1XU7A 2YV2A 4GKBA 4EEZA 1U7HA 4A27A 1BW9A 3FHLA 4NBVA 1SBYA 2WEKA 5U4QA 3WGIA 1E92A 4J43A 1HDXA 1BMDA 1F8FA 4ZA2A 3GPIA 1N1GA 3B1FA 3I23A 2DM6A 5AYVA 3GQVA 3TFQA 2P4HX 1O9BA 1IPFA 1S6YA 1TLTA 7ADHA 5IXYA 3HHPA 5TX7A 1HE2A 4FBGA 5JDCC 4WUVA 1YOVB 2HDHA 2JFGA 5U1PA 5B1YA 4WECA 1PZGA 1NPTO 4RF4A 4Y67A 2PGDA 5IXSA 4KUGA 5TNXA 4C7KA 5K0ZA 4AJPA 1PJSA 4XB2A 4F6LA 1UZMA 1UDAA 2NNLD 4LVUA 4PLYA 2DTDA 4FIZA 4BO4A 3DBVO 4FFPA 4I9NA 1Q0LA 2ET6A 1DIRA 5IZ4A 1LDMA 1QSGA 2R00C 5HRUA 2VUTA 1DXYA 5JFOA 1J49A 1DC4A 1ZK1A 5GY7A 3Q6IA 1I3MA 1E3WA 1TT5A 2POQX 3TNLA 5JC8A 1E77A 1NQ5A 3P5SA 4W6ZA 3DOCA 1UXHA 1GYPA 1IOLA 1YB5A 1EQ2A 5ICMA 2JD2A 1RKXA 1BHSA 5H83A 8ADHA 3LF2A 1RM4A 3KZVA 4IXTA 1DDOA 1N2SA 1XSEA 2X0IA 3E6AA 3P7MA 4PLPA 3WQSB 2OUIA 2GD1O 5JDIA 4XYLA 3L6OO 3GUCA 1VSUA 3B1JA 4BNYA 3WGHA 5I9LA 1GD1O 1SPXA 4Q39A 2E82A 5GZ1A 1PGNA 1LTHR 4EEXA 2CVOA 3ZW9A 1U3UA 2IZ0A 4PRLA 4CMJA 5DCUA 1BXGB 1NHWA 2OZPA 2BF7A 3VPFA 1ZEJA 2NVBA 1DHTA 1LA2A 3QWBA 2JFFA 2P9GA 4Z3KA 1Z74A 3RC1A 3A06A 4L74A 5IDXA 5A5EA 3BMQB 3G17A 2PH5A 3JYQA 4TZTA 3GDOA 1XCBA 3IUPA 1W8DA 3DZBA 5DBIA 4CM7A 3ZU3A 3PHJA 3WICA 3Q2KA 1C0KA 2EHDA 3D5QA 1DAPA 1SCUA 1LDYA 4HKTA 1PJ2A 2WE7A 2YHIA 2Y68A 1PJ4A 4GX2A 4Z6KA 3I6QA 4JQCA 3ZWYA 3UKOA 1EE9A 2Y67A 3D4NA 3HUDA 5GZ6A 5KJEA 1PQWA 4WNCA 3JQFA 3PP8A 3JD3A 5A9SB 3T4XA 1ADFA 2OO5A 4KMSA 1S7CA 3AOEA 2AQKA 4CM8A 3GRKA 2ZYDA 2QRKA 5DF1A 3GG2A 1ZCJA 4JNKA 3GFBA 5EQFA 2H5LA 3S55A 3HN2A 3ZWPA 3F46A 1O95A 4WLVA 1EE2A 3PEFA 4H16A 1Z82A 4CMHA 1H6AA 5COBA 4PLGA 5IG2A 1X13A 2O50A 3GAZA 4YWJA 3U09A 2UUPA 2I67A 5T8KC 1A9YA 2PNFA 1N7HA 5L7WA 3ONDA 2ZK7A 4ZQHA 4PG8A 4TRMA 4DIOA 1E6UA 4LGVA 4ZGWA 3WG9A 3PWSA 4CMKA 3BMOB 4RO0A 1QYWA 1AHHA 2VYNA 1HLDA 1MC4A 4MJLA 3WSWA 2W2LA 5DCYA 5TF4A 4BNIA 5JY6A 3OIDA 1NPDA 2WTBA 3KYDA 1H6CA 2IXBA 4EZBA 1TT5B 1E3WB 1A7KA 3PFWO 4AJLA 2I3AA 1WXDA 2WSBA 3GGGA 2DBVO 3RAJA 4HP8A 2VZ9A 4II2A 4DGSA 4AJEA 2P2SA 4A10A 5BNIA 2B4TO 1ENOA 4FFRA 1GEGA 3IJPA 3ULKA 5B4VA 1ISIA 4GWGA 3K96A 1ADGA 1PIWA 4JGBA 3ZNNA 3NX4A 4I9UA 3O26A 1ZMOA 5H81A 1NBOA 3OSUA 4FC6A 1ML3A 1YVEI 2ZCVA 1V9LA 4NDNE 5CPBA 4BNNA 4B79A 3I83A 3W4KA 1F06A 1GU7A 2BGMA 5C3MA 1IHXA 3OIGA 5TQVA 2ZTLA 3OP4A 3RFTA 2ZB3A 3JQ9C 1CJCA 5A9TA 5CDGA 3VOSA 1R0SA 2X23A 4MOWA 3CUKA 2X9NA 1BRMA 3R3SA 3ZZNA 2VT3A 5JYDA 1PGPA 1ZSNA 3KETA 2HSDA 1VRWA 3GHYA 1DRUA 3H4VA 4TKLA 2E6UX 4GVLA 4NHEA 1NFQA 4K6CA 4HNHA 1VKNA 2VZ8A 4JXKA 3B70A 1MUUA 4NBRA 5IFLA 1E3EA 2A94A 2FSSA 4ZRMA 2PK3A 4J2HA 4NFYA 3H3FA 1W73A 3PGXA 4LRSB 4FW8A 3ZU5A 1PR9A 5LCXA 2VYVD 1I30A 1FXSA 1JTVA 3E5MA 3UH1A 3AI2A 3TF5A 4EYEA 4WPGA 3LT1A 1BVUA 2DQ4A 3AUUA 4DYDA 1D3AA 2HCTA 5DNAA 1CQIA 4D3DA 3WXBA 1U7TA 3DAGA 1A27A 2Z1MA 4AJHA 1VJ0A 5T6BA 4BO3A 4ILKA 2IZ1A 2IDZA 4K6FA 5FF9A 4CMGA 4N5LA 2O4CA 4O0LA 4WLEA 3S2FA 3H5NA 2HU2A 1U4SA 3LQFA 2HK7A 2I6TA 4OQZA 3QHAA 3UICA 3CE6A 3F3SA 1AXGA 4DLLA 1YB1A 3Q11A 4FDAA 2GYYA 4D0RA 4TKMA 2EKQA 4IJWA 4E32A 4BNFA 1W6UA 2GUGA 3DHEA 1PWXA 1XLTA 4XYGA 1ZH8A 4LN1A 1NASA 1FDUA 3OIFA 5A05A 4CMBA 2OHXA 3FPCA 4OGWA 3ZH2A 1HZZA 1WDMA 3RWBA 4J9UE 2J6IA 4NR0A 3PJGA 3IAHA 3VDRA 3BHIA 3KYDB 1DFIA 4JCOA 5BR7A 2RIRA 3FRJA 5KNLA 2V65A 1EUCA 3U49A 5J23A 1UZLA 1LDEA 3FNHA 2DPHA 4HFNA 1Z7BA 1R0LA 4W82A 1LC0A 3PHGA 2CFCA 3PWKA 1LLDA 4HUJA 1SMKA 2HRZA 4OQYA 4QSMA 2VWGA 4RVGA 1L1FA 2OXIA 2D2IA 4QXMA 5DOVA 3K2EA 1YDWA 1YO6A 1QV7A 1ZK3A 4DQVA 1QV6A 4BO6A 1SO8A 3NYWA 4P4LA 3I9JA 3O8QA 4FS3A 2VHVA 3GGPA 1KBZA 3JQ7A 4CLHA 4DIFA 4YYZA 1BSVA 1PQUA 3LSYA 4W7HA 4UAGA 3JCZA 4A26A 2YZ7A 5ILGA 1KY4A 1SNYA 1WW8A 1U2GA 1D4FA 1HWYA 4Q3NA 1I32A 1LLQA 1NAIA 2PD4A 1YDEA 3COSA 4BKRA 2C82A 3M1AA 3WMXA 3GMDA 5K9ZA 5KJFA 3E9QA 3JYNA 3E82A 3F4BA 4JLWA 2AEJA 1XEAA 4BGEA 5JC1A 1E1NA 4MP8A 3DHNA 3VKUA 2X9GA 4PG5A 2J8ZA 4E13A 3L0DA 1YL6A 3GVIA 1OC4A 2X9VA 3L77A 1GQQA 3RFXA 2D4AA 2I65A 3VHRA 4E30A 1ENYA 5L9AA 1P0CA 3GNSA 3UF0A 4YJFB 4W9NC 3ROPA 3G79A 3ZU2A 5ENVA 4CM4A 4NJOA 1I10A 1SB9A 3NT2A 1SC6A 4MKRA 4BMVA 5HS6A 2C7VA 4IGFA 3RUFA 4GSKA 4BIIA 5FEUA 3JQEA 2VCYA 2O4UX 3GEGA 2OL4A 4M55A 4HBGA 3NGLA 3W8EA 5I7EA 1GY8A 4R1UA 3DONA 3QVSA 5BT9A 3OBBA 1I3NA 2NQ8A 4ESOA 2Y93A 2OFPA 3P2YA 4CMIA 3JQGA 4RLHA 1YQDA 3WQRA 3OA2A 4ZD6A 2D5CA 2CNBA 2Y0EA 4YBZA 5L53A 4M89A 3GZNA 4JJIA 3DEYX 1EK6A 2X4GA 1EUDA 4URFA 5LDGA 