3GEDA

Fingerprint and structural analysis of a apo scor enzyme from clostridium thermocellum
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
245
structure length
242
Chain Sequence
NRGVIVTGGGHGIGKQICLDFLEAGDKVCFIDIDEKRSADFAKERPNLFYFHGDVADPLTLKKFVEYAMEKLQRIDVLVNNACRGSKGILSSLLYEEFDYILSVGLKAPYELSRLCRDELIKNKGRIINIASTRAFQSEPDSEAYASAKGGIVALTHALAMSLGPDVLVNCIAPGWINVTEFTQEDCAAIPAGKVGTPKDISNMVLFLCQQDFITGETIIVDGGMSKRMIYHGDWNWFYKID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Short-chain dehydrogenase/reductase SDR
publication title Sequence fingerprint and structural analysis of the SCOR enzyme A3DFK9 from Clostridium thermocellum.
pubmed doi rcsb
source organism Clostridium thermocellum atcc 27405
molecule tags Oxidoreductase
total genus 84
structure length 242
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gedA00
1BXKA 1NPTO 2J3HA 1IUKA 1PJCA 4GGPA 3TSCA 4D0RA 1GQQA 1JTVA 1ZK4A 3KYBA 1ISJA 2DPGA 1MGOA 1DRUA 3NGXA 4E5NA 1IULA 1ML3A 5MGBA 1I0ZA 1RM3A 4YYZA 1M75A 2FRDA 5ITWA 1QR6A 2Y1DA 1MUUA 3RROA 2NVWA 4QUKA 5G0TA 4B4VA 4YT4A 1FXSA 2GD1O 3L4SO 4WKGA 5CFZA 2OBYA 2DVMA 4IUYA 5IJZA 4AJKA 3OH8A 2VOJA 3KUXA 1NVGA 2VRCA 3OEYA 3PXXA 4Q3EA 4TRRA 4D3SA 1ZIDA 2EW2A 5TC4A 1QKIA 1O9BA 3NTOA 3DZBA 5DP1A 1PJ2A 3EMKA 4RLHA 3AJRA 2J5KA 2JCYA 4EUFA 4IBOA 3BTOA 1SO8A 3NDIA 2VTDA 3IMFA 1T1SA 3FTNA 5TQVA 4WPGA 1Y5RA 3IIEA 4RPGA 3DBHA 3L0DA 4Y67A 2D3TA 4A2CA 1HF3A 4Z0TA 5G0UA 3H5RA 3FR8A 1YS4A 1VM6A 2PFGA 2HMTA 3CMCO 4UREA 5COBA 2QYTA 3MWDB 2O48X 4NBVA 3MJCA 4R4JA 4J1TA 3VPXA 1HZZA 2GZ3A 1JKJA 5DCWA 1HSZA 4UAGA 3H8VA 3QA9A 5GZ6A 1SOWA 1EVIA 3LK7A 4JIGA 1B14A 3JQCA 4H3VA 2VWPA 4OIMA 4P8RA 3AY7A 4AFNA 1GUZA 1SC6A 3H9EO 4DBVO 7ADHA 3DZJA 4B8ZA 1C1XB 5A9SA 4Y98A 3KEQA 4ZQFA 3RUEA 3TZ6A 3IKTA 3GK3A 4J9UE 3ROQA 3FNHA 3ROPA 3E03A 1N9GB 5TT0A 4OM8A 2HK8A 3CZMA 4TZKA 4GVXA 4JXKA 5GZ1A 5L9AA 2CDCA 1NTOA 4CM9D 4R9SA 1I2BA 3GDOA 2BHLA 3K9QO 5AQ1A 3VH1A 3SJUA 2B83A 2ZB4A 2FMUA 4BO7A 1DLJA 2D59A 3D3WA 4M87A 5JDIA 2DUUA 3F47A 1KETA 3WWZA 1T1RA 1ZVMA 4E0BA 2X9NA 3F1KA 1KVSA 2I3AA 2P5UA 5DULA 2BMAA 1QRRA 2OBNA 2OP0A 1PIWA 1LQTA 3PPIA 1BDBA 2PA3A 3L6EA 4PZDA 1K0UA 2YV1A 1LDYA 3OICA 4CQMD 4K9DA 5JW6A 4YPOA 3QV1A 1LSJA 3PHHA 3WGZA 1NP3A 3DOOA 4OGWA 1DAOA 4LCEA 4WGGA 1BW9A 1HLPA 5JPIA 2A9FA 3HG7A 4UVDA 4GVLA 3TL2A 3PHIA 1ISIA 5ES3A 4PLHA 5I7EA 3FNEA 2C82A 3TFOA 7MDHA 3PTZA 2HKIA 1EQ2A 3EYWA 1M6WA 5FWNA 1YL5A 2ZCUA 3BAZA 2Q2VA 2J5RA 3EVNA 1VJ0A 3IUPA 2ZQYA 4RDHA 1UAYA 3Q9NA 3X2FA 3KBOA 4J2HA 4BNGA 4JJIA 4DRYA 3PWSA 2C5AA 4W7HA 1QLJA 1E1NA 1WW8A 2G17A 1B16A 4NHEA 1F17A 2ILTA 4YWJA 2FR0A 3B1KA 3ZHBA 1L1FA 1WXDA 2IDZA 4QFDA 4QX6A 4M1QA 2EJWA 3WQSB 2EIHA 3IJRA 4NBRA 3RAJA 3UF0A 1E1LA 2X8LA 3HDHA 4IJVA 1Z73A 2Y66A 4IDDA 3Q1LA 2AE1A 1E6WA 3HZZA 4UVGA 3E18A 3SVTA 1KVQA 1PZEA 4J1SA 4KTTE 3GAFA 3DO5A 4TRJA 3RUCA 4J16A 1C0KA 1UP6A 2OL4A 4DTIA 4MVJE 1HZJA 3O8QB 5CDSA 2NVUB 3RQSA 4Q3DA 3ZWPA 2VTEA 4BHTA 1Q7CA 1U3WA 4E12A 5JNLA 1PJLA 2D5AA 1BVUA 4K28A 4HV4A 1NR7A 5I7VA 1QLHA 1G0OA 3BTSA 1WAMA 4IM7A 1BDMA 1C0PA 2Q1UA 4YJDA 3O9ZA 4IMRA 5F3RA 3T4EA 1PGJA 4PVCA 1PS9A 4JQCA 2P68A 4OXKA 2PTGA 4KTVE 1U4OA 1E3SA 2AE2A 1KY4A 2NV6A 2P4QA 1VLLA 1B15A 2EW8A 5BR7A 1DC5A 1PWXA 3WQRA 3LT0A 1LSOA 4OOEA 3ZH2A 5IN4A 4Q39A 3UW3A 5H82A 4JJGA 1P74A 3I9JA 4E2XA 4I9UA 3WOHA 1JAXA 2DLDA 2NU6A 1T2FA 3G1UA 2A4KA 3JCZA 2X23A 9LDBA 1PQPA 1CIVA 4HUJA 4ESOA 4C7KA 3IP1A 1NASA 3DL2A 4DL9A 4IMPA 3C7AA 5F1PA 5JLAA 1BXZA 2NLOA 2VQ3A 4EJMA 3Q6IA 3JSAA 3U4CA 2GZ1A 1PTJA 4CUZA 3C1OA 3JQ7A 3C8MA 4GI2A 3QHAA 1WVGA 3DOCA 3ETDA 5B4VA 5EJ2A 4NH4A 1I3NA 3CE6A 3JTMA 2Q1WA 4L76A 5JC8A 2IEDA 1T4DA 4IJKA 1MV8A 3GHHA 2NU7A 3ICPA 2NTVA 4AJIA 1D4FA 1YJ8A 3RUDA 4NBUA 3GZNB 5TX7A 4JGBA 3JQDA 4N18A 3VPGA 2PV7A 3WWYA 3VTZA 4AICA 5F1OA 4PLVA 2E4AA 4RF3A 5AXCA 2E82A 1PZHA 3U4IA 5ER6A 4YACA 2GDZA 1YOVB 4CL3A 3JQ9C 4GMFA 1KVTA 4FC7A 1OZAA 2WM3A 5KVSA 1UZMA 2OP1A 4ZJUA 3GN2A 4IJUA 3TWOA 1BHSA 2PD3A 2EGGA 3G0OA 2HMUA 1N8KA 3C85A 3H3FA 3ZGYA 3BHJA 4CMKA 2RH8A 2FWMX 1C3VA 5DT9A 1EZ4A 4AJLA 3WMWA 3G79A 3GRKA 4D43A 5IAAA 3ULKA 2D8AA 2NQ8A 4CLHA 4NFYA 2ZYAA 4HP8A 1GQYA 4O0LA 4Z0PA 1Y8RB 5EQDA 5EMHA 4CQMB 2B36A 1CEQA 1DRWA 2RAFA 2DBQA 2PZKA 4IGEA 4IS3A 3U4DA 1OBFO 3RKUA 1X7HA 2UV8A 3HE3A 2GN8A 1B0AA 4MVJD 3QVTA 4OH1A 1U3UA 1HKUA 4S1VA 4BNZA 5CP8A 1XLTA 1B8UA 2VWHA 3PZBA 1H9BA 4BNMA 3WYBA 1NVMB 5KOIA 1GAEO 2GN4A 3I9NA 4TROA 4QT0A 4NJOA 3WFJA 5COQA 4RVGA 3EY4A 1ZXLA 4WCFA 1EVYA 2Q3EA 4A7PA 1LX6A 2R00A 4BNIA 1AHHA 2OFPA 1ULUA 1HXHA 1I3MA 3TFQA 3HWRA 4FOSA 5AYVA 1ZSYA 3ON5A 1WWKA 3OJLA 1F12A 2NU9A 1R4NB 4HNHA 1T2EA 4PLTA 2BELA 3RFTA 3PJGA 3GEGA 1RWBA 4D79A 3ZZNA 1CQIA 4A73A 1UH5A 3GNQA 4D44A 3L07A 4DIFA 5ICMA 4XYMA 4LN1A 4R01A 4A10A 3WSWA 1OC2A 4GQAA 4J7CA 1B3BA 3ADOA 3PFWO 1V6AA 2I3GA 1M2WA 3S55A 4ALMA 2I65A 4CM4B 1X7DA 3DBLB 4J2OA 5TJHA 1KY5A 2PLAA 5C3MA 5G4LA 4E3ZA 1C0LA 2PZJA 4YAEA 5JXWA 4CM8B 2DC1A 2DQ4A 3JQBC 1NFRA 4CPDA 1I36A 3W6ZA 4BOYA 4RLSA 1C14A 1NM5A 3D3EA 3RCBA 2Y1OA 3H6KA 1Y8QA 4BKQA 2POQX 5I8ZA 4MPDA 3L77A 4BKRA 3KRTA 2XXBA 2PH3A 3GGGA 4Y6RA 3RIHA 2O3JA 3H5AA 3QVWA 