3GEDA

Fingerprint and structural analysis of a apo scor enzyme from clostridium thermocellum
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
245
structure length
242
Chain Sequence
b'NRGVIVTGGGHGIGKQICLDFLEAGDKVCFIDIDEKRSADFAKERPNLFYFHGDVADPLTLKKFVEYAMEKLQRIDVLVNNACRGSKGILSSLLYEEFDYILSVGLKAPYELSRLCRDELIKNKGRIINIASTRAFQSEPDSEAYASAKGGIVALTHALAMSLGPDVLVNCIAPGWINVTEFTQEDCAAIPAGKVGTPKDISNMVLFLCQQDFITGETIIVDGGMSKRMIYHGDWNWFYKID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Short-chain dehydrogenase/reductase SDR
molecule tags Oxidoreductase
source organism Clostridium thermocellum atcc 27405
publication title Sequence fingerprint and structural analysis of the SCOR enzyme A3DFK9 from Clostridium thermocellum.
pubmed doi rcsb
total genus 84
structure length 242
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gedA00
4CM4B 3DMTC 3GN1A 4BL5A 4DL9A 4A26A 4XJTA 4RQTA 5G2OA 5THKA 3BZUA 2HK9A 5IG2A 2X4GA 2OL4A 4ALLA 3QVTA 3AW9A 4ALMA 5JAMA 3F4LA 5CDSA 1M66A 3D4NA 2SCUA 1R4NA 2ILTA 2DBVO 2H9IA 2Y67A 3F3SA 7ADHA 1EZ4A 3AOEA 1LSSA 3LF1A 1C1XB 4CLDA 1ENPA 1OC4A 2VZ8A 2YQ5A 1ISGA 3A14A 3UICA 4LW8A 1E77A 1E92A 1QYWA 4CM5A 2ZYDA 2DUUA 3GZ4A 4AJOA 1X13A 5IAAA 1NVMB 1DC4A 2RHRA 3MCVA 1CJCA 3AI2A 4DYDA 1GADO 1A71A 4W9NA 3ZWVA 4QECA 2OHXA 1M67A 4M86A 2IYOA 2C0CA 3VZQA 3KB6A 3AUAA 1EVYA 2BHLA 4BNJA 3GEGA 2GN8A 1TB4A 1PJQA 5L9AA 4WKGA 3DQPA 2I66A 4CQLA 2IEDA 3MJTA 2VYVD 3L6OO 1Q7BA 1BDBA 3OICA 1OMOA 1WVGA 3KUXA 3LT1A 4DQXA 1ZMOA 3OFSA 3U4CA 2W2KA 4Y6SA 4RVGA 3E03A 3X2EA 4MKXA 4JGBA 4YRBA 1Z45A 3RASA 1BGVA 5C5IA 3VTFA 3JQBA 3L6DA 4FOOA 5CHEA 2IRWA 4P4GA 2X5JO 3QIVA 3ZDFA 1GPJA 1W4ZA 1BW9A 2E6UX 2O23A 2WE8A 4PLYA 1E3WB 1S7CA 5HBRA 3QLJA 4BOYA 4WGGA 2BFOA 1R0SA 3BMOA 4XDYA 3RKUA 2PA3A 2BI7A 4P4NA 5KJEA 3TZ6A 1U3WA 2PH3A 3JD2A 3TNLA 1GL3A 1Y9EA 1VC2A 4A03A 3R3SA 1NASA 3UXYA 1U8XX 2E48A 2NU6A 1XQ1A 3W1VA 4RVUA 4NG5A 1F12A 4GMFA 2HJRA 3GZNB 4FQ8A 2AQKA 1DLIA 1U28A 3RUIA 1W73A 5TT0A 4K28A 1E1MA 3FPLA 4OQZA 4CLHA 1ZNQO 1X7HA 2CVQA 4GPD1 1VLLA 2HSDA 1C0PA 5DBFA 1K2WA 1M76A 1GV0A 2J6IA 3AU8A 1RWBA 5LC1A 4BNWA 1Q0LA 4URFA 3D1LA 2AQHA 4FW8A 3O8QB 3WOHA 3BA1A 4JCOA 4JIGA 1XR3A 2PNFA 4OM8A 4U6QA 3LT4A 2EJWA 1YBMA 1M6WA 5KKAA 5A03A 4XB2A 5IJZA 4GSLA 3DFZA 1ARZA 1OFGA 4AJ4A 1XIVA 3FNGA 1ONNA 5HM8A 2DUWA 4RV9A 4UVHA 1KEPA 2VOJA 3PHGA 1PR9A 2CSUA 3PK0A 4BKPA 4BV9A 3P2YA 2O2SA 3UF0A 3CIFA 4FGSA 4R1NA 3ROMA 1V9LA 4XR4A 1E7WA 4ZRNA 4EEZA 3QVSA 5DN9A 3FNEA 5BSFA 4BO2A 4HFMA 4IGFA 2J5QA 1H2BA 4ZQEA 3PJFA 3UN1A 2W4QA 1ZCJA 1N1GA 3NV9A 1Y8RA 3AK4A 3INTA 4LSMA 2I9PA 3NJ4A 2B0JA 4BV8A 1BVUA 3EUWA 3K9QO 4J2OA 2AXQA 4WLUA 4EJ0A 4Z9YA 4JROA 4CR8A 4TQGA 1QMGA 1OOEA 1A9YA 2AEMA 2AA3A 1GCUA 1HKUA 4B7UA 2BELA 2VHVA 1PJBA 2YUTA 3GOHA 4TVBA 3S2EA 1JKFA 4M55A 4QTZA 5KTKA 1DFGA 4WOKA 4IIVA 4JBGA 1MXFA 2ZYGA 4CMAA 4MP6A 4QEDA 1SOWA 3BHJA 1PX0A 2OMEA 5KJ1A 2D59A 4XYGA 2VUUA 3LU1A 2C59A 3VZPA 5TIIA 5TC4A 5JAZA 4W9NC 1I24A 1RKXA 3GGOA 1DC5A 3C24A 1P74A 4HADA 5AVOA 4BO3A 2R00A 3R0IA 3DB2A 4CM9A 5GZ1A 1SEVA 2BMAA 1NWCA 2GF2A 4RO0A 3IP3A 2EWMA 6ADHA 1NFQA 2BD0A 4WLNA 3DAPA 1GQYA 1XSEA 4NK4A 3WG9A 3DEYX 6LDHA 3EZYA 2C5AA 4G65A 5CP8A 5JY6A 4PLFA 4CV3A 3OBBA 1B7GO 2VT2A 2Y0CA 4H15A 1DLJA 4NIMA 3F1KA 2J5RA 3Q1LA 3RAJA 2ZB4A 1PSDA 1UZLA 4CLXA 3PGXA 4H7PA 3NT2A 4YAKA 4QFCA 4CMJA 3RUHA 1ADCA 2Q1TA 1I2ZA 4N5MA 2AE2A 1HE2A 4MVJG 4OHUA 3V5NA 4OKIA 2Q4BA 1JKIA 1J6UA 5AQ1A 3TL3A 1XDWA 2B69A 1PIWA 4U8GA 4PRKA 3B1KA 2CF5A 2NQ8A 4R5HA 4GSKA 5IXSA 5C7LO 1JWAB 2GN4A 2P4QA 3JQ8A 4RF4A 1T26A 4EYEA 3TRIA 4BUCA 1LLUA 2BLLA 4NBVA 1UDCA 4R41A 3ZWNA 5JSFA 2FN7A 4FFPA 2EIHA 4L76A 2Y0DA 1SOVA 4FN4A 1KVTA 3BTOA 2BFAA 4MPDA 4BNUA 1GV1A 5KJFA 2B4QA 4PVDA 3GUYA 2EKQA 3DTTA 3QJ5A 3U0BA 4K6FA 5JDCA 4YYZA 4CLOA 4DYVA 2V65A 2NV6A 3UVEA 3CINA 1CETA 3AM5A 5KVCA 3HN7A 4XA8A 3CH6A 2D2IA 3NDRA 2POQX 4KUHA 4MVJE 3GK3A 4AG3A 2JFHA 3PI7A 4HUJA 4XYMA 3W4IA 3E6AA 1EEHA 2X5OA 1JW9B 2DVMA 3ITKA 3RC7A 3PQFA 2O7SA 4RCVA 2PV7A 2WD8A 4TMFA 4IDBA 3G3EA 1HE4A 3QRWA 1SMKA 3BMQB 3G79A 4UUPA 1F8FA 5EN4A 1D3AA 3H4VA 3HWRA 3ZU3A 3ORFA 3DBVO 4NNJA 4Q3DA 1VJTA 4M89A 4CQLB 1XEAA 2RCYA 4UVIA 2Y93A 1EFKA 5EINA 3O26A 4W7HA 1UP7A 1UXJA 2VWPA 4BGVA 4F45A 1YONA 4GWKA 3ZU2A 4Y98A 4LMPA 3OQ6A 3E9NA 2JAHA 1DAOA 4NBWA 3U4HA 4CMIB 2HRBA 4AJJA 1EK5A 4OKNA 2EKPA 4RF2A 4LVUA 2Z1NA 4WPGA 1EDOA 3AY3A 2EW8A 4O63O 1ADFA 1RM5A 3AUSA 5A3VA 3GAFA 3MJCA 1RPNA 5U9CA 4H16A 3QWHA 1K6JA 4N18A 2Y0EA 1PJ2A 4MIYA 3FBGA 2XXJA 2Y68A 1LBEA 2WE7A 1H9BA 4QT0A 2GZ3A 4GVLA 3U49A 4EJ6A 3QP9A 1UJMA 2ZIZA 5F3RA 1E7SA 4NQZA 2PLAA 1BRMA 3O8QA 2UYYA 1OI7A 2NTVA 2RH8A 4II3A 2JHFA 7MDHA 1HXHA 2V6FA 5I9LA 2BH9A 2UV8A 3NJ8A 3D4PA 3Q2KA 3WTBA 4BGUA 1A27A 1F06A 5T6BA 1WZIA 1JDJA 4JP3A 2VNSA 4H3VA 4HNHA 1LC0A 4DPLA 2O3TA 5A04A 4FBGA 2VUTA 3WGQA 4ND4A 1FMCA 1EUDA 3C85A 4XEHA 4ZA2A 4P4LA 1B3BA 2DBZA 4B8WA 1UXIA 3RVDA 1R12A 3JQ9C 1H94A 4UUOA 1KYQA 3WNVA 4AJLA 3KXDA 4AL4A 4BB6A 2BF7A 2J3HA 2FY8A 3FTNA 4MOWA 4BIIA 3JCZA 4EZBA 1C14A 4YB8A 4JBHA 1UP6A 5LDGA 5G4KA 4IZIA 1I5RA 3ZHBA 3JQBC 3FBTA 1DO8A 1LTHR 4Q3CA 2JAPA 1WDMA 3RUCA 