3GEDA

Fingerprint and structural analysis of a apo scor enzyme from clostridium thermocellum
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
245
structure length
242
Chain Sequence
NRGVIVTGGGHGIGKQICLDFLEAGDKVCFIDIDEKRSADFAKERPNLFYFHGDVADPLTLKKFVEYAMEKLQRIDVLVNNACRGSKGILSSLLYEEFDYILSVGLKAPYELSRLCRDELIKNKGRIINIASTRAFQSEPDSEAYASAKGGIVALTHALAMSLGPDVLVNCIAPGWINVTEFTQEDCAAIPAGKVGTPKDISNMVLFLCQQDFITGETIIVDGGMSKRMIYHGDWNWFYKID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequence fingerprint and structural analysis of the SCOR enzyme A3DFK9 from Clostridium thermocellum.
pubmed doi rcsb
source organism Clostridium thermocellum atcc 27405
molecule tags Oxidoreductase
molecule keywords Short-chain dehydrogenase/reductase SDR
total genus 84
structure length 242
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gedA00
2A94A 1LRLA 1O94A 3ONFA 3PFWO 3UCFA 4XJSA 3BTVA 1WZEA 3AOEA 3S2GA 5B4TA 4H15A 3V1UA 1Z73A 4I5EA 1YONA 4BO4A 3QSGA 2YV1A 4CQLA 2AG5A 4QTZA 3DXFA 2DKNA 3U5TA 4M87A 1GZ6A 2FRDA 2P4HX 4ZGWA 1IULA 4WEOA 3ANLA 3S1LA 1GR0A 2Y68A 5DDIP 3VHRA 6ADHA 2H63A 4L9RA 3WGHA 3I9OA 5FEUA 2DC1A 3JV7A 5T6BA 1CQIA 1P1KA 2GNAA 3GGPA 1EEHA 3KLMX 4Q3CA 3MJVA 4OKIA 1C14A 4DREA 1S6YA 2CF5A 1HF3A 4NI5A 1ZMOA 3N58A 2I6TA 2EKQA 3QVWA 4BO7A 5HRUA 2LDBA 2BGMA 1PL6A 2XPCA 4JNKA 2PY6A 4ZRMA 1NWCA 3KSUA 5JYDA 2FR8A 5ES3A 4A7PA 1T26A 4URFA 4B3JA 5GZ1A 4WASA 4CLHA 5I7EA 2OMEA 2JFFA 3UVEA 3AJRA 3BMQB 3JQAB 4MIOA 3IKTA 1JKFA 1DC5A 4JBGA 4J1TA 1XDWA 4QFCA 1E1NA 2BFMA 1LI4A 2VZ8A 4PGFA 2QHXA 3O8QA 2A9FA 3MJ4A 4I5DA 4FB5A 2VYND 3F46A 4YB8A 2PZLA 1RPNA 2OFPA 3AOEC 4M1QA 4WLUA 3TZCA 3BXXA 1BGVA 3EC7A 4TQGA 1CERA 2VTEA 2OZPA 3CXRA 1AE1A 4PFJA 5A4DA 4YAIA 3DO5A 3IUPA 4CV3A 4R01A 4AJPA 2E49A 4CM5A 4QO8A 3V8BA 1YBAA 1PL8A 4JXKA 1P1IA 1YBMA 2DUUA 4XKJA 4BQPA 3CMMA 