3F3SA 4W9NA 5T6BA 5KVCA 4DYVA 4Z3KA 5IXYA 3QWFA 4XB1A 1G6KA 1LLUA 4CV2A 5JS6A 3MTGA 2VYVD 1UXJA 3NV9A 1IHYA 1Y5MA 4ZQBA 4XQ9A 4RZIA 1UDAA 4BMVA 2C59A 3MEQA 2CFCA 4FJ1A 1ISGA 3W8FA 1ARZA 3PQFA 1PGPA 2OHXA 3WJAA 2B35A 4XQEA 3D5TA 3VVCA 2PK3A 3S8MA 2WYWA 3PFFA 5DN9A 5L7TA 5CEJA 1UJMA 2X5KO 3ZW9A 1R0LA 4BV9A 4CMIB 2AEJA 1O89A 2X0IA 2ZK7A 4U8GA 4J1QA 4UUNA 3TL3A 5KIAA 1MP0A 2Y0DA 2YW9A 5TNXA 4MJLA 2HRZA 1D7OA 1BXGB 1KERA 3ICCA 3JQEA 4W82A 3H9UA 1PX0A 5CDUA 3ADPA 5I7FA 3K31A 3AUUA 3JQGB 1R4MB 1WLYA 2BLLA 1LDEA 1UR5A 5FI5A 3GC6A 5G0SA 2BFPA 4B7UA 5KJCA 1X13A 4HY3A 1LQUA 4CLDA 3JQAD 3ONDA 2C29D 1LU9A 4BGVA 2FP4A 1ADGA 3WB9A 5BNIA 3H65A 4QO8A 4QXMA 3JQFA 3U62A 5CEEA 5JY6A 3WNVA 3MJSA 1LDBA 2JHFA 3DAGA 3QW2A 4IQGA 2C5EA 3CUKA 4MVJH 5I9LA 1V3VA 3VPHA 4EEZA 2V7PA 2YV2A 2GUGA 4XYBA 3WGQA 3HDJA 4DQXA 4G65A 2I99A 3SX2A 4DPMA 3ZU3A 2P4HX 3LT2A 4IZIA 2YZ7A 2DTEA 3NKLA 4JN6B 1YDEA 5L4SA 2BFAA 3GHYA 1AGNA 3I9MA 4ND1A 1R6DA 5U1PA 1FDSA 2BD0A 2V6MA 2HJRA 4O63O 3ZWYA 1IPFA 1NAHA 2NTJA 2YQ4A 5JDIC 5H83A 3K96A 1DDOA 2B69A 3BMQB 4B7XA 3ETGA 3E6AA 1AE1A 4YT5A 1M6HA 1YGYA 3DQPA 4GWKA 3LF2A 4MP6A 4K6CA 1E5LA 1LLQA 4N5NA 5ENDA 3EC7A 1V0JA 4W99A 3H4VA 2DM6A 2CF6A 4CLRA 3DZKA 3HQ4O 1M67A 1Y9AA 4XGNA 1ISHA 2R2GA 4ZRMA 3S1LA 3WJ7A 2BFOA 3ZNNA 4R51A 3VAZA 4CM7A 1ZK0A 3LF1A 4KP7A 4PRKA 3E5MA 1P1HA 2O4UX 3FPCA 2VHWA 2C07A 3HFGA 3W4JA 1NPYA 2WEKA 3PHJA 1Z6ZA 1UDCA 4NJMB 3RBXA 3RUAA 2G82A 4GX5A 4ITUA 1N1EA 2C7GA 1A27A 1E5QA 4MIEA 1EFKA 3MCVA 3RJ5A 4RDIA 1YL6A 5DNAA 2GLXA 5KVVA 3WGIA 1LUAA 4GMGA 5T57A 2FPIA 3GGPA 4ALJA 1SOVA 5BNTA 1GCOA 1PSDA 1QSGA 2QYSA 3AOEA 1F0YA 1DHRA 2QG4A 1JVBA 5IXSA 4NU6A 3EDMA 2O23A 2ZTMA 2OUIA 2YDYA 4MINA 2VRCD 4RPJA 1XG5A 4DMLA 1AN9A 1VKNA 4ZQEA 4IDAA 1PWZA 3S2FA 3F4LA 4EJ6A 3U5TA 5B12A 4OAQA 2AQHA 4J0EA 1P77A 3EUWA 4CQLB 3NJ8A 4WLFA 4QECA 3VZSA 2W2KA 2VNAA 1ZMOA 1V35A 5KJFA 2BI8A 3C3XA 4FGSA 4HBGA 4YJHA 3GR6A 5DZSA 3WTCA 1V9LA 3ROMA 1Q1NA 1FF9A 2NTNA 1TT5B 3DBRB 1ZEJA 3GDGA 5CAEA 2OOSA 5KJ1A 1XGKA 1E7WA 1VC2A 3KEOA 2D4AA 4Z9FA 3FWNA 4NK5A 4D7AA 3ZNQA 1ONPA 2C54A 3VH4A 1Z82A 1XWFA 5EERA 2X22A 3IDSA 4TKMA 3C1TA 3I4FA 3K5PA 1DIGA 3WBBA 2FSSA 4FOOA 4ALNA 3DC2A 1E6EA 4FJ0A 5A04A 5JYEA 3ONEA 4IDGA 3WGYA 4N54A 4TQGA 3AI1A 4FW8A 3CSDA 4J90A 4S3MA 1Q0LA 4IIVA 3FSRA 2EXXA 1SPXA 1ULSA 2VHYA 1WMAA 4RVDA 5IG2A 4XYLA 1XR3A 2XPCA 2NUAA 5JCJA 3RSHA 1HSOA 4DREA 1NNUA 5F5NA 4E33A 1LBEA 1MX3A 2OORA 4DUPA 2OXIA 2YHIB 1I3LA 4YT2A 4Y8VA 3JYOA 3Q9UA 5HM8A 1ISMA 1PS0A 5ER9A 3WR5A 2O3SA 2EWMA 3C24A 1JN0A 3V2HA 4MVJM 3TPCA 5C7OO 2AW5A 3GUYA 3MWEB 3GF4A 3R3JA 2V65A 2VNSA 3ZW8A 4XX0A 3VH2A 1L7EA 2J3KA 3LC1O 4FIZA 1JDJA 3VDQA 4BO0A 1P1FA 5B4TA 1F8FA 3NT2A 4UULA 3ZDFA 2ZKLA 1I2ZA 1DB3A 3U4HA 1CYDA 2Y67A 2CY0A 2G0TA 3PHGA 5I9MA 4MOWA 1GU7A 3LU1A 3ORFA 3DOJA 1YXMA 3ZWVA 3OBBA 2ZQZA 4INAA 3VHRA 4K1LA 1DFHA 1HE4A 4G81A 2Q46A 2FOIA 2UUPA 3D0OA 1F14A 4A26A 1LJ8A 2G76A 4RPLA 3UCFA 4CL8A 2CD9A 4B3JA 5DBGA 3JQ6A 3LLSA 3FN4A 3PHLA 4GGOA 5F1KA 3ROKA 3WGGA 1GYQA 3PGJA 4B3HA 4P4GA 5CPBA 4BNLA 5C37A 2D2IA 1R37A 1E7SA 1QP8A 1D1SA 2O3QA 3JV7A 4GLOA 1BWSA 3ANNA 2Q1TA 1TB4A 2HQ1A 3NTRA 1PJ4A 1N9GA 2JKVA 2JAPA 3AI2A 1GPJA 3GOHA 4KDFA 5L4NA 2G1UA 1FJHA 4D41A 1XQ1A 4YJGA 4YA6A 4JJFA 3KYCB 4YXFA 5KJ6A 4FQ8A 3C7CB 3L9WA 1T2DA 2CF5A 2VHVA 4L74A 1GD1O 4R69A 2VWQA 3HFSA 4UVHA 4YBZA 1B26A 1B7GO 1H94A 3I5MA 4B4WA 5HRUA 1EVZA 2Y1EA 1OAAA 1Y6JA 3I6QA 3M2TA 1JLLA 3SLGA 1A9ZA 2PKQO 2AXQA 4LGVA 1TI7A 1NWHA 1ZZEA 4L73A 2UAGA 4KUGA 5KNLA 2WSBA 2H63A 2CNBA 4PLZA 1KOLA 2LDXA 4IDFA 3L4BA 1C1DB 4GPD1 4KDEA 4B79A 2C2XA 4CR7A 3ZV5A 3O38A 2YY7A 3VKUA 2J6IA 3H9GA 3U3XA 2WDZA 3L6DA 4CR8A 4CMEA 4IQ8A 2FPGA 4XWYA 1QV6A 2C0CA 3QVOA 4E32A 1S6YA 4WCFC 3HB5X 2BGKA 1H6DA 3WLFA 1PJQA 1W0CA 2R00C 3MJVA 4URFA 3RU9A 3BMCA 5U9CA 1Y7TA 4FFNA 1EDOA 1PZFA 1H6CA 4GX0A 3BTVA 4FB5A 4MO2A 3DMTA 3LQFA 4UEJA 3PLRA 4R68A 3R6DA 5L4LA 2SCUA 2A35A 5GY7A 2VOEA 5DBIA 2VYNA 3O03A 5I8WA 4KQWA 2FR8A 4ZQGA 3NX4A 4PG6A 4BB6A 4II3A 1YRLA 5FF9A 1IY8A 5A05A 1VJ1A 3DBHB 1OFGA 3S2EA 3EW7A 4XRRA 1DLIA 4ALKA 4CR6A 5F5LA 3E82A 1YBMA 3H3JA 1HYHA 1H9AA 1ADCA 4OQZA 2AHRA 1HDGO 2CVZA 3D4NA 3H9JA 4OQYA 2GASA 2FPPA 5L53A 4ID9A 1EUZA 2EV9A 1Z75A 4ZQHA 4E5MA 4CLXA 5AVOA 4ND4A 3VOSA 3FNGA 4FFPA 4P38A 5IDYA 3G17A 3HHPA 2HCTA 4J7UA 4XR9A 4FDAA 3MJ4A 2NQTA 3QY9A 4DA9A 4R3NA 4N5LA 1IZ9A 3GLQA 3GVXA 4W9NC 2EP7A 3UH1A 5C7LO 3ASUA 3OECA 4Q3CA 1C0IA 1HDZA 3PP8A 3OQ6A 4A27A 3WGTA 1NQAO 3EZLA 3KXDA 2WE8A 1SNYA 2VWGA 3ZHYA 4BNUA 3D4PA 4P22A 3WICA 3GN1A 6ADHA 4R41A 4J0FA 1MB4A 3NYWA 5A03A 1BSVA 1TVEA 2VUSA 1LSSA 2HLPA 4AJHA 5JFOA 1PGQA 4AVYA 3PWZA 1CDOA 4I5FA 4LMRA 4WLEA 3Q2KA 5TS3A 4Z6KA 5C7IO 4B3IA 2Y0EA 2JD1A 4CLOA 3SBOA 1U8XX 1SCUA 3ZNPA 2JJYA 2NNLD 4L0QA 2VZ9A 5IDXA 2FN7A 4E4YA 3TQHA 5AOVA 2VZ8A 3WS7A 5DBFA 3HDQA 3ITKA 3ZV4A 4R3WA 1K6JA 2O2SA 1EK5A 3BHMA 3GRPA 1MC5A 3OF2A 3JYLA 4FJ2A 4I8XA 3KVOA 2Q1SA 3KYDB 2WYVA 3WMXA 2IODA 1XHLA 1KBZA 4C4OA 4H7PA 3M1AA 2W4QA 1EMDA 4AJPA 1Z45A 1IOLA 1GTMA 3GZNA 1BRMA 1LSUA 4OHUA 4TMFA 4MVJG 3JQ8A 1J0XO 3JQFC 4CJXA 3W1VA 2OO5A 1U7TA 4PZEA 4XIYA 4YJFA 3OP4A 2HSDA 2WYUA 