5B37A 3L4BC 1BGVA 4MVJH 4FGWA 4NK5A 4XQGA 5EQDA 3RUHA 4R9RA 3VH2A 4D45A 1NQAO 4FFMA 3RQSA 4NI5A 4B8ZA 3DAPA 4ND2A 2J5QA 4XQCA 4BV9A 3BIOA 4D43A 3FI9A 5I7VA 3VPSA 4UEOA 3EUWA 2EW8A 5F5LA 4GMFA 4XR9A 1LDGA 1GPJA 4NU5A 1HDZA 1ZJZA 5I7FA 4YQYA 1P74A 4DIBA 1H93A 3F9IA 2G5CA 4J1TA 4Q3CA 3LC2O 5T64A 4E2ZA 4MVJP 5K6AA 4MPDA 1SAYA 3G1UA 4WEQA 4D46A 3GN1A 3EC7A 3IP1A 3HN7A 4Z0PA 4OL9A 4NK4A 4GQAA 3INGA 4IMRA 3QW2A 1PZEA 1PEDA 4YAIA 4LSWA 4Z9XA 2YDXA 1X15A 1R0KA 3PI7A 4OXKA 1ZSYA 3RUIA 4GH5A 3U4HA 3O8QB 2C7GA 1HDOA 1DB3A 1CETA 1KVSA 5DN9A 5EIOA 3DZIA 5C7LO 4DMLA 1SEVA 4FR5A 4CMCA 4JJFA 2QHXA 1VC2A 1LI4A 3VVBA 3CKYA 2CF6A 2VNSA 4BKOA 3GA0A 4U0KA 4IJUA 2NQTA 3N74A 5A1TA 3FD8A 3GDGA 4CUJA 3JQAD 1KERA 3OJOA 3ITDA 4EBFA 5BSEA 3KEQA 4MP3A 1NWHA 2GZ1A 3TQHA 3V1UA 3PHLA 4QUKA 1O0SA 1T1RA 3HDQA 3MZ0A 2CDBA 2GGSA 2GSDA 3WGYA 2WM3A 4DYVA 4N5NA 1E1LA 4QTZA 4MIEA 3F1LA 1B3BA 1GUFA 3ADOA 3DWFA 3OJFA 1MFZA 3DR3A 3JQDA 3D4PA 1KYQA 2B69A 3AFMA 1U3VA 4RZIA 5AQ1A 2X0JA 1P0FA 4KZPA 1Y9AA 5IDQA 1LDBA 1I0ZA 4I1IA 2NU9A 1E3JA 4QT0A 4EJ6A 4ND1A 4D79A 4D0SA 1PGJA 2FSVA 1SOVA 3ZDFA 5CDTA 3KEOA 1I2BA 4YTEA 1EFKA 1WLYA 3FNFA 5T67A 2QZZA 4HFJA 3ZHBA 1X1EA 1JAYA 3QLJA 3E9NA 3P19A 2F00A 1JVBA 3KSZO 4EUFA 2Y0DA 3ZWNA 3F6YA 4MVJD 2D8AA 3T7EA 2EGGA 3QSGA 4HWKA 5ES3A 2HMUA 4EW6A 5KWEA 3N58A 4YEDA 1N7GA 2OP0A 4FB5A 1QYXA 4QFCA 1QXSA 1Q0QA 1KIFA 1HEUA 1FDVA 3NEPX 1GTMA 4XIYA 1XGKA 2B4QA 4TZKA 1IL0A 3NTQA 3HDJA 2C07A 3C24A 3ZNQA 4YRDA 3AI3A 4RPHA 3E18A 1GFSA 4ROSA 3DQPA 1B14A 3DC2A 4NIMA 1OI7A 3DMTA 1NP3A 1HDRA 4OM8A 2Q3EA 2PFGA 1L7DA 1P77A 1YOVA 2Q49A 3H9EO 4XRRA 3OF2A 2X1HA 5DP2A 4HFRA 4GKVA 4EI2A 3FTNA 3ZV5A 4W99A 4XJTA 2PH3A 3ADPA 3KLPX 3K8ZA 2ZJ0A 1KVUA 2C2XA 2E37A 4DQXA 3AUSA 2J3IA 3K5PA 4A5OA 3OQ6A 1H6BA 3CTMA 4NH4A 2YV1A 1ZBQA 4NBWA 2IEBA 1DRWA 1KETA 4LCJA 1NVGA 2GCGA 1U5AA 3UXYA 3UOGA 2FPPA 2VHWA 2B36A 5T5QA 2NACA 3W4JA 1OC2A 4YPOA 4B4OA 5L4LA 1RJWA 2NSDA 4UEJA 3BZUA 2AG8A 1LXCA 1Q2XA 2FR1A 3PQDA 3VZSA 1ULSA 1T26A 3F4LA 5IDYA 4H3VA 5JBIA 4MVJF 4MDHA 4J1NA 4DBZA 4CQMD 3F5QA 4RV9A 3PPIA 2ZTUA 1NQTA 4XDZA 4DUPA 3HADA 3I1JA 3D4OA 3QVXA 5L51A 3H9GA 3PTZA 4IM7A 5HTOA 1UP7A 2BFAA 3C3XA 1IHYA 3WR5A 4DPKA 3BMQA 9LDTA 1Y8QB 4NBUA 1T2CA 3PZRA 3UCXA 2GN9A 4GLOA 1Q7GA 4IDCA 3JQCA 2HUNA 1DJNA 1R66A 3O9ZA 4IDGA 4RZHA 3GVPA 4R3WA 2Q2WA 3O4RA 2UVDA 1YL7A 2Y1DA 1M75A 1E7MA 2DLDA 2A35A 2UYYA 2VT2A 2ZTVA 3CMCO 1NXQA 4M87A 4GLLA 4L9RA 1CYDA 5JO9A 3VVCA 1KVTA 3EGOA 1Z73A 3KVOA 4IIUA 2CDCA 4ZQBA 4ALLA 1T2FA 1T4BA 4J4TA 1OOEA 4E5NA 3G49A 2PWZA 2EJVA 2EKLA 3X2FA 4CLXA 4XKJA 1E1MA 3UUWA 1PGOA 4CLDA 4PN3A 1UXGA 2DUUA 4IDEA 1GYQA 3S1LA 4EJ0A 2ZTMA 4TRJA 1PZHA 2JHGA 4EUEA 1PL8A 3TL2A 3NT4A 5EPOA 2VTEA 1T2AA 5LC1A 3AK4A 3DB2A 4J7CA 5A5FA 4FJ2A 5JCJA 4K9DA 3V2GA 4E5KA 3BHJA 4LMRA 1GV0A 1K6IA 1KEPA 2I5PO 4IJKA 5AXCA 4YAKA 4FJ1A 4XD2A 4OJNA 1C0IA 1B16A 3SC4A 4BOYA 3BMOA 5CEFA 4WK6A 4R51A 5EL0A 4CM9A 1JU9A 1F17A 3LT4A 1V6AA 4XGKA 4S3MA 1N9GB 3D3EA 3OHSX 3ZWVA 5LDHA 1UH5A 3WGQA 1E1KA 4B4WA 2IXAA 4JJGA 3IIEA 4GX0A 4CQLB 1IUKA 4EUHA 1M6HA 1MFPA 4KDEA 2W2KB 1TB4A 3H9JA 4BO1A 4TVBA 3RSHA 4F46A 5IZCC 1CIVA 1O6ZA 4PLFA 4RDIA 3KBOA 1TVEA 3C85A 5BSGA 4WLOA 3OICA 3GC6A 3A4VA 3HWRA 5A3JA 1BVRA 3JD0A 4AJIA 1Z6ZA 3AFNA 4BKPA 3PQFA 3I4CA 1MLDA 2NWQA 4KTVE 5F1PA 1H9AA 4J49A 2GDZA 5DOZA 1EEHA 2VOJA 5KJ6A 3QVTA 1ZEMA 3NDJA 2OORA 4U7WA 3WTBA 1HE4A 3BTVA 4M8SA 5BNTA 5A9RA 5TS3A 2DC1A 4DQUA 1MP0A 1ISHA 1LQTA 3LT2A 1GAEO 4X54A 1RM0A 1XHLA 5G0SA 3ICPA 2E48A 4CMEC 2EJWA 4CR6A 1LC3A 4P4GA 2PKQP 2R6JA 3LYLA 1WZEA 4CR7A 3DMYA 3NUGA 1PJCA 4B8WA 4CM5A 4JBIA 3FNEA 2O7QA 2VZ0A 3FWZA 3G1TA 4K1LA 4BB6A 1NR7A 1HETA 2V6GA 2BMAA 2J5RA 2B83A 1YONA 5DP1A 4XQ9A 5B12A 3ST7A 3TDKA 1E5QA 3BMCA 4E5YA 4OXNA 3TJRA 1JWAB 4OKNA 1YJ8A 4BO2A 3TFOA 4YT8A 3CZRA 4E3ZA 1ZK0A 1JA9A 2QX7A 2WYWA 4KDFA 4YCAA 2Y1GA 3WBFA 2F1KA 4Y6RA 4L75A 4AL4A 2AE1A 2A9FA 3PRJA 4R1SA 3LT0A 1N92A 3RUDA 5JPIA 3M6IA 4D3SA 1R4MA 1JKIA 1SB8A 2HAEA 1VI2A 2ZQYA 4CLOA 1B3RA 1P45A 3W8FA 4L4RA 4GPD1 1MG5A 1WMBA 2C5EA 4QO8A 5CG2A 6LDHA 4HY3A 3ZV4A 4L4XA 1M67A 3RUAA 1VLLA 4MIYA 3HNPA 1TT7A 1YL5A 4HADA 4XB1A 1AGNA 3UCFA 1IB6A 2DUWA 4XGNA 4P4NA 2ZIZA 3DTYA 1JKFA 4BNLA 1W0CA 4JX8A 5G4LA 3WIEA 3I9OA 4U8GA 4ALMA 1G0NA 2PZLA 4GL4A 1ULUA 3NAQA 5L40A 