3GEDA

Fingerprint and structural analysis of a apo scor enzyme from clostridium thermocellum
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
245
structure length
242
Chain Sequence
NRGVIVTGGGHGIGKQICLDFLEAGDKVCFIDIDEKRSADFAKERPNLFYFHGDVADPLTLKKFVEYAMEKLQRIDVLVNNACRGSKGILSSLLYEEFDYILSVGLKAPYELSRLCRDELIKNKGRIINIASTRAFQSEPDSEAYASAKGGIVALTHALAMSLGPDVLVNCIAPGWINVTEFTQEDCAAIPAGKVGTPKDISNMVLFLCQQDFITGETIIVDGGMSKRMIYHGDWNWFYKID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Short-chain dehydrogenase/reductase SDR
publication title Sequence fingerprint and structural analysis of the SCOR enzyme A3DFK9 from Clostridium thermocellum.
pubmed doi rcsb
source organism Clostridium thermocellum atcc 27405
molecule tags Oxidoreductase
total genus 84
structure length 242
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gedA00
4GX0A 5F5LA 1I8TA 3BTSA 3E9NA 4YQZA 3C1TA 4TRRA 4EJMA 5I9LA 3VKVA 1GPDG 3QE3A 1RWBA 5H83A 1QLJA 3GEMA 4BGUA 4TRNA 4BKQA 1EVJA 3KSZO 3I9NA 2QYSA 4TROA 3DZJA 3X2FA 4JX8A 1KBZA 4AG3A 3RUHA 1O6ZA 1R16A 4FDAA 1IHYA 3TOXA 3EY4A 1E1NA 1UAYA 2Y66A 2C29D 1KYQA 1OFGA 4BNHA 1F8FA 4RQTA 1PTJA 3NUGA 3M2TA 4XX0A 1GQYA 3F4LA 3E18A 3TZCA 2ZKLA 3OJ0A 2PV7A 4Y6SA 2DTXA 3GVIA 1UP7A 1NAIA 4D41A 5JY1A 1EQ2A 3HN2A 5F1KA 3JQGA 2VZ9A 4DPKA 1QR6A 1TT5A 2X8LA 4J16A 5A9SA 4YJDA 1E6WA 4J2OA 3ZV4A 3F47A 1R15A 3H4VA 1PJTA 3PPIA 2PH3A 3MJ4A 1LRKA 2F00A 2XAAA 2E82A 1GUZA 3E9QA 3HHPA 1Q2XA 4OAQA 4B7XA 5CDGA 2P9EA 3ENNA 1P1KA 2TMGA 1T1SA 2OUIA 4GKBA 5TS3A 3JQ6A 1P31A 1PS0A 2JD0A 4ND1A 5JC8A 2BI7A 1C0KA 3GPDG 4LK3A 2V7PA 4MDHA 2VRCA 5ILGA 5T64A 5TJ9A 3ZNOA 2W98A 4WPGA 3T7CA 3NTRA 4FB5A 5FF9A 1GEGA 2B0JA 2FPGA 2OGUA 3MZ0A 4UREA 5L4SA 1Z82A 4NZ9A 1JDJA 1MGOA 3HUDA 5JS6A 2ZCVA 4PG4A 1EVZA 3NKLA 4LCJA 1GDHA 5JMPA 1GYPA 3U49A 4DLAA 1NXQA 1QLHA 2AE2A 3AY3A 1PWXA 3SC6A 4I5EA 2VHVA 3HN7A 4YAGA 2FR8A 2FR1A 2X0IA 2AE1A 4NHEA 2I3GA 1SOVA 1SCUA 3GAZA 2AG8A 4PGFA 3INTA 2JFFA 4NFHA 4R9SA 4S3MA 2AEFA 2C54A 3K2BA 3R0IA 2NVUB 4BNWA 3KYDA 3GDFA 2DFVA 4CMAA 4GX2A 4A73A 1W0CA 1N9GB 4DTIA 1ZSVA 3H9QA 1JLLA 2ILTA 3C85A 4FN4A 1QMGA 1HYHA 5TGDA 4B4OA 1I3LA 5JE8A 4AJOA 1K3TA 4JP3A 1ZSYA 3HQ4O 5KKAA 1YO6A 1BW9B 1HYGA 2PZMA 3EVNA 4CQLB 3ASVA 1UUFA 2LDXA 2WYWA 1NP3A 4M89A 1PR9A 3PDJA 4EI2A 1N5DA 4KUHA 4RVFA 4RZHA 4BVAA 3WJAA 1LLCA 1KY4A 1ZK1A 1PJ4A 4Y8VA 1MLDA 2AQ8A 3H2SA 3U4DA 3BMOB 3O4RA 3MJTA 3TZ6A 4KP7A 4L4XA 4FJ1A 2OOSA 3QQPA 1PJBA 2HMVA 4ZQHA 4A0SA 3DAGA 4NH4A 2IEDA 2FOIA 4AJKA 4E31A 4UUOA 3JQFC 1YDWA 4RVDA 3LT1A 1AXGA 3W6ZA 3ZWVA 4PFJA 4DMLA 5CFZA 3TN7A 1CERA 3IKTA 2D59A 2C5AA 1E3LA 3N74A 4DIFA 4NJMB 3QLJA 1NQAO 4WCDA 4I8XA 1PQUA 1RKXA 3VPFA 4LCEA 4R3NA 2Q1UA 2EERA 3LLSA 4MP6A 3NT5A 1EUZA 4BNUA 3EUWA 2QQ5A 5AQ1A 1PSDA 1E3WA 1VPDA 1BXKA 2VQ3A 1KY5A 2P9CA 1E5QA 3FWZA 4XQGA 4YB8A 1WW8A 1KEPA 4DYVA 3WBBA 4WASA 1PX0A 1Q0QA 4AJHA 3ZU4A 2C07A 2X23A 4XA8A 3VVBA 1XWFA 1E1MA 2JL1A 1PWZA 2X5OA 3KTDA 2JD2A 4GMGA 4DIOA 5JDIC 4L8VA 4E5KA 4XYBA 2QYTA 1B8UA 3VZPA 4I9UA 4B3JA 3PQEA 2ZYDA 4BO7A 3TL2A 4AJ1A 4OO3A 1FXSA 2GN4A 2JKVA 2ZATA 3K2EA 4M49A 4CV1A 3AM4A 3LT0A 4ALNA 3KSDO 4BO1A 2DLDA 4DXHA 3WICA 2C2XA 1EE2A 1IYZA 4KWHA 5FFFA 1V3VA 1SO8A 2PFGA 3Q0EA 5IAAA 2HMWA 1VC2A 1NHWA 3BXXA 3RD5A 1LBEA 3KETA 3D4PA 4RPKA 5EJ2A 3ZWYA 1DFHA 2VNSA 3GY0A 1N8KA 3GVXA 3C7CB 1IUKA 1YQDA 3IC5A 4WE3A 3ICCA 4DLLA 1K89A 3CKYA 2HKIA 1BVUA 1EVIA 1H0KA 3W8FA 3ZWAA 3H3JA 3EK2A 3OQ1A 4WUVA 1LDBA 3LSYA 3NDIA 1YH3A 4E13A 2FMUA 1GV1A 4DQVA 5JYEA 4CLRB 3GLQA 4NG5A 3WGTA 3ZHXA 1R0KA 4KWIA 1ZMTA 3ENKA 3S1LA 5GMOA 4TVBA 4IDFA 3UCFA 3NRCA 2UUPA 3DWFA 2IE0A 4GVLA 4NFSA 1PJCA 4PRKA 4D45A 2DBRA 1I33A 1U7HA 3I9LA 3S2EA 5KTKA 3JQ8A 1XEAA 3OQ6A 3WQRA 3UICA 2O3QA 1DEHA 1I3MA 1JKIA 1VKNA 1ZK2A 4XQEA 5F1PA 3OFSA 3UFXA 3CXRA 2Y1EA 4XIYA 4B4WA 1WWKA 1WXDA 4IZHA 5G4LA 1E6EA 3U4IA 1BSVA 5B4VA 3JQ7A 4IGFA 4WLVA 5G0UA 1F14A 5KVQA 4CMKA 5KKCA 1XYGA 3KEOA 4A26A 5JAIA 3D5TA 1R37A 3ETGA 4CQMD 3H5NA 1IL0A 4YDRA 3H9JA 3GZNA 4RLSA 3RVDA 4NBVA 1P1FA 3RKRA 4AFNA 2AMFA 3BZUA 4O63O 4ID9A 2FZWA 3LC7O 4MVJH 5T67A 3AUAA 4BV8A 4YJHB 1V9LA 1S7CA 4UVGA 2CDAA 2VOEA 5AXAA 1HE4A 4XGNA 2TMDA 4RJTA 2QRLA 3DFUA 4IDEA 3W4JA 2B4RO 2NACA 2YV3A 3GAFA 2VN8A 3P7MA 4Y9DA 5JDCA 3WGIA 4MIYA 5TC4A 5ILOA 3ONEA 5L9AA 4BO0A 2CY0A 3MWDB 4CJXA 2ZJ0A 2FRDA 3H9EO 4L73A 2Y05A 1B26A 3VVCA 3EVTA 3KV3O 4MOWA 1DB3A 1ZK0A 4Q3AA 3HSKA 3FI9A 1MFZA 4XR4A 3NDRA 1XU7A 4FOSA 2W2LA 2V6BA 3QSGA 3RASA 2AEMA 4J7CA 2ZB8A 1XKQA 4WLOA 3AUSA 1Q7BA 1EFKA 3D3WB 4W6ZA 4XDZA 4CR7A 5EQFA 2ZTVA 4KQXA 4CV2A 1U5CA 4R4JA 1YQGA 2GPTA 1LSOA 4YT8A 3RJ9A 4F46A 5BT9A 4BNYA 4Q3BA 5A9SB 5I9MA 4XR9A 1K5HA 2J5RA 3WDSA 1T1RA 1Z7EA 3D64A 2JCVA 5BNIA 1EBUA 1ZEMA 4U8GA 3SX2A 3UGKA 2P5UA 4S1VA 3VTFA 2PGJA 4CMBA 1N7GA 1NVMB 5A5EA 1W8DA 2EP7A 2BFOA 2PKQP 1NPTO 1P33A 1B2LA 4CM4A 4PLWA 2EGHA 2VYNA 1ISFA 2FHSA 3PJEA 2V6MA 1I2BA 3DMTC 3PEFA 4JBGA 3SLGA 1QG6A 3O26A 1QYXA 3EAGA 5BQFA 1HT0A 1R0LA 3GF4A 4Z0TA 1U7TA 1I5RA 1OI7A 3D0OA 4HWKA 4WCFC 2Z1MA 1EK5A 5TNXA 3G17A 2GZ1A 3IIEA 4HFMA 4PVDA 4QUKA 4MINA 4BIIA 2JHFA 1P1HA 2DFDA 1Z74A 4FC6A 1E1KA 4Q3DA 5L7TA 