3DZGA 2C54A 5AQ1A 3RCBA 1LRJA 1PJTA 2X5OA 3DL2A 2DTEA 4TZTA 1Q7GA 1FMCA 1U3UA 3K31A 2X0RA 4Q3AA 3FTPA 4BGEA 3X2FA 1H2BA 5G4LA 3JD4A 4CUJA 1EK5A 2PWZA 3ETGA 2ZATA 4JP3A 2V65A 1D7OA 3NDJA 1Y5MA 5GZ6A 1SB8A 3GR6A 2IYPA 3AM5A 1NM5A 2VHZA 2J3IA 1I3LA 2VRBA 3P2OA 2J5QA 3PHIA 1UP6A 1OFGA 3K92A 3IAHA 1QLHA 5DF1A 1NHGA 3VC7A 1CWUA 3H7AA 4KUHA 5A9SA 3HFGA 4MIYA 4ESOA 4F45A 3GN1A 3NDRA 4R16A 4OSPA 2E48A 4P22A 4CLOB 4A0SA 4J91A 4GBJA 5B4UA 3JQEA 5I8WA 1I0ZA 1UXKA 1I2ZA 1AN9A 1FDUA 2B4RO 1X7DA 4JN6B 1MC4A 4IS3A 5JBIA 1PJBA 1YJ8A 1PS9A 4AJHA 4CLRB 3QVOA 3D7LA 3PHGA 2RH4A 1Z82A 4B4WA 3JQ7A 3T7CA 4RVSA 2GN6A 3L0DA 3OICA 3T4EA 4FFLA 4IDCA 2WD7A 1PWXA 3U0BA 3ASUA 4NMHA 2P91A 4LMRA 1XCBA 3LLVA 1EBFA 4OQZA 5IXSA 3ZWYA 3CKYA 3WGTA 1XKQA 4FD3A 2P4QA 4CR7A 1GYPA 2NADA 3GZNB 3WGGA 3L07A 1P44A 3AY6A 4IGEA 1VKOA 2VYVD 4J2HA 3VH4A 1B26A 4JJIA 4PRKA 1ISHA 3RUHA 2TMGA 1IB6A 1Y5RA 4E31A 2VZ0A 5IXYA 4MVJE 1UUFA 3FNHA 4FC6A 4YJFA 1NR7A 1YJQA 2YFQA 1C0IA 1B16A 5AYVA 5L7YA 3RC7A 1QP8A 2YDYA 2B4TO 3P2YA 1H6DA 1U3WA 3F5QA 2C07A 4Z9FA 1ADGA 4L4XA 4JJGA 4EUFA 1U7HA 1DRWA 4WLOA 3WIDA 3EUWA 3GZ4A 1JVSA 1CIVA 4HNHA 5LCXA 4CL3A 5IZCA 1HSZA 4WK6A 4DTIA 2H1SA 3U09A 2Y1GA 1T25A 3V5NA 2Y0CA 2CY0A 2C59A 2Q46A 3OA0A 3QJ5A 4LSWA 2G0TA 3H5AA 3ROMA 4D45A 2IDZA 4TKLA 5I7SA 1BDMA 1AHHA 3W8EA 5COBA 2I65A 3IP1A 4ILKA 4RV9A 4LMPA 1GYQA 1TA4A 1PZHA 3NTQA 3BHJA 1ZK3A 1DOHA 2EV9A 4FQ8A 5A3VA 4BKPA 3NYWA 3LVFO 1ID1A 1KC1A 1HZJA 3BMNA 4BKUA 3T4XA 2DAPA 4QQRA 5AOVA 3TZ6A 1QYCA 1UP4A 1VRWA 1UH5A 3ZV6A 2ZB7A 1J49A 1SB9A 2YY7A 2HRBA 1ISGA 5CDGA 1E7MA 1DB3A 4G2NA 2DFVA 1EMDA 1YQGA 4UEOA 1ISJA 1ORRA 2Y1OA 5F21A 2PGLA 1M75A 3KZVA 1EUCA 2BRUA 3Q6IA 3S2EA 4IMPA 1HT0A 3E5RA 4RORA 1LSJA 3ICCA 3KEQA 3OSUA 2FR1A 1GPJA 5IDYA 5HTOA 3ZWMA 4DXHA 1JKJA 4NJMA 4LN1A 5HS6A 3FF4A 4DYVA 1YDEA 4GX5A 4LW8A 4GL4A 4E5NA 3FWNA 