4BNTA 5IDWA 4R5HA 3GH3A 3JQBC 5L45A 5JSFA 3T7CA 1H5QA 1EDOA 5H82A 3GFGA 3T4EA 3TL3A 3I9LA 1PL7A 5DULA 2X0NA 3B20A 4HFMA 1C0PA 1UXKA 1Y8RA 5JY1A 3AY7A 4BV8A 3K73O 3C7DB 1G6KA 3WGZA 5TRTA 4IUYA 4BNUA 3RCBA 1NAHA 5TC4A 2JCVA 3UGKA 3V1TC 4ZRNA 2YDYA 3EDMA 4N54A 4DA9A 3TZKA 1PZFA 1XYGA 2P68A 2FMUA 3NDIA 5AXDA 3WNVA 3VH4A 4EGFA 2V6MA 2RHCA 3ANLA 3H7AA 3R6DA 4R16A 3SVTA 2QIOA 2P4QA 3HQ4O 1DOHA 2VUSA 3D5TA 3FPLA 4CV1A 3GZ4A 5ITVA 5ENDA 3JD4A 5ER9A 4FN4A 3V2UA 4R01A 4PIVA 1V3UA 3STHA 4DBVO 1B15A 4AVYA 2HMSA 1P1HA 2EXXA 1NPYA 2EG9A 4Q9NA 4AG3A 3ZWXA 2TMGA 2X22A 2YFHA 1HE3A 2IEDA 1HE5A 1I01A 2Z95A 3IP3A 1EZ4A 3MEQA 4IJVA 4LVCA 4ZU3A 2Y99A 1NX6A 1QYVA 1P9LA 3WNQA 1VM6A 3D3WB 5C7OO 1Z45A 3JQ8B 3KLMX 1TI7A 3WS7A 3VTZA 4YJFA 1DHRA 3BMCB 4RDHA 3K6JA 2QYSA 4OKIA 4TVOA 1Y1PA 3PYXA 4E21A 5JCXA 2EP7A 4O1MA 1WZIA 3D64A 3VZQA 4XYBA 2J3KA 1HDCA 3WMWA 1YQXA 4Z0HO 2XPCA 4CM6A 3H6KA 3A9WA 1D1SA 1R4MB 3HB4X 5L4SA 3IUSA 2QG4A 1ADCA 4YDRA 3CSDA 1UDCA 4CLOB 3PJEA 3A1NA 3DOOA 4L4SA 4O6VA 2AMFA 4M49A 5KIAA 3TOXA 4J7UA 5JAMA 3G0OA 1E3IA 1ZFNA 1ZNQO 4RL6A 1QMGA 1KC3A 4E12A 4U6QA 4NFSA 5CEEA 1I24A 1K0UA 2XF8A 3IS3A 1EUZA 5DBFA 4Y6SA 3L6EA 1H2HA 1A4UA 1U8FO 1MXFA 1EBFA 1ENPA 1FDTA 2NU8A 5AVOA 1K6XA 4WCFB 3F47A 4GX5A 4UUNA 3TZQA 4BO7A 3DFZA 1UP6A 2ZCUA 4BQPA 4GGPA 2Q1TA 1RPNA 4XJSA 3TSCA 2VN8A 3PYMA 1GCOA 5COAA 1W4ZA 1ID1A 2NADA 1Y8RB 3R0IA 4GMGA 1QG6A 4WE3A 3IC5A 3RBXA 3HFSA 3RIHA 1YBMA 3H3JA 3DZJA 2CY0A 2GNAA 3FR7A 4II3A 3IMFA 4WCDA 4C4OA 3KSDO 4AJOA 3ZNPA 4MVJE 5T57A 4H15A 4QFDA 2EIHA 5JDIC 4DL9A 3GVHA 2Q45A 2WYUA 3AM5A 1JWBB 1PJTA 2DBQA 2YFQA 3I6IA 4W7IA 4XQEA 5TGDA 1L7EA 2JJYA 2VTDA 2BLLA 2JKVA 3Q1LA 2DBRA 5JNLA 2JAPA 3NV9A 4R41A 5B4UA 1U2DA 2QQ5A 4N18A 1LRJA 4XX0A 3PDUA 4H7PA 4JBGA 2PA3A 3IDSA 2CSUA 3GAFA 1XQ6A 2V6FA 3IJRA 3W6UA 1V0JA 1U4OA 3UHAA 4FJ0A 3ROQA 4QQRA 2VNAA 4IDDA 2D59A 3AY3A 4U0JA 3BHMA 1OFGA 1U5CA 2CDAA 2PKRA 2Q1SA 4XWYA 3TZCA 1GQYA 1YBVA 3EZYA 2QZ9A 4DPLA 4PRKA 1IULA 1M76A 3U9LA 1TEHA 2DAPA 3OQBA 1ZMTA 4ALJA 4E2YA 4FSHA 1WDKA 1B8PA 1VE9A 2ZKLA 2IZZA 3JQFC 5FYDA 1ZSVA 1J4AA 1T1SA 3E5RA 2ZATA 5G4KA 3AOEC 4CPDA 4XEHA 4ZJUA 3I9MA 2FR8A 2VYVA 1KVRA 4PGFA 3DO5A 4J0EA 1E3LA 1YKFA 4UULA 3KHUA 4Q3DA 3KXDA 3CINA 1HT0A 2XAAA 3OH8A 1EVJA 2UAGA 4N5MA 1DEHA 1KY5A 1GUYA 2YV3A 5C5IA 1HKUA 5EINA 5L7TA 2BFMA 4RPLA 3FBGA 3ZWMA 4KQXA 4CMAA 2HMTA 4JROA 3PDJA 4J2OA 3WGOA 3DBRA 3ZV6A 1H2BA 2O3SA 3WBBA 2HLPA 1T25A 3UW3A 3DOJA 1DFHA 4WLFA 4M1QA 3AW9A 3TWOA 1ZK2A 2VWHA 4BKUA 2OBNA 1ISFA 1NQOA 1C1XB 2H63A 2PZKA 2GASA 4BO8A 2GN8A 1X7HA 4Y8VA 4LK3A 5JDCA 4CV3A 4RJTA 3U4IA 5AXAA 7MDHA 4B7CA 4I08A 3TPCA 4CJXA 3SJUA 4N7RA 4YRBA 4KQWA 1PSDA 4UVEA 1WAMA 3C1TA 1R16A 4CM1A 1A9ZA 4NJMB 3X2EA 1ZXBA 4IBOA 4BGUA 1WDLA 3QIVA 4ALKA 2R00A 3RBZA 3E03A 2Y1OA 4DTIA 4CLRB 2VRCD 1NM5A 3MWDB 1AXEA 5KJ1A 4ZHSA 4AJ2A 4XDYA 1GDHA 3AUAA 4BB5A 2AE2A 2ILTA 4Y98A 2FPGA 3MOIA 2D5AA 2C0CA 4FOOA 5CDUA 1GZ3A 3WJ7A 4ITUA 4MINA 5ADHA 2ZYAA 1P1IA 1CWUA 1LRKA 4UUPA 3BXXA 2QRJA 1JVSA 2Q2QA 3PLRA 4BO0A 1Q7BA 3BTUA 3RKUA 4C7JA 3RI3A 3V1YA 4E31A 4GSLA 2VRBA 2B0JA 2WD7A 3DTTA 4XGIA 4DLBA 1UAYA 2W90A 4XCVA 3QRWA 1V35A 4BMNA 4HXYA 1UDBA 3W1VA 1EMDA 2B37A 1HL3A 4Y6PA 4DLAA 1Y8QA 1ZKMA 1YS4A 2DVMA 4DREA 1M66A 1P1KA 2Q4EA 4E0BA 5G4KB 3LK7A 1X7GA 3GHHA 4AJNA 4UUMA 4QO7A 3H2SA 4MVJG 2GO1A 3FSRA 4XZ3A 3ZHZA 3WDSA 1EVIA 5CEJA 1RYDA 3VH3A 4BO5A 3NT5A 1NWCA 5BSHA 4WGGA 5HS4A 4J16A 3WIDA 3EVTA 2JHFA 4PG6A 4BS9A 3SJ7A 3C7CB 3KSUA 2YUTA 3CMMA 1GZ4A 4GI2A 3VTFA 4IY1A 3RFVA 4OO3A 4R3NA 3FN4A 3TZHA 3LLVA 3ETEA 2VWPA 4FPXA 1GZ6A 2Q2VA 4TWRA 1MB4A 2P91A 4RGBA 1E3SA 3ITKA 4PZCA 3OEYA 4FD3A 1DSSG 1PS9A 4TQGA 3DBRB 4PCVA 4OOFA 4RVHA 3PIDA 2VHXA 4WJZA 2XOXA 5CAEA 2FN7A 3CXRA 4K26A 3MJVA 3KV3O 3CH6A 4BGVA 4JN6B 3EAGA 4I8XA 2V6BA 1PQPA 1DPGA 6ADHA 4O59O 1U28A 3MJEA 1DIBA 1LLUA 3VZPA 1U8XX 4J91A 4R1TA 2NVWA 4E5MA 3ENKA 1ORRA 2NV6A 1P44A 3QP9A 3ICCA 5T8KA 4RQTA 4TSKA 2BKAA 3RC9A 1E7SA 2P9EA 1OBFO 1BDMA 1N9GA 3L4SO 3S2GA 3NTOA 1CEQA 3I4FA 2DKNA 5COQA 1P31A 2NUAA 1TXGA 1IY8A 2E4AA 3JYOA 3L9XA 5CHEA 4PLZA 1EK5A 4CQLA 5JXWA 5TJHA 4OH1A 2X6TA 2W2KA 3E48A 4J3FA 1CRWG 2ZB7A 3GN2A 3PXXA 2Q4BA 2SCUA 3WYBA 4L0QA 1LJ8A 4OXYA 2QYTA 5IN5A 1O94A 5ILOA 1RM5A 1LX6A 1GV1A 4UVIA 1N1EA 1U3TA 3RC7A 4RORA 3BTOA 2FZEA 2RAFA 