2TMGA 3V8BA 1GYQA 4I5GA 3C7DB 5EQFA 4E6PA 4MVJF 5JW6A 4CR7A 4K6CA 1SO8A 4OYRA 4QQRA 2O3RA 1P31A 3SJ7A 1P45A 1NVTA 2IEBA 3PWZA 2EERA 4WLFA 4IDFA 4DLBA 5ICSA 3RD5A 3LC2O 2VZ9A 2Z95A 4CM9D 2ZYAA 4EW6A 1WP4A 1P0FA 2VCYA 1ULSA 1BVRA 5L53A 5CG2A 3ZV5A 4DUPA 4BNHA 2Q45A 1P44A 3I4FA 5DOVA 5COAA 3EW7A 4BMNA 2OFPA 4XYEA 4HY3A 3GNSA 4PLPA 2JCXA 4KUGA 4OXYA 1PJLA 1A4IA 4CMEC 3CXRA 4W6ZA 1DJNA 2VWGA 3UAGA 4XD2A 4CM3A 1Q1NA 1N92A 5AOVA 3NDIA 2IXAA 2IDZA 1ISIA 3ONFA 2DFVA 3GNTA 2AG5A 2R2GA 3FNFA 4FGWA 1E3SA 3TOZA 5G0UA 3JQAB 4FOSA 3ENNA 3SX2A 1I8TA 3RC2A 3RIHA 1RM3A 4ZU3A 1K6XA 3QVOA 5I8ZA 1E6EA 3VPXA 4IDCA 2V6BA 3V1UA 2X86A 1W0CA 4FS3A 3AY6A 4BO0A 1E5LA 3MOGA 2AG8A 5TT1A 3ZWAA 5I9MA 4OOEA 2J5KA 4DXHA 3Q3CA 1ZZEA 3M2TA 2B5WA 3EK2A 2Y1EA 3WGHA 1HTBA 5A3JA 4MVJP 2PK3A 2FHSA 1LSJA 1MB4A 3KSUA 1DRVA 3OA2A 3I83A 3LSYA 3LQFA 2Q1UA 1N9GB 3C8MA 1NM5A 4YQYA 5JDCC 4I5EA 3BMQA 3FR7A 1EVIA 1Y8QB 2P9EA 3QWAA 2CMDA 3A06A 3AU9A 4D3FA 3QVXA 4I5DA 2CNBA 5CDYA 2VRCA 3JYNA 1L1FA 1QP8A 4OOFA 5JCXA 3QHAA 4KP7A 5BSEA 1U7TA 5A02A 4R1UA 4FFNA 2NACA 1LDBA 3OJFA 2V6MA 1BXZA 3S55A 3DAFA 1L7DA 4OMUA 4BNXA 3L07A 4BNLA 2EV9A 5JDIA 1JU9A 2OBYA 2BGMA 4RPJA 3UCXA 2FSSA 1YBVA 4YAEA 3S1LA 1YQGA 1JQBA 4W82A 3RC9A 5F5LA 2HJSA 2O3JA 2O3QA 3DXFA 5FI3A 2VUSA 1PGNA 2O48X 2E49A 2VHXA 3UFXA 4I5FA 4QO8A 3NYWA 4D0RA 4FJ1A 4JJGA 5DZSA 2B36A 5TRTA 4GLOA 4CLOB 4BNMA 4CODB 4WLVA 2Y05A 5CEFA 4ND3A 1I3MA 3L9WA 3Q2IA 1T2AA 2UVDA 3B6ZA 3KHUA 1KETA 3MOIA 5ITVA 2J8ZA 4XYLA 1IZ9A 4D79A 1GQ2A 2XF8A 1LQTA 3JYLA 2E37A 3PQEA 3WSWA 3GN2A 1UXKA 3GFBA 3GC6A 2PH5A 3S2FA 2QQ5A 2CDCA 4XWYA 3WDSA 3DZBA 2NSDA 2PZKA 4KZPA 4OSOA 1SB8A 1GU7A 3VAZA 5AXDA 3I3OA 1ZK1A 3KYCB 3DL2A 3OMLA 2YHUA 3JQ6A 2G5CA 5JBIA 1B16A 4XRGA 4A73A 4RVDA 1NPYA 1TLTA 1E3JA 1O94A 4IBOA 2PZJA 4TZTA 5A9RA 4YJFA 3EVTA 1KEVA 3ZN2A 3JTMA 1CDOA 3JQFA 3KYDB 3V1YA 2D1YA 1J4AA 3HNPA 4R68A 1E3EA 1O8CA 3H9EO 3I9NA 4E32A 4OAQA 2VHWA 4TRMA 3MWEB 2W8ZA 2H6EA 5KVVA 1EQ2A 1SZJG 1U7HA 4B7CA 1RM0A 3GUCA 4PGFA 3ST7A 3T7EA 3VPHA 4YT2A 3ZI0A 1U2DA 5A9SA 3I9JA 3E8XA 3JSAA 3M1AA 4Q3AA 5I8WA 2X1HA 1UAGA 3L9XA 4DIOA 1PGOA 3G1UA 4R16A 4R54A 1BWSA 1X0XA 4MVJI 1F17A 3H5AA 4FB5A 2J3JA 4NU5A 1TT5A 3K5PA 2C29D 3X2FA 5DF1A 2NLOA 3BMCB 3JYPA 4QUKA 3H2ZA 4QFDA 3WWYA 2P91A 1R0LA 2VWHA 4UAGA 3FI9A 1PL7A 4CM8B 5C3MA 1JTVA 4BNGA 4MVJM 3HB5X 1Z7BA 4WLOA 3Q0EA 2B35A 1TEHA 2A94A 3FTPA 2HAEA 3OP4A 3H3FA 5TF4A 3WYBA 5C7OO 2YDYA 4NJMB 3VZSA 4J4BA 3WTCA 4INAA 1E7YA 3WBFA 1IYZA 3P7MA 4MJLA 1Y1PA 2D5CA 1TA4A 4HKTA 1PGPA 1FK8A 1IPEA 3BIOA 3KSDO 3VDQA 3OHSX 4TSKA 3H5RA 3BXXA 4JQCA 1WZEA 2NTJA 1X1EA 4TWRA 3VZRA 2AQ8A 1AHHA 1ZK0A 3U62A 1HYGA 1SB9A 1YVEI 1T4BA 4PIVA 3RJ5A 3OSUA 1R0KA 4RVHA 1BHSA 5DP2A 4CL3A 1I2BA 3VC7A 1V0JA 3PHIA 2EG9A 5G4KB 3CZRA 1LDMA 2J3IA 2DC1A 1K3TA 2HK7A 4RQUA 3R6DA 4MKZA 3EHEA 4Y9DA 1PGQA 5FF9A 4IUYA 1I10A 1ZVMA 1ADBA 4BKUA 4BNZA 4WLEA 3V2UA 2Q50A 1JAXA 2WD7B 3JQGA 4IQGA 5AXAA 2ZTMA 4B4VA 4UREA 3KYBA 1KEWA 1NYTA 1DJQA 4YRAA 1ZMTA 3GT0A 4TZKA 5H81A 4D41A 1B8VA 2DT5A 4AJIA 4R9SA 1UXHA 3UHAA 1GUFA 1J49A 3A1NA 2ZK7A 4N5NA 4EEXA 1WDKA 2HMUA 5L7YA 2O3UA 4MIOA 3IMFA 4DRYA 4J1QA 2JHGA 4J7CA 1RM4A 3U4IA 2GCGA 2Q2VA 3V2GA 2GNAA 5I7SA 3JQ7B 2DPHA 4IDGA 3AI3A 3GHHA 4BGEA 1QV7A 5BNTA 3ZWOA 1U5AA 4XIYA 3PFFA 4YA6A 1A7KA 4II2A 1XCBA 3FR8A 3GVCA 2NVBA 1VRWA 4YVFA 5F1OA 4IXWA 4UVGA 4YT5A 3RFTA 3VHRA 4CMCA 2CDBA 1YJ8A 2CUKA 5TNXA 2VRBA 3GAZA 5JMWA 1X0VA 2NM0A 3I23A 4BKOA 1A4UA 4J0EA 2WM3A 4YDRA 3GMSA 2ZQYA 5L4NA 4NMHA 1HLDA 1SBYA 4FIZA 1P1JA 2V7PA 4I8XA 2A92A 1HETA 2P5YA 4TROA 3H7AA 1FDTA 1VL6A 4BNKA 3WXBA 3RCBA 4E31A 3WJ7A 3CEAA 3PP8A 3KZVA 2FMUA 4WCFB 1DHRA 1PJCA 1QRRA 2BFPA 1A72A 1G0NA 3E9QA 4F46A 2G82A 2Y1FA 4FC6A 3F4BA 1ISHA 1BW9B 3JQDA 1GZ6A 3C1OA 2B4TO 1Y8QA 1QYDA 5EESA 2GN9A 1HLPA 3WSVA 3KTDA 5JO9A 1QSGA 3Q9UA 1VSUA 4YCAA 2PD3A 1QORA 4FD3A 2WTBA 1NHGA 1MP0A 2DTDA 5DDIP 4CLEA 3VPSA 3KYDA 1IL0A 4DC0A 1XGKA 1ID1A 1OBFO 1P77A 2G17A 3U5TA 1ZK2A 4C4OA 3DBLB 3ZWWA 5EMHA 3A4VA 4K26A 4E13A 2AE1A 2NU7A 2O2YA 3K31A 5HRUA 3VVBA 1UAYA 3QV1A 5MDHA 5K6AC 3LZ6A 4F6CA 4IJUA 1HE5A 1PS9A 4RZHA 3AOEC 2OGUA 3CSDA 2YV2A 5AXBA 2QIOA 2W2KB 4DQVA 4N7RA 4E33A 4PLGA 3WYCA 4CUZA 1GQQA 2PD6A 4OXNA 3DR3A 4GX2A 1GD1O 1LSOA 5CEJA 2VYNA 1B8UA 4OQYA 1F8GA 3FD8A 3TZKA 3LLSA 1O5IA 1DRUA 4Z0TA 4ESOA 3JYQA 1SNYA 3PWKA 4XIJA 2C5EA 4RPGA 3RSHA 4Z0HO 1XQ6A 1YQDA 4D45A 1WAMA 3F1LA 1N7GA 2A35A 4J2HA 5JFOA 4J91A 4YJGA 4XQEA 4GWGA 3BMNA 4PLHA 3KM0A 1C1XA 1YOVA 1MFPA 2D5AA 3JD0A 1KY5A 2QHXA 4I1IA 3KV3O 1LA2A 4D46A 1I2CA 4RLSA 2PY6A 1IOLA 1NPDA 3WMXA 4XRRA 3VPGA 3EVNA 5GY7A 4EJMA 2ZTLA 4DBVO 3OIDA 4ALIA 2B83A 1IE3A 1TI7A 3JD1A 1VL8A 4JX8A 4IY1A 2Q4EA 2WSBA 3K96A 3PXXA 3OJ0A 3PLRA 2AHRA 3ZWMA 1R6DA 4PZDA 3LC7O 3HADA 5ADHA 2I3AA 3UW3A 1BMDA 1YDWA 4XYBA 3OF2A 1ZSVA 3GR6A 3OA0A 3GZNA 4CM8A 2VWQA 4R1SA 2EW2A 3MJSA 3QWIA 2UUOA 4Z3KA 5JNLA 2OP0A 4DIBA 1LLCA 4JP2A 1XKQA 5JE8A 1E1NA 3EYWA 1Y5RA 1LSUA 2TMDA 5IN5A 4X54A 1Z82A 4ONEA 4B3HA 1QG6A 4AJEA 1V35A 4MO2A 5FI5A 4UEKA 4E5KA 3VH3A 2NWQA 2YFHA 1I01A 4FR5A 1H5QA 3GMDA 5KVQA 3MWDB 4ZICA 4PLTA 3ROKA 4D3SA 1QKIA 3DHNA 