3KBOA 3HG7A 3OM9A 3ZN2A 4FD3A 4MKRA 3JQDA 3L4BC 4W9NA 4M86A 3G0OA 2D8AA 2GZ2A 5CG2A 1B14A 1LDNA 5B37A 3STHA 4BNLA 3DC2A 2IYOA 2P2SA 3R3JA 1ZCJA 1U3UA 4LRSB 1N92A 3FD8A 3INRA 5KJFA 2E49A 4GBJA 1DLIA 4TZKA 1B7GO 4PLFA 4PG6A 4EUFA 1A9ZA 4GX1A 1J6UA 1ZMOA 3F9IA 3KYDB 3OA2A 3GN1A 1N1EA 5KIAA 3HADA 3GC6A 2E6UX 3PZBA 1F06A 3LU1A 1I32A 2CDBA 1PZHA 4YRAA 1DC3A 2BF7A 1XR3A 5ITVA 1BXZA 1X1TA 4YAIA 1GZ6A 2PGLA 2O7QA 3E48A 1HSZA 4YQYA 4XYMA 2EW2A 4OH1A 4FW8A 4EEXA 4ESOA 1YL6A 3AU8A 4IDGA 4AJJA 3WBFA 1J0XO 4URFA 4XZ3A 4OQZA 1WVGA 1NHGA 1PS8A 1UP6A 4J1QA 4YJGB 1G0OA 1R6DA 2X9NA 1Q0LA 3VH2A 5ER9A 1YOVB 1YE3A 1BXGA 3AOGA 3HZZA 4GWGA 4LRTB 1RM0A 3DZGA 3KYBA 3NTOA 1VM6A 4B8ZA 5DCYA 1VJ0A 3AOEA 5KOIA 1RYEA 1BMDA 1HZJA 4YCAA 1IZ9A 5L4NA 3WNVA 1SEPA 5IZCA 2GZ3A 4YA6A 3Q9NA 4DREA 1UP4A 5FYDA 1ADBA 4PG7A 5DP2A 3ZHYA 5LDHA 3MOIA 1LXCA 3IJRA 4XQ9A 3TDKA 2I76A 4QFCA 4E2XA 3RFTA 4K28A 3DR3A 3DHEA 4PVCA 1N7HA 3GFBA 1E3WB 4B7CA 2PD6A 5T5QA 2HJSA 1RM5A 1BW9A 2WTBA 4G5HA 4XB1A 4CQLA 3CMMA 3TPCA 3DMYA 4MVJD 4CMJA 4ND2A 2Y0CA 1ENYA 5TF4A 4J4HA 2JAPA 2VZ0A 2PZKA 5KJ6A 2R00A 2FSVA 3V2HA 2UUOA 1HSOA 2VYVD 3AFMA 1GPJA 3BMOA 2VZ8A 1IPFA 3JQ9A 3DAFA 3FWNA 1IE3A 2EIHA 2I67A 3FCOA 4LSMA 2VT2A 4GLLA 4RORA 3OA0A 1A4UA 1GU7A 3QVWA 4R1UA 3KVOA 5BNTA 1GUFA 1PEDA 3L6OO 4EUEA 3BTUA 3PWKA 2EHDA 3JD2A 2QX7A 2C0CA 5U4QA 4I1IA 2FR0A 1A71A 1YL5A 4W99A 3U5TA 4FPXA 4NJMA 1UXKA 3PYLA 4IINA 3V2GA 3F1KA 2OMEA 4CL3A 1DC6A 1QXSA 3T7EA 1SAYA 4YR9A 4R1SA 4BGIA 3E9MA 5KJ1A 3GDGA 3K96A 4E2YA 3I9OA 5G0VA 4A03A 3O8QB 4BQRA 2ZJ1A 1A7KA 2A9FA 1R66A 1P44A 4GX5A 2D1YA 4RGBA 4XKJA 3SXPA 1YVEI 3S8MA 2BGMA 1UAGA 1M76A 4QXMA 4BNNA 3L9WA 3R6DA 1EEHA 3EW7A 5GZ6A 1LTHR 1BTOA 1Q0HA 2CNBA 5DN9A 4J7UA 3F3SA 3PFWO 2HUNA 4YJFB 1P3DA 1J49A 3F46A 3GH3A 2YQ4A 3QVXA 3P19A 3ANNA 4ND3A 4D3DA 4YAEA 2B69A 4YT2A 3F5QA 5IDQA 3U09A 1KERA 3H6KA 4U6QA 1VI2A 2PZJA 4DGSA 1K2WA 4BKUA 3VPXA 2PD3A 4GMFA 1BRMA 3GZNB 4PLCA 1LDMA 1Y9EA 2DBZA 2XOXA 3AY7A 3RFXA 3U3XA 2GF2A 3T4XA 4ZQFA 1T4BA 2PH5A 1ORRA 1LSJA 2C82A 3H9GA 1BWSA 4ZJUA 5EL0A 4E3ZA 1CIVA 4YT4A 1MXFA 5C37A 3KRTA 1PQPA 4HKTA 3U4CA 4CMEA 4CL8A 1HE3A 2YW9A 2E4AA 3FN4A 3BMCA 1XU9A 1NQOA 3CUKA 1NASA 2NV6A 3IP3A 3RQSA 1P1RA 2IZZA 1SNYA 2O50A 4UEJA 5KCZA 2Y1OA 4INAA 3WMXA 4QT0A 3NAQA 2XXJA 1CF2O 3N7UA 3RBZA 3BYZA 4MJLA 1PGJA 1LSUA 2HRBA 3WGYA 4CLOA 3HWRA 3AI3A 2B4QA 1P1JA 1DAPA 4DC0A 4BO8A 4UAGA 1LI4A 5KJCA 4E2ZA 4YVFA 4E5YA 3OHSX 3RCBA 2A4KA 5BSFA 4CV3A 4OSPA 2BMAA 4NU6A 1OC4A 1PR3A 3Q3CA 5JNLA 1BHSA 4D3SA 1X0VA 1X1EA 4NMHA 3ZHZA 2Y68A 1MFPA 4JK3A 5HS6A 1TVEA 4OQYA 1TT7A 2R2GA 3DBRB 3FR7A 1M66A 4EUHA 3LC2O 1NX6A 1AUPA 3FTPA 3D1LA 5CDTA 2W8ZA 3G79A 4NIMA 3DBHA 3B1FA 4B8WA 4CM4B 1L1FA 4QQRA 1U4SA 1MA0A 2EJWA 2CVOA 1EBFA 2WSBA 3PJDA 5K6AC 5IXYA 4MP3A 3DOJA 4BKOA 3DQPA 1JW9B 4RPHA 5EINA 3PTZA 5THKA 1HEUA 1P45A 1KOLA 1YS4A 3MEQA 4RQUA 4CM5A 1LQTA 3F6YA 2OL4A 3TQHA 3TNLA 3G1UA 4BO6A 4TRMA 5A02A 4UUMA 2EV9A 5TRTA 3U62A 5TIIA 3GFGA 1S6YA 3D3WA 3ZWBA 1IB6A 2ZQYA 2JFHA 4MP8A 3VTZA 3NT4A 1AE1A 3PYMA 5U1PA 5C5IA 3PFFA 1B8VA 3PZRA 1DBVO 2EG9A 3CE6A 4JBHA 2C7VA 4FS3A 2D0IA 1SOWA 3BMNA 3AY6A 3O38A 5T8KA 3U9LA 1QV7A 4MVJE 1GQQA 3V8BA 4XYGA 1G1AA 3UCEA 4HADA 3WGHA 2CF6A 5ITWA 4R54A 1D1SA 4II2A 3VH4A 1ISMA 3TZQA 2RBEA 3QWHA 1PS9A 4J0EA 4IDBA 1I30A 2IZ0A 1E1LA 2PKRA 3OEYA 1T2CA 3ONFA 2B5VA 1DHRA 1QKIA 3HFSA 1KVUA 4HFNA 1FF9A 3U4HA 1P77A 4EDFA 3OJEA 4MKZA 3M2PA 5JAMA 3EMKA 4H3VA 4YRDA 1ONPA 4AJ2A 5AXBA 3MCVA 3I83A 1ZZEA 1ZJYA 2Y1FA 4HNGA 3HDJA 4A2CA 1H6DA 2HRZA 2FPPA 1WZEA 1UZNA 1XQ6A 5EMHA 4BS9A 1SEVA 4OHUA 2UVDA 4OGWA 3VHRA 2W2KA 3WTCA 4BMSA 1H2HA 2VCYA 4U0KA 2WWRA 1EVYA 2EJVA 2VHWA 1CQJA 4WEQA 4XB2A 1KS9A 5A04A 5CAEA 4QECA 1BXGB 4J43A 2AG5A 1NVGA 3WFIA 4ALLA 5AYVA 1WDKA 1ZBQA 2J5KA 1DO8A 2FSSA 2ZTMA 4XYEA 3CIFA 2A94A 2V6FA 2NQTA 4B3IA 3SJUA 5A4DA 5B4UA 2DBQA 1JVSA 4IQ8A 4UULA 2G76A 2JHGA 1SB8A 2HQ1A 1NWCA 1DXYA 1VLLA 1LRLA 2HK9A 4I08A 1IHXA 4AL4A 1WMBA 2B83A 5J23A 2DTEA 1JN0A 2BLLA 2Q45A 4JIGA 1HDZA 4Z0HO 1CQIA 4BOYA 4R51A 1LUAA 2Y0DA 3KSUA 5JO0A 1YB1A 1ZNQO 2Q46A 1VJTA 5JXWA 3RBXA 2GLXA 2P9GA 4E2WA 3HB4X 4MVJP 4CLDA 4IM7A 2GERA 4YT5A 5F3RA 1T2EA 4L0QA 3JQAD 2Z5LA 1QYDA 1ADGA 4YJGA 3UUWA 1Z73A 4KZPA 4UVDA 1YOVA 3UF0A 1PGQA 4BO9A 1GQ2A 1E77A 3F5SA 4I9HA 4IIUA 2NTJA 4P4GA 3RJ5A 3LT4A 5A06A 2YV1A 3ZW8A 3PLNA 4F45A 1VL0A 4FFMA 2O7SA 1E7QA 2X5KO 2ZB3A 4KTVE 4HFRA 1ID1A 8LDHA 4RVSA 3WLEA 4N18A 3DHYA 1U3VA 4R5MA 5C7OO 2GRAA 3CZMA 2BGLA 1C0LA 2X4GA 3K31A 4GPD1 3ONDA 1NR7A 1L7DA 5LC1A 4PLTA 3UH1A 3OIDA 5IDXA 3NT2A 1HZZA 4OYRA 1I36A 1E7WA 1UDAA 3PGJA 3PYXA 2CD9A 2PKQO 4JBIA 4ALMA 5IJZA 4GWKA 1NVTA 1C14A 1YRLA 2GN6A 4BO4A 2NUAA 4RL6A 2O2SA 4E12A 1YJ8A 5JC1A 4O0LA 2J5QA 3TOZA 3GHYA 2H6EA 5JY6A 1M2WA 3PWSA 2EW8A 2PD4A 3PWZA 2GR9A 4F3YA 5F5NA 1HLDA 4CM9D 4DYDA 3DZFA 5AVOA 3I9MA 3B20A 5COQA 1JQBA 3QW2A 4JNKA 4PLVA 5TT0A 1D4FA 5ENVA 5B1YA 3JD3A 1UR5A 2QHXA 5JAQA 3WOHA 6ADHA 5EQDA 2IEBA 1V8BA 2Q3EA 3JQBA 3PP8A 5T6BA 5ICSA 1E0DA 1KC1A 4R5HA 4KOAA 4ALIA 3PLRA 2ZYGA 2GSDA 1PJSA 1UJMA 4RPJA 1ENOA 3O03A 3PRJA 1QP8A 3ZZNA 3S2GA 1PJLA 1YB4A 2P4HX 1SBYA 