3FTPA 3EMKA 4U6SA 1AN9A 2AQIA 4RF3A 1YH3A 2YQ4A 5KVQA 3WFIA 2WD7B 3QWIA 4KOAA 1RYEA 3JQ9A 4BNVA 2H9IA 2PV7A 1J6UA 2VWQA 3QWHA 3SX2A 3DL2A 4IDBA 1NVMB 1YGYA 3JQAA 4YJDA 1NNUA 4DWVA 1BXZA 1HXHA 1P3DA 3LF1A 2EGHA 2YJZA 3A28A 2B4RO 4IDAA 1B0AA 5JW6A 2RBEA 1C14A 2R2GA 5BSFA 3QY9A 3S2IA 3Q2IA 4G65A 2OGUA 1XQ1A 5JLAA 1Y81A 3JSAA 3NTRA 3HG7A 4I5EA 1NFFA 2ZJ1A 4INAA 2HK8A 1E5LA 3WWZA 3G3EA 3GG9A 3GR6A 1I36A 2UDPA 3ZWCA 2EF1A 5CDYA 1HDYA 1YE3A 3QA9A 5G0UA 1GQ2A 3AI1A 4WNIA 3ROMA 2PZMA 3BYZA 5THKA 1JAXA 4ALNA 4DMMA 1VJTA 5A04A 1T2EA 3M1LA 5G0TA 3WX0A 1B8UA 4ZQGA 1I2ZA 1MX3A 1RWBA 4MIOA 5G2OA 3CIFA 4BNGA 1H6DA 3KYCB 4WOJA 4RPKA 3OM9A 2Y1FA 5KKAA 1H0KA 3RBVA 3HFGA 4YQZA 4PVDA 4WLNA 2CVQA 1ZW1A 4MVJA 4KUEA 4BKQA 2PY6A 1UUFA 2PD6A 4FGSA 4BQRA 5F1OA 2YQ5A 2HMWA 4IMPA 5L4NA 3EYWA 1KVQA 3NDRA 5ICSA 2RH8A 5K6AC 5KOIA 1DRVA 1GCUA 4NU6A 4BNKA 1F14A 3E9MA 3QWAA 4NQZA 5ITWA 2VOEA 3IL2A 1KEVA 2FOIA 4NMHA 3ZWWA 1T4DA 5A3VA 1KEUA 5JAIA 2WD8A 3JD2A 4LW8A 4NFHA 2AHRA 1G0OA 4YAJA 4G2NA 2Q1UA 2E49A 2G0TA 3K2BA 1QRRA 4P8RA 1P1JA 3EZLA 3F1KA 3JQ6A 4DC0A 1I3KA 4F45A 1G1AA 4B4VA 2ZQZA 1IZ9A 1Y5RA 4NG5A 1Q7CA 2CVZA 1B7GO 3ZNOA 3QE3A 2VHZA 4OMUA 4Y9DA 4XR4A 2WE8A 4ZVVA 2OBYA 1IE3A 5AOVA 4CL8A 1R4NA 5MDHA 3VZRA 1DJQA 2PZJA 2WJPA 3LC1O 4E2XA 4YR9A 3DZKA 1JW9B 2BH9A 3U5TA 1ONNA 2FP4A 3K31A 1A5ZA 2O2YA 3PFFA 1F0YA 3ROKA 3WTCA 4Z3DA 4I5GA 2I76A 2C20A 4U5QA 3KRTA 1PWZA 1P1FA 1E6WA 2I3GA 2O3TA 5EMHA 1FDWA 1XWFA 5F3RA 1U1IA 3KO8A 4NPCA 1R37A 1SOWA 1UP4A 3WLEA 3AU8A 2EKPA 3JTMA 2DBZA 2X5KO 4K28A 4XA8A 4A2CA 2VQ3A 3GEDA 3JQAB 3MJTA 3H65A 1CQJA 4IIVA 4FCCA 2P9CA 3U4DA 3OFSA 5L3ZA 1Q1NA 2BRUA 3FR8A 2NTVA 4PG7A 3HJAA 3JYLA 5KJCA 3TN7A 4QX6A 3BMNA 1WNTA 1AE1A 2WMDA 2D3TA 1EFLA 3RROA 4CQMA 3NJ4A 3GEMA 1UJMA 2AEFA 3D1LA 3D3WA 2BGKA 3OJLA 1VSVA 3JQ8A 5IF3A 3L6DA 3ZHYA 1HTBA 3Q9UA 3HE3A 1I3LA 4KTTE 3ZHXA 2GN6A 3DBHB 4OHUA 3OECA 5CPFA 4YJHA 4W9NA 1D8AA 5FI5A 5L7YA 2NVUA 4CL3A 1UZNA 4LCEA 1R6DA 4OOEA 1XG5A 5I8ZA 4M86A 3MCVA 4YT4A 3LVFO 3FBTA 1HSZA 3D0OA 3DZFA 1D7OA 4RQUA 4Q3AA 1E7WA 3DMTC 4FFLA 4ZN6A 3ZV3A 5AXBA 1FJHA 1C0LA 2NLOA 4RVFA 2AW5A 4ND5A 1BW9B
chains in the Genus database with same CATH superfamily
1UBKS 1BQ3A 5B1HA 1GG8A 3CEHA 3DB1A 1LV8A 2IYYA 1LBHA 3KKQA 3LCJA 2TRSB 3UJBA 4UHEA 2RGWA 2JCYA 4EYGA 4OLHA 3H0CA 1WXIA 3T12A 2HJSA 2BDUA 1NLMA 4I4TF 5J2UF 3QVLA 5C7IO 2ODPA 3PJDA 4L5YA 4QEDA 3HTXA 3GDFA 2BGLA 4GMKA 4G5XA 3TW8A 3EBLA 4KQJA 4MHSA 2NX2A 5JSZB 3NHJA 2QP3A 4YCNA 4G84A 4M36A 3ANNA 4D42A 5IKEA 1QHGA 1DDGA 3CO0S 3NXSA 4JP3A 1Q12A 4N6NA 3SEFA 3U62A 4B46A 1NZFA 1HYQA 1PLLA 3I2JA 1G3QA 2WJGA 4P2BA 3VAYA 5CA1A 1G9XA 1IZ0A 1ZC3A 2OZLB 2XUZA 5F4BA 5BSRA 1LBEA 3K9QO 4JUAA 3T9CA 4YRNA 2Y77A 3SOPA 1BVYF 1MO4A 1BKYA 1F1JA 1PR2A 1S4MA 2J5BA 3B9QA 4JSTA 4WA8A 5ALPA 3UUEA 5I45A 2BH2A 4JI0B 3PXGA 1XDGA 5FADA 2WICA 4GKKB 1IXSB 1GG5A 3HV0A 1QS0B 1T2DA 2H2IA 2ODTX 3MHPA 1PJ8A 3N07A 4GYKA 2J0QA 5CJPA 4HGOA 1XZMA 4YECA 1MPTA 2YWJA 3ERCA 1N25A 3K9HA 1SPBS 1RWXA 2EATA 4YJGA 4F3NA 1UIRA 4GXTA 3GOQA 1IPEA 1QAQA 3QTLA 5KDDA 3MJFA 3ESCA 1IN6A 4L9AA 2X5JO 2XEXA 3GLFA 3ZD9A 3NWPA 5CFPA 3DT9A 2XMQA 1GPYA 2HO5A 3FJ1A 4GGMX 1HV8A 1U0TA 1S3GA 2RAVA 5K0TA 5LMNB 1TE2A 4EOGA 3TW4A 2VATA 4RLSA 5F5NA 4M21A 1TVCA 4G8BA 1ZIDA 1D0SA 1JAIA 2ZKIA 2ZRKA 1E1RA 4BTLA 1EWKA 3DFIA 2J1LA 4HEHA 2O8EB 3M5DA 1KS9A 2YWDA 1DOAA 1K1EA 4FQ7A 3GEIA 4C2AA 4GWLA 5G41A 1DAIA 1EHYA 1TZ2A 3IOBA 3ITNA 2D0IA 2BFOA 1UT5A 3JPWA 5AVKA 2XXBA 3VYUB 1P4AA 5AVSA 4GR5A 2ZUUA 1JJFA 2WOOA 2AG0A 2BI7A 2QN3A 3MB5A 3HXKA 3HDHA 2EFJA 4I4TA 3GGOA 4WBXC 2WF6A 4JBWA 1TU3A 4CI9A 3H1TA 5L8VA 4ZVTA 4G5OA 1LWOA 2I71A 2WJYA 4O25A 1U3DA 1V5EA 4PZUA 4RD0A 3WK8A 3ZE7A 4AP5A 1LSJA 1YS1X 1VL6A 2XNDA 3AFHA 3CF4G 4J7XA 4BMSA 2XYVA 5J4KA 2ONCA 3U19A 1Z22A 3ZDZB 1E69A 1XDSA 2AH5A 5DBGA 5A4DA 1YZ3A 4IDHA 1U6JA 1V8DA 4M88A 2YHIB 4CWAA 1BAPA 3CZ4A 1SR8A 3MRTA 4BXOB 1LDNA 3B6KA 1RKBA 1R0ZA 3UXEA 2P8SA 4KLNA 3W05A 4YCJA 1TLFA 2RBGA 5IU6A 5KSYA 3O47A 4B3HA 1E0DA 3RUEA 3ZCRA 2VJNA 1ODIA 4JBHA 4PO1A 1IJKA 4LY6A 3KB1A 2MIIA 3BTSA 2VNJA 2F1IA 2AFIE 3H99A 1EQUA 2EYQA 2OV2A 3IJEB 2BI8A 4EVRA 4XQ0A 1M54A 1IBRA 5ADWA 2Y9MB 2HR1A 3UN1A 3O0TA 1B6TA 2APJA 3KKZA 4JVLA 2AK3A 3I9KA 1TQ4A 4CU2A 4OLBA 1T24A 4XGQA 3T5TA 3EHEA 1OXBB 2QT1A 1PZMA 