4NFYA 4RPJA 2Q49A 2VHWA 4J43A 1ZH8A 4NU6A 4YA6A 1GFSA 4GKVA 2AA3A 3JQ9C 4L75A 1GY8A 1OC4A 4B8ZA 2OBYA 3UICA 1FDVA 2X7HA 1YOVA 2HMWA 4GI2A 1TT7A 3G1TA 1EVJA 4KUGA 4NPCA 4YBZA 4UULA 3WFJA 1QYXA 3S2FA 3AUTA 1B8VA 4BB5A 3EVTA 1HTBA 5BR7A 1Q0QA 3MEQA 1HDZA 2ZK7A 2PZMA 2P9CA 1P33A 3D5TA 4CMBA 1BXZA 3LC1O 4LVUA 4XZ3A 3B1JA 4AJEA 3W8FA 3ZZNA 3PXXA 3DBHA 4R51A 1HE2A 4MP3A 5KCZA 1K6JA 1PS0A 2D8AA 3AI2A 1FF9A 2JCYA 4UUOA 5AXAA 4A10A 4YAJA 1R12A 5ER6A 3INGA 1ONNA 4ALMA 3DWFA 4P38A 5JAQA 2YQ5A 3GUCA 1QSGA 3NRCA 3ZV3A 1GUFA 3M1AA 1NVTA 3CUKA 2O23A 4IBOA 5L45A 2O4UX 4FFRA 3O38A 4FFPA 4IXTA 2GYYA 1U1IA 3WBBA 3HG7A 4R3WA 3L9WA 1HRDA 3DMTA 4IJUA 4IDGA 2I3AA 3INRA 4UUPA 3F3SA 4FGSA 4F3YA 5JAMA 4YJFB 2OUIA 1PZGA 1NPDA 5AXCA 1VM6A 4CM8A 4YT5A 3GNQA 2A92A 3I9MA 3GVIA 3ONDA 4HFJA 5A04A 5AXBA 4PLZA 5C3MA 1PGOA 4DUPA 1N5DA 2B83A 3WS7A 2QZZA 1G0OA 2YHIA 3E9MA 3FBGA 3L4SO 5K0ZA 4ND1A 2BMAA 4HFRA 4BO1A 4FOOA 1ENOA 3QWFA 4CMCA 4E5PA 4E21A 4R9RA 4G81A 2X8LA 3WGOA 1GV0A 1IY8A 1GPDG 1SCUA 3VPGA 3PP8A 4IGFA 4BO0A 2AMFA 4E2WA 1RYDA 3EHEA 1WLYA 3ZHZA 1VE9A 3MJTA 4LVCA 3WMWA 3GF4A 1JU9A 5C7OO 4D3FA 1UP7A 1WDKA 3DFUA 3RAJA 4CMIB 3WMXA 4K6FA 4ZQHA 4OIMA 1I33A 3ZHXA 1XG5A 3VH2A 4A27A 2UVDA 1GQ2A 1R15A 3C8MA 4MKRA 5A5FA 1PX0A 4HWKA 2ZB4A 1E1KA 1R4MA 1LDGA 2CNBA 4PLYA 3RUIA 4XQCA 5COAA 4NNJA 2IZZA 4XRRA 2DLDA 5DZSA 4JQCA 4OGWA 4RJTA 2DT5A 1V8BA 2X0JA 3PRJA 1GCUA 4R4JA 2E37A 1E3LA 3GT0A 3MJCA 1YQXA 4UVEA 4CV1A 5KWEA 4U0JA 1YVEI 4BV9A 2ZIZA 3WXBA 3WWYA 2UUPA 5A02A 5JAZA 2J6IA 5LDGA 1Y8QB 4YJGB 2QRKA 2VWPA 2NU8A 4QX6A 3GDOA 5CG2A 2Q1TA 1E3IA 4LCJA 3WR5A 3AOGA 4BL5A 4B4UA 2QX7A 3RI3A 3VZPA 3ZU2A 4GQAA 3RC1A 2IYOA 3KYBA 3PJFA 4BUCA 4CR6A 3UCEA 2EJWA 4XYLA 3ADOA 3GVCA 1R4NB 2J5RA 3BHMA 4IDEA 3INTA 3PJGA 3G79A 2GD1O 1YBVA 3GEDA 2X0NA 4RL6A 2FPGA 4B4OA 1PTJA 4RLSA 4WCFC 4AJ4A 1E0DA 