5JAZA 3OEWA 3DAPA 4I5GA 3BHIA 5TSDA 2X5JO 1C0PA 2YYYA 3ZU5A 1B8PA 1JU9A 3LC1O 4HY3A 4QO7A 5DULA 2O4UX 3BMCB 3WTBA 4LN1A 2BELA 1EDOA 1HDYA 3O8QA 3QWFA 5KJEA 2I9PA 4JXKA 2X7HA 3ETDA 3VZQA 3DHNA 1LQUA 1HYEA 4WLNA 4E4YA 3JYLA 2CMDA 2D4AA 4L75A 2I3AA 1J5PA 4A27A 4A10A 5DCUA 1MX3A 1O5IA 5F1OA 2FPIA 1NPDA 4IGEA 3WLFA 4CLOB 1E3EA 2H5LA 4Y6PA 1UXHA 4YJFA 4GGOA 2O48X 4Z9FA 2JAHA 4PLZA 2I5PO 3D4NA 1D1TA 3FNHA 2WD8A 4GKVA 4CR6A 1U2DA 4BKRA 2JFGA 4Z9YA 1H5QA 2X0RA 4IIVA 1JAXA 1P74A 5K0ZA 5DF1A 3FRJA 5IF3A 5IN5A 3MTJA 2RIRA 3ZNPA 4TRJA 4L4RA 4BNFA 2O2YA 3LVFO 4FFPA 5DBIA 1H6CA 2CVZA 1M6WA 3IOYA 1SPXA 1UDBA 2W2LD 4WOKA 4ZQEA 4XCVA 1M67A 1AHHA 3VPSA 4OXKA 4YWJA 4JJGA 3QVSA 4NPCA 3PHJA 4O59O 1ZXBA 3K5PA 3DBHB 2V65A 1I24A 3R1IA 3VDRA 2UAGA 3TRIA 1NFRA 4CM3A 3QP9A 4WECA 1B0AA 2DU8A 3A1NA 2NWQA 1BVRA 1I2ZA 3QJ5A 4PRLA 3RU9A 1A72A 4J1SA 1QYVA 1P1IA 2VTDA 3SC4A 1I10A 3TWOA 3BAZA 3NGLA 4WLFA 3LT2A 3KZVA 3PQDA 1CEQA 1TA4A 3L6EA 2JJYA 3I3OA 4BO5A 4DVJA 3SVTA 1ZK4A 5C7IO 1DRWA 1GY8A 1T25A 1DAOA 3AJRA 1LX6A 3BTOA 3OICA 4YXFA 3COSA 1N2SA 2VYND 1C1DB 4UUNA 2POQX 2EKLA 4TSKA 1CJCA 3NX4A 2FP4A 4OKNA 1GCUA 4PG5A 3VZRA 1EUDA 4CQMA 1Z7BA 1NBOA 5EN4A 4AJLA 1JKFA 2EXXA 3BMNB 3BHJA 4ALJA 5JYDA 1U5AA 3KYCB 3RUDA 2OXIA 2A35A 4AVYA 3JV7A 3HJAA 3DBRA 4J3FA 4L76A 1ULUA 2V6GA 1X7GA 3FNFA 2PA3A 2ZIZA 3GZ4A 3UCXA 1WP4A 2B36A 2HCTA 3NTQA 4CM1A 5ADHA 4E33A 3ZV5A 5GZ1A 4RDIA 1GV0A 1PL6A 1YBAA 1HETA 3LK7A 3C1OA 5G0TA 2YHIA 1GUYA 4OIMA 4Z9XA 4UVHA 1ISHA 3VH3A 4FQ8A 7MDHA 5DBFA 3HNPA 5JDCC 2DM6A 1EQUA 4C7KA 4R3WA 3HDQA 5DT9A 3TF5A 1LRJA 2ZK7A 2X9GA 5KVVA 1MB4A 3ZV3A 3ZW9A 4D0RA 1LC0A 1WZIA 1Z6ZA 4J0FA 1ONNA 4N54A 4RDHA 3I9KA 1GR0A 3C7DB 2I6TA 5AXDA 1MV8A 5CHEA 4A7PA 4NBUA 2QRJA 2W2KB 1DC5A 2PY6A 1PGOA 4RPGA 4FGWA 1KC3A 1XGKA 3CEAA 3E6AA 5AOVA 1NNUA 1H2BA 1FDTA 1WNTA 1GD1O 3V1UA 2P5YA 5A1TA 3JD1A 1Z45A 2JCYA 3WSVA 1U2GA 3GMSA 3KEQA 3PJGA 3UAGA 2PNFA 4LMPA 3RUAA 3RI3A 4HFJA 3NJ4A 4IS2A 4XGIA 3ZNQA 4E21A 4FFRA 2XXBA 3FTNA 4EITA 1V3TA 4WK6A 5IN4A 2VOJA 3H8VA 4ILKA 1E5LA 4BO2A 3MJVA 4ZQGA 2PWZA 4XJSA 4PZDA 1EK6A 3GR6A 4N5LA 2I65A 2I66A 4FCCA 1QYCA 2C5EA 1H9BA 4AJEA 2ET6A 3QIVA 4JGBA 4N7RA 1U4OA 2O4CA 1GAEO 3OETA 2VHXA 2Y0EA 2VRBA 3P2OA 1X15A 3OF2A 5FEUA 2PTGA 3QHAA 4HBGA 5H82A 2HDHA 3GA0A 4NNJA 4RVUA 1LEHA 2WMDA 1HDCA 3C3XA 1NQ5A 4DQUA 5BSGA 2WJPA 1TEHA 1RYDA 2D3TA 4Z3DA 4Q9NA 3WYCA 4NI5A 4A5OA 4D42A 4Z0PA 3BTVA 3GGOA 4E6PA 1K6IA 1V0JA 4QFDA 1NYTA 3DBVO 1NWHA 1T2FA 1U8XX 4W9NC 1FK8A 4E30A 1ULSA 4E5MA 5KVSA 2YDYA 3HE3A 4IMRA 3DTTA 2C59A 1GL3A 2HSDA 3WNQA 2YUTA 4GVXA 4RO0A 3IMFA 4H15A 4W7HA 3KOUA 1Y9AA 3WFJA 3ADOA 3QWAA 1ZW1A 2Y67A 4JJFA 1B15A 2DC1A 1UXGA 2WE7A 4EZBA 1XCBA 1PGNA 4RF2A 4ZQBA 2W4QA 5DBGA 1U9JA 5CDSA 1KEVA 3ZHBA 4CM6A 2OZPA 4J4BA 4LVCA 3RUFA 3AU9A 5HS4A 3GMDA 5L53A 1UZMA 3PHHA 3ROQA 1ZXLA 1LSSA 1HLPA 1R12A 2Q99A 4KUEA 2X6TA 2SCUA 1LNQA 3DO5A 4P38A 3ROPA 2VHYA 5ES3A 5TLSA 4D46A 1JA9A 2VUTA 4FC7A 3AI2A 3DL2A 3LZ6A 4PIVA 4BNKA 1ZFNA 3GNTA 1R4NB 4R1NA 5F21A 4WGGA 4P4NA 4EYEA 4TKLA 2CF5A 3CPSA 4IJUA 1JKJA 4MO2A 4NU5A 3VAZA 3OH8A 5L7YA 2IYPA 3HDHA 4DUPA 3K30A 3SJ7A 3TFQA 4ZA2A 2GASA 1A4IA 4OJNA 1R4MA 3JQEA 1QV6A 4BHTA 2IXAA 5L95A 3AOEC 3RIHA 1JVBA 3ZU2A 2G1UA 1OAAA 1GZ4A 4CLHA 4PN3A 2YQ5A 3FHLA 4ZRNA 4D44A 3ASUA 5IZCC 3WJ7A 2NVBA 4XQCA 3KLMX 4XEHA 1M75A 4AJIA 4YAKA 4QX6A 4WJZA 4DIBA 1LC3A 3W4IA 2VNAA 2X22A 1GCOA 1A27A 1VJ1A 4W7IA 3KUXA 4J6FA 3VPGA 5JBIA 2Z95A 4BB5A 1LDYA 1E7MA 3UW3A 4UEKA 4MVJA 3DEYX 5L51A 1DRVA 4NQZA 2WM3A 5G0WA 1BGVA 2DPHA 3L77A 3ZWXA 4NDNE 1G0NA 2EWMA 3KO8A 4EJ0A 1RJWA 2NLOA 3EHEA 1KVSA 5B12A 1KIFA 2VWGA 2AHRA 3AM3A 4GI2A 2R00C 1HL3A 2Q2QA 4IJKA 1E7RA 1K0UA 3NDJA 4N5MA 5H81A 3UXYA 3JD4A 1HKUA 3G1TA 3K92A 3IJPA 3S2IA 1LDEA 1YBVA 3LDHA 3JQ9C 2O3RA 3FR8A 4CMIA 2QIOA 3WMWA 3INGA 3MJSA 1DDOA 1C0IA 2BI8A 2YFHA 4BNMA 1PZEA 4M54A 1XHLA 3W8DA 2NU9A 3M1LA 4E5NA 4BO3A 2NTNA 3RC1A 2GYYA 1QSGA 2J8ZA 1UDCA 4U6SA 4NK4A 1YGYA 1Z75A 4CMCA 1UH5A 4JROA 1DHTA 3WGQA 4PCVA 1QYWA 1PIWA 2BGKA 2OFPA 3C24A 3KB6A 4AJNA 4FR5A 3V5NA 4CPDA 4GAEA 1V35A 3GK3A 8ADHA 3A28A 1E92A 2O3UA 5I7VA 1R0SA 1DFIA 9LDBA 2PGDA 1QRRA 5JCJD 1DLJA 1BDBA 1LA2A 4JQCA 3H5AA 1GTMA 3GVPA 4R1TA 1X7DA 4PG8A 5DOZA 1ZVMA 2Q1WA 4XRRA 1VL8A 3PXXA 5JO9A 2AQIA 4X54A 2PLAA 1EZ4A 3ZWCA 4CQMB 1FMCA 1DFGA 4UUPA 3HFGA 5TX7A 1PL7A 3ZI0A 1U3TA 4DQXA 5EERA 1YJQA 2HMUA 4IXTA 1VSUA 3JYQA 5K9ZA 2Y1GA 1CYDA 1XLTA 3GGGA 2HJRA 1TLTA 4K6CA 1RM3A 2OHXA 4OOFA 1XA0A 4BMNA 4J7XA 4XDYA 3CMCO 2D5AA 4DLBA 3UKOA 3RC7A 5A3VA 4MVJF 2YHIB 4QTZA 1J4AA 3KXDA 4RVHA 1EE9A 2OO5A 3DFZA 2XF8A 1ISGA 4WKGA 3VH1A 1ISJA 4KUGA 1O94A 4D79A 5HTOA 3E5MA 1HXHA 3I5MA 4MVJM 1AHIA 1Y8RA 2HO5A 3OIGA 4AJPA 1DOHA 5GZ3A 2AXQA 3ITKA 1WDLA 1X14A 1ZH8A 5EPOA 4I9NA 2JD1A 4DA9A 1OOEA 1SZJG 2X58A 4FFOA 4TKMA 5I7SA 1C1DA 2X86A 3O9ZA 5DDIP 2ZTUA 4LMRA 4M1QA 1DIHA 2VRCD 5T57A 2P68A 4L74A 2GDZA 3AUTA 4YPOA 2BD0A 3KYCA 4E32A 4OMUA 2FY8A 2GCGA 4TWRA 1JWBB 1FDWA 1I2CA 1M6HA 4Y67A 3VC7A 1A9YA 2X0NA 4IJWA 2DKNA 4J1TA 4EGFA 2CDCA 2BFMA 1PJ2A 5DNAA 1HWYA 1XG5A 5JFOA 1EDZA 3W8EA 1I01A 3ZWMA 3I6QA 2BRUA 4BGVA 3RUEA 