3FRJA 4PG7A 3KEQA 3BMCA 4FC7A 3NTOA 3JD3A 4Z0PA 1XU9A 3C1TA 2YY7A 3HDJA 3GRKA 4U0JA 3WFIA 3WGOA 4JJFA 4DREA 4CMBA 3GNQA 4JLWA 1CERA 4OO3A 1C3VA 1EE9A 2ZCVA 4Q9NA 5AYVA 2C20A 5KJ6A 1WXDA 1BG6A 1KC1A 1LNQA 2OZPA 1FDUA 2ZJ1A 4E5NA 3DBRA 3ZWCA 2Z5LA 4BKRA 4GH5A 4PVCA 4R01A 3RQSA 5JO0A 1PL6A 4OSPA 5JCJD 3FWNA 3OM9A 3ITDA 3C3XA 4YAGA 2RHCA 1BXKA 4NI5A 3ABIA 5TLSA 3O38A 1C1DB 5L51A 4E5YA 4CQMD 5T8KC 1M6HA 2DPGA 3L4SO 4ALJA 1CQIA 4MKRA 1GZ4A 2D3TA 1E3IA 3VPFA 4UUNA 2XXBA 3H6KA 1SPXA 3DC2A 3H9UA 1VJ1A 1V3TA 4WCFA 1MG5A 3ADPA 4WNIA 3QVWA 1TT7A 5T5QA 2GZ2A 1P0CA 3OEYA 3ROQA 1D1TA 1EFLA 1UP4A 3TL2A 1CEQA 3HFSA 5FYDA 1ZIDA 2Y66A 1XHLA 5C7IO 1JAYA 4YJDA 3WR5A 3EC7A 1MX3A 1EMDA 3CTMA 3EAGA 5DP1A 1G1AA 4FJ2A 2X9NA 4FDAA 1MFZA 3ZWPA 2G1UA 1T2EA 4LRTB 1DFHA 2V6GA 4BMVA 3INRA 4AJHA 1DSSG 1UZNA 1VKNA 4NBUA 4W7IA 2EHDA 2GGSA 3GEMA 1KVRA 1Y9AA 2FP4A 4I08A 1UDBA 1I3KA 1ZW1A 3WS7A 5FEUA 4WJZA 4M1QA 2JCYA 3DO5A 4ALNA 2EP7A 4A2CA 4CV2A 4RDIA 4RPHA 2QZ9A 2IE0A 4B4WA 4Q3NA 3Q11A 4XR9A 1QYXA 4MDHA 4JBIA 4C7JA 3LC1O 1UH5A 4D43A 3WWZA 3GRPA 4NDNE 3E9MA 5BNIA 3N74A 1HZZA 4CM1A 1V3VA 1HE3A 1PTJA 3H65A 1PZHA 4OGWA 3S2IA 1MA0A 3ZWBA 3PHLA 1LQUA 3TFOA 4J7XA 3IJPA 1PZGA 3DZFA 1NAHA 2HMWA 1YL7A 3L4BC 1I36A 2PTGA 3ZW9A 2DQ4A 1E1KA 2Q1SA 1H2HA 4JNKA 3F46A 3G1TA 1JVSA 4UEOA 2C54A 2PKQO 4C7KA 2JJYA 4IMRA 4CM6A 3ZV6A 3UCEA 4HV4A 3SC6A 5KNLA 4YJHB 2HMVA 3SLKA 4AVYA 1Z75A 3OIFA 3RWBA 4IMPA 4AJPA 2FR0A 3P5SA 5CPFA 1H9AA 1XELA 4CR6A 1U1IA 3LK7A 1IHYA 2W2LD 2NADA 4AJKA 1GAEO 3T7CA 3OEWA 5A1TA 3ZNQA 3PYLA 5IF3A 3LF2A 2P4HX 5FWNA 1FJHA 3SLGA 2AQIA 4KMSA 4WOJA 3B70A 3DBLA 3RC1A 4HFNA 3ENKA 1KY4A 4YT8A 4LCEA 4R9RA 3DHEA 1D8AA 3GGGA 2Q2WA 3JQ9A 1PQPA 4FFLA 1WPQA 5IFLA 3IJRA 3QA9A 4B3IA 3D3WA 2YJZA 4PZCA 3CUKA 3JQEA 1DIAA 2NUAA 5B1YA 1CF2O 3LT0A 4KWIA 2VYVA 1O0SA 1HSZA 4WEQA 4KQWA 4Y6RA 1O95A 2X5KO 3CZMA 5ILGA 3GVPA 1X7DA 1Y5MA 1LJ8A 1HYEA 3M6IA 4U7WA 4R1TA 1TVEA 2ZB3A 5CDUA 1GUZA 4D7AA 3L0DA 3GQVA 4GGOA 4U0KA 1A7AA 2QG4A 2EGGA 3FF4A 4ZJUA 1HSOA 1B3RA 4S3MA 1MC5A 2VN8A 3RU9A 4J90A 1ONPA 1P9LA 3WLEA 5KVSA 4JJIA 1QR6A 3L6EA 3PRJA 2LDXA 4MP8A 1ZK4A 5DNAA 1YBAA 3ZGYA 3DBRB 3AUTA 5ICMA 3D4OA 3LVFO 1ZH8A 1PJ3A 3PIIA 4HNGA 3K8ZA 3RUAA 4IDDA 3MJEA 4XZ3A 2X7HA 3L4BA 3GLQA 4GAEA 3D64A 3QSGA 3H8VA 1TXGA 2PGJA 4YWJA 1Z6ZA 4HX5A 2EF1A 4DA9A 1ENOA 4FJ0A 4ZQBA 1EBUA 1HWYA 4IINA 2X9GA 2F1KA 3WQSB 1IUKA 5A05A 5EIOA 1PJ4A 4G5HA 3C7CB 4ZQFA 3ZU4A 1NQOA 2IZ1A 3UCFA 2CDAA 1IZ0A 1GFSA 1VKOA 3OJLA 3ZV3A 5A4DA 3C7AA 2JKVA 5TJ9A 5T67A 4LVCA 1YOVB 4BO4A 4TRRA 3E18A 1DHTA 3RUFA 3FPCA 4E21A 3WGYA 4XGNA 3Q9NA 4ZN6A 4CMIA 2GPTA 5T57A 2UAGA 1VPDA 5BR7A 1ORRA 3K92A 3ONDA 1T4DA 4BKQA 5I9NA 5K9ZA 2HDHA 1X1TA 1LX6A 4BNYA 4ZHSA 4EBFA 2EXXA 3IOYA 2AMFA 3LT2A 1JA9A 2DTXA 4U6SA 2YDXA 2NQTA 5B4VA 4OXKA 3DWFA 3WFJA 1J5PA 1C0LA 4DMMA 1PGJA 3CMCO 4R3NA 1CQJA 4JN6B 2FPPA 1PS0A 3IP1A 5BSGA 4IPTA 2G0TA 3KRTA 2X0NA 3TN7A 3ZV4A 1LU9A 1PWXA 4L4RA 4NH4A 3TWOA 3O9ZA 3GFGA 3FCOA 4NU6A 1PZEA 1R37A 5ER6A 4MINA 2G76A 2ZKLA 1JVBA 2GD1O 1ZO8A 2H1SA 1CYDA 2ZB7A 3W8FA 1H6DA 1NQ5A 3DBHA 4PG6A 3DFUA 4DPKA 5JDIC 1ZSNA 1U4SA 1NFFA 3R1IA 1ISJA 4BVAA 4L8VA 2A9FA 4TKMA 1M2WA 3JV7A 4IJVA 4OIMA 3GG2A 4UUMA 4B4UA 5THQA 1YRLA 1NXQA 2JL1A 1Q7GA 3E1KA 1VM6A 1NP3A 1YS4A 3MEQA 2HUNA 4R5MA 5JS6A 2HRZA 5DT9A 4B3JA 1B15A 5JXWA 3VDRA 3EMKA 3NGLA 4XQGA 4YJHA 5DCWA 3GG9A 1JN0A 1ZJYA 5I7FA 3FN4A 4CQMA 2D4AA 4YPOA 1P33A 4ND1A 5HS4A 1ZXLA 5G0VA 3WMWA 3I6QA 3K30A 4IJWA 2CD9A 3WICA 4CM4A 1N9GA 3KOUA 1BXGB 1R66A 4B8ZA 3OECA 4BNIA 4CLRB 1Q0HA 3W4JA 4UULA 2GO1A 2HLPA 8ADHA 4KWHA 3ASVA 4RPKA 3TOXA 3RBXA 1C1DA 1I3LA 3GHYA 1E7RA 2HK8A 3KLMX 2GZ1A 3VVCA 4IJKA 3OQ1A 1QYVA 3HDHA 1YL6A 3Q6IA 1BTOA 4WNCA 1J0XO 4YR9A 1RJWA 4W4TA 3COSA 1I30A 4E2XA 2C82A 1MLDA 2QX7A 4CM7A 1Z7EA 5IXYA 1VSVA 4Q3EA 3V1TC 3DZKA 2P5UA 1DPGA 1GYRA 1ADGA 1NPTO 1NQAO 1T1RA 3PGJA 1X15A 1DFIA 4XB1A 2CVZA 5JYEA 5G4LA 3DZHA 1Z74A 1PWZA 3I5MA 4ITUA 3JQAA 3WQQA 1NTOA 4YEDA 4RORA 2P9GA 2RAFA 2QW8A 1EE2A 3RUDA 3K2BA 3RFXA 2BRUA 4NBRA 3HZZA 3A28A 4PLCA 4OJNA 4TVOA 4EI2A 2PZLA 3JQCA 1T2DA 2PWZA 2ZATA 2B37A 1NNUA 3VTZA 3I4CA 4O6VA 1U9JA 3LYLA 1NHWA 1ZKMA 2E4AA 4RDHA 1U2GA 4MVJD 3TF5A 1ISFA 3ETGA 1GUYA 4A5OA 4PG5A 4BHTA 5TGDA 2BGLA 1LDGA 4PG4A 3QY9A 2XOXA 3DHYA 2GUGA 2JCVA 3TDKA 5ILOA 4RF3A 1TT5B 2PGDA 4J9VA 2VZ0A 2Y1CA 2CY0A 4J1TA 4DGSA 1ZUD1 3ZCXA 1PU2A 4HP8A 1CIVA 2C2YA 3PYMA 4XKJA 4KDFA 2YW9A 5JMPA 2I3GA 1T25A 1A9ZA 5ER9A 3BMOB 3K73O 3JYOA 1MUUA 4CV1A 2BGKA 3WB9A 1KVUA 1XG5A 4J4TA 3GVIA 5J23A 5F1KA 5F5NA 3PHHA 3TJRA 5I7VA 2C7VA 1MGOA 4Z6KA 5F21A 3KBOA 4XCVA 2YYYA 3WGTA 2GSDA 3RBZA 2C7GA 2YV3A 3WIDA 2E82A 3TFQA 5HTOA 3OETA 5L4LA 1AUPA 1Q2XA 3QW2A 3E82A 4PRLA 5T64A 2HMTA 4BQPA 3MJVA 5A9SB 1U8FO 1YDEA 4DVJA 2DAPA 1GZ3A 4ROSA 3OH8A 5K6AA 1VJ0A 4B4OA 4LGVA 1EVJA 4YJFB 4NFHA 2WWRA 1X7GA 4QXMA 4B7XA 3DONA 5LDHA 3GPIA 4DPMA 4A27A 1ZXBA 1OC2A 4MP3A 1R4MB 5CEEA 1P1KA 3U4DA 4D44A 4M49A 2JFFA 1B8PA 4NFYA 3PTZA 1D4FA 1E3LA 3KSZO 3PYXA 3TSCA 3AOGA 3PJGA 5KCZA 4O5OA 4RLHA 3INGA 3S8MA 5T8KA 1KEUA 1H6BA 2VTEA 1DC3A 2GLXA 3UOGA 4YTEA 3MTGA 4BO6A 1VL0A 1Z73A 5COBA 