1YOVA 3GQVA 4KZPA 1I3KA 4BQRA 1N2SA 3QSGA 4ZVVA 2O3UA 3KSZO 3EZYA 2DT5A 2QX7A 1A9YA 1E7RA 3BTUA 3QWHA 1A71A 1PGOA 2GGSA 2GZ2A 3BA1A 3RBVA 1UXKA 1NX6A 2PH5A 2J8ZA 1W8DA 1GYRA 1LC0A 1EVJA 3V2UA 3F5QA 3AW9A 1XU9A 3RUHA 4XDZA 5JBIA 1YWGO 3I83A 3TOZA 1E1MA 2VCYA 2GRAA 5A9RA 1Y8RA 4WE3A 3VZRA 2ZIZA 1SEVA 4EZBA 5KTKA 2X86A 1DPGA 1E7YA 2QRJA 2Z1NA 1BTOA 3RVDA 5LCXA 3WQQA 5A3JA 3BYZA 4TKLA 5HA5A 2GN9A 2WWRA 3SEFA 4OKIA 4NFSA 2CVQA 5DOVA 4MKXA 1A4IA 4D46A 3I4CA 5JAIA 2H1SA 2DTDA 3Q11A 3GFGA 1QYDA 3PJFA 4Q3BA 1MLDA 4AJ2A 3CXRA 5K9ZA 5HTOA 4O6VA 1O0SA 4DC1A 3QWAA 3RWBA 5ICSA 3LDHA 4KOAA 5KVQA 2HMSA 4BNFA 2P91A 1DIHA 2ZTUA 3UUWA 2PKRA 3WDSA 4ZN6A 4Y9DA 3ZU2A 5FI3A 3OETA 5HS6A 3GNSA 5CG2A 1SBYA 4BNHA 3MJEA 3AOEC 3JYNA 1DRVA 1X14A 1I5RA 1A7AA 1KEWA 1MFPA 1TLTA 2P2SA 3KB6A 3KTDA 1LTHR 2JL1A 3HNPA 4J6FA 5EIOA 3JYQA 6LDHA 4LCJA 3VH3A 4IGFA 2HMVA 1BMDA 1U1IA 1R4NA 5L40A 5JAMA 3BMOB 1WZIA 3JQ7B 2CUKA 4BO4A 3QWIA 5CDGA 2IZ1A 4B7CA 4IJWA 2RIRA 2HO5A 4ALLA 1P1KA 2GO1A 5A3VA 1KC3A 4BV8A 4EI2A 3WIDA 3ENKA 2AA3A 5GZ3A 1GCUA 1JW9B 2DU8A 1GEGA 1ZJYA 4KWIA 4M89A 4UUPA 2W2LA 3NT4A 4JBIA 1HL3A 1E3WA 1N1GA 4IDEA 4ZGWA 4CM4A 3W6UA 2AQ8A 4BNTA 1U5CA 4WLUA 1B2LA 3N74A 4FR5A 1VL6A 1XKQA 2EG9A 2X1HA 1ZFNA 2QHXA 3R1IA 4PCVA 3TNLA 3LC7O 1RYEA 2C2YA 1AXGA 4M55A 4XYEA 3UVEA 1FDVA 1MXFA 3DTTA 4NQZA 4E2WA 2IE0A 2I6TA 2YDXA 3FBTA 3QRWA 3QP9A 3FHLA 1X1EA 4RL6A 4YVFA 3IJPA 3DONA 4R1NA 5L45A 1NHGA 3CTMA 1V8BA 4TSKA 3SJ7A 1U5AA 4OYRA 3WXBA 3ZV3A 1YQDA 1XEAA 1U2DA 3GFBA 1O94A 4WLNA 1NQTA 1NVTA 2YHUA 2X4GA 3JD3A 3DBVO 3I9LA 3QQPA 2VN8A 4YAJA 3WTBA 2H9IA 1YBAA 3C1AA 3KETA 3OA2A 4PG5A 3P2OA 4QFCA 4EITA 1Q0QA 3V1YA 2BI7A 1HYGA 2P9EA 3FR7A 4DLLA 3MZ0A 5BSGA 4FBGA 3RI3A 3WLEA 1DFIA 4QSMA 1BGVA 1KVUA 4FSHA 2FHSA 3VTFA 1W4ZA 4HADA 4NDNE 2B0JA 3NRCA 3A9WA 4ILKA 5EN4A 3NDRA 1N7GA 3RKRA 3P2YA 5BSEA 5G4KB 3AM3A 2ZB7A 3JD4A 1VSVA 1PJ3A 1YBVA 1ZNQO 4L4RA 4J4BA 2H5LA 4U7WA 1BXGA 2WD7B 2HK9A 3F4BA 4KWHA 1JWAB 3JQGA 4FD3A 3PZRA 3D5QA 3P7MA 4OOFA 4YQYA 4RVFA 3V8BA 1E7QA 4BNNA 1VI2A 4WCFB 2VZ0A 1W73A 4PLFA 1MG5A 3OM9A 1OC4A 3RC7A 2JCXA 2NSDA 2OZPA 1GY8A 5K0ZA 1CF2O 1X0VA 5I7SA 3DAPA 3ZWAA 3GMSA 4RVHA 1GUFA 3PIIA 4E2ZA 1U3VA 4JROA 1KVRA 3RC9A 1E77A 3OJFA 3N7UA 3HN2A 4R54A 3DAFA 2JAHA 2X6TA 3INRA 4XA8A 5T5QA 3ZI0A 5HBRA 4EEXA 1HTBA 1ENOA 1DJNA 3DDNA 4JNKA 3T4XA 4RQUA 1P0FA 4AJ1A 4BO6A 1OI7A 2ZTLA 3SXPA 4PG7A 5G0VA 3K2BA 3D4OA 2JFHA 5KWEA 4G5HA 1ZKMA 4NPCA 5BSHA 2Y1CA 3TZQA 1E3LA 1LNQA 1GEEA 1RM0A 4IXTA 4XCVA 4TRMA 1OOEA 3TN7A 4D3DA 2FY8A 3O4RA 3EGOA 1VSUA 4YTEA 3KSDO 1X1TA 4R16A 8ADHA 2WE7A 3KV3O 5KKCA 3UFXA 1QV7A 1Y8QB 3OQBA 1TEHA 2D0IA 4HWKA 4J49A 5T8KA 4LRTB 1U3TA 4F6LA 2DBRA 4UUMA 5ITVA 3L4BC 4CMAA 1LXCA 3AI3A 3I9KA 4PLCA 5L95A 3FBGA 3GVPA 3HSKA 4HNGA 2AEFA 3M1LA 3INTA 1U7HA 1YE3A 5L3ZA 3SLKA 2IZZA 5THQA 3MJTA 1JAYA 1HDOA 2NVBA 4GAEA 4J43A 4YEDA 4CMEC 1B8VA 1HE3A 1SB9A 4GSLA 4CM3A 3DXFA 1CERA 1ZSVA 3E5RA 3ZV6A 1EFLA 1P31A 3I6IA 2O2YA 4DVJA 1CWUA 1T4BA 1XQ6A 1NHWA 4M86A 2Y0CA 1LRKA 4OL9A 2BFMA 3B1FA 4R1UA 1UP7A 3AUSA 3ZU4A 1IZ0A 4J9VA 3AFNA 2EHDA 4XD2A 4JP2A 2BGMA 4JP3A 3DHEA 1UXHA 4AJNA 4XKJA 2J3IA 5JCJD 3PDUA 3W8DA 2ZB3A 3T7EA 2QIOA 3OIFA 3OJOA 3TF5A 3DZIA 5BT9A 3F6YA 4IZHA 4A03A 3IKVA 1U8FO 4CQLA 3OFSA 3CPSA 3LLVA 1M76A 1XCBA 1PL7A 1RPNA 1EDZA 1W6UA 1ZUD1 1NQ5A 2LDBA 4MKZA 5CEFA 4DIOA 2ZCVA 1E3IA 1FDWA 5IDWA 4HFMA 1Q0HA 4E5YA 1P3DA 1N7HA 4ROSA 3U49A 5G2OA 4K26A 4PGFA 3BMNA 5H81A 1TT5A 3DBRA 3DR3A 3GT0A 4FN4A 3PQDA 5DDIP 5JAZA 2B4QA 4DBZA 2ZJ0A 4AG3A 1H6AA 2HU2A 1XDWA 3AY6A 5IZ4A 3ZHZA 2VYVA 3VPSA 3JQ9A 1P44A 1TT7A 3B1JA 4E2YA 3CMMA 2O7SA 2GNAA 1AXEA 2Y1FA 1EUDA 3IC5A 4L4SA 2JHGA 4QEDA 2WTBA 4BIIA 1RKXA 4RVUA 5TSDA 1X15A 3NTQA 4GSKA 4WASA 1U4SA 3A4VA 3DHYA 4UVIA 4BNWA 1OMOA 2ZTVA 4LW8A 2D5CA 8LDHA 3MTJA 2NM0A 3GA0A 1H5QA 3GVCA 3UCEA 1HWYA 1ONOA 1Z7BA 1G1AA 4CM5A 5B4UA 1GYPA 5CHEA 2YYYA 2PR2A 3MOIA 4QO7A 1PGNA 5JAQA 3ZWOA 1ADFA 2QW8A 3RUFA 3EHEA 4H15A 1ENZA 2Q50A 3DZHA 2VRBA 4XGKA 2JD2A 2D1YA 2YHIA 1HT0A 1K2WA 4LVUA 3KLPX 3UKOA 4CMJA 4IS2A 4HFRA 4LISA 1E92A 4GX1A 5L7YA 1YONA 1LA2A 2E37A 4U6QA 5K6AA 3TRIA 1GZ4A 2PY6A 4XIJA 4AJ4A 5HS4A 2EP5A 2IZ0A 3AUAA 4MVJF 2WJPA 4IPTA 1P33A 2PZLA 2TMGA 1LI4A 3JD2A 1E6UA 4X54A 3STHA 3DWFA 2CDAA 4U6SA 5LDHA 2RHCA 1UAGA 4OO3A 1PL6A 5BNFA 3S2IA 4BO9A 3KHUA 4PRLA 3FPLA 3HN7A 1R12A 3ZWMA 4EDFA 2ET6A 4IDCA 4YCAA 1UUFA 1ZW1A 2E6UX 3TDKA 1ISFA 3UCXA 3COSA 1I24A 4A5OA 3GPDG 1CRWG 1YO6A 4IINA 4BNKA 4WNIA 1T2CA 2HDHA 3CEAA 4AJEA 1UDBA 3PIDA 4L8VA 3WGHA 5IN5A 3ABIA 1F8GA 2I76A 3MOGA 3QJ5A 1Q7GA 1CJCA 4I9HA 4WECA 1PJBA 5F21A 3CINA 2Q2QA 4TZTA 1JVSA 5IFLA 1EEHA 3LSYA 4XRGA 4NK4A 4LK3A 3RJ9A 3O26A 1R15A 3AM5A 2FZEA 3JQAB 4NFHA 4ZD6A 2R6JA 5JO9A 2VYND 4II2A 3R0IA 4YJHB 5JSFA 1A72A 2AQIA 2CZCA 2HK7A 4B4OA 3TZHA 1Y1PA 4ZA2A 3FD8A 3KOUA 4BKOA 3DFUA 1I32A 2HRBA 1E0DA 1FDTA 1QORA 4M49A 4MIOA 5JMPA 3SC4A 2UDPA 3I52A 4LSMA 4XJTA 1I10A 1Y9EA 3FRJA 3JQBA 2X0NA 4DMMA 4WLOA 4Z9YA 1QXSA 4YT8A 3E48A 2RHRA 4RO0A 3A1NA 5C5IA 4CMBA 2BGLA 1T25A 4M54A 4Z9XA 4CMCA 1C1XA 1I01A 3PYXA 1C1DA 1QYVA 3G3EA 2Y05A 1DBVO 3V2GA 4I5DA 