3AW9A 3B1KA 3G3EA 1V6AA 2J3KA 3TZKA 2EGGA 4GH5A 2WE8A 3PQFA 4OOEA 2YJZA 2UYYA 3WIEA 3DZIA 3RKUA 4G2NA 4RCVA 3RFVA 3WWZA 4XD2A 4OSOA 4CUJA 4XYLA 2VT3A 1NPYA 5MGBA 4DC1A 7ADHA 5A03A 4BMVA 4ONEA 5HWSA 4GSLA 5JCXA 1ZEJA 2Q4BA 3ZV6A 1CRWG 1E6UA 4CR8A 4DWVA 3ETEA 3ST7A 5LDGA 3TL3A 4ZRMA 4BNGA 4YRBA 2WDZA 2DVMA 1Y1PA 2Y1CA 3Q2IA 3SBOA 2YHUA 4ZVVA 3HB5X 2G82A 3LQFA 1OBFO 2DAPA 3D3EA 3Q11A 1MP0A 3PHIA 3LF2A 2VTEA 1Q7GA 4P4LA 1ISIA 5AXCA 1U8FO 2C7GA 3AK4A 3GG9A 3DZKA 4FJ2A 2Y99A 3ITDA 4ITUA 4RV9A 5T8KC 2VHZA 3ZCXA 3RAJA 1B16A 4PLYA 2J3HA 3GN2A 1HDOA 4U5QA 3K9QO 5FI3A 4DBZA 5A9RA 1B3RA 3VZSA 1JWAB 3TJRA 2HU2A 3PVZA 3V1TC 3JQFA 1DIRA 3OJOA 2J3IA 4J91A 5LCXA 2OORA 4F6CA 3P2YA 3OSUA 5IG2A 2YDXA 4DPMA 4Z3KA 4Y98A 2J3JA 4PLHA 5HBRA 4ZGWA 2O3JA 4BNIA 3RU7A 3BIOA 3RUCA 2H1SA 5B4TA 1MC4A 1PZGA 3GGPA 4Y6RA 2RH4A 2X0JA 1SMKA 3P5SA 3R3SA 4QO8A 3EZLA 1D3AA 3FSRA 3IS3A 4MIEA 1P9LA 4GSKA 2P91A 3W1VA 4HV4A 5CDYA 3T4EA 5CG1A 2NSDA 4IUYA 3VOSA 4D3FA 5FWNA 3ZWPA 3F1LA 3WYEA 2NQ8A 4FSHA 4BB6A 4JCOA 2VWPA 3JQCA 2RH8A 4R68A 4UEOA 3GUYA 2GN9A 5JDIA 2IDZA 4R9RA 1IPEA 1GYQA 3BMQA 1R4MB 2LDBA 4FFLA 2NM0A 1EMDA 3IKVA 1GZ3A 2HMSA 3JYPA 5C3MA 4C7JA 2ZTLA 1FJHA 1H6AA 4C4OA 1ZUD1 4ZICA 1IOLA 5L45A 1WDMA 3EZYA 1N1GA 1PL8A 3A14A 3DZHA 2AQKA 2IODA 3Q1LA 2DPGA 2WD7A 5CEJA 1LLUA 5I7EA 2IRWA 4IPTA 4YAJA 3DOCA 1C3VA 1I0ZA 1C1XA 1Y8QB 2QW8A 4LW8A 1NM5A 4UVEA 1TXGA 1WMAA 1T2AA 1QORA 1YXMA 1LJ8A 3JQAA 3OIFA 4HXYA 4CV0A 1GADO 4B4UA 3OMLA 4Q39A 4OM8A 4BNTA 4FIZA 2GNAA 1R4NA 1Y6JA 2NU7A 3PK0A 1ZJZA 4RLHA 3S55A 3WIDA 3A9WA 4OKIA 4U0JA 1EUCA 2O23A 4RZIA 5A5FA 3CTMA 1O0SA 4YBZA 1PJ3A 4CMIB 3B1JA 3QRWA 3K8ZA 5JSFA 1T4DA 2FWMX 4OXNA 5CP8A 3PHLA 3PI7A 3OJFA 1PQWA 1X7HA 1K6JA 3H2ZA 5IFLA 4FFNA 1E3JA 3FNEA 1YB5A 5A05A 3JSAA 4JN6B 3AM5A 3H7AA 2GGSA 3ZU3A 5KVCA 1Y5RA 2CSUA 2OP1A 3I52A 4I5FA 2Q2VA 3VPHA 1HDRA 3DZBA 5L40A 1W6UA 3EYWA 2CZCA 3V2UA 3FNGA 2HAEA 4PLPA 4NBTA 2AEJA 4YTEA 3A06A 4CM8B 3I6IA 4EBFA 4J49A 4E0BA 1ADCA 4CM9A 3X2EA 3I9JA 3V1YA 2X9VA 3H5RA 4LISA 2HK7A 4BKPA 4NK5A 1T24A 4EJ6A 4Z6KA 3DBLA 3HDYA 2CFCA 1ENPA 2DT5A 4HNHA 5EESA 4KDFA 4BV9A 3QV1A 4NR0A 3VKUA 3ZWWA 3CSDA 2EKQA 4WNIA 5JLAA 2HK8A 4WLUA 3AUUA 3AI1A 3JQBC 2JCXA 3GEDA 3LF1A 4O1MA 1A7AA 1BG6A 3ZNNA 3KLPX 3WGZA 5G0SA 3MJCA 1JAYA 4MVJI 4G81A 4NBWA 3LLVA 2GD1O 3KHUA 1MXHA 4IJVA 3UVEA 1GYRA 2WYUA 2WEKA 1LLQA 1IULA 1PGPA 1XELA 1CWUA 3DXFA 5A9TA 1B3BA 4BQPA 2Z1NA 3NEPX 1KETA 3LYLA 4TQGA 3ORFA 1KEWA 6LDHA 1RM4A 4R41A 1H6BA 1Y8RB 4IQGA 1DC4A 1H93A 4MKXA 4XGKA 1I3NA 1E7YA 3DMTA 2VWHA 3PGXA 5DCWA 2B37A 3SEFA 5THQA 3BHMA 2AA3A 3TSCA 2RAFA 5G4KA 4ZD6A 3FPLA 1U28A 3PHGA 3I4CA 4WCFA 4K26A 1UXIA 5JW6A 1LLDA 3MJEA 1ZK3A 1D7OA 4IMPA 3DONA 5CDUA 3DDNA 4OXYA 4OL9A 2B35A 2E37A 3RC2A 4FJ0A 3I23A 1ZKMA 4ND4A 2GN8A 5DZSA 3ULKA 2A92A 4LSWA 3B6ZA 3NGXA 4AICA 4B7UA 3QA9A 3IP1A 3WGGA 5TJHA 3MWEB 3L4BA 4GQAA 4D43A 3TZHA 3ZWOA 3N58A 4II3A 5CEEA 2BH9A 3WGOA 4PLGA 4H7PA 2DTDA 3JQGB 4TVOA 9LDTA 1TT5B 1YONA 3Q6IA 3RC9A 3IUPA 4YYZA 4KQWA 3MOGA 2H9IA 2W90A 3EDMA 4RPLA 4ND5A 2ZYAA 3H65A 4MVJG 3GUCA 2HMTA 2BFPA 2EEZA 4P22A 2YZ7A 1F0YA 1YWGO 1Q7CA 1DRUA 2C20A 3PIDA 3QWBA 4KDEA 4LGVA 5GY7A 1SB9A 1A5ZA 3MTGA 2VUUA 4Q3CA 5HM8A 5U9CA 1OMOA 5FI5A 3RWBA 1TB4A 2FN7A 2G5CA 1HF3A 1ZIDA 3M1AA 2NADA 2Y93A 4R69A 1E7SA 1NTOA 2QRKA 3L0DA 1GFSA 4R01A 4Q3NA 1VRWA 1HE5A 1F8GA 1VSVA 1YKFA 5EIOA 4WNCA 3D4OA 4FBGA 2H63A 2IZ1A 4XWYA 4GL4A 1HTBA 3GHHA 1P0FA 4HX5A 5JMWA 2B5WA 3ZDFA 4IBOA 2Q1SA 2Q49A 3H3FA 4HP8A 2GO1A 3M6IA 4F6LA 2P4QA 3FF4A 4J4TA 1DPGA 4CUZA 2D5CA 3QY9A 3RROA 1RPNA 1XDWA 1Y81A 4J90A 4QSMA 3A4VA 3JYNA 4NFYA 3WS7A 4BGEA 4DRYA 4CMHA 4CLEA 1WLYA 1BDMA 2CUKA 4YEDA 4ALKA 1SC6A 1KVQA 1V3UA 5TQVA 5BNFA 4IDDA 1NAHA 1DIAA 2DUUA 4RF3A 3WXBA 4CODB 3H9UA 3PJFA 5CPFA 3E1KA 4YACA 1XQ1A 1K6XA 1Y5MA 5ENDA 5HRUA 4IXWA 1O9BA 4QEDA 5BR7A 4J9UE 3ROMA 2R6JA 3GT0A 4IS3A 3AWDA 5L3ZA 4PZCA 4WOJA 2O3TA 3RUIA 4E5PA 5MDHA 4K1LA 2UDPA 4EEZA 4D7AA 3IQDB 1IY8A 4J2HA 4NJOA 3OECA 3GOHA 5COBA 2Q2WA 3BMQB 2NNLD 3DOOA 5I9NA 3JCZA 4W4TA 3FBGA 3GPIA 3WYBA 3OBBA 1WPQA 2NU8A 4BNXA 1MUUA 5G2OA 1AGNA 1KVRA 3WB9A 4BUCA 5KWEA 1HDXA 2ZCUA 2F1KA 1MG0A 1ADFA 1PZFA 3L9XA 3WWYA 2B4TO 3OJLA 3GG2A 3I4FA 1DJQA 3GEGA 5L7WA 2WD7B 3D5QA 1T26A 2NVWA 1KVTA 2PK3A 3C7AA 2DUWA 1X13A 2NVUA 2OP0A 4FOOA 1C1XB 5IXSA 3E5RA 1N9GA 1VKOA 3JQAB 3E8XA 3DB2A 3G49A 3OP4A 2EP5A 4H16A 4K6FA 4M8SA 4B3HA 4UVIA 2YFQA 2DQ4A 1O89A 1FDUA 4J9VA 4NBRA 3WSWA 1Q1NA 2AQHA 4JLWA 4BNJA 3PDUA 5BSHA 5KNLA 3IL2A 1I3KA 2EF1A 3C1AA 5CPBA 2C2YA 4XJTA 1AXEA 4MIOA 3UHAA 1UXJA 1DIGA 2PZLA 3NV9A 3C8MA 2VWQA 1YQXA 3L6DA 3E82A 4GLOA 4Q3EA 1NFQA 4DL9A 1PJQA 4G65A 5I7FA 3OQBA 1DJNA 2YY7A 3CH6A 1HE2A 1NFFA 3W6UA 4RF5A 1OZAA 1GEEA 3F4BA 1HRDA 3ZGYA 1U3WA 2DBVO 1YBMA 4N5NA 2UV8A 1PU2A 1XSEA 3WQQA 1TI7A 4RVGA 3U0BA 4XIJA 1E3IA 1FDVA 1H9AA 2BKAA 2FZEA 3GDOA 5IDWA 1W4ZA 3IDSA 1H94A 4BL5A 5IDYA 1VE9A 1L7EA 3Q9UA 1MG5A 2D2IA 3UOGA 5C7LO 3GQVA 3GVHA 2OBNA 5COAA 1HDGO 1ENZA 4WEOA 1Y8QA 3RSHA 4D0SA 3AFNA 1ARZA 3IAHA 1IZ0A 2NTVA 3L07A 3IUSA 4TMFA 3GRPA 1NQTA 3ADPA 4J1NA 1E3SA 2VYVA 4WLEA 2Q1TA 1DIBA 1MC5A 4IDAA 