4IS3A 3LDHA 3IIEA 3NT5A 3HN2A 4J7UA 1EDZA 1ENYA 3PDUA 1ZK3A 1HDZA 3SXPA 3QQPA 2JD0A 1U5CA 4IIUA 3AJRA 3F47A 3PFWO 2OXIA 3AWDA 3AFNA 2NVUB 1GCOA 3W6ZA 1VE9A 4PLZA 4TKLA 3WX0A 4EUEA 3WGGA 2FRDA 3PVZA 4Z3DA 3H9GA 2X0JA 3P19A 1LRKA 1QLHA 1U3VA 2YHIA 1PR3A 4L73A 4LCJA 3ZNNA 3AUUA 1XU7A 1OZAA 5CDGA 5JY1A 1KS9A 1GYPA 1K0UA 5U1PA 5B4TA 3DOJA 3K2EA 3NRCA 2GERA 5G0SA 2OO5A 1YB5A 1U4OA 4FSHA 2PR2A 4MVJH 3WLFA 5CFZA 2ZJ0A 1P1IA 5GMOA 4BNNA 1LRLA 4ZRMA 2W90A 3DDNA 2FWMX 2GR9A 4OH1A 1UR5A 3ULKA 1HZJA 3O4RA 1O9BA 5C37A 4J9UE 1WMAA 1ZBQA 3GY0A 3B20A 3RUEA 3ETEA 2D8AA 4Y67A 4LRSB 1HDOA 2X0IA 3DOCA 3PIDA 3G17A 3OQBA 4HWKA 4KTTE 1GR0A 1Y7TA 4GX5A 4NR0A 3SBOA 3ANMA 2FZEA 1I33A 2VNAA 1BSVA 1ZFNA 5IDXA 1V6AA 3EGOA 3QWFA 4NJMA 5A9TA 2O50A 1HDRA 1LDEA 5H82A 4NZ9A 1PJTA 1YWGO 4HFJA 2X9VA 3ICCA 5DCUA 4J43A 4NFSA 3WJAA 1PZFA 3WYEA 4EGFA 1E7QA 2PGLA 4R3WA 5A5FA 2YQ4A 3HB4X 4RGBA 3PQDA 5BSHA 3PEFA 2Q2QA 3IC5A 1S6YA 1RYEA 4RJTA 3I9KA 2WYWA 1AHIA 3I6IA 5L40A 4IGEA 5BT9A 4GX0A 4WEOA 4S1VA 3W8DA 1F14A 2HU2A 3VH2A 2XPCA 1X14A 1PS8A 3GH3A 1N2SA 1GEEA 1Y8RB 1BDMA 4ZQHA 3RI3A 1NFRA 2HKIA 3ZHXA 5KKCA 3BAZA 4CMHA 4WK6A 4Q3BA 4L75A 2GASA 3DZGA 1LEHA 2WD7A 4U5QA 4FFRA 1HF3A 3GEDA 4ZGWA 5AXCA 2VOEA 5JYDA 2NU8A 1YB1A 3W8EA 2AEJA 4L74A 4G81A 1LXCA 1YGYA 1AXGA 4PZEA 4DWVA 1XA0A 2O4CA 4N54A 1HYHA 4M87A 1UUFA 3IDSA 3ETDA 2WMDA 2JD1A 4P8RA 5IZCA 2NNLD 1QV6A 2OOSA 3NDJA 3JQ7A 1DIBA 3OJEA 2VRCD 5LCXA 2Q1WA 1LUAA 3JQ8B 5MGBA 4CUJA 1W8DA 1R15A 1WMBA 2ZTVA 4J49A 3T4EA 3VH4A 4HXYA 3VKUA 5ITWA 4CV0A 2X6TA 3MJ4A 5IDQA 2FPGA 3G49A 4N5LA 1MG0A 4LSWA 2JD2A 2GYYA 4GVXA 3BTUA 1C0KA 1DIGA 3GDOA 4E30A 2NU9A 3P2OA 3HG7A 1MC4A 1OAAA 1T2FA 4FFMA 4GGPA 3RFVA 1QYCA 1BXGA 4IDEA 4TRJA 4BO9A 4YXFA 4CLRA 1N5DA 4Y6PA 4XX0A 3E48A 4CMKA 4E12A 4G2NA 2DKNA 3EY4A 1P1FA 4UVEA 1LRJA 5TJHA 1K6IA 3D7LA 3EDMA 1LC3A 1KVQA 2W2LA 4IDAA 3L77A 3PJDA 1JKJA 4I9UA 4J1NA 1HDGO 3LLVA 1Y6JA 2CZCA 3TPCA 2HO5A 2FSVA 1EK6A 1B2LA 2ZQZA 3E5MA 4CJXA 3KETA 2CF6A 1N7HA 4YRDA 4KUEA 4E2WA 4YACA 1LI4A 1U3UA 4RPLA 1N8KA 2YFQA 4GLLA 3U3XA 3RBVA 4DC1A 1B14A 4J1SA 5B12A 1EUZA 3TZQA 4CL8A 5DBIA 2IZ0A 3G0OA 3ICPA 2DM6A 1CRWG 2OUIA 5ENDA 3ZHZA 3H5NA 3PWSA 3V2HA 3QWBA 4ILKA 5TX7A 1FXSA 3IUPA 3M2PA 4GKBA 3BMNB 3ZW8A 1KOLA 2X22A 5KOIA 4BQRA 1KC3A 4PCVA 1T1SA 1JWBB 1FDSA 1EUCA 2RIRA 3F6YA 4BO1A 2VHZA 2Q99A 1Y81A 2YZ7A 1DEHA 3GDFA 2Q46A 4QX6A 2EP5A 3ADOA 5G0WA 5GZ6A 2ZCUA 4XJSA 5DCYA 5HWSA 5IDWA 4KQXA 4I9NA 1I3NA 1NR1A 2QRKA 1MV8A 2NVWA 1NX6A 1DXYA 4RVFA 4CMEA 1PQWA 2H63A 3BHMA 3U9LA 1VI2A 4NK5A 3ROPA 3GVXA 3IL2A 1R4MA 4O59O 3AM4A 1KERA 9LDBA 5EPOA 2NVUA 4L4SA 1B0AA 1NAIA 4BO7A 1U3TA 3HSKA 4R69A 2Y1GA 3DZJA 3HDQA 3WQRA 4GKVA 3S2GA 1GTMA 4LK3A 4YJGB 4BO8A 2F00A 1Q0QA 3FNHA 3H3JA 4A7PA 1EBFA 4DQUA 3BYZA 3HJAA 3WBBA 4LISA 2X8LA 4IS2A 4P38A 5ENVA 1A5ZA 3DTYA 3I1JA 1SAYA 2ZTUA 3DOOA 3DZIA 4K1LA 1Q7CA 1HDYA 1LLQA 3HQ4O 3B1FA 3E5RA 3UKOA 5A5EA 1ZJZA 4WECA 2B5VA 3GA0A 2QZZA 3D0OA 3DMTA 2X0RA 2DU8A 1YQXA 4J16A 2VQ3A 5HS6A 4AFNA 3ZNPA 3UUWA 2GN6A 5G0TA 4DLLA 3RU7A 4ALKA 3PLNA 3T4XA 4EDFA 1IPFA 5K0ZA 4Q39A 3F9IA 4IXTA 2DTEA 1HRDA 4PLVA 2FZWA 2BKAA 1N1EA 2RH4A 1LDNA 3ZH2A 5COQA 4E2ZA 2Z1MA 3RROA 2R6JA 2P9CA 1LDYA 3WGZA 1WDLA 4YT4A 4D3DA 4F3YA 3TQHA 3H9QA 1SCUA 4Y8VA 1P3DA 1V3UA 1FF9A 1R4NB 4PLWA 2B4RO 3KEOA 1H6AA 1L7EA 3IUSA 4RL6A 4BNVA 1PJSA 5TQVA 1YB4A 3UH1A 5B4UA 2I99A 4IM7A 3NUGA 3TZCA 1PL8A 3VH1A 4ZVVA 1ISMA 3IQDB 2BFMA 5I7EA 2FR8A 3FWZA 3U09A 3F5QA 1PQUA 5EJ2A 2YHIB 2C07A 3KVOA 1AN9A 3AI1A 3GDGA 4FFOA 4E5MA 4EUFA 1ENZA 2VTDA 3ZWXA 1E6WA 1G6KA 1HDXA 1I0ZA 2PKQP 1H6CA 3WIEA 5L45A 3JD4A 4KTVE 3MZ0A 4E0BA 4EUHA 1WNTA 4WUVA 5IZCC 2Q3EA 3HFGA 1HT0A 4FPXA 3ANLA 3CMMA 2D0IA 2I65A 1T2CA 4Z9FA 4D0SA 2UDPA 4BNTA 3PHJA 4GQAA 1EVZA 3OIGA 2X58A 4UEJA 4UVDA 4AJNA 1GEGA 2QYSA 2QRLA 3W4KA 2DBRA 1MXHA 3KLPX 1AGNA 3GF4A 4KOAA 5DOZA 5BQFA 5CG1A 1XYGA 3D3WB 3HE3A 4O1MA 4HBGA 2EEZA 3B1JA 4KDEA 5EQDA 3D5TA 1B26A 3JQAD 3M1LA 4RF5A 3I9LA 4QSMA 5EL0A 5L7TA 3ZU5A 3JQFC 3W6UA 1DBVO 4DIFA 1ML3A 1ZSYA 4IQ8A 3RKRA 1O6ZA 2OBNA 5KJCA 1P1HA 4CMGA 2W98A 2Q49A 2IZZA 4R4JA 2I76A 2BI8A 4WCFC 2DFDA 1YO6A 4DBZA 2PD4A 4I9HA 4J6FA 4J3FA 3HDYA 4EITA 5GZ3A 5IN4A 5JLAA 2QRJA 4NJOA 3D3EA 4ZD6A 3EZLA 4R51A 4YAJA 2O4UX 1IULA 4YAIA 3RJ9A 4BS9A 2I5PO 5DBGA 3WGIA 1XWFA 4LN1A 2UUPA 2VT3A 4ID9A 4M8SA 4XQCA 1DB3A 4ZQGA 2WYUA 1E6UA 1WWKA 1DDOA 5IDYA 5B37A 3ZZNA 1E0DA 3ONEA 4E4YA 3BTSA 3NX4A 2AEFA 5H83A 1NVGA 2Y1DA 3QE3A 5L95A 3VOSA 2GDZA 1JLLA 2Y99A 1YJQA 1FDWA 1E7MA 1WLYA 4DTIA 2DLDA 5JAIA 3DAGA 1T24A 3BTVA 4Z9XA 3R3JA 4ND2A 4ND5A 4MVJA 5JC1A 5IZ4A 2XAAA 1KVSA 1RYDA 1YKFA 5FFFA 3O03A 1NR7A 4J4HA 2Y1OA 1M75A 2VYND 4AJ1A 1ONOA 2CVOA 3H9JA 3NEPX 5L4SA 1P1RA 1UXGA 2OP1A 2HCTA 5BNFA 3I9MA 4BB5A 4BO5A 3VKVA 1QXSA 4MIEA 4E5PA 2WJPA 2O7QA 3AM3A 3PJEA 1E3WA 3C1AA 1WW8A 1DRWA 3FHLA 5CDTA 4A0SA 2HQ1A 3CKYA 1K89A 2IYPA 4XQ9A 1SC6A 3GPDG 4GX1A 3I9OA 1GPDG 2LDBA 2EKLA 1E5QA 1W6UA 1FDVA 4L0QA 1G0OA 4XDZA 2IXBA 1KIFA 4BNFA 3ZWYA 4E2YA 4E3ZA 1DIRA 1EQUA 4O0LA 3CE6A 3JQGB 4GMGA 4CUKA 4F6LA 5A06A 5F1PA 3SVTA 3NGXA 1DC6A 4RZIA 3I52A 1ZEMA 4A10A 5L7WA 2A4KA 