1GQ2A 1WDLA 3UGKA 1R0SA 2IXBA 3OIGA 5IF3A 2X58A 1E3JA 5A5FA 1X0XA 4IDBA 1I2CA 4Q3NA 1J6UA 4N5MA 4DGSA 2EERA 3CIFA 4JBGA 5KJEA 4BGEA 1LDMA 2E49A 4BVAA 4DYDA 3WBFA 1HDYA 5IZCA 4TRNA 4PLWA 4XQGA 1IHXA 1T2AA 2YFHA 3NT5A 2EKQA 1R66A 2OMEA 9LDTA 1KYQA 2Q4EA 5DP2A 4D3FA 1XU7A 4NIMA 4BGIA 4CMGA 4J4TA 3WYCA 3I9OA 1M66A 2VUUA 2Z95A 4CV0A 2EEZA 4BNYA 1P0CA 4QTZA 1NQOA 1DJQA 5AXAA 3D7LA 1XA0A 4NU5A 4BNXA 1PEDA 4NZ9A 3JD0A 4QQRA 5BSFA 3K6JA 3WFIA 4WEOA 1KEUA 3UN1A 2PGLA 5A4DA 2DUWA 3K8ZA 1MG0A 1BG6A 1ENPA 2IEBA 1O95A 1WMBA 1KEPA 2PGDA 2YV3A 3ETEA 4L75A 4TVBA 2CSUA 2B5VA 3K73O 1HE2A 3L6OO 1DOHA 4WLVA 5A5EA 1DHTA 2Y99A 4OJNA 4RVSA 2GERA 2AMFA 2A94A 5A02A 4JX8A 4E6PA 2P9CA 3KLMX 3NUGA 5TGDA 3D64A 4LSWA 2DKNA 4AJOA 1JKFA 2I9PA 2V6GA 4ZRNA 3A28A 1JA9A 3AWDA 3K30A 2O7QA 4YJGB 4E13A 1TXGA 5DOZA 3OA0A 3PGXA 1DSSG 4YAKA 2WD8A 4WOJA 4CM6A 1Y81A 3QVSA 2DBZA 4DQVA 4Q9NA 5JYDA 3RASA 3PEFA 3A14A 1L7DA 4E31A 3B20A 3ANMA 1XSEA 4WNCA 1VKOA 2Z1MA 2BRUA 3M2PA 4P4NA 3K2EA 3DB2A 3ZNOA 3KZVA 4I5EA 1B8PA 1GR0A 3ZCXA 3O8QA 2NVUA 3NAQA 5EQFA 3PYMA 3GVHA 3TZCA 2C20A 2YUTA 3GEMA 1KIFA 3PVZA 3GH3A 1QYWA 4G2NA 5A9SB 4IY1A 1VE9A 3BXXA 4I5GA 1ONNA 3CH6A 2EF1A 2IXAA 1IPEA 3PLNA 1NR1A 1K6XA 4FGWA 1DXYA 3NGLA 1YDWA 4GKVA 3GDFA 2CVOA 3GEDA 3OJEA 2X9GA 3KYDA 4YQZA 5JCXA 1WDMA 3H7AA 4J7XA 4RPHA 4XYGA 2J5QA 1EUCA 1H2BA 1Q2XA 3BMCB 3DHNA 3FWZA 1PU2A 1HEUA 2GPTA 1GUYA 3D3WB 1P1JA 3B70A 1RM5A 1YB1A 4RF2A 4DWVA 1D8AA 5TIIA 1BVRA 2B4RO 1D3AA 3I23A 5THKA 3UXYA 3V5NA 1EQUA 1O8CA 2YJZA 1J4AA 2ZYDA 4A0SA 4BL5A 5JY1A 1JKIA 4BO5A 4L4XA 4GX2A 3AFMA 2W8ZA 4BUCA 2YQ5A 4BNVA 4P4LA 2GCGA 5ENVA 4E5PA 1JQBA 3DMYA 1A5ZA 1LRJA 3NJ4A 4ZHSA 3GGOA 4E21A 1BW9B 1HDCA 3VPFA 2XXJA 3A06A 2B4TO 3BIOA 1NFFA 2HAEA 2DFDA 3JD1A 5T8KC 4PZCA 3FF4A 3ZN2A 1YVEI 3PYLA 3ASVA 1MFZA 1WP4A 3NDJA 4OKNA 1PJSA 4CV3A 2W2LD 4B4UA 5KCZA 4PIVA 1H2HA 3H2ZA 3PWKA 2VT3A 2DPHA 2X5JO 1HE5A 2IYPA 4CM9A 4WK6A 3G1TA 1HYEA 1LDNA 2VHZA 4DPKA 4KMSA 3IP3A 1NAIA 3VZQA 3WX0A 5KKAA 3T7CA 2DTXA 3LYLA 4DLAA 5A06A 3DTYA 1S7CA 3HB4X 1GPDG 4PG8A 4WUVA 1E1KA 1NWCA 2QRKA 5JDCA 4OMUA 3ANLA 3U9LA 4GH5A 4CV1A 5BQFA 1LDGA 3ZWCA 4FPXA 1DC4A 5ILGA 3IOYA 3LZ6A 1CQJA 2G5CA 1LLCA 4RCVA 4GL4A 4I08A 4EBFA 3ZWBA 5JMWA 4XR4A 2DFVA 2O3RA 2X5OA 3HUDA 4MVJI 3VKVA 1QMGA 4CLOB 4CQMA 3G49A 1H93A 1HDRA 1I30A 3GY0A 2ZJ1A 3OEWA 5TJ9A 2EJVA 1YQGA 1N5DA 2F1KA 3W4KA 3RFVA 4W4TA 2FR1A 4NBTA 1H6BA 3SC6A 3KO8A 3E9MA 3BMOA 4YRDA 5MDHA 4PFJA 1WNTA 2Y68A 1GV0A 1DEHA 1AUPA 3AK4A 4Y6SA 4L9RA 1VRWA 1PR9A 3I1JA 4FC6A 2GF2A 4MDHA 3ZWWA 1RJWA 1Q7BA 2HJSA 3F46A 2DAPA 4OXYA 3PK0A 1J49A 2EKLA 4LMPA 4HFJA 3E9QA 4Z0HO 2VHXA 4RQTA 4RORA 3JQ8B 1DC6A 2HUNA 1MC4A 4DQUA 3M6IA 3OSUA 2RH4A 5COAA 2WMDA 4YJFB 4YAIA 2JFGA 4WJZA 1UZLA 2I5PO 3WYEA 4BQPA 3Q2IA 5ILOA 1QYXA 4YB8A 1ORRA 2H6EA 3ZU5A 5L7WA 3LT1A 2HMWA 1ENYA 1FMCA 4R1TA 4HKTA 4RPKA 4UVEA 2J3JA 5T67A 1D1TA 1KC1A 5J23A 2PNFA 4FFLA 4DIBA 1IL0A 2Q2WA 4XZ3A 2W98A 4PG4A 1ZMTA 2RBEA 1RYDA 3F5SA 4YR9A 4XJSA 3IQDB 4HX5A 3GUCA 2EGHA 1GL3A 3IS3A 1U28A 2O3TA 2PD4A 4OSPA 1DC3A 1E7MA 3D1LA 1YKFA 2W90A 4UEKA 3WGOA 1ZEMA 1DFGA 3DBLA 4FS3A 3OHSX 4PLGA 4ND5A 4O5OA 2FZWA 4C7JA 3U0BA 1RM4A 5K6AC 3IAHA 4W7IA 4R5HA 4CM8A 3GG9A 2P5YA 1SZJG 1NYTA 3CZRA 1PJTA 1V3TA 3ZHXA 4BS9A 4U5QA 5CDTA 2PGJA 1GADO 1JU9A 4JBHA 5G4KA 4F6CA 2AQKA 1P1RA 3F1LA 1DO8A 5T64A 1XELA 2NU8A 3UHAA 1VL8A 4NI5A 2JD0A 2WD7A 4DXHA 1YB5A 3ITDA 2CDBA 4NR0A 4XDYA 2AG5A 2Y93A 3IUSA 4EW6A 4RGBA 1ID1A 3VVBA 4E30A 3EVTA 5LDGA 4TWRA 5JE8A 4U0KA 4W6ZA 2YFQA 3AU9A 3AOGA 2JCVA 2XF8A 5HWSA 3QVXA 2PZMA 1TA4A 2QZZA 5FFFA 1A7KA 2GN6A 4KUEA 4J1NA 4ZICA 1JWBB 4FFOA 2Y1GA 3AUTA 4RF5A 2QZ9A 2X0JA 1U9JA 3WIEA 4CUKA 4UEOA 4UUOA 2Q49A 5IDQA 4O59O 4BO3A 1P1IA 1PL8A 4BGUA 3S2GA 4RJTA 4GWGA 1HRDA 3RC2A 3HDYA 3FI9A 4RZHA 1GZ3A 1UP4A 3HJAA 4LRSB 4CMIA 1YB4A 2Q45A 5LC1A 1LLDA 4N7RA 4BO8A 3IL2A 3V1UA 3QE3A 1GFSA 4EYEA 4J91A 4ND2A 1E3WB 1YQXA 1DIAA 3I3OA 4AL4A 4JCOA 1R4MA 3INGA 4OXNA 3BHIA 2BH9A 4MP8A 1DIBA 1MXHA 3FCOA 1H0KA 4NNJA 3UOGA 1IB6A 4GBJA 3BZUA 1PR3A 5EPOA 4MIYA 4BMNA 1G0NA 1SEPA 2Z5LA 1E3EA 4XQCA 3X2EA 2DBVO 3ZWNA 4BB5A 3E1KA 4RV9A 5TT1A 1R16A 5B1YA 3OJ0A 3GAZA 4XB2A 3HADA 3KSUA 3B6ZA 3PJDA 5DF1A 2CMDA 4PN3A 1K89A 2I67A 1K5HA 4MP3A 4NMHA 1XYGA 3F9IA 4ONEA 4DLBA 5CDYA 3PJEA 1N92A 1Z74A 5EINA 3N58A 2PD6A 1J5PA 1R0KA 4F46A 5IZCC 4J3FA 4KUHA 4ALIA 4ND3A 2RCYA 1EK6A 1ZJZA 2A92A 3DZGA 3PI7A 4MVJA 4U0JA 3TZKA 3GNTA 3BMQA 3RU7A 3PDJA 4YDRA 2IRWA 3ONFA 4O1MA 3ZWXA 1Z7EA 1O5IA 4XEHA 3RBZA 3Q3CA 1GV1A 2NADA 2AEMA 1EBFA 2ZYGA 3GPIA 2X0RA 4JLWA 4RF4A 2IYOA 1NXQA 4M8SA 1P9LA 4XGIA 2E48A 4IQ0A 4I1IA 1VPDA 4F45A 1V3UA 1WZEA 1X7GA 3OMLA 4H16A 3WSVA 1ZCJA 5JO0A 4DPLA 2BF7A 2PKQP 1CETA 2AG8A 3QIVA 4NG5A 4PLYA 5FYDA 4BKPA 4TVOA 3WNQA 2XAAA 3E8XA 5DCUA 4NJMA 1HETA 2VT2A 3FNFA 4HFNA 3GMDA 4FFRA 2P9GA 3EK2A 3UAGA 1NBOA 1ZK2A 3DMTC 3RFXA 3CKYA 4D45A 3AM4A 2VUTA 4I9NA 2ZB8A 3OQ1A 3L9XA 1QG6A 4FCCA 4IXWA 1SB8A 3KM0A 1UXGA 1T24A 2FSVA 1I33A 4NBWA 2O4CA 3W8EA 1LRLA 4AJJA 1SMKA 2XOXA 1ZXBA 4R1SA 4WCDA 1VJTA 4WOKA 1ZBQA 2TMDA 4Q3AA 5TLSA 3LT4A 4D42A 3U09A 3RUIA 2EKPA 1P45A 1ZH8A 