3CZRA 1ZO8A 3K6JA 1LU9A 5DP1A 3RBVA 1CETA 2VUSA 3DBLB 3FBTA 3ICPA 4JP2A 4IDCA 3QVOA 5IZ4A 1T2DA 5I8ZA 4IZIA 2RHCA 3L4SO 4B79A 1JTVA 2AW5A 2Q4EA 1ZSNA 5TT1A 3S2FA 2YV2A 3JQ8B 5HA5A 1WAMA 2Y1DA 3ZWNA 1U1IA 1YDEA 4AJ4A 1ML3A 4MPDA 4KMSA 2I99A 3EC7A 2ZB7A 3FPCA 4I5DA 3UN1A 2HLPA 3Q2KA 3W4KA 3EGOA 3DTYA 2GUGA 3GRKA 1KEUA 3JQ7B 3WR5A 4U7WA 1F12A 4PZEA 2IXBA 2XPCA 1F17A 3PIIA 4M87A 4CM7A 2RCYA 1G6KA 3WX0A 1OC2A 4HUJA 2PR2A 1CDOA 4O5OA 4XRGA 2X1HA 3GNSA 4CUKA 1YL7A 2CVQA 5I8WA 5JPIA 1O8CA 2QZZA 3NJ8A 4M55A 5ER6A 4CM8A 4DMMA 3E03A 5ICMA 4GGPA 3JD0A 2O3SA 4L4SA 1Y7TA 4BNVA 4ROSA 1XIVA 5K6AA 2G17A 3QVTA 3ANLA 5G4KB 2QZ9A 4CLRA 1EFLA 1FDSA 4LVUA 2ZQZA 4CMGA 4TZTA 2G0TA 2EKPA 2ZB4A 4WCFB 4P8RA 4W82A 1DSSG 3NYWA 1O95A 5A3JA 5CEFA 3ABIA 5DOVA 2Q50A 1VL6A 1LDGA 4FGSA 3ANMA 3BA1A 1W73A 3WG9A 3JTMA 3TFOA 1D8AA 2WYVA 3GNQA 4RF4A 4R16A 4IQ0A 4B4VA 5L4LA 3I1JA 3ON5A 1AN9A 3SLKA 3JYOA 2J6IA 2RHRA 3GVCA 3CINA 4O6VA 4ZHSA 3B70A 2BFAA 3D7LA 4CMEC 4JJIA 1NR1A 3QWIA 4L9RA 2NU6A 3WQSB 4CLXA 2OBYA 3KM0A 3ROKA 1P0CA 4DPLA 3K73O 4ZU3A 5BSEA 2BHLA 4IY1A 3VDQA 4BNZA 4ZN6A 4K9DA 4DBVO 4EW6A 2E48A 1ONOA 1UZLA 4KTTE 4YJHA 1X0XA 2QG4A 5JCJA 3ZH2A
chains in the Genus database with same CATH superfamily
4GX0A 5F5LA 2AC2A 1I8TA 3WL6A 4D9BA 4DLZA 4QJ3A 5K20A 4DLNA 1W5FA 3RC8A 4P3PA 5I9LA 5JZMA 3IBYA 1QX3A 1NXWA 1RWBA 2O05A 1RP7A 1Y63A 2APJA 3IUEA 3JR3A 3KZKA 4MMXB 1YZ3A 4URHA 4BGUA 3IOEA 4PN7A 4BWFB 5BP7A 2QYSA 4L5CA 4LSZA 3RS0A 3IYLW 3V8QA 5ICFA 4BFSA 1FCJA 5AW3A 3JVIA 3RUHA 3B51X 4FDAA 4ON9A 4EYOA 1E1NA 1UAYA 2NYAA 2Y66A 4PAMA 4C7BA 3VYUB 1CUCA 1F8FA 3ZY3A 1JPNA 3RK0A 3ZWQA 3LO5A 3HBNA 3QEJA 2OKGA 2IY9A 1I7NA 5P21A 2FE4A 3NUGA 3LDUA 3JALA 3EBLA 2PN1A 4KYTA 5DHAA 3RS9A 3SR3A 4XPIA 4ZCTA 2I9KA 3OJ0A 1TO2E 1HNXB 1M34B 3GVIA 3NH6A 1DTEA 5JD4A 3FIJA 1O7JA 2Q3MA 1NAIA 3LHKA 4JFRA 3N87A 3ZIAA 1EQ2A 3PGVA 2Y71A 1GNVA 4R9NA 5F1KA 1AUVA 1TT5A 2G77B 1E6WA 5IC6A 3HVRA 4GPEA 4X45A 3ZV4A 3EZ6A 2FQ1A 1ANKA 4EABA 3HYCA 4BDSA 2VAMA 1QU2A 5KQGA 1VYUA 1L4LA 2E82A 2F00A 1O94C 2XAAA 3E9QA 3HH8A 3M9LA 3OOJA 4OAQA 5DBOA 2GHQA 1T8TA 2RKOA 5DT2A 4B7XA 4KN5A 4RWEA 3RS2A 2ODBA 4B09A 2R44A 3QLUA 5MFZA 4G2TA 4GM0A 5DASA 1MAWA 4R40A 4C7XA 2OZLA 4GKBA 5JNWA 2LIPA 1P31A 2JD0A 2XUOA 4AMGA 2GJ9A 1C3OB 4J07A 1C0KA 1QHGA 1Z6YA 2V7PA 2JIZA 4XE5A 4DNPA 1MVNA 5ILGA 5T64A 2WRZA 4AWXA 2AI3A 2H4XA 1II8B 3U61B 4N47A 4PIMA 5J4HA 2GYUA 2AC7A 4RK1A 3F78A 5FF9A 3DGEC 1RYNA 2FPGA 4Y7CA 3MZ0A 4PXSA 4M21A 5BNWA 4YDSA 1PUIA 2Q5HA 2ZCVA 2PBLA 1RWNA 5JS6A 2PUCA 4LCJA 2GF9A 3KOOA 4H18A 5AK4A 5HCNA 3WK7A 5CCEA 2R7NA 2MSCB 3CB4A 3O8NA 2IDKA 3R7WB 3OFNA 4DBLC 1PWXA 5F7XA 5JRJA 3VPCA 3SQWA 2MSLA 1U2ZA 2X0IA 2AE1A 3VTAA 1SOVA 1FVFA 1SCUA 4M99A 3IDAA 1NE7A 4Y30A 3ZCQA 1E6CA 3INTA 4R9SA 4S3MA 2ZW9A 3CKKA 5HCUA 1TW3A 3R0IA 4NCKA 2J30A 4XIGS 1TZBA 3Q7TA 2W9XA 5DFAA 2DFVA 4CMAA 2C2ZA 2CLLB 1GDTA 1N9GB 1QAMA 4NMXB 4DTIA 4FR2A 1YTLA 1XT6A 5IYZB 1W2WB 4QTTB 1JLLA 3C85A 3ZU6A 1KDPA 2YC2C 1EFRD 1YTUA 2WSYB 1F3LA 3NATA 2FU5C 3FTCA 3G2MA 4MPTA 1QMGA 4DJAA 1TM1E 4QOHA 4TUYA 4B4OA 1EXVA 5CFNA 4JP3A 3NAZA 3CTPA 4GXTA 5KKAA 2KJQA 5BVHB 1JG3A 5CW1A 1NMQA 2BZGA 4W5HA 4FHDA 2E1RA 2PMKA 3H9BA 5L3QB 5CA1B 2X13A 1MDBA 1JQJC 3H2BA 3IEKA 4JBYA 4M89A 3T6KA 4CRWB 1HQCA 5EJMA 3WLHA 2GAOA 3OQPA 1XRLA 2G4CA 1MA3A 2FSFA 1NJ8A 1W4AA 3R7BA 1C7EA 3WB0A 1O6FA 1JYEA 1Q57A 1VIYA 1WD5A 2H4YA 2AQ8A 4FQ7A 3AVYA 3PLAE 4CEHA 3F6RA 4RGVA 4KP7A 3BIFA 1EHYA 4AULA 1V5FA 2LD4A 5F9FA 3LY7A 2G83A 5EP2A 2GX6A 3QQPA 1JE0A 1T1IA 3TIGA 2CCGA 1PT8A 3H1GA 5KTNA 3LUGA 5CYGA 2NOAA 421PA 1QHHA 3EHDA 1BWRA 5TGTA 3G5LA 2QI9F 5GJBA 2W8BA 1OWLA 3CG4A 4CF7A 3CONA 1BQ3A 3LT1A 4Y2QA 3BVPA 1YZNA 1JA1A 2OORC 4YC7A 1XTVA 3G13A 4MS1A 1OH5A 4LZPA 1CERA 3MRTA 4IGAA 2C5AA 1E3LA 4B8YA 4DIFA 1WOYA 4DQLA 2HA5A 4IO1A 3V3TA 1ZP6A 5CJ2A 3VPFA 5BOVA 3UY4A 2X7JA 3OZAA 4ER3A 1K8ZB 4R71A 4YUYA 3E3OA 4R3NA 4QODA 4C2UA 4LI3X 3CLVA 3NXSA 2G71A 4KEAA 5ELLA 4DMKA 2PX8A 5I7UA 1EUZA 4BNUA 3EUWA 1A4XA 2GTPA 2IEYA 3Q3IA 2JLSA 1E3WA 5BXQC 1F20A 1ZH0A 3HYRA 2IPLA 4EUNA 1KY5A 2R8PA 1EB9A 3H2GA 4N7MA 3O8OA 3G7UA 4YMLA 2VPIA 3LA8A 2FFJA 3KTAB 2SHKA 4WASA 1NV9A 3FFAA 3FWPA 4DYVA 5JJCA 5JU6A 5K0CA 3NLLA 4B3TB 2ATEA 2QSYA 2X23A 4KFRA 3B6MA 2JL1A 1KGSA 3A0RB 2X40A 3AXSA 3QLEA 2AMYA 2C95A 5JDIC 4ZZ3A 1DS6A 4DV3B 3A6ZA 2QYTA 1BS9A 3FYDA 1P0MA 3EFOA 1FS4A 4G0XA 2WPNA 4ARVA 4FLEA 2OCIA 3KE9A 4HC4A 4BO7A 3UMGA 1SKBA 1FW8A 4YV7A 3K2EA 4TL9A 3I37X 4XJVA 4ALNA 4BO1A 4G0NA 2W11A 1FUEA 4DXHA 3WICA 2C9ZA 1EE2A 2CLCX 3BGDA 2IYRA 1F60A 3FOBA 2GS9A 3OUUA 3PUVA 1V3VA 1SO8A 2D8MA 3Q0EA 2H8GA 3T06B 3L06A 2VJPA 4KE8A 3SYRA 5C1PA 4G5XA 2CZGA 2HMWA 3ILYA 4H08A 5H16A 3BXXA 1J0AA 1JHZA 3DOFA 5TQ2B 3RD5A 4Q1DA 5AI9A 1TQDA 3IURA 5EJ2A 3N9IA 4C0XA 2VNSA 3UBMA 1N8KA 2VI5A 2WJZB 3GVXA 1IUKA 4WE3A 1D9XA 4UTNA 3RS3A 2P5TB 1K89A 2CL5A 3BQMB 1EK0A 2VT7A 3I04M 2XUJA 1TEVA 1WE2A 3FG9A 1EVIA 4HG2A 5KKNB 5JS1A 1NM5C 1P2TA 1YACA 3VR3A 2C78A 4RTKA 4OU4A 1GP2A 3LSYA 3S4YA 4P0PB 2RSLA 2EBHX 2VJYA 3OLWA 3PDCA 4RVCA 3IJ5A 4EG0A 2J67A 2UZ1B 3GLQA 3H4MA 2FUEA 4WL0A 4CCSA 2AGVA 1R0KA 3FFXA 1ZMTA 3S1LA 