2I6TA 3F5SA 3PPIA 4L4XA 2HMSA 1UZMA 2CFCA 5EERA 4PN3A 2P68A 1NQTA 3FSRA 4NHEA 4OL9A 3SJUA 4B79A 1HL3A 2EJVA 1D7OA 3HUDA 1YXMA 1YE3A 4XGKA 3N58A 1DOHA 3KYCA 8LDHA 5JC8A 2FOIA 5KIAA 3OJOA 4GBJA 2VHYA 3IKTA 1IY8A 4AICA 3AFMA 3PZRA 2FR1A 4PFJA 4IQ0A 5HA5A 3H2SA 4NPCA 1NBOA 2PFGA 3SC4A 1GY8A 2QYTA 2X23A 2I67A 3ON5A 3D5QA 5JCJA 3BHIA 1H93A 4NBTA 5ES3A 1YH3A 1DIHA 1V8BA 3CPSA 4PG8A 3NAQA 3A9WA 3ANNA 1DAPA 1HEUA 2ZB8A 5TS3A 9LDTA 3PZBA 4DMLA 2GRAA 1SEPA 1ZEJA 1ULUA 1NWHA 4CPDA 1QLJA 1PEDA 5TSDA 1YL5A 5JAQA 1IB6A 4JK3A 2R00C 3WNQA 4FCCA 4YQZA 3AY7A 1C0IA 4W99A 2IODA 4K9DA 1HDCA 4WASA 4D42A 2FPIA 3NTQA 2P2SA 3IAHA 3KO8A 5JPIA 5KWEA 1AE1A 1O89A 3IS3A 3NTRA 2PZMA 4XGIA 3GVHA 5U4QA 3UGKA 4QO7A 5CPBA 1IHXA 2H5LA 1CWUA 4P22A 4IZHA 4RVSA 3DMYA 4JXKA 1D1SA 4WCDA 4DLAA 3K6JA 5CAEA 2O3SA 3DBHB 4CQMB 1F0YA 3N7UA 1XLTA 2AW5A 4HFRA 3MTJA 2JFGA 4WE3A 3SEFA 3GGPA 4TRNA 1K5HA 3IKVA 1KBZA 2WEKA 2WYVA 3TZHA 2RBEA 2J3KA 4GL4A 5DULA 3ASUA 2NTNA 2C2XA 1I32A 3ZNOA 4BGIA 2ET6A 5L3ZA 1H0KA 2PKRA 2OORA 4L9RA 3ZHYA 4M54A 3NKLA 1E1LA 3NT4A 2WDZA 1GDHA 4YBZA 1LLDA 2EGHA 4AJ2A 1R16A 2DBQA 2YV1A 4J0FA 4LMRA 3STHA 4BMSA 1AXEA 4GI2A 3PDJA 3HHPA 1UDAA
chains in the Genus database with same CATH superfamily
2A9QA 3CURA 4CM4B 3GN1A 1GILA 4BL5A 4DL9A 1OKKA 4XJTA 5JALA 4RM2A 1ZIOA 3KHTA 4LE0A 2Q4DA 3T5DA 2AVDA 2KQUA 5CXUA 4V0NA 3Q5DA 3QQ5A 4IV5A 4AZ3B 1J8YF 1O5TA 3FPHA 3DLPX 1II8B 3HZHA 4CCAA 4KQIA 5K3OA 1ZGGA 1YU6A 1R5BA 4LZOA 4IX1A 3T06B 1DL5A 4Z7NB 5IKPA 1Y8ZA 4LJ7A 5FNVF 4IICA 1QOQB 2GK4A 2DBVO 4Z1MD 5F78A 2QX9A 1EZ4A 3NANA 1SKUA 1G3QA 4CKZA 5JI2E 5IM4F 2DETA 5DEOA 5HBGA 1ZHOA 2IBSA 2PRIA 1IU9A 1ENPA 4MYUA 4YRLA 1F2TA 3A14A 1USKA 1CE8B 4L0CA 1S8OA 1V5WA 4G4SO 4NU0A 3TQRA 3UICA 1E92A 4CM5A 3WGVA 4YK7A 1ZH0A 1BYUA 2B4AA 2ZYDA 2WB4A 3Q3IA 2GQ0A 5D85A 4RENA 1VJ5A 2ZUBA 5IAAA 1TX4B 3USZA 1ZOLA 3B2EA 4YDHB 3LUCA 1CJCA 1JF8A 3AI2A 1GADO 4W9NA 5KPDA 1IN6A 3ROFA 1JJVA 2PRSA 4QECA 1U63A 2WMNB 4IJ5A 1EFDN 3RV3A 4I46A 5EAIA 2IYOA 3VZQA 3ZYZA 2WF6A 3ESRA 1DXOA 2R48A 3GA5A 3KB6A 1EVYA 3VR5D 1ZHHA 4Q16A 3F2VA 1IBRA 4LOLA 1EP9A 3NATA 5L9AA 2HT1A 3G8YA 1QCCA 3R3ZA 4N4AA 5D7NA 4CQLA 4ZXFA 1C8BA 2FH5B 2W37A 1OZHA 1PFQA 3L6OO 1HYQA 1Q7BA 2ZRNA 2DR0A 3FRIA 4JIMA 1GL7A 3KUXA 4JU8A 1XZDA 2C5BA 3BQ9A 4D57A 3KJQA 4HQKA 1ZMOA 3LBIA 3MGAA 4DBLE 3D0QA 3DR5A 4JY7A 3E2PA 2AXNA 3OFSA 3QOYA 1S2DA 3U4CA 1AVTA 2EATA 2X9LA 4X85A 4Y6SA 2VHEA 3EGDB 4RVGA 5K05A 4N48A 4M1WA 4NHOA 1L4HA 4YRBA 2VYCA 4OXRA 4MNTA 5C5IA 1RE1A 1K0FA 2C4HA 4LXIA 1AK9A 2BCEA 2QP4A 1YBFA 2Q4OA 4YROA 3A4IA 4JP8A 3SG0A 1Y6FA 4J94A 1OWMA 3LWNA 4DADA 3KVNA 3NBZC 1L4UA 3OE7A 4H7FA 4NEQA 3WAKA 5HBRA 1QYIA 1L3BA 2PCJA 1RPZA 4Q7QA 4EHAA 2WIFA 2YCBA 5CVCA 2PA3A 3MMXA 4RGYA 5DWDA 3VDNB 3TNLA 2CWDA 4PAGA 4U7JA 3HBMA 1GL3A 1ZC4A 1KO7A 1VC2A 5EMJA 3A6LA 1T5SA 4JVMA 3UXYA 1P8AA 1XQ1A 4OPMA 1Y1RA 3OF3A 1YUMA 2J5XA 1EJ2A 3FY4A 4LFAB 2QX6A 1J8QA 2BEJA 2GK7A 1AS3A 5AJVB 1U28A 2A1UA 2QW0X 4OEHA 3RUIA 3C2QA 4DWJA 5FH9A 3D81A 1CUAA 5FADA 2OZVA 5E6RA 2VP4A 1MOSA 3FPLA 3PUJA 2CVQA 4GPD1 1VLLA 1I4TD 3FX2A 2C3OA 3FB1A 4DMCA 3GLGE 1E94E 2FX3A 4AZSA 1GV0A 1IAVA 2J6IA 3FDZB 3R2JA 2OCDA 3GLIB 1T91A 1UMCA 2BRUC 3TD9A 5ALWA 5WRFA 3D1LA 2AQHA 3KB2A 4ZCQA 4NVRA 3WOHA 2JLCA 3A9SA 1I5OA 1G55A 4QOIA 4XWAA 3BA1A 4JIGA 5AHRA 4U6QA 4W5RA 4DUGD 2GEFA 3MTIA 4I3HA 5AJTA 1JG4A 5AI6A 1JEAA 2HNBA 1LPSA 5K0LA 3E7DA 4H6VA 3KJFA 1GPUA 1U2GC 4PQFA 3RWOA 5CCEA 5IJZA 4MPRA 4KVZA 3DFZA 4DW8A 3T4PA 1G8YA 1GAWA 4AJ4A 1XIVA 3FNGA 3NRJA 5BURA 5ADWA 5HM8A 5LNK1 5KB3A 2VOJA 1E1QA 1DDIA 2P9ZA 4D0NA 4BV9A 3F3MA 4Q9HA 1R4ZA 2WM9B 2OFFA 3E22B 4PBTA 5ANRB 3UF0A 4M0DA 3LX6A 3ROMA 3OTQA 4Q7EA 1P6QA 1FX1A 3KFVA 4FKMA 1Z4MA 4HGOA 4XR4A 2JK1A 4YRFA 4B1FA 4H6WA 5JH7A 3IAM1 1Z5OA 2DWUA 3OHPA 4OK3A 3B82A 2WJWA 4Q4AB 1JEDA 3D6UA 4EP1A 3GLFA 1OTHA 2NNWB 5IMBA 4HDMB 1MV5A 4M8KA 4TSFA 1GJRA 3QVSA 2NZYA 3CLSD 1SUCA 5JDCC 3KKMA 5BSFA 5HQ3B 5FWYB 2J5QA 1DRJA 1OA1A 4XGRA 3M8KA 4OX9B 3OFNA 2ECOA 3UN1A 4DYHA 2YCLA 4ZARA 2W4QA 4G0ZA 1GWNA 5LQJA 2Q0QA 4RV5A 2BHRA 2X8JB 2VKTA 1T9GR 2I9PA 2JGLA 2GPSA 1NONA 3D0KA 3NJ4A 3D7KA 2Q9UA 4N0DA 3FNBA 3TD2A 1ZGJA 3OM0A 4BV8A 4NP6A 2AXQA 3KVYA 4WLUA 3VNAA 4JROA 3NIFB 4MVYA 5ALOA 3ERCA 4TQGA 4UBJA 2IHVA 3NAMA 3TH5A 2OC9A 8ABPA 3BWEA 1GCUA 1HKUA 4B7UA 2VHVA 1JHMA 2HFJA 3KPYA 3JS5A 2WKRA 4TVBA 3GGCA 1K86A 1CNMA 1JKFA 1OE0A 2VT7A 4OREX 4HATA 4HSGA 1KHHA 3N6RA 1D0SA 2BGTA 2QRHA 3AF3A 2QRVB 4JR0A 1DKNA 1TMGE 3K94A 3VI3B 1U9CA 2ZYGA 2V97A 1TVMA 3L4JA 1TK9A 4IFBA 4G0UA 4MI6A 3F2IA 5JLJA 5J1SB 1K3UB 3JR7A 4RA6A 4E51A 2D59A 5EIXA 2BFCA 1OZ0A 1TJNA 2IL1A 2PWPA 2WIDA 2G7MC 5JAZA 4Q00A 4GZ5A 1WXEA 1DC5A 4D97A 2QTMA 4HADA 5FA5A 1BJRE 1ZJ5A 3AVVA 4ND8A 4BBPA 2ONKA 4CM9A 3L3BA 3TGLA 1LVUA 2ZBUA 2FN4A 5TVKA 4CQNA 2HCRA 3BICA 1ZH4A 2BMAA 4NYMQ 4KR2A 1JYSA 3T7RA 4TLEA 2JGMA 1VL1A 3G5UA 4Z54A 3W8RA 2B25A 3WSTA 4RO0A 3S70A 4H17A 4L8LA 4DNOA 2IXFA 3R0XA 4KMOA 1L5QA 3WG9A 4JXZA 3ITNA 3DEYX 4WMLA 4I9FA 1XPOA 4RTLA 5I7WA 2C5AA 1IUNA 2G06A 1EFPA 2H2FA 3FI0A 4NCBA 1B7GO 4RMGA 2PL3A 3RR2A 4IGKA 4H77A 3PFBA 3RAJA 1AA6A 3PGXA 2VZEA 4MAFA 4WN9A 