5B37A 3W4IA 1IE3A 2GSDA 1YJQA 4GKBA 1ZK3A 2NACA 3E9NA 2QRLA 4PVDA 1ADBA 2UVDA 5AXBA 3PRJA 3VC7A 5CG1A 4BO1A 3PQEA 1K6IA 2C7VA 5CPFA 3GVIA 2OGUA 4MKRA 3VDRA 3AU8A 4CM1A 3TJRA 4F3YA 4D0SA 1I8TA 1MA0A 4KQXA 3DZFA 2V6FA 1F06A 2UYYA 3H2SA 1EE9A 2PWZA 1FDUA 1PZGA 1SAYA 4JK3A 4HXYA 3R3SA 4EUHA 5ADHA 4J4HA 1LEHA 3P5SA 4FFMA 4OSOA 1FK8A 3C7DB 5DCYA 1HDXA 1EBUA 1UXIA 4BNJA 4YRAA 1ZSNA 2GYYA 5U4QA 2Q99A 3ENNA 1EE2A 5G0WA 4EJ0A 2QQ5A 5L51A 1B3RA 4MVJP 4CUJA 1ZO8A 3UICA 1YH3A 2O50A 4Z3DA 3TOXA 4BKUA 4ZU3A 2BKAA 1WDKA 1PS8A 2GR9A 4LVCA 3H5NA 4YAGA 2B5WA 5AXDA 4CLRB 5GMOA 3QWBA 2JFFA 4R5MA 5I9NA 3EAGA 1NFQA 1K3TA 1LC3A 3Q0EA 1KS9A 3WG9A 3FTPA 2Q4BA 5JC1A 3GZ4A 1GDHA 1T26A 1A4UA 2NWQA 5EESA 3JQAA 1QYCA 3OIDA 3VZPA 4B8WA 3ST7A 1UZNA 1HLDA 1GZ6A 3DEYX 4GLLA 3AY3A 4BO2A 1IYZA 1PQUA 3RD5A 3BMNB 5FEUA 1WPQA 3RC1A 3QLJA 5A1TA 3H9QA 4PLPA 1PQWA 1XIVA 5A9TA 2X7HA 4DC0A 1DIRA 4CLEA 1DAPA 1ZK1A 4IIUA 2UUOA 3LVFO 3K92A 4BMSA 1O6ZA 2F00A 4CMHA 1KEVA 5EL0A 1NPDA 4YRBA 1YL7A 5JDCC 4EUEA 3NEPX 1U2GA 5TF4A 2X9VA 3JYPA 4WEQA 2B37A 3LC2O 5TRTA 2W2KB 2V6BA 3DFZA 1VL0A 3P19A 2ZATA 4Y6PA 4CODB 3GG2A 3KYCA 4E5KA 4EGFA 4R9RA 1AHIA 3V1TC 4K6FA 2I66A
chains in the Genus database with same CATH superfamily
2V7UA 3VNQA 3GBSA 4HS4A 1E9AA 4AC9A 1N6NA 4ZAZA 2ZIVB 3HACA 1HY3A 2P5TB 1AA6A 5AHRA 1ZUNA 4I6JA 2ZSBA 4LXHA 4D0RA 3RYIB 5EMLA 1DJMA 3I6YA 4LHWA 1JTVA 3J7TA 1MGOA 4C0HA 1DBIA 1SBHA 2CLHB 3BB4A 4U63A 4DLWA 4G1MB 3PFKA 2PPLA 3NGXA 2KE5A 4REQA 1ML3A 1QQ6A 1LS6A 1OU4A 2OHVA 1I0ZA 2PXCA 3DFMA 4Y6GB 5LQCA 2FRDA 3E5HA 4JQZA 1N33B 2RHTA 1XRRA 1ZIPA 4P33A 1QP7A 4P9NA 3OPMA 4C9BA 3A3OA 5JYCA 4JUCA 1E1YA 3OH8A 4AG5A 1ZXXA 3NHRA 3K5IA 2VOJA 5JWHA 1JJBA 3N0XA 2G8NA 3RLFA 2PO7A 1HOXA 1Y4UA 2HTFA 1SXJA 2QD5A 1IRIA 1ESEA 4PXYA 3VZBA 3G9ZA 4WZBB 5TC4A 1XVUA 3WL4A 3DEKA 5L3SA 2WVJA 1CZLA 2J09A 1E66A 5DP1A 3G85A 5FLXA 2WU8A 6PFKA 3BTOA 1TM1E 1ZW6A 2ATEA 1CR4A 4XWKA 3IMFA 4PC6A 1JHXA 2ZBDA 2DLNA 3LL7A 3OZIA 4TTTS 2ZE8A 4WADA 3DDUA 4ZVTA 4J3NA 4B5LA 2IUSA 2PRYA 4JC0A 3ISTA 1L7OA 2X2FA 3IIEA 4G0MA 5JLJA 3L0DA 3EBLA 2DP4E 4LMAA 3WBJA 4Z0TA 1KEEB 2GCOA 1ML4A 1XMIA 4I1OA 4IEFB 4D0GA 2V3VA 1EK0A 2B1QA 4M2LA 1ZH4A 1F7VA 3A10A 3CMCO 1EVQA 5BQPA 1TDJA 4D3YA 5REQB 1OD6A 1WE2A 2NXWA 3VISA 5HCNA 4YN3A 4AJOA 3LHKA 1GZHB 3MJCA 1QCCA 4GM4A 4J1TA 4R4JA 3VM6A 2GZ3A 1G21A 3VPXA 4UM7A 3W5AA 1JKJA 2JVJA 4O2AF 2PUTA 3H8VA 3IR7A 3QA9A 1VMEA 3L0OA 1EVIA 3LK7A 3SM9A 3M5CA 2MYUA 4HZUA 4P8RA 1BXRB 2UZ0A 3GFTA 4U2KA 4UM5A 4WXEA 3GRCA 1GUZA 3WMGA 3H9EO 1P0MA 3F3YA 4B1FA 4TQUS 4HZGA 5TPWB 1GLNA 1P75A 4GLJA 1NTRA 5FJIA 4QBHA 4UQLA 3FOZA 3LP6A 2QM0A 3IE1A 1I9GA 3ND5A 2G07A 5E3JA 2PVPA 4Y98A 3HVIA 3RUEA 1P9WA 5LN1A 4C4SA 3AUFA 5H3CA 2O2GA 1VPVA 3FNHA 1FS4A 4D4JA 3WLPA 1E1CB 1O3YA 1FFGA 5TT0A 3RV3A 3RWMB 4IP0A 3ZHVA 2CV2A 3U6BA 3LCJA 3D54D 3QVMA 1U2DC 4AO6A 1I4OA 5GZ1A 3D3QA 1DO2A 1VMKA 1NTOA 3PDHA 3K9QO 4FKMA 2H2GA 5AQ1A 3VH1A 3B6IA 2RMKA 1JALA 5JCOA 5CVTA 1Q15A 5JAPA 2FMUA 1DLJA 5CGZA 3HHEA 5AKXA 4EELA 3GLUA 2XUGA 4OD0A 3D3WA 3WB0A 2WI8A 1B6GA 3C6XA 3OLCX 3VDQA 1KETA 2G9ZA 4MRMA 4OQXA 1VGRA 3LXMA 4GYWA 1BN7A 1OKKD 1QYRA 2HU5A 5BO5A 5JQGA 2X9NA 3G9XA 4XTCS 4YMTA 4H2DA 4L4ZA 2MMGA 3F1KA 5AHXA 2XVMA 3HYTA 2WOOA 4X8MA 4U39A 5HIIA 3TLJA 2ZT5A 4ZVRA 1DRKA 1GT91 2H08A 3PPWA 1WSAA 5F12A 5JFGA 4KLAA 1LQTA 4NAUA 3QUQA 2PA3A 1NY5A 2QMZA 2ZI7A 3THYB 2HHJA 3HFRA 4M99A 1OFUA 3E3AA 3LFHA 4PZDA 3M5WA 4F38A 4EY5A 4JLUA 1PJZA 3ZLTA 1YZGA 2HT1A 4CQMD 1RADA 4JNCA 5ADUS 1CUCA 2IHJA 4EQ6B 2OHGA 3E9CA 2C4NA 3VBCA 4DCMA 1XZHA 1ECLA 4LCEA 4OJQA 4K6OA 3HVUA 4Y1EA 2LCFA 3S68A 4WGGA 2IPXA 1ZCBA 5SY9A 4CTMA 2W71A 1WOYA 4GVLA 5ES3A 5K8LA 3F6PA 4PLHA 4ZVNA 4BN0A 3DDCA 1QNLA 3CUEF 1JMYA 3ETJA 4C0KA 3W5DA 3TFOA 2ZWVA 3LBYA 1EQ2A 1JLKA 1M6WA 1Q22A 2EC5A 3LPNA 3S81A 5IWCA 2EWVA 2J5RA 3T4UA 2AR9A 2D54A 2ZBPA 3IUPA 2ZQYA 4GEKA 1ZP6A 3Q9NA 2PGXA 4J2HA 2DRIA 2O8FB 3CX6A 2WVGA 3HUFA 1FW8A 4R0NA 4YCDA 1T8YA 4ZVKA 4Q9KA 4BNGA 3O8LA 1N9KA 4D6XA 2F64A 1JA1A 1K27A 1QLJA 1XTRA 4TKZA 3TH5A 4X45A 5I9IA 3UK7A 3DZCA 4YWJA 2FR0A 5DTIA 3NONA 4ZAFA 2H4FA 1TYCA 3OM8A 4QFDA 3U3OA 2VK4A 2MSCB 4DUGA 5BY2A 3FFXA 4XWAA 4PPQA 1JLRA 5EXPA 4IDDA 2OHFA 1MX9A 2P75A 2XTZA 2J48A 2AE1A 4C87A 3AFOA 1AK9A 3E18A 3GJ3A 1H9CA 2WZBA 5LDDC 4J1SA 1PZEA 5LQNA 3B3GA 3AEQA 4C4XA 1RCUA 3AUYA 4GWLA 2A84A 3IAUA 4EFNA 3O8OA 4M1KA 4J16A 5ESWA 2Y0PA 1GPH1 2GXAA 1WLSA 2BCEA 1D6SA 3M6FA 3F90A 3ZWPA 4TZ6A 3NKFA 3AEUA 2V9PA 5HF8A 1WB4A 4E12A 1YZUA 2CXSA 3PUWA 1PYGA 2QNRA 1CVLA 1QLHA 4GMDA 1XNRB 4DW8A 2OQRA 4KXMA 1VBMA 4NICA 4NENB 1WAMA 3H1BA 3P9SA 5DHQA 1ZI6A 3O9ZA 1IZ8A 1QB7A 3SMQA 3NQ41 4GUAA 4ND6A 4OI2A 2P4SA 5IAJA 1PGJA 2CDRA 3IIJA 1YFJA 1GARA 4JQCA 4L6CA 1D0IA 1ESNA 1ATZA 1USVA 2A9PA 2ZUCA 5AM1A 4C0QC 4ZYVA 4B2IA 5BW4A 1E3SA 2NV6A 2P4QA 9ABPA 1VLLA 1C9NA 1EM8A 5CXSA 5BR7A 1PDWA 2AN1A 3WQRA 1LSOA 5IN4A 2G8LA 4LJ8A 4Q39A 3OPVA 4MZXA 1AK1A 4V2UA 3ZX5A 3N2KB 3PNSA 5CVDA 1NSYA 3B5JA 1P74A 1SPBS 1L4KA 1C9DB 3I9JA 4CF4A 5IVDA 4KH1A 4KGDA 3WOHA 3KQUA 1P3JA 2PYDA 3GA5A 3GLIE 5CBKA 3NV7A 1CY7A 1O03A 1QR2A 2F59A 2SBTA 5DYIA 3KTAB 5E2IA 3LWDA 2NZ8A 