4MA5A 3WHLA 2J9ZB 2I4RA 2C92A 3IULA 3LUBA 1BZYA 3EW9A 3QHPA 3MWKA 4IDFA 4Q9KA 1Q19A 4Q9JA 5EZYF 4D45A 5B3JC 1ORWA 1T6XA 3PS9A 2QYHA 1KAMA 4JAVC 4DR7B 2VF7A 5DYYA 1YZVA 4G1MB 2O3QA 3OIUA 2QTAA 3P9YA 2IKQA 4WBNF 4IIHA 3OFSA 2ATVA 4XIYA 3RBAA 1G17A 1SHKA 1YRQA 4IICA 1WXDA 4NCIA 4IZHA 2G28A 5IKPA 3GCGA 1BSVA 3IVCA 4QBHA 1PL0A 2XIJA 2YMPA 3B5JA 4ZEVA 4MR8B 5B4VA 2IZ6A 2ISSD 5G0UA 3LY9A 2JW5A 3D8RA 3LW7A 4JGIA 4TYMA 4F1WA 1XYGA 3DXXA 1DKNA 3B36A 4TTRA 5EFOA 5JAIA 3UGJA 1JLMA 1GNPA 2M2IA 3ETGA 3PRHA 4B3DA 3QSYA 4D9HA 3CEPB 3NQ41 4YDRA 1HORA 5CLJA 4G89A 4I1PA 1IUPA 1WDTA 4NBVA 2HNBA 3OCZA 4JYZA 4DQ0A 2C8KA 1SQSA 4RA9A 5FPTA 4UEWA 2FZWA 3VQTA 3LC7O 4AZ3B 3KL2A 2YINC 3K1AB 1NLUA 2EC5A 1P5ZB 3AUAA 1E2HA 2XVMA 5AW1A 1KBOA 1ZUIA 2FV8A 4REMA 4UVGA 2FMHA 2J32A 5KSOA 3DV2A 2AZXA 2DPLA 2TMDA 2QRLA 4F21A 1MH1A 5KTPA 1PNQA 4WXMA 4LXYA 3K94A 1WQ4A 4KKXB 5I9BA 1MZPA 2NACA 3B7PA 5CUQA 5JDCA 2J85A 2I1VB 2HK6A 4GDFA 2AJBA 3EGXB 2QRHA 3QBDA 3O8BA 4GECA 4LEIA 4B6QA 2QJWA 4BBAA 4PQFA 1G19A 2ZJ0A 2FRDA 2BP7A 2P8SA 2Y05A 3EVTA 3KV3O 1ZK0A 2M6LA 4DE5A 2ACVA 3HWX1 3FI9A 1MFZA 1XDDA 3VX4A 2XD9A 3ACBA 3LBFA 3NDRA 4R2IA 4G0UA 2W2LA 2ZRBA 3CVVA 2UXDB 3K0AB 4ZT5A 4L6AA 3CVXA 4WLOA 2F8TA 1OGYA 3KFXA 3S5UA 1NVDA 4O1IA 1YI0A 3MBKA 3TVTA 4DV0B 3JWIA 4W6ZA 4C0QC 2HB6A 2XF2A 1REQA 4NC9A 4IJ6A 1Y3CE 1BVYF 1TX4B 4D74A 1NGSA 2YXEA 4OK5A 1RLMA 1XUOA 2NXWA 4ZCPA 2YXDA 3FGPA 4J0DA 5ITZB 5FORA 5A4MS 4P31A 3RJ9A 1FYXA 3EPPA 1E59A 5A9SB 2KBEA 2OYRA 1Y48E 2EJBA 2RH9B 4UU8A 2YTZA 3RODA 4DAEA 4FBLA 1U0HC 3VSBA 1JFTA 3SIRA 1OA1A 3FZEA 3KLBA 4N01A 1KJ9A 3T7AA 3UGKA 3G2KA 3VTFA 3WKEA 3HGTA 3HKEA 4CMBA 2W6JA 3L1VA 3G8DA 2DWCA 1W8DA 3BDAA 4WA8A 1KQOA 3L7CA 2PKQP 4B83A 4QXPA 1FUUA 4KNWA 3NU1A 4AP9A 4CM4A 4YLEA 1YRBA 1ISFA 2FHSA 4HLUC 4UHCA 1I2BA 3PEFA 5E1DA 3WHIA 4YCMA 3SLGA 1QYXA 3A32A 2X1LA 3EAGA 3GQBB 3I1IA 2VJAA 4Q00A 5BSTA 3WV4A 1CIPA 4JVNA 5JALA 3CNHA 3ZD6A 1DJLA 3GF4A 4AMYA 1U7TA 1I5RA 3D0OA 5JPCA 2IS1A 3W8RA 5KMGA 1L7PA 2VCEA 4WCFC 2O2GA 2Z1MA 4IW3B 2O8DA 1BXRB 1QDLB 4P3XA 1TTPB 5TNXA 1BX1A 4LF4B 1KZ6A 1RPAA 4PVDA 1BMFA 1JB1A 2LIVA 3LCVB 2O8FA 1P1HA 1Z74A 5KWJA 3NIDB 4Q3DA 5L7TA 4KB5A 2C2MA 1H1DA 1T3TA 3CRQA 3IPCA 3ZN2A 4TYWA 3DEFA 2IA5A 1NOJA 2H18A 3JQDA 3VJMA 3PR1A 4M86A 3G0OA 1EIZA 1WHSA 2GM4A 1B14A 1LDNA 1V96A 3G02A 2D3WA 2PJZA 4XH9B 3OQNA 4BNLA 3B9QA 3T1OA 4AP5A 1NSYA 1RI4A 2DUMA 1DX6A 4HBZA 2BEWA 2WTUA 3K8OE 1QFYA 2WICA 2O1EA 1S3IA 1KI6B 4Q12A 4KQKA 4CT5A 5KJFA 4DA8A 1SWVA 4TZKA 1B7GO 1GQOA 3OKCA 3R5HA 3ZE7A 4ABYA 2D5IA 3REFA 4EHBA 1X3SA 3KYDB 3OA2A 5LB4A 1N1EA 1ZJ4A 2R87A 3GC6A 2E6UX 5BSRA 1IHOA 5ALKA 2HRRA 4I9GA 4NESA 4F4JA 3G8CA 5HR5A 4YRAA 1DC3A 2F3PA 2JGDB 3RM3A 5ITVA 5FBLB 1L5RA 2P79A 4HNAA 3VSAA 4YAIA 1T0UA 2G9ZA 1NBMA 2IX9A 2RGXA 1T9GS 5AR1A 1LS1A 1JJAA 3NIFB 1HSZA 4E6EA 4EI8A 1K86A 2EW2A 2F3QA 4FDLA 4G1VA 4OVKA 5A5VA 1YR2A 1ZUWA 2R6AA 1P7VA 4IDGA 3DP9A 4O1HA 3T3PB 4AJJA 2XWJI 3WBFA 4B35A 1PK9A 5A2QA 3HPQA 1ATIA 2XZLA 3ZVMA 4I5IA 2A3RA 1BC5A 1WVGA 2CLOB 5EHQA 1AGRA 3ETCA 4E03A 3C6BA 3KQHA 5E9JA 4FNAA 4YJGB 1R6DA 1VCIA 1N32B 2J33A 3L1IA 2AOTB 2CLFB 3K0EA 3ESYA 1TTQB 3NBUA 3BZWA 1NI4B 5KPDA 2HX1A 4FYXA 5CXXA 1G8SA 3I2HA 2JBAA 3K7EA 3SR0A 3AOGA 2CJWB 2J0UA 2R6CA 4LRTB 2WPDD 3OKPA 1PKEA 1QQ5A 1RM0A 3O1IC 4Q48A 4D1YA 1BQEA 5CIYA 4F91B 3LHSA 2A0KA 1VJ0A 4P5EA 2OXEA 4C4RA 1MPXA 1P3Y1 2QSUA 3DYVA 3QYAA 4YCAA 3MELA 1EUYA 1IZ9A 3IPYA 3V7YA 1Q21A 4REOA 5IEJA 5DXFA 4DFDA 2GZ3A 5HQJA 1Q20A 2JJ2D 4YA6A 1JRLA 3EAQA 1UP4A 1K9SA 1IBMB 4P32A 4G0YA 3HBAA 2X8JA 3K0KA 3MOIA 1WTAA 3DFFA 2I76A 3ZW7A 4E2XA 1OJ7A 3RFTA 2WHPB 1A9TA 1TCAA 2LRHA 2FWIA 1DL5A 3DULA 2TMYA 3DR3A 3EC1A 4PM4A 1FYDA 1EFVA 2CLKB 2XHEA 1V9SA 1ZL2A 2Z6VA 2HHAA 3DHEA 3ELDA 3KXKA 2C99A 2PD6A 4AN0A 3UXMA 3M70A 3NKVA 2AR9A 4BP9A 2NO1A 4CQLA 2ACWA 3OIWA 5CH3A 4CMJA 2PSDA 4ND2A 2Y0CA 4J4HA 3C3AA 2VHUA 4IIFA 4Y6OA 3L8GA 3TLZA 5LQDA 2ID9A 4L02A 2R00A 4WWHA 1A9XB 3H42B 4BTLA 4DJFC 2CXSA 1Q7TA 2VYVD 3AFMA 3GOQA 1UFOA 4ZVMA 4D99A 5DK4A 3TEJA 4YRSA 4EJ2A 1IPFA 3BE4A 5CB0A 1E2FA 4JWTA 2C4KA 2GEJA 1FFEA 3VR4A 3FWNA 5GADl 5B1EA 1DQPA 1PG5A 3FCOA 2VT2A 3NUZA 4GLLA 4Y2YA 4OJTA 2V4MA 2D1FA 2ZG6A 3KR0A 3CX8A 5CXSA 3DS8A 4DADA 5BNTA 1LPBB 3L6OO 3QH4A 10MHA 4EFMA 1D2GA 2B82A 2QVLA 4CKBA 2EHDA 2QRVA 3JD2A 3P9NA 4QUJA 2C0CA 2QLJA 3G2HA 3H0KA 4A0QA 5K3AA 2MSEB 2IEIA 4G0QA 3U5TA 2AXPA 3IAS1 1UXKA 1Y8AA 2JVKA 1O77A 4FPXA 4HEHA 4NJMA 4P1ZA 3F1KA 4Q4JB 3BULA 1B0ZA 4CL3A 1QJCA 3O73A 4I50B 1DC6A 2WTMA 5F2EA 2EFDB 1SAYA 4HTAA 4BX9A 2QBYB 2CFTA 4R1SA 5FPYA 2QX8A 2OAGA 4BGIA 3UNXA 4YIHA 2CDNA 3P0EA 3TG2A 1ZRNA 3KT3A 3LXRA 2XVZA 1B8OA 3FZGA 4BQRA 4OIFA 2ZJ1A 5K2MA 4DA6A 2G7ZA 2VDPB 4M0UA 3BJRA 3H99A 4MKGA 3DE0X 4YRFA 4XKJA 2XUQA 2ODNA 3A1UA 1YVEI 4D2IA 1CRQA 2Z04A 3RLIA 2EX4A 3CBGA 3EW7A 2I6SA 3L8ZA 1Q0HA 2QVCA 3MWLA 5C8YB 4J7UA 1TL7C 5EGNA 2FPIB 4LJSA 1IIBA 3ILVA 4PX3A 3I4LA 2P4EA 3CVWA 1LX7A 1I4WA 3PKZA 2A3NA 3L7OA 4HWTA 4Z8YA 2YQ4A 5BYJA 4C0KA 2UXCB 3QHQA 4WJKB 1Z9BA 4YAEA 5L3RA 4MWCA 2BYTA 4CIDA 3F5QA 5IDQA 1B0UA 3AP3A 3C70A 2W93A 3QEAZ 3V3KA 1UDRA 1VI2A 5IX8A 4OHCA 1D5CA 3EVGA 1RWKA 