2O14A 1YJCA 4U00A 3GLHA 3RUHA 1L5KA 3A6HA 4OHUA 1I2ZA 3UJCA 3V5NA 5F9FA 3G2JA 4OKIA 1JKIA 2FPIB 1JQLB 1L5HB 2GJ9A 1XDWA 2B69A 4G1VA 2COKA 1T4GA 1E2IA 1UANA 4PIPA 4F5DA 3GLGA 2GHTA 3CF4G 1AUVA 2NQ8A 1S2GA 5BUZA 1PWHA 1VLZA 2RGUA 3TJZA 4A8JC 2HPVA 4MQEB 1T26A 2AFHA 2I1LA 1LLUA 1G6OA 5IJAA 1EHYA 2H07A 4R41A 1O9HA 3WKDA 2FN7A 2ODTX 5A4KA 3R3XA 2EIHA 3FGOA 5REQB 3SQNA 1YJAA 3TR0A 2XCLA 2XOKD 4E4RA 3N6XA 3GIWA 4MPDA 5KJFA 3W7AA 2BFAA 3KSAC 1GV1A 1Z22A 2P79A 3GUYA 2YH2A 1W46A 1YZUA 4FYKA 2B1JA 3AO0B 5JDCA 2BFBA 5IJWA 3HCDA 1FJXA 4YYZA 2JKYA 2V65A 2EVWX 1WR8A 3AM5A 1Y6ZA 5JMTA 1OWOA 4DMGA 3PL1A 1BA2A 2NZXA 3OLCX 5CHYA 5E9JA 6CHYA 4ENRA 3K4PA 4PYOA 1E0SA 5DV9A 2O2XA 3TB6A 1O6BA 2EAUA 3GK3A 4AG3A 2C2WA 2C95A 3EZ7A 4XYMA 1L1QA 4TV9B 3E6AA 4XASA 3Q7RA 4J0DA 3VR0A 1HFKA 5BUCA 1RPTA 4RCVA 2CLEB 5EWJA 4UFPA 4MYHA 4TMFA 3DSRA 3KQMA 2O8VA 1W88B 3T9BA 3G3EA 5U4XA 1SQFA 1ZMXA 1JZTA 3CN7A 3PD7A 4UUPA 1F8FA 2QN1A 1WKVA 3OEHD 1L7VC 1KJZA 2VL7A 3H4VA 3HWRA 3DBVO 1YC2A 3ORFA 4YO7A 5HMLA 3DE4X 4PO9A 4CQLB 4QHYA 3AESA 3HA2A 2Y93A 1XROA 2SCUB 2XUFA 5J2UB 5AW2A 4FWIB 4W7HA 1UP7A 1F6BA 3OZDA 2VWPA 4BGVA 4F45A 1YONA 5JEDA 3EDQA 4HQRA 1S9DA 4XWGA 5K8CA 4QHSA 3U7GA 5F7XA 4ECAA 1QQBA 4CMIB 3L1JA 2O57A 4KRGA 4QM7A 4OKNA 4I8DA 1JH9A 2EKPA 1XVUA 2IYXA 4LVUA 2XZLA 1UPXA 4O2BF 4GI3A 4GI7A 4LA4A 5EMNA 5A3VA 3K9FC 3MJCA 1JJIA 4MTLA 4PTLA 4R31A 1ZX1A 1IDOA 4I3FA 1K6JA 4AAYA 1PJ2A 1OX5A 3C3MA 4B48A 4EJFA 1P4AA 2BJHA 3CISA 4I4CA 4U1RA 3BWYA 4Y1EA 3TRKA 3U49A 2PGAA 3K9BA 4EJ6A 1E8NA 2GAIA 3LCRA 4GXQA 2ZIZA 1WF6A 2I3BA 1BRMA 4I4TA 1O6FA 2WF5A 3CVOA 3Q1KA 5FOWA 1M1UA 4NDAA 4II3A 4HB2A 4I1VA 2OV2A 4L7VA 4RKYA 2FPKA 1KHTA 1SVIA 2V6FA 1IN1A 3VTAA 1JAZA 1XTQA 2UV8A 3D4PA 4IDNA 4I6JA 3UMSA 1AUQA 1AMNA 2XLCA 1SK9A 4RH3A 1WZIA 2AK2A 4NECA 1BD4A 2O2DA 1EGAA 2QMOA 2RAPA 3KKQA 2A9JA 2VNSA 5JWHA 3T9EA 3TSYA 2Y71A 1JDSA 1J25A 3PDCA 4DPLA 3EGDA 1Z0KA 3M4NA 1FZQA 4IFEA 1C4OA 4Z8XA 2EFEB 5KNCA 1XK7A 4ND4A 4C0AC 4M4SA 2UXCB 1N2JA 3LGAA 2WVJA 3SYNA 3ZVKA 3KT3A 2R8OA 3RADC 4TVKA 3RVDA 1M7GA 3FW1A 4UUOA 1H4SA 2PZEA 2PBZA 1NX9A 3AIKA 5AI0A 2CZGA 3CCBA 4XTCS 2BF7A 3BF8A 4RV4A 5K3SA 3S99A 5IK2D 5JZSA 5ED4A 2FY8A 2HQOA 4H1UA 4BIIA 2CN1A 4AKHA 1Z8DA 2UYOA 1XN1A 1DBWA 5CX1A 4YB8A 2CXNA 1UP6A 5ICGA 4E6EA 1H4TA 5CGQB 3UNXA 5EE9A 3BSYA 5BMVB 1DO8A 1RNLA 3S7TA 1JLHA 3WWOA 1YSCA 3V8BA 1YAJA 2JHAA 4E6PA 5ITZB 1PCXA 3JZMA 5JW6A 1IY0A 1P7WA 2ZP1A 4W63A 3VGPA 4B4DA 4FR2A 4E4TA 4QHTA 3FWPA 5C34B 4K1XA 3FZEA 1TKCA 4RSHA 1Q5PA 2A1UB 1WZNA 3U0VA 4AJ9A 5K0BA 1N8SA 1UMDB 1YMQA 1TU3A 5LOVA 2IEBA 1JQAA 4S2EA 2EERA 1OT3A 3FCCA 5E0OA 3QU4A 1DTWB 3RD5A 4MPPA 2A6PA 1ODIA 3MERA 1H22A 3BX1A 4FILA 4WBXC 5KREA 2EFHB 5J58A 2VF7A 1WP4A 3SHWA 2G0AA 3OESA 2VCYA 3H19A 1EFRD 1T0JB 3NAZA 1BJKA 2C83A 5EJGA 4EB3A 1L9XA 3ZXIA 1CT9A 2IIVA 4DUPA 4BNHA 2PAFA 3WZMA 2GYUA 4QELA 5BN3A 4V03A 5M29A 1R74A 3MMPA 2AW3A 2AFIE 3GNSA 5JQGF 1COWD 1XRRA 2WF8A 1E20A 4PLPA 5ES4B 2JCXA 4FB4A 1OYWA 1TF7A 4EARA 5JJLA 4C6HA 4XVUA 2GPAA 4YWHA 1G8PA 1SKYE 4GXNA 3KQQA 1DJNA 2VWGA 1ITZA 3FSEA 4CM3A 4Y9RA 3U3ZA 5CBKA 5FPYA 2BZ0A 1UBLS 4OHBA 4L57A 3PS9A 2H29A 4YRKA 5C1PA 5LLTA 3BRSA 3RHSA 1JJ7A 2DFVA 2AG5A 1QO0A 3L6BA 2VUHB 1G4HA 4K9KA 3FUUA 4DQDA 3Q10A 1XT6A 2YWCA 3JQAB 2WB2A 3ENNA 3ML1A 4HTAA 2A9RA 4RTRA 5F9HA 1MZVA 1RRGA 1SZDA 2FETA 1ZMBA 2C4UA 4QUJA 3QVOA 1D1PA 3VPXA 1H2XA 4FS3A 2ZULA 2EQAA 4BO0A 1Q17A 1HQDA 2B7LA 4EVQA 2NYVA 5TT1A 4RD1A 1UFOA 1W29A 2BPOA 5HCUA 5KAMA 1JJBA 1Q3KA 2B4YA 4L5IA 2IXGA 3W3AD 3BJRA 2ZE6A 4DV1B 2VNIA 1T8WA 4DXHA 3P97A 3M2TA 4DLZA 1J0EA 1JHVA 2H1LA 1RHRA 3E7XA 2CMKA 3Q3VA 4IG9A 3KQKA 1R8QA 2WTAA 1HL7A 4Y2PA 3W79A 3I83A 4S12A 2V0GA 2VKQA 2ZWAA 2Z3ZA 2HZBA 5EP4A 1N9GB 4BX8A 2NIPA 1S96A 2BGWA 1DC7A 2DF8A 5JNUA 2VEDA 3AR3A 4LJAA 1NF2A 1OGJA 4L78A 3AU9A 4XVCA 2WKWA 1ECGA 1CUXA 1I9CA 1VJGA 4MA0A 5MF6A 2UYQA 3L0BA 3C16C 1L1FA 3GFOA 4IIXA 4MARA 4CL2A 5AW7A 5BSEA 1E2DA 1TZKA 1U7TA 2Z43A 4P3OA 1NVWQ 3GAMA 4HSEA 4QE3A 1ECFA 1S2LA 3NM4A 4G1CA 4R1UA 1LDBA 3OJFA 5KQRA 1KO8A 2I8AA 5JEEA 3W3AH 4ADSG 1M1YE 1KGSA 1UBSB 2ZJYA 3PQ2A 4RL4A 1R50A 1P7YA 2XYPA 3C97A 4L8YA 3OO0A 4DIMA 4JT4A 5EG5A 4BNXA 3L07A 4ZAVA 4XW2A 1AKRA 4MEBA 1JU9A 1ZVQA 2OBYA 2X15A 4MYCA 4EY6A 3UCXA 3EWAA 1OFUX 5K8JB 4NAUA 3VO8A 1YQGA 3C3CA 4YJ3F 1JQBA 1KI8A 1PR1A 2C9BA 2PUHA 2P4EA 2RGNC 3EEBA 3L7DA 4FNGA 4N3GA 1YCDA 2GPYA 4XLZA 4F06A 4TZ0A 1TEVA 2O3QA 1C9JA 1YR2A 4UEQA 5LU9A 2E49A 1U3CA 1F7UA 5DW3A 4QO8A 4F9EA 4IV0A 1M8FA 2AC4A 3NTUA 4MICA 3HUTA 4OATA 4DM7A 5CA0F 1ABFA 3BGWA 3N87A 4JJGA 5DZSA 5HFNA 4EYOA 3KWLA 2B36A 3DCIA 5AH0A 1OGYA 5DNCA 4FXOA 2NP7A 3TMYA 5B5SA 3VJMA 1E9DA 1PR5A 3MBOA 4LHYA 5I4IA 1E99A 3SP1A 3THRA 5ITVA 2FJ0A 4L07A 4W5QA 3C8HA 4PPQA 4D79A 4ERXA 2XF8A 1RC1A 3W78A 5JHGB 3WSWA 3BSSA 1ODSA 3AQIA 2YWEA 1DV2A 1T3HA 4YS6A 4HDRB 3D0RA 1J2JA 4LTNA 3C5VA 4ZTBA 3L0SA 3S2FA 4DIUA 2V4MA 3JASB 3L02A 4KZPA 3L1KA 3MC1A 1QB7A 3CLKA 4OJTA 5T4FA 3MWDA 5TQ0A 3OIWA 1NKTA 1Y4AE 3N9IA 1OWNA 1XXHA 5EJAA 5K3DA 3X1DA 4BJ3A 3DL2A 1A9XA 2C8LA 5HF8A 1NPYA 2ZW9A 4UJ5A 1DEXA 2WU3A 3EVTA 4YJFA 5AMXA 2ZIEA 4JVLA 2QB5A 3QX7A 1YRHA 