4CQNA 4QAJA 4HUJA 1CUFA 1XVIA 3IP1A 2AK2A 3KKKA 4H6XA 3DL2A 5ULLA 4DYHA 2B98A 3AERB 2R4QA 4IMPA 3V80A 4RVOA 4KE8A 5F1PA 3WRYA 4DL9A 2PS0A 2ZVQX 3AP1A 3RSQA 4NX2A 3OQJA 5LIRA 3U4CA 1M74A 3BS4A 3JQ7A 3LQRA 4Z51A 2BM0A 2GCEA 3DOCA 4G63A 1XNQB 1W0JA 3DOHA 1XTQA 3CE6A 1YFZA 2Q1WA 2B3DA 4RH1A 4GOLD 3ESQA 5KI6A 2YHBA 2NU7A 1BHJA 3RUDA 3Q7PA 5KX5A 4QYXA 2C0PA 2UYHA 1YMUA 3WWYA 3VTZA 3TTWA 1RDFA 1A7JA 2QN1A 2YOHA 3AF0A 3A1FA 1K08A 5AXCA 3KD3A 1MOSA 3U4IA 4YDSA 1RKBA 1E4EB 2D2XA 5ER6A 2XJ9A 3RS9A 4UNQA 2ODEA 4K88A 3HGMA 1GPMA 3IUMA 4FC7A 3LK6A 2P78A 2WM3A 3CJRA 2PZGA 3ZHSA 2QVXX 2JLUA 2NZYA 1A5SB 3TWOA 5J4HA 1NJ5A 4Q16A 1JP7A 2FFHA 2RHLA 1RXVA 2UUBB 2VVTA 3E7WA 3U16A 1FFDA 2Z6QA 2OWDA 2EDAA 4BTEA 4YV0A 3T1TA 3H3FA 3UAYA 3BHJA 4XCQA 5DBHX 3TOCA 2I80A 4GOXA 2RONA 3RLIA 1RFGE 2WJGA 3G79A 5ALHA 4D43A 3C3KA 3S2YA 4EVQA 4LECA 4MB2A 4B80A 3KE9A 2K4MA 3DO6A 4I8DA 4LDQA 4CLHA 5BXQC 4HP8A 4JLKA 5DM0A 1NGSA 2ECKA 3FPBA 3KXIA 3ZDQA 1NVXQ 5FBRB 1CUSA 2HF7A 2VSYA 1F51E 2WWTA 3L8EA 4CQMB 5GGXA 2RAFA 3SZUA 2HL6A 3V1NA 1T13A 1V8FA 3MN1A 3W2HA 4X63A 4IGEA 2HCBA 1GZVA 1WXIA 2HRDA 1X7HA 2XTJA 2UZ3A 3H4TA 4FEGA 4HDMB 4LOIA 4G0VA 1AMOA 1XZJA 3WYAA 4DRXB 4BQIA 3CVYA 4L4UA 5DXAA 3HB9A 4F4UA 4R9UC 1FYWA 3VAYA 4EA9A 4A2QA 4RKQA 1PSWA 1K9SA 4IHJF 4AXXA 2P67A 2Y1XA 2F3RA 4KGXA 1L3CA 1B8UA 1U8CB 3MT9A 3HVJA 3PZBA 4LQ4A 3DNFA 3OC0A 5DW0A 2Y0BA 1BO6A 3K6KA 3ZE7A 2DULA 5CH3A 1GAEO 2GN4A 5KOIA 2EP8A 3VHQA 5HFJA 3O4GA 5B55A 5COQA 3ZQJA 2A6PA 1HMPA 3OO0A 4WAUA 5K3BA 4Q02A 5CCXA 4PZYA 3GO4A 1R0RE 1ZXLA 1EVYA 1IY2A 4EPWA 2XMZA 3C97A 1X3SA 4LWZA 1AHHA 5BQXA 2VRNA 5K3AA 5BRJA 2FPMA 3LO8A 3HWRA 2HFKA 5A0FA 3TFQA 2ADOA 2AJCA 2FW8A 1GZ5A 1IQUA 2HRRA 2P8JA 1F6BA 1WWKA 1EFCA 4RW0A 2SNIE 4QUIA 2W4MA 3EMVA 3EXHB 1IN8A 2GK4A 2WUEA 5G1PA 3FYUC 1XCMA 2GF0A 3FUXA 4FHGA 3PJGA 4IIDA 4FK8A 2VJMA 3FMPB 3D4BA 2H0RA 1GPWB 3EXG1 3V8MA 5JH7A 2CL5A 4FS8A 3IX7A 1RRPA 3ZZNA 1MJ5A 4A73A 1UH5A 1T3HA 3IODA 3Q8XB 4RK1A 1S2LA 3G7NA 3TE7A 5LJIA 4GQAA 5LA6F 1N75A 4OHOA 4EW3A 3EXFA 1M2WA 1Y6ZA 1BIFA 5GOZA 2I65A 4B84A 4ZTBA 1AUOA 4DCUA 2IHZA 3VVLA 4YUWA 3AJDA 1S3FA 1TUGA 2PLAA 1H2RS 4E3ZA 2OCYC 2M32A 2PZJA 5JRJA 4KFRA 2QYHA 3KKMA 4BJ1A 4MCIA 2XJ4A 2DQ4A 3CEJA 3I05A 3VU0A 3T52A 3O90A 4WACA 5GONF 1UADA 3BRQA 3U4QA 2F48A 1GOTA 1C14A 3OCJA 3OIVA 3RCBA 3RAFC 3P4YA 4BKQA 5J2TA 1A69A 1LLFA 1MAHA 3TEFA 5DU2A 3MPOA 4R2XA 5EXEA 5CLIA 4YMHA 3O8NA 3AONB 2XXBA 2PH3A 1S8AA 1U0SY 2ZW9A 4XI9A 5C32A 1WUKS 4Y6RA 4C2AA 4P93A 3RIHA 2Q4RA 2VCHA 3ME5A 4TT3D 2XH8A 4MGIR 2HA7A 4G6ZA 3AX6A 1YRQA 4PU0A 5IXYA 2JLZA 1ZWKA 6REQB 1FUUA 5FOVA 2EQ5A 5CVVA 3KZKA 1FRZA 1JAZA 2ZVDA 2YWCA 1Y5MA 3KUUA 4RZIA 1UDAA 4BMVA 2C59A 1BDIA 3DTNA 2DBYA 3H87A 2CL0X 2EZUA 1Q7RA 2HWXA 2YN0A 4S1NA 4EB0A 1AMUA 4RTRA 5DE3A 1MAAA 4GI1A 3WJAA 2B35A 2R66A 4G3XA 3D5TA 4OMFG 5LZ5A 3H4IA 2DE0X 3VVCA 4MUFA 2J9GA 3ESRA 2WYWA 3PFFA 4OUKX 1G2OA 3TTUA 2J08A 2JJ2D 5CEJA 5L7TA 1UJMA 4CF5A 1S8FA 4AN1A 3EZ6A 4F4HA 4S24A 2ZSDA 2PMFA 5IP5A 1H66A 2OBFA 1TEXA 4BV9A 5DSZA 1IN6A 3A9VA 1O89A 1QIHA 2ZK7A 3KQQA 3L93A 4JBNA 4U8GA 4UUNA 4X0EA 5EE3A 5IAEA 1MP0A 4N3BA 2Q8PA 3D81A 1G17A 3KHTA 3R9IA 4Q1BA 2HRZA 1BXGB 1KERA 4PV7A 2ID9A 3Q2OA 1G6OA 4FZ3A 2HIGA 4W82A 3H9UA 5G1NA 3RVJA 3BFKA 5CDUA 1F1JA 3K31A 3MUFA 3R0JA 3IP7A 2NO4A 4LQCA 1WLYA 3QVUA 2BLLA 1LDEA 1UR5A 3CKLA 1F2TA 1TQ4A 5ALYA 4EATA 5F7XA 5AKKA 2BGNA 1O95C 1U9IC 4LV8B 1RP7A 2BFPA 3ELUA 5B2FA 5M34A 2FN9A 5BQOA 4IF6A 3QUTA 1ZD2P 4XJXA 1G8AA 4CLDA 2JARA 3JQAD 3MAAC 1Y9JA 4BRSA 2C29D 4I66A 3DPUA 4BGVA 3JQQA 1ANKA 4MVCA 1ADGA 4KO4S 1UDXA 2YRFA 1XRSB 4QNRA 4DDTA 5TQ0A 3L8CA 5J9FA 4E1VA 1SCIA 4KB5A 4ZI7B 1DAEA 5C8ZA 1WPRA 5AVXA 3N3AC 2QD4A 4LF9B 2JHFA 2C5EA 4M8NE 4G5YA 1V3VA 1YUBA 2G04A 4IFBA 4ZT6A 3VPHA 1J21A 5KOJA 1W36D 2JGDB 1KH2A 4DQXA 4JGGA 3DD5A 1XE3A 3HXKA 4DPMA 5JQWA 2MINA 1SG0A 2YZ7A 4JN6B 5H7XA 4A6EA 5L4SA 4EF6A 2P3OA 4QJ5A 5JD4A 3U44B 1R6DA 2AB0A 1W2HA 3K5HA 1TA9A 3ER6A 5U1PA 3NCTA 3CUYA 4S0ZA 5IBPA 3TI7A 2IS6A 3ZWYA 1NAHA 2QKYA 2HIHA 4FYWA 5LL6P 3K2QA 5FWYB 3JWPA 4L9WA 5FJJA 2B69A 1EYZA 3WKEA 2DX7A 4GVPA 5KNBH 3ETGA 4Q1FA 4NCKA 4N03A 4QHYA 4GWKA 2IITA 1M0WA 4I7EA 4EJ2A 3PQ7A 4BKMA 4OLJA 5M5BA 5HHTA 3ROZA 4N5NA 5ENDA 3EC7A 3GUUA 5JH7F 1G3RA 1PE0A 1DX4A 4GO1A 1C41A 3V4SA 4BFUA 5TEWA 3DZKA 4V1CB 5TY0A 1M67A 3HEMA 3NEYA 3NOQA 4ZRMA 1XEWX 3WJ7A 2G40A 2JEYA 2GM4A 3ZR4B 5IYZA 2WNHA 4P98A 4OHYA 4P36A 4Q3OA 2C5LA 3LF1A 4GOND 1K4MA 2O4UX 3MIIA 4PO9A 4ZK2A 4ENWA 2QT1A 1GXSA 3A6GA 3QNMA 1G66A 2QUIA 3SFZA 2PN1A 4QDZA 4N48A 2V7QA 1CZOA 2WEKA 2VPXA 2AMYA 4AURA 4XLZA 1UDCA 2FSHA 3BSFA 3NATA 5F2EA 3FMIA 1Z06A 2G82A 3KFLA 1N1EA 5F9HA 1A27A 1BD4A 3QF4B 3C3WA 4C29A 5CLHA 1QRTA 1A97A 3MCVA 1Z5ZA 5K3CA 4RDIA 5BMOA 1YL6A 1J0DA 5DNAA 1AM4D 5EJ4A 3C5HA 3WGIA 3H13A 1CP2A 3IEIA 3UT6A 4AROA 5BN5A 5TR9A 4ALJA 3KR0A 4QYIA 3RAEC 2IIQA 3ZLJA 3EQ9A 2JLVA 3TAUA 2QG4A 3D2BA 3FPJA 3LDFA 3U26A 1ZOIA 2QJTA 2FPUA 4OU5A 2O23A 3L7OA 4ZXPA 2ZTMA 4OTZA 2JFPA 5KTPA 3ZY2A 2VRCD 1XG5A 1VKNA 2J4FA 3IP8A 4LHSA 1U94A 3KWLA 3S2FA 3F4LA 4CTNA 4QTYA 2QI9C 2AQHA 4H4CA 1UEXC 4J0EA 5GAJA 4CQLB 4C1NA 1J0BA 3D8RA 