1YRHA 4LS3A 1BYUA 2FWBA 3UWMA 1A9PA 3GZNB 4PLCA 1E3QA 1SUPA 1T0PA 3LPNA 1IK6A 3OE7A 4TM8A 3HKCB 4G8BA 5HK8A 3WVNA 4JQYA 3CWZA 2XOXA 3BSWA 3RVQA 2MSDB 4QDZA 3RHSA 2PUBA 1G18A 3DM5A 3ET4A 3UJHA 3H9GA 4AM8A 4OHVA 5FTWA 4QIHA 4XCQA 3LCUA 1E1CA 3ZS9A 1WHTA 4I6GA 5C37A 3CYFA 1V1MB 1PYGA 4TZ6A 1MOZA 4ZVRA 2XGMA 2R85A 2JLAA 2G25A 1DCKA 1M1XB 2QDKA 1Z0KA 3B53X 5AWFC 5JRDS 3FN4A 3BMCA 2XITA 1NQOA 1QTNA 2F43B 4XWTA 4C03A 4KPEC 2R8XA 2IZZA 1SNYA 2Q9UA 4D3XA 2XMSA 4UEJA 3RSFA 3TJZA 4INAA 3GWZA 4MQ5A 2FWPA 3NAQA 4RZSA 4HDNB 1KHHA 1EM6A 4WFKA 2JLWA 4QPNA 7REQA 2IF2A 2R11A 1PGJA 2AZMA 1XOIA 1XTTA 4INOA 4KI0A 4CLOA 3HWRA 2F55A 4BO8A 1QDUA 1UINA 2GFHA 1YUMA 4UAGA 3PD0A 4DCTA 3C5CA 1JHQA 1RYHA 2PWPA 3DWEX 3IBCA 2O6LA 2YVLA 1K6EA 4PIPA 5LA6F 4JMLA 2D1RA 2CCKA 3K9GA 3LWNA 4GDMA 3D6TB 1KAQA 3IH5A 4OSPA 4MV8A 1J0BA 2AN9A 4AZ0A 4LFAB 3R0VA 3LTEA 1JR3A 5JNLA 1B1CA 1RIFA 2RMKA 4ESEA 2P9ZA 3DKKA 1Z47A 2C2OA 3K1TA 1U0TA 4GOND 3KXLA 4HI0E 4LTDA 4J94A 4KITB 1O96B 1NUTA 5BPHA 3FR7A 4W1SA 3RGWS 3LC2O 2NXNA 2NN3C 2YKGA 4RD0A 2COKA 4LOIA 3ICQB 1E2EA 3D1LA 4JUDX 4KQCA 3B5EA 3WADA 3ZCTA 3WGVA 1O6GA 1PK7A 3G79A 4PU0A 3NV7A 4JQOA 1JEQB 3VTKA 2XWBF 3QE0A 3BBPA 4WNAA 1GZ5A 2OSVA 2XZOA 1TZJA 3I0ZA 1JR2A 2JBHA 3EVAA 4C0HA 2ZETA 1WSWA 4M9QA 5E0KB 4EX6A 4G0VA 2C58A 1JG1A 2NSYA 4TL6A 1N5MA 5F4BA 5K6AC 3PJDA 1J9EA 1RXWA 2ZAGA 3MWDA 3DQPA 1POWA 1QOQB 4MJ3A 3AHFA 5EINA 4JSYA 2ACEA 3T9CA 4FT4A 5AJTA 1HEUA 2HHLA 2IOYA 1UODA 1YS4A 2FW6A 2G8NA 3MEQA 1KOLA 3RIMA 4CM5A 3MCZA 2Q3FA 1US8A 2WWYA 5E7QA 2XUAA 4RFVA 4WDRA 1M2OA 4L5AA 4U2DA 4IHAA 1D03A 1IG0A 1XJ0A 1YRYE 4KQ1A 3JZDA 5LZ8A 2YIDA 5TRTA 3U62A 4B7ZA 3DV0A 1S6YA 5TIIA 1OJLA 3BCUA 5JYCA 3CEMA 3D3WA 5K09A 5JI2E 5H5JA 1FXWF 4HDRA 3UH0A 2HU7A 3A2MA 4I9NA 2CL0X 2ZQYA 5IJ0A 3CLTD 3VTZA 4M0FA 4NDZA 5C5IA 3W8NA 5HUJA 1FBTA 3DVAA 1NUPA 3EBOA 3PZRA 5H7XA 4DYHA 2W2QA 5BSMA 3JZAA 1VPEA 1O4WA 3A9UA 4Y2JA 5C9ZA 1NZDA 2ZIGA 3EFEA 2P4SA 3THWA 2OHGA 5LXTA 4PC3A 2GARA 2QTVA 1NQXA 3UM9A 5HZGA 3ZE9A 1WB6A 4XYGA 1F0NA 2QZPA 4QNMA 2W6PA 2PA0A 5ITWA 5FOWA 3GX1A 1TM5E 1K4YA 4WAUA 4XVUA 1G3MA 2XI4A 2QRZA 3EQ7A 2PS0A 4D97A 3PUJA 4BE9A 3CSSA 5KOHA 1Y1LA 3H5TA 1I30A 2WMYA 3OEYA 1RI1A 4OQXA 3DUWA 1T2CA 2DG2A 1ECGA 4D8XA 1FF9A 1T5SA 3UENA 4EDFA 2ZIEA 2CNWD 1MBZA 4EG5A 3LKVA 3KPWA 3BK2A 1CEEA 3L8DA 2G9VA 1QVWA 2M9MA 2VATA 4POAA 4DY6A 1JQ3A 4AJ2A 4FLMA 1FP1D 1GU0A 3U7RA 3I83A 1FZTA 1ZJYA 2ENUA 2PXXA 2FPOA 4HH4A 3LCRA 2CL7X 1F51E 2HRZA 2I91A 5REQA 1GVHA 1LVGA 3F90A 5EVCA 3RWOA 2JFBA 2PUAA 1P5JA 3GU3A 5ELMA 1Z7YA 4WXEA 2IYLD 3VHRA 4GS5A 2VPZA 3NNNA 5FI1B 1H2HA 3QBVA 3K0FA 4OG2A 4XB2A 2VHWA 1KS9A 4EFNA 1U9IA 1U1FA 1Y34E 4AMBA 1BXGB 2L42A 3VV3A 2W43A 2WAYA 1WUIS 1WDKA 4CFZA 1ZBQA 3OQHA 2J5KA 5TQ0A 1MW9X 2FSSA 1NJFA 4R6WA 2O0MA 3CIFA 3P9IA 5EE5B 2G88A 4QYWA 4B3IA 2MJLA 2DBQA 3AYXB 1ABBA 1JVSA 1ZITA 3UUGA 1SB8A 4L8WB 1M2FA 1DXYA 4C76A 4M6WB 4QWMA 3KLOA 1KYXA 4UU1A 2PX3A 4G5SA 2V7BA 1PV4A 2B83A 1DG3A 4KR9A 3UJ9A 3QVVA 5DGXA 2Q6KA 2W6OA 3H2YA 2WJ4A 5C53B 1JWLA 4JIGA 4WKBA 3VXKA 1R4AA 4QICA 1KGDA 3OZTA 1JLSA 1T35A 3QMWA 1YB1A 4MWDA 3O9MA 5AVJA 3TW4A 4CYMA 4D8WA 1MNQA 1Q1GA 4YHHB 3NPAA 1AKRA 4H59A 2HR1A 1V11A 4GXNA 2WZCA 3C2QA 2J7PD 2YXNA 1XD9A 3AKCA 4ENUA 4YMHA 3HB4X 1SD5A 3PUZA 4CLDA 4IH4A 4Z1OA 3ORQA 4YT5A 1LNZA 1FQKA 2Q6OA 3JQAD 2Z5LA 3WZ2A 3ZG6A 1W96A 3BMXA 1ADGA 1CY7A 2AXEA 3UUWA 2D0OB 3EG9A 2HRDA 3ZDAA 4JR0A 5ALEA 4D9JA 3V2IA 3Q12A 4HRXA 4JQSA 4QQFA 3AF1A 1GQ2A 4I9HA 3QLVA 4CVNA 4WBNA 1JHAA 3RJ5A 1IMJA 3VC1A 5A06A 1JI3A 2YV1A 2OMKA 2C2KA 1Z2PX 3PLNA 4PY2A 3PJRA 1JT2A 2FR8C 2O7SA 4MAMA 4CGYA 1IIRA 4JH0A 4J2TA 4Y1RA 1ID1A 4D96A 4RVSA 1Z4QA 1I7LA 1NUQA 1TVKA 4OMFG 1UXOA 1NBEA 5K0SA 1U3VA 2B34A 5JBNA 4LJ4A 4E09A 4QUAA 3DM9B 2DKOA 2BGLA 5GQSA 4BUZA 4DDVA 1H2AS 2BJHA 1L9XA 1C0LA 1QS0A 4D56A 1ZNWA 3MC1A 2HNKA 3QU9A 3MILA 4REQB 1SXGA 4HNTA 4XW2A 4P98A 1G8AA 3TIFA 1YV9A 4PLTA 1AKNA 4WACA 5KUTA 3IESA 3F71A 1DPFA 2P0EA 2VBGA 2HGSA 2VPXA 4ALMA 3WLTA 4JBIA 2XQGA 2FN9A 2CD9A 2PR7A 1TK3A 1XZJA 2VL7A 5IJZA 2R1VA 1FNDA 1V16B 2AFIA 2GN6A 1S0UA 1WZUA 3SE7A 4RL6A 1H23A 4XWWA 2O2SA 4QU8A 1YJ8A 1A2KC 5AJUA 5JC1A 1EZ1A 1XCGB 4XD7D 4ETNA 3GHYA 1Z6QA 2CJYA 1OT3A 3O2QB 1M2WA 4B6JA 3PWSA 4IFEA 4B81A 4HVTA 2EW8A 4H27A 5JSUA 3PWZA 1WL8A 1WXFA 4DG9A 4B5LA 2GPJA 1GVNB 1NW5A 2DQSA 2GR9A 4FWBA 4ME6A 4Z2YA 3URKA 1NTRA 4F9EA 5AVOA 4ZYWA 5COQA 2X0DA 3NORA 5TT0A 4PLVA 1D4FA 3QEMB 3STUA 4BZQA 5EUMA 1SBZA 2FMKA 2ZI5A 1VGQA 2B4YA 4C5CA 1U90A 1DKPA 2Q3BA 3IAFA 2IOFK 2IUYA 3VYTB 2XCIA 2XY4A 5E6UA 5EQDA 2IEBA 2Q3EA 2Y6UA 1EXNA 2OQ2A 4OJKA 2PFKA 1ODLA 1KC1A 4R5HA 3KTOA 4GIBA 1KP3A 2ZWAA 1FJXA 1H2ZA 1L5KA 1FRVA 3OCCA 1UJMA 4RPJA 4JZKA 4OXXA 5J2UF 3QVJA 4D4HA 5JAZA 3ZZNA 1FQOA 1SBYA 2B2NA 2ECKA 3EF3A 3VYSB 1SCQA 3AF6A 1U0BB 2ZYIA 1RQ2A 1HEYA 3DAPA 2XCRB 5TSDA 1FP4A 5C3UA 1WZ2A 1ID8A 2V5VA 4MEJA 4K0KB 1K9VF 2EEPA 2NZ8A 1EWYA 2FJUA 1Q84A 3ZU5A 1D4AA 1PR0A 2ZPUA 3HBFA 4B48A 3WTBA 5HVNA 3WLJA 1N8SA 1EDOA 3QWFA 4KOEC 1HURA 4EATA 1X39A 4AKGA 1LQUA 1TW2A 2DGDA 4E4YA 4JEMA 4OATA 1RRVA 2CBGA 2AXNA 3KS9A 4PAOA 2EIXA 2F6RA 3BKXA 1J5PA 4GR5A 4DR6B 2HWYA 