1PT5A 3KYDB 2WQ7A 3V1YA 1WY5A 1E3EA 1AF4A 3R7WA 1O8CA 2WWYA 1KNQA 1JHDA 3O2NA 3MWEB 1J39A 2GS9A 2JJ1A 1X1SA 2XMBA 5J4HA 4ZAZA 2XEXA 5BW4A 4PR3A 2QL6A 3PDIA 3TVTA 3ZHRA 4B7CA 1KYYA 3GUCA 4YI5A 3M4YA 3MS7A 3T7EA 4MV9A 1IATA 3GFRA 3I45A 4DBLC 1MORA 1VKZA 3CWZA 3E8XA 5FR1A 5A9SA 1HEYA 3JSAA 3SM9A 3WISA 1XZJA 5J5VA 3QZUA 3UWDA 1G66A 2I7CA 1UIRA 1CDDA 4BQEA 3UH0A 5JZOA 4DIOA 1I1QB 1BWSA 4WKPA 1GN9A 1C7RA 5A7GA 5IT0A 3AJEA 5E8JA 1A77A 2J0VA 4QUKA 5DF1A 1G21E 3H2ZA 4QFDA 3WWYA 2P91A 1R0LA 5I9BA 1CR6A 2HO4A 4WLOA 3VR6A 4KIJA 4B3GA 2FEKA 3H3FA 4AMZA 1R6BX 3RVKA 5C7OO 1G6HA 3MBKA 4INAA 5CJJA 3WBFA 4EB6B 1R8JA 1IYZA 3NYRA 4NWIA 3P8ZA 1N34B 1NG9A 2A2ZA 4NPAA 5KTSA 3ZVMA 1PGPA 2VA9A 1QH8B 1IPEA 1QHNA 3TXXA 3VDQA 3DL0A 3GT7A 4DCSA 2X4IA 3F6EX 1BH2A 3VZRA 3DM5A 4TWRA 1K8QA 1B76A 3BXGA 1WSWA 1VIVA 2ZG6A 3GD5A 4RFLA 1IHUA 2CB9A 1BCSA 3ZWKA 3U62A 1PFKA 1QFSA 5ABPA 3OPMA 1PVVA 2XQGA 4MS4B 1YVEI 5LMNB 3T1HB 2YOHA 3OSUA 4OHYA 2YN0A 3IPLA 2HBYA 1KJNA 1NLMA 2CFTA 3WKCA 3RIEA 5AD1A 4CL3A 5SZIA 1V0JA 1FUIA 1TVCA 2FG5A 3PHIA 4XSVA 1Y5LA 3CZRA 1UDWA 1FXUA 3PNKA 2JGKA 1N5IA 4P08A 4UHHA 1NXSA 4GP7A 4AZ0B 1L8AA 2ZFUA 2QN9A 3TZLA 1CR4A 3IP8A 1Y3AA 2RHHA 1WJGA 1MX5A 4IUYA 2SICE 5I45A 1D2MA 1ZGZA 2FFRA 3S44A 3TNFA 1XMXA 2B92A 4RHEA 5AHKA 4BKUA 4POOA 1O77A 3G68A 4Q37A 4YGXB 1JAXA 1Z63A 2VDPB 4F4CA 2UYGA 2ZTMA 3MMSA 4LWQA 4MS3B 5K0FA 3UC9A 1DJQA 1X42A 4B45A 3KAJA 5H81A 4D41A 3IEIA 5C8VA 3LRTA 3D3QA 5F76A 2IYQA 1GUFA 1KAQA 4IR7A 1JZQA 5KSYA 1OAOC 2RHLA 5HQTA 3OC6A 3LCJA 1WDKA 2HMUA 5CYPA 4JBNA 3VRHA 1SUSA 3PGLA 2JIDA 1IBKB 2FW9A 4J7CA 4Z53A 2JGDB 2YWJA 3TLGA 2ZIXB 4W5JA 2GCGA 2Q2VA 2EBUA 2Z9CA 3DDHA 3ELBA 4RE6A 4RYDA 1OUMA 3SD7A 4B84A 2GNAA 1M8JA 4HN9A 4IDGA 3TKYA 3KOXA 4E5DA 3GHHA 4BGEA 1Q91A 1GO2A 2J3LA 2V4UA 4US1R 2PZGA 1YB7A 1KO5A 2P4SA 1I6MA 3L8ZA 2UUAB 1U5AA 5B3LA 1G3IA 3NRBA 5DNWA 5ITZA 2XWQA 4PYIA 4O4HA 1XCBA 2B8WA 4RZ3A 4H4CA 5DYTA 4QJ3A 4CKEB 3OWXA 1Q95A 1FVHA 3LDAA 2IHUA 2CLOB 2C77A 3MSCA 4RETA 3THYB 2AJ8A 2FRDC 1PD1A 2NXJA 4W8HA 4OAOA 5TNXA 3GAZA 2OB2A 3P32A 3GBPA 1PYOA 1Q16A 2XNJA 3HBFA 2QTWB 5SZHB 2Q0SA 1T9GS 2WJVA 4YDRA 4OM7A 3GMSA 4ZVQA 1D5CA 3VOAA 4LJ6A 4URYR 2F8MA 1PSWA 1ULHA 3O74A 4YASA 4F3TA 1P1JA 2NT4A 2X13A 4UAJA 4U7HA 5F77A 4GUDA 1NYLA 2AMVA 2FTKE 3ENWA 4LXQA 2EZTA 4EYQA 2FSPA 2X8AA 1PT7A 1Z2EA 2ZYRA 2UZ3A 3KUCA 4GO1A 4BNKA 1LY1A 3WXBA 5AHXA 2JIMA 3B9PA 3DL4A 5FA6A 4H60A 3CEAA 3WJ7A 3PP8A 4F8YA 1ZOPA 3KZVA 2HW8A 4IIJA 3KXKA 4JYPA 1PJCA 5KU7A 2OBFA 1A72A 3GUVA 3E9QA 2WIKA 1DKUA 2ZUVA 5E7IA 1F2VA 1USWA 1SA0B 3F4BA 1RQGA 4LBVA 5CFMA 2HCJB 1ISHA 1BW9B 2YN2A 3JQDA 4OLFA 3U80A 1XDBA 2G9QA 2Q0XA 4C4XA 4JUCA 3PFGA 3KJGA 3EE6A 2QTVA 3OZWA 4K9LA 3KTDA 1QSGA 1F2UA 3ISVA 3GD7A 4GOND 1TK2A 2BBSA 2H1IA 4GMXA 4ZO7A 1CUEA 4W5NA 4EW1A 4FEAA 4Q6BA 1PK8A 2RSLA 2NYAA 5DDIP 3EOBI 3LKDA 2FEWB 2ZVPX 1UWKA 5HG0A 1NMQA 3PR1A 1GGFA 4MVXA 2QTRA 1SUEA 3ZWWA 1QDLB 1NR5A 4LEIA 4MKFA 1X8LA 2RB5A 3OCVA 4K26A 4Q7MB 4TLAA 1V25A 5EMHA 3WLMA 4E22A 2XX3A 3N2NA 3QV1A 2J5BA 2FV8A 3KR2A 1XZKA 5D87A 4F6CA 1U65A 1GOTA 1HE5A 4HAUA 2C8KA 5EZYF 1YIDA 4RZHA 4KXWA 3CSDA 2YV2A 4R7ZA 5AXBA 3SSNA 3WYFA 2QRQA 4D4LA 3C3BA 5F2NA 2XUIA 4LZAA 2ZPUA 2QROA 1FUUA 1CEEA 3B9QA 4PLGA 2W6JD 3M33A 4B9AA 1P17A 3NNSA 2C61A 2GXSA 2AYYA 5A4FS 1ZCBA 2PD6A 1W93A 3P52A 4LNUA 4OH7A 4OXNA 3GWGA 3DR3A 4EQ6A 1GD1O 1R6XA 5CEJA 2VYNA 1B8UA 3EVFA 4OJKA 4ZANA 2CCKA 3LLSA 3RKSA 5K0SA 1DRUA 4TYQA 4IF6A 4RA9B 5TQ2A 4W1SA 1KP3A 5FPSA 4XIJA 1E9FA 4RPGA 3QBJA 3GJSA 1A2QA 2RAUA 5JS1A 3OT1A 5FOSA 4PLHA 2R87A 3JWJA 3KM0A 1YOVA 2C2GA 2O06A 1H69A 1EVLA 1KAEA 1G16A 2XD9A 4PSCA 2FDCA 1QWOA 1I2CA 3RS8A 5DNYB 2MR5A 2HM7A 1IOLA 4Q9AA 2XTMA 4UE3S 3HS3A 1HYBA 3G9XA 4EJMA 3VSBA 4R71A 4N40A 1REQA 4P31A 2YQZA 2IHJA 2HX1A 2B83A 1OPRA 3RT7A 4EYGA 3GLFE 1H66A 4JI1B 3N59A 3W06A 1Y7IA 4IAOA 1N2BA 1OQAA 4IY1A 4OY3A 4UDXX 1VMDA 5C51B 3IE1A 3NALA 1Z2PX 1V2GA 2Q4EA 2WSBA 3BWDD 2X2OA 4NATA 4F2HA 3NKFA 5A4MS 3B5IA 1AY0A 1R6DA 2HXYA 3TW6A 5EIEA 1XNQB 3GLSA 5ADHA 3MVEA 6ABPA 4IO0A 2HF7A 3OF2A 3EUEA 3LTEA 3RAPR 4JI5B 4FYJA 4ZEWA 2VK4A 2XGSA 3GZNA 4CM8A 5K3EA 4F2WA 4R1PA 1UZAA 1XD2A 3UV6A 5KTTA 2EW2A 3MJSA 1ECLA 4G8BA 4HH3C 1W4BA 2ACKA 2XCUA 4TSFD 3KKLA 2XHEA 3AINA 3TR5A 2VQ6A 4DIBA 1FUKA 3C6BA 3BSFA 4PR0A 4PSDA 1LSUA 3GJXC 1GPBA 5IN5A 5LP6B 1Z82A 4CQJA 2I7DA 2C3PA 1CQPA 4AJEA 4B35A 1BDHA 4RJLA 5DGXA 5FI5A 2HA3A 3QXXA 4US2R 3VH3A 2YFHA 1O4WA 4MR8B 2PJRA 3M1YA 2B1QA 4A15A 1G8KA 5KVQA 3ROKA 3DHNA 1WU7A 1IJEA 1C9KA 4B31A 1VMEA 3K2QA 1TAQA 2PPLA 1H8ED 4MPJA 2IK8A 1E9VA 4EGAA 3B5EA 3RJ5A 3UEOA 4ZYLA 4MB0A 3WDMA 1MB9A 3WFIA 3QX3A 2OD7A 3OCXA 3P0EA 3GNQA 1L6IA 1UBKS 4Z4QA 1SWVA 1NZJA 1ZD3A 3JATB 1IBMB 2XCOA 1TM1E 1EJ6A 1TYAE 2IUYA 3RYCB 1EE9A 3QOXA 2ZCVA 4LSZA 5AYVA 4GOLD 1GPLA 5B58T 5LQNA 2PRYA 4I50B 5DNDA 4LAFA 4WHMA 1W4AA 3BQNB 4HAXA 3R74A 3SYMA 4DA4A 3HFRA 3VKGA 3JRNA 4LVOA 3ZY5A 4EH1A 5IVHA 1PL6A 1SXJC 2DYKA 2DPMA 3TW8B 1YT5A 2YIJA 3ITDA 5CDFE 2GAAA 4Q3KA 1NF9A 2XTNA 4D99A 4B6OA 4NY1A 2P27A 1BXKA 1SQ6A 4N0MA 3ABIA 1CZKA 4L5CA 4M1OA 3BIJA 2FGKA 3RSLA 1JILA 1ZGAA 4ECEA 4JJ7A 5LKRA 1N33B 4K03A 