2HA6A 3QPDA 1G3IA 1OR8A 2MSWA 3QPCA 3Q8WA 1EGHA 3HI6A 1FNBA 4MR7B 4DV7B 3S70A 2E1PA 1XN1A 1C3OB 1DJLA 2BI8A 3F9RA 3L5KA 1LB1B 2QQ0A 3B85A 4NS4A 4RZ3A 1MX1A 4AWBA 4BX3A 2A14A 2QN2A 1UKZA 4KGZA 4YJHA 1E98A 2WK1A 3RSSA 3WTCA 1Z0DA 1CUHA 1R6BX 3VGPA 4Y1FA 3K3PA 1FF9A 2NTNA 1TT5B 2BGIA 5HFNA 4D56A 3KKNA 1XGKA 1P1BA 3D8TA 2CNKA 4UARA 1PNTA 1ZNXA 4C7OB 3STUA 1T0UA 2YJNA 2PKYX 3DGEC 4ACBA 3ZNQA 2JHPA 2R2AA 1CZHA 2EW1A 2PGIA 1Z4PX 4R0VA 3PXEA 1EUDB 4G5GA 5EERA 5IJ0A 2WBLC 2GD2A 1DWUA 4TKMA 1M7HA 4MZDA 3F74A 4O2RA 2FSSA 2B8JA 3TQSA 4ALNA 1SXGA 1AXRA 1E6EA 3DC2A 3FYDA 2JA2A 3LIIA 1I0IA 2B2CA 2VDQB 4KRGA 1E5XA 4FSDA 1HT2E 2ATXA 3AI1A 2VLIA 4F86A 2IYRA 4A1OA 4IIVA 2W42A 1YE8A 3OUZA 4RQAA 3GL9A 1L6RA 1W2GA 1GQOA 1WMAA 1E4VA 3C8ZA 2XPCA 4XYLA 1Z12A 4RD6A 2NUAA 5FIUA 4BLTA 4F71A 2QTBA 5DGTA 2OVBA 1R18A 3RSHA 1IHPA 1Q0PA 2IU3A 2OORA 1MX3A 3DDSA 2A1TS 1ZISA 2ZRJA 3ZHRA 4UD6A 3HJCA 3Q9UA 1UKCA 4WNAB 2NO9A 5ENZA 5IASA 4NY1A 3STWA 2EWMA 5G53C 4CTJA 3ZS8A 1TAGA 1BEUB 1JYSA 1K7EB 4NJEA 3V2HA 1PTJC 5DKFA 1FE8A 3CVVA 3KU4A 4P7FA 2VNSA 3THOA 1VPEA 3OM1A 2QTLA 3LC1O 3L7NA 4FIZA 1JDJA 1GZ7A 2EX0A 4G5FA 4KLNA 4LGMA 1F8FA 4UULA 4B33A 1I2ZA 1DB3A 3AJ8A 3ENQA 4RJLA 1WXFA 2ZRBA 4HTAA 4UEWA 4TVKA 5E6RA 3OQMA 5JNVA 1C8KA 2CY0A 2G0TA 3R5JA 4DV6B 1JUDA 3Q7RA 5I9MA 4ECAA 1G5HA 4ARZB 3G0DA 1YXMA 5M7EA 4FMPA 3ECCA 4MQ6A 4INAA 1G9SA 4F2WA 1F8UA 4HWSA 1IAVA 4U7GA 1DEKA 1OLUB 1HE4A 1NT4A 5ALQA 4G81A 3VHXA 1PT9A 3FB1A 1EE1A 1F14A 1FVFA 1LJ8A 1R3DA 2G76A 4TUYF 4WVLA 1DAHA 2CD9A 4CL8A 5AIBA 1A8UA 3FN4A 4LBVA 4QL3A 1T9AA 3RO7A 4A16A 2ANCA 5FUQA 3A27A 1B00A 1D1PA 4QYSA 4ZPXA 4F6RB 1WKVA 1GYQA 4NBTA 1FIUA 4P4GA 4BNLA 1G98A 1RRGA 2D2IA 1P9OA 1E7SA 1QP8A 2BY4A 3O1IC 1U8TA 3D2AA 3JV7A 2ZRDA 3ANNA 2X2EA 2Q1TA 2E21A 1EFRD 2HQ1A 3WNDA 1PJ4A 4GYYA 5E4FA 2AWNA 1N9GA 1RQNA 3QU2A 4WDQA 5K0EA 3O84A 3W2IA 5IEJA 1OJLA 1D2EA 2JKVA 1QPBA 2X9LA 3AI2A 3D6FA 4PNPA 5DO9A 1RFLA 2O1SA 4MI9A 2G1UA 1FJHA 1T8UA 4LX0A 1QAMA 2QGNA 4OH7A 4R0MA 1SK8A 5KEIA 5KJ6A 4YI3A 1M5RA 3BFXA 2L0XA 2ZUUA 5HIJA 1AGPA 5BOSA 1T2DA 2CF5A 2OQIA 4BMXA 2ZSIA 4L74A 1IBRA 2XUOA 4INPA 1Y4DE 4R69A 5DHFA 5EGSA 1E61A 1PT7A 5CLFA 2VHJA 2Z04A 1B7GO 3H0KA 3I5MA 4KO8A 4NVRA 2IH2A 5EHXA 2NZ2A 4PZLA 2RAPA 3ZHQA 1NUSA 1Y6JA 3I6QA 2R48A 3IAM1 3M2TA 1T5IA 3I34X 2PH7A 3LM8A 1LWNA 1IOZA 4LGVA 1TI7A 1TYDE 1ZZEA 3TW4A 1B6TA 3NHSA 2EFEB 3IE2A 3LUAA 2X7JA 4R7ZA 3SDSA 5KNLA 2WSBA 4PLZA 4EF4A 1OZ0A 1C7JA 3U1VA 1U2EA 3NIGB 3L4BA 4KDEA 2BDTA 2ZFUA 3JVUA 1KDVA 4CR7A 4OX9Y 2REQA 4JLVA 4AYWA 4XXHA 1HURA 2RG1A 3U3XA 4GQBA 5HE8A 2XTAA 1TPYA 4UBMA 5B58T 3AIOA 3GCXA 1QH1B 5AVZA 1YUNA 3N7TA 4JKOA 2FPGA 1ZPDA 3QNUA 1Q3KA 3BXPA 2YVLA 1EWYA 4D9KA 3LP5A 4L16A 3QVOA 3ZWKA 4X41A 3AVYA 2CHEA 2GAFA 1XA4A 3KKEA 4WCFC 1H6DA 1JR4A 1XKTA 1STOA 4I50F 3ZCSA 2OE2A 2RGRA 2Q5OA 4QODA 4EY3A 3UK2A 2EFCB 1PZFA 1H6CA 4Y6OA 2Q2NA 3B13B 3FPSA 1PHPA 1X42A 1GFWA 1M6NA 1W5BA 2JFXA 3DJFA 3Q40A 2ZG6A 1WUTA 5HIAA 4QOJA 4XE5A 4KQKA 1E2KA 3IOBA 1M0EA 5L4LA 4B47A 4R1OA 1U2QA 1KH3A 1Z6PA 2SCUA 2VOEA 3W2FA 2D2EA 2C2MA 2VYNA 4ZQGA 1A0OA 1IIBA 4O4HF 4PG6A 1YRLA 5FF9A 1KHTA 3L1KA 3Q3GE 4KLCA 3DBHB 3B7PA 1KMNA 2PIAA 3URMA 4P1ZA 2F62A 4MUYA 3S2EA 5HIKA 1PHRA 3EW7A 2JFBA 4JVMA 1FUIA 3DTVD 5KYKA 3AR3A 1YI0A 4DF3A 5F5LA 2R85A 3E82A 5FA5A 3P9QA 3M83A 3K9HA 1H9AA 2RHBA 4DLSA 1F20A 3H99A 2ECPA 5DTJA 3TLBA 13PKA 1KIMA 5L53A 5L6MB 2I87A 4J0DA 5C18A 2H1IA 5AVOA 3PNQA 4OHVA 3R7AA 5EKXA 4CKYA 5JASA 4ND4A 2C9OA 1Z4LA 3DNMA 4I19A 3FNGA 3VOSA 5C81A 1DP4A 3G17A 2QQFA 1O5TA 5BVGB 1NBME 4XR9A 5AKHA 4FDAA 4AS1A 1QTQA 3NHJA 1LPAB 4CT4B 3RR2A 2XV1A 5K1ZA 4QVGA 1U7UA 3GVXA 5C7LO 2I7XA 1NI3A 2RFLA 2ZB2A 4WKOA 4Q3CA 1C0IA 3L1HA 3ERCA 2WQ6A 2R8RA 3WGTA 1KSGA 3L4EA 3QLEA 3EZLA 1EJBA 2XB6A 2WE8A 1MVLA 2P9ZA 1L3BA 4EG4A 3A1CA 3NPMA 3WHIA 1DKOA 1XDGA 4PO1A 3KAPA 2H1VA 3GN1A 2NO1A 4R41A 1U0JA 4J0FA 2HLDD 1MB4A 1Z9BA 3NYWA 4BAGA 5A03A 2JGJA 3PVCA 1BSVA 2ZSAA 4XDHA 3DEZA 4AJHA 3TNDA 3TR0A 3GRZA 1PGQA 2XWBF 3OPYI 2ODBA 3PWZA 3HVKA 4IXDA 3LH5A 3QFCA 4R8VA 1QH8A 2R6CA 4I5FA 3UK6A 2RGGA 4LMRA 4WLEA 5ARBA 5TS3A 2XWQA 3I8SA 1NQUA 2DFTA 2Q4DA 4B3IA 4LHEA 3HZHA 4D9JA 2H11A 2IY8A 2HO4A 3BE8A 4MUAA 2JJYA 3BL5A 3VYTB 2QGFA 4L0QA 2HQBA 1XU4A 5JVDA 1NLMA 3A37A 3MTBA 4CBVA 4FGUA 3AQ4A 2VZ8A 3WS7A 2PQ2A 2DHEA 3WWOA 3I28A 4JLMA 3HDQA 2W70A 5KYNA 1G4HA 2XW6A 4R3WA 2O2SA 3BHMA 1QCDA 3N59A 1PSZA 4FJ2A 5TVGA 3R8CA 1C7RA 4I8XA 1Z5VA 2Q1SA 3KYDB 4EKEA 3SEZA 4ENTA 5HJ7A 4QRDA 1EUCB 2JCSA 3P5BA 4PZ0A 4KVGA 1GGJA 2W4QA 7REQB 2FUKA 3QPVA 2ZIUB 3VSBA 5TS2A 1IOLA 4OHUA 1ZJ4A 1L4NA 4TMFA 4WY2A 4L78A 3AFIA 3AF4A 4TYNA 3HDGA 1GG5A 3TOVA 3HGTA 1BQEA 1U7TA 3F0TA 3K0FB 3QUSA 1QKJA 4XIYA 3OP4A 1AX9A 2AWOA 3GQVA 1YOVA 5EEHA 3JZAA 4KZPA 1KE2A 4KZKA 4BQRA 1N2SA 1DV1A 1KA9H 3KSZO 2DT5A 1ZM9A 3AWIA 1YT5A 1E7RA 1KQ3A 3OTHA 4EABA 1PGOA 1E5DA 3WSTA 5HZMA 1PR2A 1FUKA 2GZ2A 3BA1A 2F3SA 3FVRA 4OP2A 4R7TA 1ZN9A 3VR5D 1TQ2A 2FEXA 4RABA 4Y2XA 1ABEA 1YR6A 1W8DA 4XVQA 2Y4NA 1J06A 1OX4B 2O8DA 3V2UA 1CS0B 1MDBA 1I51A 1ZQ9A 3B3JA 2B82A 2VBGA 4LHVA 1M10A 4YONB 1KMQA 5IJWA 1E2HA 1ZOPA 2JHCA 4L2IA 5JBIA 1YWGO 2YMLA 