1S5PA 1VYUA 3WY9A 5KSWB 4DVJA 1Y1SA 1SXQA 3N28A 4B2LA 2GJ4A 2YW2A 1M6WA 1XZCA 2ZSAA 4IJ6A 3WFJA 4EVSA 2RHOA 1LNQA 3HBLA 4ARSA 1YRQA 4ONEA 2BE9A 3UVEA 3NCTA 3SX4A 2B21A 5G0WA 1EXVA 3TPZA 1ODCA 3BFKA 5HQ3B 1QRUA 3CV3A 3C1OA 2Z2YA 1QJCA 4PFSA 4V1CB 2X0RA 2YYSA 4L76A 5EP2A 4N76A 1PP4A 3NGXA 1YIAA 4KAFA 1IVYA 2AI2A 1E2BA 4B82A 3ETGA 4E07A 1WTAA 1DUIA 1ODSA 3LQ1A 2C3UA 2R66A 3JALA 1N0UA 3SNKA 5IANA 2DSNA 1HZJA 3PFIA 4ML3A 5FBZA 2J4CA 2E55A 2QRLA 3SJAA 4ZQFA 1WZUA 2QLLA 4NDAA 2NPOA 5K8LA 1XMQB 3HB7A 5G3ZA 2JCBA 2YVLA 2VBGA 3HS3A 3D6NB 2IRWA 4R69A 1LSSA 3QI7A 4ND8A 5DTIA 3VI3B 1NG1A 4PZEA 3C6QA 4YXWD 3O8CA 3DOHA 4XX1A 1E7QA 3H42B 3CF6R 3GVCA 1ACLA 1FC0A 3OCWA 4AJKA 1XMPA 1ZGZA 2B1IA 3BSYA 2EQAA 4YVFA 2G1UA 2IZOA 1SA0A 3L0SA 5KAMA 5JSUA 3N2ZB 4NZPA 5ED4A 2XJ4A 1HYEA 3A58B 3TLGB 4B4UA 1NP6A 4BUZA 1M6VB 1XTRA 1E6EA 4IH9A 3RAFC 4BGIA 3BE5A 4X20B 2Q1WA 2I9PA 3BRQA 4PXYA 5DHQA 1ZN2A 3LC7O 3HVJA 1JT9A 4O8ZA 1KDPA 2WB2A 3WLNA 2G1PA 3FNRA 4GI7A 4XUGB 2NU7B 1EGAA 1RC8A 1YMVA 2V7GA 3WGLA 2IBTA 2V7PA 4YMWA 5EZSA 2REXB 2JIPA 3P97A 4V0SA 2REBA 2PSDA 3C6KA 1MRSA 3PQ5A 4TS4A 1PJQA 4A15A 1SRRA 3E22B 4GF5A 3K15A 1P7WA 3QEOA 1XQ9A 1XTJA 1ZD8A 4LG1A 5CVVA 1W8IA 4D4LA 2CHFA 1QGOA 1E2IA 2DFTA 1Z7WA 5AICA 4IQGA 3A25A 4PSVA 2R6HA 4RVSA 2FVYA 3IOYA 3V8BA 4LISA 1P91A 1QZXA 1PU2A 1S1MA 3NWBA 4YJ3F 4AYTA 2CV1A 4MULA 3CZCA 4YASA 2CNNA 1KQOA 3L0ZA 1CUVA 3QYJA 2GHRA 1Q1ZA 2UZ1A 2YQZA 3OLXA 3MERA 3QQPA 4D4KA 3DGFC 1C9MA 1GPH1 1MOQA 1TTHA 3HMKA 3G5TA 3W8RA 2GPBA 2JJ2A 3C41J 5KYTA 3UOWA 1WULS 5DH9A 4ZMBA 2H5EA 3RU9A 4YP6A 1JALA 2XF2A 3DJFA 4C76A 4EH1A 4H7IA 3URMA 2WOJA 2CUKA 2D13A 3VH1A 4YCCA 3TOZA 5LLDA 4HV4A 4TS1A 3CVJA 1P29A 1XJWA 2M2IA 4R8KA 4ZI7B 5BXQC 2QX9A 3KL4A 5C46F 1OAOC 3M2PA 4YAGA 1Z62A 4O4LF 3H1FA 2ZRQA 5LQMA 2R11A 5CGZA 2WJWA 5DT9A 1VCNA 1E7RA 1NF2A 1QHYA 2GN2A 1NRIA 2JJQA 4OD0A 5I4IA 2E85A 4M54A 3DEJA 5AKKA 5HA5A 2GZHA 4AJ4A 3JATB 3T99A 4EI7A 2RGNA 5GVSA 1H22A 4NPHA 1C1DB 3QWFA 2NUPB 3WGGA 2Q50A 3DDNA 1ORIA 3WP0A 3P9XA 4IOJA 4ZTZB 3I92A 1D04A 2BBWA 4U2DA 4ZOCA 3EXEB 2F48A 3Q7EA 1T4MA 2I33A 1XF1A 1KO7A 2FDRA 4Q4LA 3RJ9A 4ZALA 2VQDA 3RKRA 3HNRA 2WWTA 1KI1A 2HQ1A 2IPMA 1CY8A 1Q0TA 2MDTA 4WY5A 5SY9A 3KDAA 3KUXA 4AO7A 1I5RA 1PS8A 2B1GA 3PYLA 4LECA 4CUKA 2BL4A 2D7DA 1LBIA 3BA1A 1LB1B 2D2FA 2IYQA 2FVXA 2GPAA 2XECA 4FFNA 3D81A 2QM8A 4MP6A 3WOVA 2CKDA 5LP1A 3WSVA 5EJFA 3X0DA 1QKIA 5JWHA 1K9VF 3SC2B 2IHUA 3WQQA 4J0FA 3DDOA 4BP1A 3EC2A 3FDIA 5F12A 1U1FA 2A1UB 4YJ3A 3SDZA 3SY8A 4CF5A 1X14A 1R0CA 2JGNA 2IVZA 5FWXA 2VP3A 4ER6A 1V2HE 2DFDA 5FUQA 4IXWA 4MV0A 2X9LA 2Z1NA 1C2YA 2ZYGA 2WF7A 2QR2A 2GM9A 3LHKA 2AL7A 1IHPA 4XWWA 2GJAA 4UDNA 1TOAA 1YCFA 3K1TA 2JD1A 2ZVJA 3PJFA 3Q10A 4M99A 3SN6A 4YMTA 3F8SA 3E7PA 1A7UA 5EUCA 2HWYA 2ZJOA 3RNOA 3LD9A 2W6ZA 4X45A 2QYOA 4BKPA 5EIFA 4B3IA 4YAUA 5C8VA 3DAFA 1ADJA 1N78A 1WBJB 1BXRB 5FCDA 1YE5A 1LBSA 2I87A 1N8KA 4O4LA 3GXOA 4BVJA 1FMJA 3JVIA 5KYWB 2PX4A 2A5JA 3BGDA 1HDGO 1ZWLA 1I94B 3NBQA 5FI3A 4BBAA 1JAZA 3TLAA 2HNKA 5ERYA 4BFXA 2R1TB 3KSRA 4C21A 1HNXB 5LA6F 3UA3A 4PNZA 4EFDA 3QF4A 1CP2A 3G68A 1BG6A 1YRHA 3HP7A 1T15A 2YVKA 3I9NA 4IJMA 1R6AA 4JCCA 4BVEA 3SF8B 3Q6MA 5GVRA 2QLFA 4CKXA 4J0IA 4QUIA 3A7EA 1TUIA 3EEBA 5H16A 5LBTA 1G21A 1FDSA 3DVQX 4F1KA 2GZDA 3GUYA 3HWWA 2WWRA 3STUA 1HYGA 4XH9B 1BDBA 4FR2A 1YV9A 2BWJA 3PNOA 1A2BA 2MT9A 4GRDA 4OMFG 4CM4B 2PBRA 5JJ5A 4ZVNA 2WQ7A 5E6UB 1Q0HA 4QULA 3E35A 3PV0A 3C39A 4H0NA 4M1KA 3RD5A 3AETA 4J0HA 1BYIA 2B6NA 3SBOA 2FHSA 1IC6A 2IYVA 3P1JA 2JBAB 4QE3A 3L9WA 1I1OA 2H0QA 4KAJA 5AKYA 3T0GA 1PQ4A 2M6RA 1QGED 4JP5A 3U7RA 4R83A 2AA3A 1DO8A 2D4HA 3CEAA 4P31A 2A1TR 1O57A 2BPOA 4IYRA 2GN4A 3GLRA 1Y0BA 1W9HA 5JCJD 3SWWA 2YJ3A 3UY4A 1R0WA 4R3UC 4XLZA 2V0NA 4YFYA 4H6PA 1UXJA 2RHRA 1HM5A 1USWA 1UDWA 1W5EA 3A1UA 3BRSA 2DQZA 3D7LA 3E9ZA 4HI0E 3SLKA 1JHVA 3TOSA 5IX8A 1O89A 2KQUA 1Y1RA 4Y1RB 2RHBA 4R8SA 4YT5A 4PLTA 5JANA 3DE2X 1Z4PX 4D82A 2CDNA 4FYPA 1K89A 4IGEA 4Z86A 3E3OA 1F8GA 3WYCA 1CE8A 4P33A 3A1VA 1HURA 2XYHA 2G82A 5DWQA 4J94A 2R44A 4M1ZA 4EVQA 4P0QB 4WK4B 1T6ZA 2IYPA 2UYOA 3PWZA 1BOOA 2H2DA 2X1VA 4TN5A 2WG0A 1QYCA 2VCHA 1B8VA 5EKXA 4AO6A 4QBGB 2OMEA 3DKKA 1K2WA 1XPJA 4P0TA 5CNIA 4Q16A 5AKLA 2AN4A 2XNKA 3CZ9A 1KHHA 3K30A 4F9GA 2O8CA 3RRBA 4IO0A 1P7CA 3MMSA 2C42A 2ZR8A 