4AKSA 3TRJA 2ZXUA 1KZYC 1F51E 2VEOA 3KNZA 5AKXA 3SYKA 4ALJA 1CQIA 3LAWA 1WOMA 3R3VA 4HCJA 2XQVA 3MW8A 1GZ4A 1YUNA 1ZIXA 3KG2A 3EVAA 4U7TB 3VZBA 4BJ1A 1SD1A 4P4SA 3U4QB 2C4WA 4M98A 1H65A 3PTLA 4O4HF 3H16A 5KDLA 5CITA 1V3TA 1DX4A 1N25A 2HA2A 3R6LA 3REOA 1RHKA 1UC8A 3ADPA 4WNIA 2H2HA 2EZUA 2GZ2A 2ZWPA 3H18A 3HACA 3OEYA 2B6NA 3FMOB 3MRVA 1D1TA 2CBZA 2PQMA 3OCJA 2QQFA 4TL7A 1CEQA 4QJ5A 2GTPA 5FHRA 3TL2A 1ZIDA 3FKSD 2Y66A 1R2QA 3MSXA 5SY4A 5C7IO 3TQOA 5FTKA 3FHOA 4A6DA 1MX3A 1C50A 1Q19A 2GOYA 1TYZA 4XVQA 2E1RA 1WHSA 4X3CA 1JIKA 2KMLA 1EMDA 1S0UA 5F98A 1G1AA 1PLLA 2X9NA 2YHBA 4RBNA 2EU8A 2D1RA 2WK1A 1QTNA 5CJPA 3G0CA 5SY9A 1DFHA 1XD8A 1IQUA 2VF2A 1CY7A 3UJBA 1U2TA 4EF5A 2H2WA 1OXKB 1UIMA 1KXZA 2QD4A 3Q41A 4ARBA 4BCCA 4O4JA 4JUIA 1YIAA 3OX2A 3P9YA 2QI9C 3L0OA 4NBUA 1JX6A 4W7IA 2GGSA 4QGGA 3HVKA 5JTTA 1J9GA 1KVRA 1Y9AA 1UF9A 4MB6A 1CY2A 1T3LA 1VFNA 1XYVA 4QXAA 4B17A 1T13A 1UDBA 1Z2OX 4JYBA 4L72A 4C5BA 1I0IA 2ZSJA 4M1QA 2B0CA 1GGHA 3K9HA 3L01A 3HJTA 3ZBUA 1SY7A 3V46A 1RD4A 1VE7A 1SVSA 4XR9A 1QYXA 1AG9A 1DQPA 1TA9A 1VLMA 1XJCA 4TL6A 5NLLA 4D43A 5KMGA 4PWZA 3RABA 3TQSA 1I6WA 5BNIA 2P69A 3R5FA 1J56A 3N74A 3WIOA 1DUIA 1V3VA 4OGWA 4QUDA 4NMMA 4R1LA 5NULA 4J7XA 3VR2A 4CIWA 1UBMS 1PZGA 3HKBA 2CLSA 2EX1A 3M6MD 4Q1FA 1RHUA 3UAWA 5LD2C 1I36A 1SBQA 5JS7A 5CB4B 1I9GA 3ZW9A 2F3RA 2XMDA 2HBQA 1E1KA 2M6SA 2Q1SA 4WJKB 2BUAA 1H2HA 4OBXA 5E4FA 2WF9A 3IAEA 3F46A 2V9ZA 2BTEA 1RIIA 2VRNA 2IPAB 4NC9A 1ZIYA 1EWQA 4LJLA 1UKBA 1WX1A 1T10A 3VMFA 2V4ZA 1FXWA 4IMRA 3LV8A 1NRIA 3ZV6A 4PM4A 3HGTA 1KKLA 2ATXA 3O1JC 5T4BA 3UWMA 4ZZIA 2EWVA 3I04A 1XTPA 3EXFA 2HMVA 3VR5A 1IZYA 5KNLA 3LIIA 1Z75A 1T1IA 1YK0A 4IMPA 3D3NA 1IY9A 3P5SA 1XELA 1YD7A 1U1IA 4UPVA 1WCYA 3SEQA 1IHYA 2W2LD 4AUMA 4MUEA 2NADA 2W8BB 4RD3A 4AKGA 2OESA 1AGPA 2RIPA 3ZPXA 3ZVLA 3LBAA 4QU9A 4AJKA 1RDFA 3HKEA 3OEWA 4HAZA 1U94A 3ZNQA 1XTBA 5IKOA 2BGUA 1W36C 2P4HX 5CNIA 1HPLA 4Q21A 3H75A 1IHOA 4WOJA 1JHQA 4Q02A 5IUJC 4YT8A 1NURA 4C3ZA 4YUZA 3KQYA 3U2QA 5H4HA 3GGGA 1OROA 3G9QA 2JATA 2G72A 4TMWA 3GJ5A 4UOZA 3IJRA 3LO5A 3IDZA 5ADVA 3OZVA 4F04A 5EXDA 1CBUA 3D3WA 4PZCA 2VPPA 5BOSB 1AGXA 2O2ZA 1FP7A 4IYRA 2J9XB 2REQB 4BKMA 1IFXA 2NO9A 4I36A 1KWKA 1O0SA 3U7FB 5EWLA 1WZ2A 4D2IA 1O97D 4FFBB 1RBMA 2JARA 3ZX4A 4KQWA 4DJDC 1ZI9A 4Y6RA 2A3NA 2VK8A 3CZMA 2IHBA 2A9PA 5I8PA 3B1VA 4HNSA 1Y5MA 3P0FA 1HYEA 5IBPA 3UMBA 4U7WA 2BHSA 5AVTA 3DT6A 1J2YA 1TVEA 1ZOOA 3FJYA 4R1TA 4D7AA 4B2IA 3CEHA 4UD6A 3TMAA 2BYTA 4U0KA 1A7AA 3REFA 4G0OA 1LCIA 2J31A 1E62A 2EGGA 3FF4A 3G0DA 1CRLA 3G0GA 4ZJUA 1RLUA 4GDFA 2P4UA 1HSOA 3WLEA 2FPXA 2I78A 5KVSA 1E3QA 3T35A 2ECKA 5C5EA 3HL4A 2FZGA 5KTPA 4N5IX 2DLNA 3HKCB 1W7AA 4OL0A 1B0ZA 4CF4A 5BV0A 1TDJA 1BDJA 3LVFO 1EA5A 1PJ3A 3PIIA 4HNGA 4HNAA 1E3DA 3HWWA 5JJBA 2PG3A 1MU0A 4M9QA 2PT6A 2X7HA 4Q3OA 4MUAA 3AL0C 4C6SA 1LWOA 4IEEA 3D64A 5I9IA 3DWIA 4RVOA 4RKWA 3T7SA 2HU5A 4ZEVA 2O8CB 1EDDA 4C6RA 3OCCA 4U9IS 1JMYA 4DN6A 4O33A 1UQRA 1YACA 4DA9A 4DUZB 4MW4A 4B2PA 1XP8A 3KLOA 5H3CA 3EQ8A 3ENQA 1XTVA 2F1KA 1RWQA 1HR0B 3IMKA 3PGKA 4WOBA 2AC2A 2REOA 4OI0A 3F74A 4ZKEA 1CK4A 1PJ4A 3RG2A 1KL7A 2OBLA 1Z34A 2JHCA 2IZ1A 1NUPA 1P6UA 3ZV3A 2PUDA 2QVZX 5EMKA 5T67A 3IV7A 1YE5A 3IAFA 4BO4A 1DHTA 2R68A 3FPCA 4E21A 5KX5A 2I91A 3Q9NA 4ZN6A 1TA0A 1TFUA 1U2PA 1N0VC 5ECDA 3MUNA 4GOOD 5T57A 3I61A 4YCDA 5IHPA 5EC8A 3Q8MA 5I9NA 2XNHA 1DTEA 1W0JD 1WXHA 4BNYA 3PX2A 2XNSA 4B33A 2ACWA 5TPZD 3IOYA 5K0GA 1J70A 3QHPA 3H2GA 4KYUA 1CG6A 4HB4A 4OQNA 4EY5A 3UPTA 2XMCA 2IY9A 2QTNA 5M7EA 4KR0A 3DWFA 4G0YA 1MRNA 2H59A 3WFJA 1C0LA 1GGNA 1TQ6A 4IWXA 2GEKA 4RVCA 4F96A 2FP4B 4U2DA 4DE5A 2HMAA 3ED5A 2MINA 4AYXA 3Q0TA 2C8JA 3R40A 3F6SA 2E9SA 4HPWA 1WKCA 4PYNA 2FP3A 1P75A 2BISA 1PS0A 1XBTA 3IP1A 4KO3S 2EARA 3UXEA 1YJXA 1LH0A 1PAUA 1UPTA 2ZIWB 2G0TA 3S68A 2OGWA 5CRIA 1LU9A 1PWXA 3CX6A 2XDAA 2XD4A 3OU2A 3P9KA 4NH4A 2R751 3IPXA 2YXNA 4M6WB 5FJIA 1Z0IA 2BGJA 4Z9AA 4RX1A 4OHZA 3TWOA 4Y0VA 3ZCSA 1R37A 3GRFA 4BFXA 2G76A 3BA6A 3H11B 1UKZA 1JVBA 5EQJB 5GONF 1E79D 1ZO8A 3R7BA 3W8FA 1W96A 3V9PA 3W05A 2VJMB 2BKUA 1MAAA 2QRZA 5T3UA 4BQOA 2XTZA 1BGXT 1P0MA 3K15A 3H42B 4IH9A 4PG6A 1T9AA 2EFYA 2QE7D 4ZTUB 4NOLA 3DP9A 3N2EA 1U4SA 2GCOB 1NUHA 1WV1A 3R1IA 4L8VA 4QPCA 1VPVA 1M2WA 1OBHA 2HLNA 3JV7A 3Q98A 4IJVA 3S3TA 2R6ZA 3OLVA 3TEFA 3M82A 2QUJA 4RZSA 3AUFA 3BCRA 4ZDJA 3IPRA 4WOPA 4P4SB 2HSWA 2JL1A 4ZP1A 3MK31 2FEAA 1NQVA 3OMWA 2YZKA 1RKBA 3EH1A 1G5RA 2P9BA 2V7GA 2WTMA 4YGYA 1BVYF 1XMVA 4EEKA 3X1MA 2XNKA 4JJAA 1X80A 3EMKA 2PT5A 3LWZA 3NGLA 4JOBA 4OHOA 4YJHA 5DCWA 3GG9A 3ZKWA 2FPGB 4ETWA 4YV0A 5K5EA 1AMUA 5CAEB 3BFXA 2UVPB 2YWHA 1I7SB 3RYCA 4DV4B 1UPBA 4TYYA 4IDOA 4G4JA 5HS4A 2ZM6B 1WDTA 3KDPA 3PXDA 3WMWA 3K30A 4G4SP 2Q27A 3W2HA 3WICA 1EX9A 4C20A 2G8LA 1T5BA 1YHZA 2HC9A 3N7AA 2AUMA 3OECA 1Q0HA 1RXUA 3EGCA 4P54A 3N7TA 4ZHQA 4R9NA 4ZOAA 3QFSA 4EPTA 1ZUHA 4H3KB 2GO1A 2HLPA 3QKWA 2AN3A 1VCOA 3UWSA 8ADHA 1E9CA 4OVKA 4HMQA 2P0AA 2H18A 1PFYA 3I2GA 4Y6GB 3OJCA 4AD8A 1BWQA 1TJYA 5L3SB 3REGA 3IPAA 4LXUA 5DM2A 3DFMA 3NWOA 3ESDA 1QYVA 3HDHA 2X6QA 3IT1A 3CGWA 5K3FB 4PNZA 3VSAA 4B43A 4YR9A 1WXGA 2ACVA 3PA8A 1EQAA 5K09A 3SC2A 2ZE7A