4WZ6A 5CM2Z 1EUYA 3I83A 5HDBB 3TOZA 4ZYWA 2Q2OA 2W5UA 2PT5A 5BSRA 3E7PA 1Y8RA 4QPZA 2V54A 5A9RA 2ZIZA 3O83A 4AF6A 2X86A 1DPGA 1GTG1 3WA6A 1X9IA 2FEWB 5TGTA 1PG5A 3BYZA 1KR2A 1EM6A 2OCLA 3JVEA 2AC7A 2IPNA 2IXTA 2GN9A 2PSDA 3SEFA 3OZ7A 5D1NA 5DOVA 1O08A 4JWTA 1BMFA 2IZOA 2PMKA 4ZVLA 821PA 5J2UA 2AVDA 3KQOA 2J7PA 2OZLB 1FFWA 2P5SA 3N53A 4MMXB 4EVIA 2DTDA 1DRJA 2GLUA 3G2JA 2LGJA 1N0IA 2I7VA 2YVAA 3BJZA 1I7DA 1A9RA 1O0SA 2FQ1A 3QWAA 1NLFA 3QHPA 4KJXA 3U3RA 2X1LA 2P6PA 1MO2A 4HWRA 2ZTUA 1DIHA 3WDSA 5AVUA 10MHA 4J07A 1ORHA 2AI2A 4L3WA 5J3JA 4WFJA 1G8PA 5ALGA 5K20A 3OCYA 2F67A 1SBYA 3VBEA 1CY6A 4KQ1A 5JS2A 1GTL1 3RHSA 1O6GA 3AOEC 4Q15A 1MO4A 3DHWC 2C98A 1I5RA 1A7AA 1XFAA 2NXJA 1W76A 1E9VA 3KB6A 3GU3A 4L51A 3I12A 5LUAA 4ECEA 3HNPA 4LZPA 4J6FA 5EIOA 1JKXA 2BEUA 4AUNA 5CFPA 4DV3B 1J90A 4BMDA 3E61A 3BWEA 2CLLB 1EKXA 4YP0A 1U1IA 1BMDA 1SVOA 1Q0SA 2OFWA 3ET5A 3T5BA 3BRWA 1DBWA 4IJWA 3N1UA 2Q9CA 3N9IA 4ALLA 2HC9A 2GO1A 3HPQA 5A3VA 4DA4A 3VNVA 3ENKA 3G59A 4F85A 2DR0A 3ENZA 1GCUA 4TL9A 1NLYA 4V3BA 4L50A 2F1OA 4MWBA 1M1UA 3TR5A 3K4QA 1QO0D 3I5AA 3S8YA 1XZCA 2I03A 2JLBA 2YN2A 3ZD6A 1UBCA 4NESA 4IDEA 1KJNA 1IQ0A 1OGJA 4GC5A 4CM4A 3RRMA 3LI2A 1NMSA 3KB8A 5AD1A 3W2EA 1XKQA 2EG9A 4AJPA 2IV2X 2QHXA 2K87A 1WXXA 1XWWA 3HR4A 4OHKA 1KMHA 1KR5A 3BDVA 3PUXA 2HA5A 1UKYA 1M2GA 2L69A 4FTWA 2C2YA 3ZXSA 3G7SA 2V1UA 4RE5A 1FDVA 4IFIA 1YZVA 3DTTA 2JAWA 3PQ8A 4NQZA 5TEVA 4E2WA 3HZRA 1E5TA 4ZREA 3SS9X 4F3NA 2YDXA 2O6HA 3FHLA 2KX7A 1X1EA 5JATA 1NRWA 5I9SA 4CGYA 4R1NA 2QZPA 4UHCA 3IO3A 1NHGA 4JDPA 2CN1A 5B7GA 4YIHA 3CTMA 2WPDA 4CEHB 2J33A 4KODA 1ZS9A 3RGWS 3FGZA 2Y9PB 3WV5A 1U5AA 3OLWA 3SKXA 3O8DA 1SG6A 2II6A 4G85A 4X6YA 3URKA 3V1LA 1YQDA 2WOJA 3IIKA 2CJYA 5JHHB 1CFZA 1O94A 2JCGA 3CEPB 1UJNA 2RG7A 2RGEA 3EXEA 4LA4A 4LOJA 5TGZA 1T5HX 3DBVO 4X71A 1YV9A 2FUG6 4MS3B 2QOEA 4DNFA 2VN8A 3WTBA 2Q6VA 2H9IA 3CLSC 4BBZA 2JAXA 3GLFE 4CIYA 4PG5A 3ZKWA 1HEIA 4H1HA 1UK9A 2W22A 1QHNA 1IC6A 3V1YA 4EUKA 5BT8A 5I3CA 5BYKA 3R4CA 5EE1A 3B6JA 4GR9A 4ENQA 5L3QA 4DLLA 3NM4A 3MZ0A 1GA4A 4IIXA 3LLUA 4KYIB 2OGTA 3RI3A 1DFIA 2VPIA 3FYCA 1TK3A 4WZBE 1OXVA 3ZJYA 2OV3A 3KJFA 4B74A 1O1YA 4WBXC 2Y77A 4LJ9A 1EFVB 1J2YA 2QORA 3IV7A 3JAWB 4B0OA 3NRCA 1N0VC 3F5FA 5KTNA 5CA1F 1P81A 2CXPA 1NP6A 1QFYA 3MBOA 2IIBA 5G4KB 3WK7A 3AM3A 4BFXA 2NP6A 1L5WA 2ZB7A 2WV7A 1ZRHA 3C6ZA 3JD4A 4TPKA 1VSVA 5FUBA 4B85A 3UJNA 1QQ5A 3Q8MA 2FUCA 2CVFA 2BDEA 3DVAA 1NVEA 4L4RA 4Q12A 1G8GA 2C8LA 1T34A 2NT3A 2YJ3A 1CUBA 4J4BA 1W85A 2HK9A 3U40A 2GYWA 2OAP1 2F55A 3Q3HA 4O08A 1YK1A 3GX1A 1BWPA 2OAQ1 4YRIA 3OM0A 2BFDA 1RTTA 4OOFA 4P31A 4YQYA 4RVFA 4BNNA 4W9MC 1VI2A 2G09A 4PHFA 1KYWA 1MG5A 3ONWA 2OZPA 4CUKA 1CF2O 1WULS 1X0VA 5I7SA 3DAPA 3GMSA 1QHHA 5TB5A 1GUFA 2F6RA 3AR9A 1HE8B 3OEED 1OXUA 5AVWA 3U5ZB 4ID3A 1U3VA 2OGZA 2CFIA 4UU1A 3OJFA 4KPGA 1O6BA 2BMWA 4FFVA 4JS0A 1XUOA 2X6TA 4JT4A 4P83A 4PW0A 3A0RB 1UC5B 4K1XA 4EEXA 1HTBA 4ZGBA 5BV1A 3EQ7A 3OCCA 5FPPA 1DJNA 2X2OA 5LXTA 2WWIA 3REQA 1C9YA 1MO5A 3T4XA 5ADVA 4ARBA 4F2HA 1ZGGA 1TZMA 4LRWA 1ESZA 5DGXA 1BA2A 2BT4A 2VJOA 5G0VA 3K2BA 3SXPA 4EM6A 4G5HA 3HM9A 1M1ZA 3PTAA 4RM2A 2Y1CA 4HR7A 1P7VA 3TZQA 1W96A 2Z4TA 3CNQS 4RIHA 4XCVA 4IXTA 1XXLA 2FJ0A 3FNRA 3NALA 4LPSA 1UFOA 3JWJA 1ZRNA 1UM9B 2P35A 4NBKA 3MAJA 1MH1A 3EGOA 5IVPA 4YTEA 1S7GA 3AF6A 3KSDO 2OR3A 3I09A 4NOJA 8ADHA 5B3JC 1GTZA 1RNLA 4Y2PA 3UFXA 3D6MA 5CB4B 1TEHA 2D0IA 4ARUA 4BBAA 1X74A 3EODA 4HB0A 3MGAA 4UUMA 1EHYA 2HRQA 3NRBA 2QW0X 4MWOA 3AI3A 4PLCA 3FLBA 1DVRA 3HSKA 4YJ3A 5DLPA 4MDYA 2FWAA 1ZUIA 2YWEA 1W94A 3T95A 4LJRA 1H8ED 3RYCB 3CG4A 1D7AA 4GAEA 4J43A 2XEDA 4CMEC 5AWFC 1G5IA 2O7VA 4B7ZA 2HNAA 4IDPA 1M72A 3DQZA 2PIDA 4E5UA 1CERA 2C5FA 3E5RA 5CCEA 1FUYB 4YCBA 4HQRA 1MVNA 3FGOA 4S2EA 1CWUA 4RD3A 5PNTA 1NHWA 3N2ZB 4M86A 1K6MA 4NE2A 4QXQA 4X8OA 4RTQA 3PLAE 1ZZGA 2AFIA 3BL8A 1ZI9A 3VX4A 3L0SA 2WU4A 2RAUA 4AKEA 2J3MA 4OL9A 4IWYA 2JDIA 3B1FA 3DE0X 5EC8A 2B8WA 3R24A 1NW4A 4II7A 3MERA 3ZGVA 1DKLA 5AK4A 1IZ0A 2CD7A 4P5PA 3VXKA 5KU1A 4KR2A 2QQEA 3I6MA 4CKWB 5I5EA 3RAGA 1E2IA 3DHEA 1UXHA 2LVBA 4XKJA 3UMCA 1QF6A 1NW7A 2WC1A 5A5VA 3QA3E 3T7EA 3DPSA 1JDNA 2G06A 3N0VA 2Q5IA 3OJOA 4NS1A 2CWWA 5BT9A 3F6YA 3PCXA 4OBXA 4A03A 2P6MA 2PQ0A 2YTZA 1OFVA 4KO2S 5LZ9A 4JENA 3FSEA 2G4LA 4R1MA 5JSUA 1JG2A 5HCUA 1MTOA 4TTAA 5CEFA 4MK4A 3LGSA 1GVHA 4F8YA 5JROA 1ZITA 3FOEC 2F3TA 3ZJ5A 1MQ8B 1P3DA 3W6NA 3LBAA 1N7HA 3EWSA 3HLTA 4JYBA 4N0QA 5AK6A 1Y6RA 1SUIA 3I01M 4K26A 3TEJA 3EQ2A 4PX3A 5A6VA 4FN4A 3GT0A 5JIBA 1JQEA 3IUJA 2RK4A 2B4QA 1H6AA 2HU2A 3CR7A 1XDWA 4HB2A 5CURA 2CNWA 2VYVA 3IQZA 3JQ9A 4KQGA 1TT7A 1B2RA 3JWIA 3CT4A 1Z2EA 1K7YA 1AUXA 1AXEA 1G8MA 1ORDA 1U3FA 2O7SA 5FUWA 4FWBA 4DSUA 4F5EA 1QG2A 3SC2B 4BIIA 4HWGA 4Q47A 4OU4A 2J9YB 5EJGA 1TQHA 1JPNA 4UJ3A 3DHYA 3IXMA 4UVIA 4BNWA 3O2QB 2IHBA 5ADWA 4D99A 4B6PA 4E6EA 4W5JA 2I4IA 2QTWB 2I6UA 5WRFA 5TMBA 1QWOA 2J3DA 1L7RA 2QY9A 1RVDA 3M6XA 4JBWA 4OG2A 3UCEA 2YVUA 1V7PC 1F4LA 3JU3A 1GYPA 5HXAA 3SIXA 3GCZA 1IXRC 3D6VA 4YRMA 1ADFA 3I8OA 5AJUA 1K86A 2QW8A 3UZUA 3RUFA 4H15A 1X1QA 1DCTA 4Y9UA 3ZVNA 4HYQA 3GLVA 2JD2A 2CE7A 3UEOA 2E5LB 3PC6A 4UDOA 4YRLA 4PYRA 4AF7A