3MOGA 1PGQA 3VHXB 2PGAA 2GCOA 5LA6A 4JL6A 1UAGA 4NEGA 5CB4F 3G8CA 4R2HA 3DT6A 3NM4A 1W0KA 3NS7A 2H7VA 3GFOA 5FPTA 4XLTA 3E8XA 3EUFA 4OMDA 5JE8A 1WXGA 4FLFA 1N36B 3NHWA 3JQBA 3ASUA 5AM1A 4ANFA 4I5DA 3TJMA 1KSHA 1SZCA 3BG5A 4L8GA 2BEUB 5FI0B 4ZAZA 5EFOA 1AVTA 4IXMA 1MV8A 2PU5A 2RCYA 2YV5A 4I9GA 1KO4A 1Y6JA 1FMCA 3NVMB 4BL5A 4Q03A 1M1XB 2GI4A 3HCNA 4DUGA 4KIFA 5DU2A 2C2YA 2XYQA 2C54A 4FFSA 2EW2A 4JC5A 3IDQA 2W11A 1W5SA 2CUNA 1HBJA 1EM8A 1X86B 1ZS9A 2JZNA 3SK0A 1Z83A 4UM9D 4IS2A 3Q6NA 2OCYC 4YRAA 1TCUA 2UUOA 3DH0A 3P2JA 3GXBA 3H17A 3D8NA 4QXRA 3T3MB 1SKYE 3GJ4A 3AF0A 3VC7A 2OZEA 2ACKA 4Q7MB 5A06A 4B7XA 3OEWA 5DZSA 4HDRA 2VSXA 1Z4QA 2QW8A 1Z9BA 4YJKA 5I7SA 3GJXC 5A4JA 1Z0SA 4US0R 1EWTA 1EWQA 4Q6BA 3LKDA 4OEHA 1PX0A 3C1AA 3K8YA 3KU1A 3M6WA 4PPYA 4B34A 1DWUA 1UKEA 3HXQA 1GL7A 3PEEA 5KNCA 1CJUC 3L8HA 4IKPA 3O0DA 1W2HA 2VH1A 3VR6A 1RYZA 3HR8A 3LQQA 5IC5A 3VR4A 2PMFA 2QYHA 1WXEA 3LZ6A 4H60A 1J23A 1P39A 3IIKA 1ZJJA 2PMEA 4Y2TA 1NBMD 1RCFA 2BTQB 2NIPA 4GWKA 1DC3A 1EVZA 1FRZA 3DBLB 3EY4A 3JR3A 3MJSA 3PL1A 4FW9A 5CB4A 2A0YA 1XRQA 1OI4A 2ATEA 5THQA 4QPZA 4F9FA 3WV4A 3QMWA 3KKPA 4YMGA 2PUFA 1CLEA 1NNLA 4EY5A 3VNVA 3OLWA 4LDZA 5I3CA 3M4YA 3QG1A 5KC9A 2BISA 3I3OA 3NBMA 1U94A 4RHYA 3HKDA 4O5AA 3QTBA 5B3JA 4LQ4A 1LV7A 4WZZA 2HHCA 5KKNB 5LVAA 3TRKA 2GCNA 1GHTA 1EEXB 2QJFA 3IQEA 3LYHA 2FZWA 1SIWA 1Y7PA 4L5BA 3CJQA 4RA9B 3A37A 1I3CA 1LTKA 1VG8A 2PIDA 2OLEA 2QRVB 4HDSA 1SVKA 2J3HA 3DHWC 5KX5B 4G0YA 4NP6A 4GKBA 1T8UA 4R98A 3I2KA 1JIKA 4IMIB 2LCFA 3DS8A 1QG4A 1GKYA 3CR7A 3QVVA 1BW9A 2HO4A 4I36A 1SBYA 4KLAA 5U4QA 2ZWMA 1UM9B 4OK6A 3R3WA 2PRZA 1N1GA 1WJGA 2DM6A 2I6GA 3L5KA 4JDUA 4V0QA 3WLPA 3VFDA 4PTYA 4HH0A 3D5EA 1OV6A 1TDJA 1S6YA 1TLTA 1TM7E 3OFJA 5IXYA 2WHXA 1HE2A 5HRCA 2HDHA 4UPEA 1JLSA 1KZ1A 3CLTD 1RRCA 2FE4A 2F62A 4RF4A 3SHVA 2PGDA 3BN3A 2MSLA 4GBGA 5HE9A 1GA4A 4KSYA 4KUGA 1GITA 2FZLA 5TNXA 4AJPA 4B3BA 4RDXA 1PJSA 4D9GA 3K0CA 4F6LA 5CLHA 3KT0A 2OXRA 3P9ZA 2DTDA 4FIZA 5KOHB 1MAVA 2H18A 5IT9A 2GF9A 3Q5GA 2JJMA 2I6SA 1ZRHA 3A9RA 3DQZA 4X84A 4X0EA 2BP7B 4AWAA 3BERA 3ZJUA 1EVEA 1DC4A 3GRVA 1ZK1A 3F4KA 3HLTA 3JWIA 3RB8A 1VPWA 3LWZA 1I3MA 1E3WA 2WHPB 2POQX 3P9IA 3ORQA 3I64A 4CGYA 2WLSA 5FBVB 3PPYA 4QVGA 4HNSA 3C5EA 1PTJC 3CVWA 4EJSA 2ISQA 2Q9AA 1UXHA 1DEXA 1Y1QA 2A0UA 1IOLA 1UBOS 1YB5A 1JPUA 3DXXA 4B3RB 1J33A 4DY4A 1JHQA 4GLBA 2BFBB 4OM7A 1KPHA 4WK2B 1WB5A 3QKWA 2JD2A 1EA5A 1FXUA 3DNMA 2FPPB 1L5KA 5CCBA 2J7KA 3OQHA 4DA4A 4FGUA 4MW7A 2QZPA 1WD7A 3E6AA 7GPBA 2GD1O 3PUVA 1JH9A 3L6OO 3GUCA 4ZARA 1VSUA 4KACA 4F8YA 1GD1O 1R6TA 3FFXA 5CW2A 1YJCA 3DZDA 4RFVA 2E82A 3JXEA 4UMEA 4B35A 3ZYCA 5C8ZA 2JASA 2OLKA 1Q92A 2VCEA 5J59A 1NOKA 3ML1A 1IB0A 1QIHA 5EUMA 3MWKA 3BB1A 3AEQA 4OI0A 1YULA 1ULBA 1FFXA 3RYCB 2X7JA 4B47A 1LA2A 4BRWA 1V8OA 2ZT8A 1U7UA 2XUHA 1TGVA 3GJ3A 3G0HA 3HRHA 3NLLA 4QJBA 3T3HA 5JH7F 4OI1A 2YZMA 2CJWA 2HPHA 1S2LA 4UASA 1JXOA 4RJJA 3E61A 3TW6A 1NW6A 1WPRA 1RXCA 3B6EA 3QI2A 4J16C 3HCPA 1WW3A 3IUPA 1XCBA 5CCDA 5KOJB 4IEEA 1ORHA 1IAVA 1N6RA 4KYIB 2OAP1 1ABFA 1TIPA 3WICA 2BGTA 2WYHA 4IHQA 1RC0A 4EL0A 1SCUA 1VDMA 3AB8A 3ZEAA 1PCXA 2F3PA 4F4CA 1HTTA 4Z4FA 2H4FA 4RLQA 3PFHA 2HCJB 2WP8J 5SZJA 1V7ZA 4GX2A 1PJ4A 2PS1A 4Z6KA 5B1EA 2O2GA 3E27A 4JQCA 3CUTA 2XTZA 3P4XA 2Y67A 3HUDA 5EA2A 2LBPA 2JIZD 3ZWYA 3ZHQA 4Q4HA 2RGGA 3JQFA 4HD8A 3AX6A 1KH3A 3DFMA 3KS9A 4FNOA 4X1IA 4HDKA 5K4AA 4YR7A 1F60A 5A9SB 3H0KA 2C83A 2ZIGA 3JPYA 2EVWX 1OASA 2AQKA 3AOEA 4MWOA 3EJ6A 4UUBA 3V7UA 5HX7A 2PT6A 2QRKA 2W4MA 2HXSA 5DF1A 1RJDA 1ZCJA 3GFBA 5AJUA 2H5LA 1OH8A 2R8EA 1EVLA 3ZWPA 4QC2A 3KZNA 1O95A 1QTQA 3LT5A 4K9QA 3HKCB 5FLYA 4NDZA 1U28C 4EB0A 1JU4A 2AOVA 4BTEA 4PWZA 3OX3A 3PXUA 4PLGA 1J0CA 1ODTC 5IG2A 5F5XA 5H59A 2WJAA 3WAKA 4D3YA 1FDOA 2QMUA 4HPXB 4UCXA 4IIJF 3FUCA 1WCV1 3M83A 1X7WB 3P9YA 1OFVA 1ADYA 2ZK7A 3RQIA 4A6EA 2O57A 5AJZA 3UXMA 1EXMA 2J41A 3H5TA 4QNRA 4TRMA 1E6UA 1SHTX 1BE6A 1TEXA 1S1CA 3ME5A 1RKUA 4CMKA 2WJ3A 3VC2A 2BFEB 4I3FA 4JC4A 3WGUA 3FCUB 3UYKA 2VYNA 1K3FA 4YRLA 1NVAA 1MC4A 1ACJA 2W2LA 4O1HA 4H7KA 5TF4A 2RFLA 5JH7A 2WTBA 2J0EA 2FUCA 2RK4A 4EZBA 1JFFB 3TUZC 1OFUA 4H7HA 4L72A 3C8HA 4TL6A 3U7EB 1RLOA 3RR2A 3ZC3A 3C5VA 1CF4A 3HXOA 4AJLA 2I3AA 5JHHB 3GGGA 2FDCA 1D7AA 4J0DA 2F9FA 4HP8A 4DGSA 4G1BA 4Y6LA 3IEUA 4A10A 5BNIA 4I6EA 3IJPA 3QOYA 2GBPA 