5FWAA 2QE6A 4FX5A 3UJBA 3WLFA 2VZEA 1BDIA 2ZWPA 3ZDCA 3D1VA 4Y6PA 1W8IA 2MCFA 3RFFA 4GGOA 1JQ5A 2O48X 2Z83A 5CBPA 1PLLA 4U4AA 2C4UA 4F2DA 2Q62A 3MBOA 1U2DA 4JNCA 1HKHA 2QTCA 2GNPA 1H5QA 3B3JA 4YJ2A 3AR6A 4ZAXA 3SMVA 3H0EA 4Z4IA 1MJNA 1IRIA 1DUSA 2QM8A 2HBYA 3FNQA 3H8WA 4A6EA 1GSOA 4Y0AA 1GG9A 2H1IA 2HZ7A 2RIRA 3FUXA 3OOWA 4L4RA 4ZO7A 3TLEA 5JJBA 3K0SA 2AIRA 2Q07A 4FFPA 4QOSA 4DEYA 1ND5A 3I5AA 5BUQA 2HWKA 5I4IA 4ZQEA 1PE0A 2AVNA 2BEJA 1JSZA 1M67A 2QNRA 4JHXA 4N0PA 3E2MA 2G0AA 3ISTA 6CHYA 4JJGA 3K70C 4GYJA 1QANA 2OBBA 1D0IA 2FW0A 3QVSA 4O4JA 4NPCA 3ZBQA 1MJHA 4PAGA 3DNMA 2GCIA 4A0RA 1ZXBA 1EFPA 3GV0A 1UKBA 1W4CA 3K5PA 4M9RA 4ACBA 1XMOB 1Q14A 2H4ZA 5KYYB 4HMQA 1M54A 4PR0A 2M1XA 2Z2XA 3VDXA 4D81A 1B0AA 3A1NA 3H1PA 5ILQA 3W2IA 3IT1A 4NCNA 4L3WA 4J1SA 2VTDA 1P1IA 2B25A 3CPJB 3E9ZA 4ODIA 3DE6X 1C9YA 2W2TA 4WLFA 2FZVA 3H0CA 1L7QA 2JARA 2XUFA 2VDWB 3HI6A 3KZVA 3L2OB 3RJMA 4MUHA 3X3HA 4KR2A 1P2FA 2JJYA 2BF4A 4BO5A 3I9V1 1NIPA 2QU8A 1JJIA 4DR2B 3OLYA 2QQFA 1G55A 1ND6A 3UMFA 4Z9AA 4IP0A 1AZLA 1JNXX 1YVDA 1M2NA 1NLYA 3N6VA 4JITA 4NATA 5BN5B 3OICA 1LX6A 2E2WA 3PRYA 2VYND 1C1DB 3H9CA 1RBQA 3ZI7A 3AT1A 1QO9A 3QUTA 2X6RA 4LCBA 3UMSA 1PFKA 3KV1A 4HAOA 1OGJA 3VZRA 5DH9A 2XNSA 2ZWMA 1A88A 1OTHA 5EUQB 1J8QA 4CG2A 1Z7BA 3VU9A 1NBOA 1VJGA 2YY6A 4IVQA 1EFUA 3BMNB 2JGJA 2FEOA 1LK0A 4NZPA 3RUDA 3T5MA 4RA6B 4FEAA 5KQLA 3UT0A 2ZIUB 2BR4A 2PYZA 3DBRA 3MQ4A 3NO4A 1ULUA 2FZ5A 1PFWA 1Y98A 4QU5A 1RJ9A 2PA3A 4PNHA 4WZ6A 5LOVB 1WP4A 2B36A 4KPYA 3BB3A 2HCTA 3AZPA 4EKEA 5CRIA 5FIUA 3ZV5A 5GZ1A 2CEKA 1PL6A 4F2PA 3LK7A 2HJGA 4CF6A 2VDJA 2YHIA 5AJVB 4X00A 2P67A 3REQA 3KJEA 2E4WA 4UVHA 3S70A 1U7DA 4FQ8A 5FUBA 3PFGA 2FRVA 1YHZA 3MGAA 1F8XA 2BR5A 2WJJA 3M81A 4OI4A 5ERYA 3RVPA 4C7KA 5DHUA 3R6LA 4C2AA 2O57A 3CN9A 1ESMA 3RS8A 1FNNA 3SJBA 3K20A 4R81A 2ZK7A 3L46A 2F17A 5K3CA 1G4UR 2FXVA 5I8PA 4IYRA 1NE2A 2FPPB 3T7SA 2HH9A 3R9XA 2FSUA 2BJWA 5KC9A 4A1OA 1H3FA 4DQKA 1TJ4A 2JFNA 3H7IA 4IZ6A 2FJPA 3THXB 1PGOA 3IQGX 4FGWA 4GYYA 1XGKA 4KHPB 3AUXA 5CAEB 2PGAA 2AB0A 3T7DA 2QR5A 5LQAA 1J23A 2BGNA 5SZIA 2P5YA 2BFEB 1DCFA 4FYIA 2JCYA 4RNDB 2I3DA 1A3CA 4XQ0A 3TLJA 2I80A 1W88B 1VGRA 3RUAA 4KODA 2D06A 5H4GA 3FPKA 2X5NA 1E32A 1L1RA 4OX9Y 1RJDA 4TWZA 3KK0A 3AVUA 3HUUA 3COVA 3ZDEA 3O0DA 5IVDA 4EITA 1VP3A 3R3WA 4EX7A 3V4RA 2L82A 3U4QA 4XJSA 1Z2DA 2ADFA 3OLZA 4X7PA 4IMIB 2I7VA 1KK1A 2BEKA 2LPMA 2QLNA 1VE1A 2YC4C 2I66A 3GRFA 3I53A 3L0YA 1E1QA 1UZUA 3ZOZA 1H9BA 3L7BA 1FFDA 5CHYA 5DTIA 2VPYA 3QIVA 4P93A 4BCBA 3IAS6 4LDQA 1MT0A 3AFOA 1CY2A 4GI1A 6Q21A 4UJ3A 1IOZA 1COZA 1SVWA 3EMDA 2VHXA 3U16A 5GGYA 5JSKA 3VR6H 4E4RA 3OF2A 2ZUBA 1UKYA 1MQSA 2D62A 2DOKA 2G04A 2OGWA 2R84A 3BEOA 3VJLA 3B2QA 3DMNA 1KEEB 3A1VA 1VL1A 2G9QA 1QGZA 3GA0A 4YAWA 1LEHA 1HDCA 1TLLA 1Q6YA 3C3XA 5F3DA 2O6HA 4DQUA 3MGKA 4WKNA 4KSYA 4Q9NA 1H2YA 1H8ED 1T1GA 5KC8A 1KO4A 2VBCA 4A5OA 4Z0PA 1T4GA 3QXXA 1UIMA 3AL2A 3OPXA 1FFXB 3FJYA 1FYFA 2RJNA 1V0JA 2O0JA 1J90A 2VNIA 3CISA 4IILA 3MUNA 1Y82A 3DMRA 3OPQA 1JFFB 4Q1AA 2B98A 1P72A 3DBVO 1NWHA 4XGRA 3DMHA 4H7IA 1FK8A 4W9NC 1ULSA 5J1SB 3DVLA 4CFSA 4S24A 1MVOA 3NANA 4G5RA 3T5CA 2C59A 5GVRA 3NWPA 2QRGA 1ZESA 2VH5R 4RO0A 5D3MA 4H15A 4DUGA 2BFBB 3M9XA 3IMKA 1Y9AA 3REOA 4ZAWA 2WUVA 3O4GA 1HMPA 2BM9A 2OCBA 5G1NA 4E5UA 5IJ9A 1HTTA 2Q5JA 5KVAA 1PGNA 2GETA 4Q03A 5CDSA 3DMPA 1E9SA 5M29A 2XYVA 1FTWA 2P62A 3IR7A 4J4BA 3UKDA 5B64A 1LGYA 1UMDA 4LNAA 1NJGA 1SUSA 2ZJAA 3AU9A 4PPNA 5SY4A 4XWKA 5ICGA 3SSNA 2W5UA 2GJ4A 1K5DA 3GLGA 1FOEB 4M53A 1X92A 4XLLA 3MINB 4PEVA 1KJIA 4HGNA 3VPBA 4B75A 5FUMA 4C7OA 4MLPA 1ZH4A 1XD2B 2KE5A 1QFZA 2HF8A 4TYYA 2VS1A 3LZ6A 3HDTA 3R5TA 1JIJA 1ZFNA 3GNTA 3L1JA 1XQ9A 4J0JA 3DMFA 4WGGA 1PEKE 4HLDA 3FPEA 4ASUA 4GEKA 3THWB 1JBKA 2X2OA 4TXLA 2F90A 5DN6A 4PCUA 5CB4B 3OX4A 1RFLA 5AOBA 4YMGA 3HU5A 3BCHA 3HDHA 4QWWA 5NULA 4CN8A 1N57A 4MHTA 4ZA2A 4OJNA 5I9TA 3UUFA 4ZOBA 4M0CA 4C4SA 2XBMA 2FW8A 1GNQA 3CF2A 5JCOC 3HXOA 3M33A 4ZVPA 4DVGA 1F0PA 3AOEC 3GFPA 3RNOA 1P9RA 3VHXB 1OAAA 4UUQA 3WLOA 4WESA 2VHQA 3BWBA 4BX0A 4D44A 5IZCC 3G9QA 4MQFB 3THRA 3WJ7A 1IVNA 3KLMX 4RHEA 3PSAA 4F56A 4F71A 1XF9A 4D25A 4TN5A 4E5SA 2JJ1D 4AUNA 1N8NA 4YFYA 3W4IA 3WWOA 2BEVB 1A27A 1GTG1 4W7IA 1X7WA 3KUXA 4Q05A 3F5MA 1XNQB 4BB5A 3SQXA 1E7MA 5AKJA 4LE2A 4MVJA 4XWGA 5L51A 1OZHA 1SHTX 4NQZA 2QDXA 2WM3A 4R1PA 3TMKA 3P9RA 1CE8A 3ZWXA 4HF7A 5AH0A 1G0NA 2EWMA 1E0AA 1OV4A 2QM7A 4DJEC 4BLSA 3BCRA 3EXIB 1XXHB 3EHEA 2NLOA 2OHHA 2C84A 1L5ZA 1ZD4A 2D2XA 3E22B 1XCMA 1Y5IA 1N0WA 1PR5A 1U8UA 3IBFA 1XK6A 3PUKA 2Q2QA 2HEIA 1XVVA 2JIOA 4HPJB 5CJPA 4W5TA 3NDJA 1K0UA 3G2QA 1QYRA 1VL5A 3GDHA 5H81A 1BEZA 4IHJA 1Z07A 3G1TA 3HKDB 4BB9A 2ATXA 2JLBA 3BS4A 4HNQA 4OMDA 4HX2A 4LY3A 3BFPA 4PF1A 3LDHA 3S2IA 1CF4A 5A62A 3FR8A 1TADA 2ODQA 3MIIA 3N2YA 2QIOA 3CPEA 4L50A 4YRJA 5BN4B 4H0FA 1WP9A 3WMWA 1XPOA 3MJSA 4UHDA 1C0IA 2YFHA 3F7MA 3U7JA 5E1OA 3TM5A 3PC8C 4HLCA 4C2BA 2GXUA 4P3KA 1DVRA 1XHLA 4Q02A 5JQGF 3QYJA 3GJ0A 1CNEA 2IPXA 2VDOB 1E62A 3FTDA 3T1QA 2QUJA 1QSGA 3AEKB 4MWTA 1IBSA 4YLYA 1BEUB 5GJVC 1XEXB 3TDNA 5JJKA 4RBNA 3CE9A 4F4IA 4HB4A 4HHEA 4B44A 1Z75A 2X2PA 4N3BA 1WEHA 2PUGA 1XZGA 4PCVA