4GWGA 4Q1CA 2FLKA 1ADGA 4K6GA 2DB3A 4TM7A 1PIWA 1SFRA 3ZNNA 3NX4A 4I9UA 3O26A 3N86A 2HU8A 4QWMA 1RLJA 4UFOA 4FC6A 1ZJWA 1E2JA 1ML3A 1OUMA 1WM1A 2ZCVA 4LXGA 2F9LA 2Z4SA 2EFDB 3O8OB 5BV8A 3OP4A 3BK2A 5BPHA 2Q9BA 2W2QA 1JG3A 3UAYA 2ZB3A 2F8SA 2G9VA 3C87A 3R3XA 5ERGB 4YP1A 4NJEA 2R7AA 3P96A 4FMCB 5KSZA 4TQAA 2B5OA 2X23A 4LVOA 1V96A 3CUKA 1BRMA 2WD9A 1PWEA 2VT3A 2QPLA 5HKOA 4NYJQ 4OF4A 3KHSA 3R2JA 3EE6A 4TYNA 1KMHB 4NHEA 1ZUIA 2DEUA 3KQPA 1DQNA 2HT6A 3ADBA 5F7ZA 1WHSA 2LV8A 1EZ1A 1ZU5A 4AF6A 3DA8A 4QASA 1BE1A 3IO3A 2C5FA 1DAGA 1JQDA 2A94A 16PKA 5CH5A 4NFYA 3F6CA 4IIJA 3I6ZA 2AZTA 3NIFB 4LI0A 1NVKA 1TD9A 2AMJA 3M9LA 3TD6A 1XC7A 2F1OA 1XXLA 1N77A 4IILA 1XBTA 5LCXA 3H6HA 1YI8A 4QBKA 3VQTA 3UH1A 1Y9JA 1RAIA 4I1PA 5A4FS 2C3OA 4WPGA 4KPFC 4G01B 2XOKD 2Q5OA 3PNKA 1BVUA 2DQ4A 1ZESA 2OTCA 4DYDA 3SR3A 2HCTA 1W87A 1WY5A 5DNAA 1EU1A 1QKKA 2QLBA 1LPOA 2VF8A 2Z57A 3DAGA 5EQTA 5G53C 3DLHA 4C6RA 3FGOA 1D6NA 1RD4A 4CQJA 3FMOB 3SE0A 1CZKA 4C7MA 2P2GA 1A9PA 1Q0ZA 2IDZA 3L6CA 3KZMA 3ROZA 2ZXUA 1GAWA 4KV9A 5EZYB 3A4NA 1SXJE 2J9XB 2V6IA 2VJBA 4XB6B 3H6GA 4HGYA 2HU2A 2A0FA 3VJKA 1U4SA 2WF8A 4C7BA 1SK8A 2CFSA 2HK7A 2ZYTX 2NP6A 1FRQA 5K99A 2HJWA 3DWEX 1VSQA 4ZIRA 1P7YA 1YQQA 2ETVA 3U44A 4QIHA 2GYUA 3EMVA 4DRXA 1AXGA 2VF7A 2ZRDA 4YO7A 2WFLB 3GWGA 1AQYA 3LP8A 3CRRA 4TKMA 2K4MA 4RKRA 1ECJA 2HLDD 3L2OB 3IKMB 1W6UA 3KWFA 4P80A 1N2CA 1YR3A 1GKLA 2D06A 2GUGA 4EW2A 1J2JA 2IUYA 1XLTA 4I3HA 2AZXA 3NHFA 5A05A 3KR9A 3FPCA 1JLKA 4OGWA 3KCNA 5TEVA 1T8WA 2WF9A 1G6HA 1OZHA 1UJCA 4JA2A 3OX4A 1KP3A 1NLZA 4A8JC 2GFQA 1W96A 5E38A 3ZW7A 4NR0A 4F5ZA 5HJEA 1RI5A 4K87A 3VDRA 4AROA 3F0TA 2VG8A 3EEFA 5DNDA 3NNNA 4JR1A 5IJAA 3TB6A 4WCVA 1DFIA 3UAXA 3U37A 1EUCA 3U49A 4LEIA 1J8YF 3V1LA 5AJWA 4DTCA 3HGQA 5EJ4A 4AQDA 1IG0A 1YJXA 4CKCA 2YRFA 5CM8B 4L22A 4B09A 2YJ4A 5FR1A 3QU4A 4BU0A 4QDOA 1JQKA 2XVMA 1E2DA 1C4XA 2Q3FA 1OXTA 3HEMA 4IHKA 2HJ9A 3OZBA 4LQLA 4Q34A 2Y1KA 4QSMA 4TLDA 4XPZA 3IIMA 5AW8A 2M9MA 3HDGA 4WOBA 2WDPA 2JBWA 2OXIA 3GUHA 5LZ2A 5BN3B 4L8YA 1Q0RA 2H00A 1O97C 1U0GA 1JSXA 2QL5A 3BAFA 1YDWA 3LDFA 2XDWA 4W5WA 1NOJA 2A9OA 5J4YA 1W36C 4KQ2A 5BMOA 3JASA 4N8EA 4BO6A 3I9JA 4XIGS 2YFKA 4CFSA 4FU0A 1NL3A 5K6TA 2VHVA 1ONBA 1H8HD 2PUEA 4XGRA 3C3KA 4YRKA 1LI5A 1ZDMA 5K0FA 1V7CA 2VDRB 3BE6A 3ADDA 1CS4C 1K97A 3W5IA 1FFSA 1OQAA 1R5NA 2BMVA 3I9V6 3RABA 3MIZA 2R6R1 1UBHS 3OT1A 2E5FA 2XGSA 4A26A 3B2NA 1EQAA 4ZOLB 5ILGA 1SNYA 3QKSA 5ARCA 4HT3B 1U2GA 2EDCA 3EA4A 3F6BX 5LPNA 1H0RA 3TR6A 4MPTA 1REQB 2BRUC 4XM2A 3WYAA 3S5JA 3VX4A 1VA4A 4UTVA 4Q3NA 2I0FA 2PD4A 4QXPA 2WUFA 1YDEA 1M72A 3ZKAA 2GBCA 3TB4A 1JG2A 3DMNA 1QVVA 1OLUA 1UFVA 2FSGA 6YASA 3M1AA 1EFCA 1RZVA 1FMFA 4H3HB 4NLLA 3E9QA 2COEA 3E82A 3F4BA 1H69A 3GU3A 4BZPA 2QNIA 1B4DA 1XEAA 2AEJA 3GA5A 4JT4A 4Y2QA 3U3KA 3DHNA 4NKRA 3GFFA 4U02A 3IQZA 2UU9B 2CVFA 2RIPA 1XL1A 1RRKA 3I76A 1L4HA 2IU4A 4PG5A 3VDXA 1OPXA 5JECA 4F71A 3ZXSA 1YL6A 1PL0A 1OY1A 2X9VA 5D3MB 5LP6F 3K20A 1ENYA 4BGDA 2Q9UA 2F59A 2P41A 1LGYA 1O9GA 1W88B 5IS2A 2OBMA 4U3JB 3VYTB 3ROPA 4ETIA 4PSDA 2G1AA 2QTHA 4U2CA 2Z56A 5K3CA 1XPOA 3IBGA 1MT3A 1P4JA 4NJOA 1F8UA 1I10A 1EIWA 3GEPA 3I05A 4X62B 4I14A 4A8HA 1T8SA 2C4HA 1EXNA 1SBIA 5GOTA 4V0ME 5FTLA 1SIOA 4RZ2A 4HAUA 1WHTB 3LCRA 5DN6A 5HFNA 4OFWA 1PT7A 3PC6A 4DILA 3JQEA 2IIBA 4BVGA 2O4UX 1NUAA 2VF2A 2IPNA 2SHKA 3FVRA 1VB3A 1T0BA 3NGLA 4PO9A 5I7EA 1GA6A 2G4LA 3OY7A 4GM1A 3WJ2A 3OM0A 4DGQA 5EXEA 2FMHA 2IU3A 3FOBA 2NQ8A 3C3BA 1JIUA 3AC0A 3MFQA 3G6KA 1KXZA 1U6KA 3QJYA 4X95A 4XJVA 3JQGA 4U9IS 4A3SA 1YQDA 3OA2A 4Y2VA 1EJ0A 2D5CA 2G04A 2Y0EA 2RHGB 4M89A 1GO2A 3N70A 5MFPA 1HEIA 2JRLA 3DEYX 5CNKA 4I50F 4URFA 1PLJA 2B25A 4HLNA 3ZVNA 4WNAA 2V7UA 3RUHA 1NF9A 4UNNA 4D45A 4DJFC 4KIWA 2VP9A 2CD7A 4ZQIA 3IURA 5KU1A 1F6BA 4YMIA 3IPXA 4KFTA 4NICA 5I7VA 4QA9A 4LYFA 3FI9A 3WMRA 1O5OA 4UATA 5F5LA 4EA6A 1WG8A 1LDGA 1SHJA 2HHAA 2OHHA 4MV8A 4NU5A 1MHTA 5I7FA 4YQYA 3MYRA 4QQNA 2BKEA 1TJPB 1DTWA 3CSSA 1DBPA 4HX9A 4O4JF 4N0MA 4MVJP 1Q74A 4F04A 3TL6A 5K6AA 1SAYA 2PUVA 4D46A 3EC7A 3IP1A 1SULA 1V16B 3U1VA 5DRTA 4UU0A 4DV0B 4AY2A 2NO1A 3I3SR 1VI5A 2AN9A 2XWPA 2RONA 3D0KA 2KSQA 3INGA 4HTFA 4PC3A 1PE0A 4AXBA 3EPHA 1DC7A 3QW2A 4J8PA 2V8OA 1GLVA 3S2SA 5LP6A 2XVAA 1VIAA 2YDXA 2W5UA 2OECA 2ZYSA 5IJ9A 3A1SA 4LOIA 4GH5A 1ZD9A 1JB9A 4A82A 3O8QB 2C7GA 1HDOA 1FVHA 5CTAA 1VBMA 2WWIA 2QD5A 4DR6B 1AK1A 3D2BA 3GJ6A 4W63A 2I3BA 3MGGA 5FLXA 3DZIA 3HO6A 2VAWA 4D0LB 1RLUA 2EFYA 3G2IA 4EHDA 1NSFA 2IOFK 1VC2A 2ACEA 5D2CA 3NVDA 4BKOA 4FFVA 3GA0A 3BJIC 4HK4A 4IJUA 4PSCA 4RM2A 3PFBA 4DV3B 4YXWA 1KSJA 3FD8A 4XFJA 4EB3A 5FV4A 4QFMA 1KERA 1TK2A 1YNSA 1C7JA 1RKVA 1B73A 5K0JA 2HDOA 2Y3IA 3LY7A 4GICA 4OGGA 3U4GA 1E2NA 2P9ZA 4KPUB 4EBBA 1TC2A 4Q01A 4NV1A 3ZKWA 4WRRA 1Y89A 2QUIA 3PHLA 1XE3A 2OD7A 4XFDA 1T8YA 3TQHA 4B2IA 3MUEA 1JA0A 5CT9A 5DSXA 2GXQA 1ZD2P 4LJ8A 3URKA 2GGSA 4I50A 1DT5A 4X3PA 4DYVA 3ZYZA 4N5NA 1SCBA 1E1LA 4Z4HA 4FWIB 3F1LA 3QUAA 3UXHA 1GUFA 3R8CA 3Q1KA 421PA 3RGGA 2QQEA 1YMQA 4MS1B 3COYA 1I6WA 5TVGA 1CUEA 3AO0B 3T8YA 3TK1A 2FK7A 5A5VA 2BEVA 1KO1A 5F64A 2XMSA 1T9HA 2PJUA 2X0JA 4BWYA 3U7GA 2BFFB 2EWWA 1N0VC 1NN1A 2QIPA 5K4GA 1NJGA 1FUKA 4YP7A 4LWPA 4O4JA 2WM8A 4D0SA 4D4HA 5JEDA 1YI1A 4DSAA 4NH0A 2IUEA 3VVMA 3FM9A 1PVOA 2WLTA 1JAYA 2C9BA 1E61A 1M1YA 3KX2A 2Y6UA 1L8OA 1GLGA 1JDZA 3SF0A 2O0LA 2QD1A 5BSVA 5LN1A 3F6YA 1WMEA 3TVTA 1NYQA 1QYIA 4ENQA 2D8AA 4L95C 4XD7D 2VDQB 4HWKA 4PHTA 5KWEA 2HMUA 2HRRA 2PG3A 4HRVA 3MD0A 1N7GA 4YEDA 1T1EA 1UBMS 1WXXA 3KOZA 4BEVA 3V32A 3GCWA 3KJGA 1F8XA 1JEQB 2HY7A 3UATA 1ZNYA 3TCKA 3NEPX 1KFKB 3MXOA 1HOTA 2B4QA 2F7SA 5TVKA 5T4BA 4EW1A 5KDOA 3TIXB 2Q6TA 1GKIA 3C24A 3TLMA 3ESRA 2O1EA 1K68A 2H1WA 3MC1A 4YRDA 4CTNA 3VOTA 3WIBA 5EEGA 1Q77A 2A2ZA 1ZISA 4RPHA 3EPLA 3T5BA 4DYHA 1NJFA 2JVKA 1VLMA 1L5WA 3O3OB 2QLJA 4N03A 3T1YB 4OM8A 1VKRA 1ZAKA 2PFGA 3E0QA 1K63A 4RYDA 1P77A 4KL8S 5BMVA 3BMXA 2X1HA 4W1QA 1BO6A 2EFHB 1LWNA 2CT8A 1D9ZA 4HFRA 1QQBA 2BUAA 2E3JA 1SKMA 3C97A 5BUSA 4ZVUA 4XJTA 1CR0A 4QRHA 5E1BA 2C99A 4HNAA 2CHUA 3T9BA 3K8ZA 2F90A 5CUQA 4G0VA 4BX0A 4DQXA 1U90A 4MMXB 2ZRJA 3OQ6A 1A4RA 4BE7B 1IHDA 1O97D 3IIIA 4A2QA 5IULC 5M2QA 2V7BA 4NH4A 3JYHA 4RK4A 1C4WA 4EFMA 2CUTA 1GNLA 3DVAA 1NVGA 4LCJA 3K2QA 5B2EA 3C7KA 3UXYA 2A9PA 3GFSA 1LQ2A 4BFLA 2MMGA 3ER8A 2VHWA 5G1OA 2FW8A 5G02A 2NACA 5JZBA 5LQCA 4DHEA 5L3RA 5HCNA 2IUSA 3N59A 5FQOA 4CZ2A 4YPOA 1XXHA 3IE2A 5L4LA 2HYIC 3OOEA 4MW4A 1TO1E 2XHEA 2SICE 2R4TA 3HCOA 2P6RA 1Q2XA 2GAAA 3Q7TA 2ZWIA 4EPTA 4IO1A 3D6JA 4ABTA 3Q8LA 4H3VA 2PKEA 4FX2A 4MVJF 3CRQA 3C8DA 3HXPA 1C8BA 4RKYA 4LF7B 1EK2A 3OTHA 3RFCA 4TKUB 1U2ZA 4H1HA 1BDHA 2GT1A 2Q7XA 2ZYVX 4QYIA 4L57A 4DUPA 1SKAA 1ZMXA 3I1JA 3S8YA 1RXSA 3QVXA 1XVUA 4ZPJA 2P11A 2PMWB 3BCRA 1W94A 4IM7A 3RV3A 4EG7A 3UJPA 1UP7A 4ITRC 1IHYA 3K1YA 4ADSG 1A0OA 1Y8QB 2DHQA 5KINB 1BGWA 3RUPA 3ZDQA 2O9JA 2XVXA 4PBSA 2GN9A 1Q7GA 3NR2A 1Z0DA 3CR3C 1R66A 3O9ZA 4IDGA 4RZHA 3ENQA 3TJZA 4C0SA 3FG9A 5JCZA 1QPBA 5DXJA 2O2CA 1E7MA 3KYIB 4RHEA 3SS7X 2C31A 4KO3S 1OLSB 1TPZA 1Z5OA 3ZQJA 4C0JA 4GG1A 5TGZA 3W0LB 4GLLA 3ZUPA 3C45A 4BZWA 5JV5A 1DI0A 1OBHA 3MBOA 2QPOA 3QG5A 1PX2A 4PQFA 4IIUA 2CDCA 2G83A 3M7IA 2O1SA 1B41A 5MN5A 2WIAA 4DG8A 1S2MA 4GP7A 3CZAA 2PWZA 3X2FA 3I5YA 1J39A 3FTDA 1AHPA 4AT1A 2BSXA 4PN3A 4GD3Q 2JFBA 4UBKA 5A62A 4YMHA 1GVHA 2FZ4A 4U7HA 3SSAA 1YBHA 3I53A 1Z4IA 3NHBA 1CTQA 1QV9A 4QODA 3JZDA 4WDQA 1IOWA 3TL2A 2YFYA 1JIVA 3NT4A 4JV5B 5AKHA 5LYJB 1Z6AA 2HNAA 5EXSA 5AJYA 1T2NA 3DB2A 4J7CA 1TPYA 4UCQA 3NHUA 5AW1A 1GPKA 3L0IB 5JCJA 2O7NA 3TX2A 4BC0A 2WNSA 3BHJA 1SM4A 1WDTA 2O0JA 2R6ZA 2CXNA 3HP1A 1BWQA 4LMRA 2I5PO 4RKQA 4TXLA 3O93A 1HPLA 4FJ1A 4GZ3A 4HAIA 4JXJA 4YAKA 4OJNA 1RP1A 1DQPA 3L49A 2KX7A 3BMOA 3DUFB 2JATA 3LXXA 1VZ2A 2EJBA 4YQFA 3OX1A 5DTJA 3D4LA 3FOCA 1C7FA 1WBDA 1DOZA 4WGFA 4D6PA 4J0CA 4DLVA 1JU9A 2XOEA 1V6AA 2KPOA 1KKMA 4EMUA 1GRNA 1QYRA 1O96B 2C2MA 3RH0A 4ER7A 3TM4A 3OUUA 3ACDA 4G5FA 1I7NA 3CCFA 1UH5A 4MCHA 3UAVA 2A0WA 2OGSA 2XLBA 3F9CA 2IXAA 3U3JA 4B4WA 1WEKA 1T8TA 3IIEA 3DTVB 4EUHA 1AA9A 1ZHOA 2EHJA 3HK2A 2FXVA 1TB4A 4UTZA 4OU5A 3C98A 1IH8A 1L5RA 1W2GA 3RSHA 2BMFA 1T0PA 1Z6TA 4R7ZA 3WRYC 1U9IC 4Z2YA 1QTRA 1TVEA 3IV9A 2GARA 4L6AA 5ADUS 1IXRC 5BSGA 5K01A 5CJJA 2P6MA 3L7NA 4JHXA 4QDUA 3CRZA 3QHQA 5JQGF 5A3JA 4IF6A 2XZTA 4FZJA 2GTPA 5FWDA 3KSAC 1JR3E 2PKXA 1PUXA 2WKPA 1Z6ZA 2JC3A 3B6IA 4HEA6 2NXWA 1CP3A 4MWCA 1X94A 3GRYA 3PQFA 4KTVE 1MLDA 2NWQA 5AHKA 5LWQA 4OHVA 1G8KA 1P9RA 3H1GA 3H5WA 3HU5A 3LXRA 4TL9A 1ZN7A 5DOZA 5BWLA 3L1KA 3HBNA 4UXJA 2CJXA 1WVMA 2VDKB 5HKAA 2C8JA 2WWYA 4V0LA 1GQFA 1ZEMA 3H11B 4AQ7A 3S29A 4U7WA 1HE4A 3CLRD 5BNTA 1OYYA 2D2XA 2C84A