4QT0A 5L3ZA 4EEXA 3O8QB 1WVGA 3E9QA 5A1TA 4OSOA 4QEDA 1F17A 4L8VA 1S7CA 4RDIA 5DCWA 4LISA 1AGNA 1F06A 3ZWPA 2QIOA 2WMDA 3PWSA 4PLCA 1ENZA 3Q0EA 2YJZA 5DP2A 1A9YA 1YO6A 1IPFA 3RFVA 1W6UA 5J23A 2VUUA 2RAFA 2R00C 2W2KA 2NTNA 4BIIA 1I2BA 3JQGB 3PFFA 1QYWA 4DVJA 1SPXA 4JGBA 3R1IA 4J90A 1HYGA 3B6ZA 4CPDA 4UREA 4OJNA 4FJ1A 4TWRA 4BMVA 4OO3A 1JQBA 3S2IA 2PR2A 1BXKA 3CMCO 4CMHA 3JD1A 1T2CA 4R1NA 2W2LD 4DYDA 1LQTA 3B20A 4FN4A 1N7HA 3V2HA 4HKTA 3MTGA 1HWYA 4W7IA 4BNYA 1R6DA 3SJ7A 4AJIA 4CM8B 4FS3A 3VTZA 5L40A 5KVCA 5A05A 1Q0LA 4BNFA 5CDYA 1ENPA 3Q2IA 1ZSYA 3MCVA 3DZIA 1N92A 1DXYA 1PR9A 2Y93A 2ZTLA 3FR7A 5KIAA 3GPDG 5IZ4A 2HCTA 2DTDA 1VC2A 5JO0A 1KYQA 1XELA 1L7DA 3KETA 1P0CA 2CVQA 3FPLA 4Q3NA 3UH1A 3EZYA 4IDBA 1VKNA 3LF1A 3R3SA 4O0LA 1WDMA 3EK2A 4OMUA 4W6ZA 3GVHA 5HA5A 1I10A 1YL5A 3NT5A 3TDKA 1LQUA 3W1VA 4A73A 4AJ2A 1SMKA 4PLPA 3R6DA 4J3FA 3CTMA 3IC5A 4MINA 4MIEA 4AJJA 2Y0DA 5A06A 3ZH2A 1D4FA 4NBUA 1BSVA 4AVYA 2JHGA 4OKNA 1HKUA 4MKZA 1HYEA 2C82A 2PA3A 4BNGA 4NBRA 3LQFA 3CIFA 2HU2A 1T4DA 1A7KA 1UDBA 3JCZA 3ZWNA 4OOFA 2VWHA 4XYEA 3IL2A 2HKIA 3GG2A 3BAZA 1GZ3A 4JBIA 4HX5A 4DPMA 1XQ6A 2IXAA 2VT3A 2O7QA 4U6SA 4MKXA 5L7TA 1X0VA 3QIVA 3ITKA 3NTOA 4BV8A 1CEQA 1P1RA 1IPEA 3BA1A 1W73A 4PG5A 1C3VA 1DRVA 4TRMA 1WMBA 3D3WB 1U2GA 3DONA 1XGKA 2CFCA 4BNZA 1M76A 1J6UA 3VTFA 3IUSA 1V3UA 1U4SA 4ITUA 2X9GA 3OA2A 4QXMA 2EGGA 2YHUA 2HMSA 2HRZA 1KEVA 2ZYAA 3ROKA 3CE6A 3PLRA 4OHUA 4BNTA 1M2WA 5IDQA 1I2CA 4NZ9A 1X1TA 1T2AA 3HZZA 2GSDA 1TLTA 4FFOA 4IZIA 1Y81A 1R0LA 4CV0A 2PKRA 2QG4A 3TL3A 2JCVA 3K30A 4Z6KA 4M49A 5BNTA 5KVVA 5IJZA 3WNVA 3SC6A 4NH4A 3WICA 3RFXA 1ZO8A 4MVJG 4BVAA 3U49A 3D0OA 1SOWA 2C2YA 3LZ6A 1PJCA 5HWSA 1H94A 3DTYA 1ML3A 4J1SA 4DQUA 3HN7A 4XDYA 1YE3A 3DMTC 4BQRA 3EGOA 4D44A 3MWEB 2HAEA 3DEYX 3VKVA 3JQ9A 4WGGA 1P1HA 3DZBA 4JBHA 1VL6A 2FMUA 5FFFA 4NG5A 1B2LA 4IQ8A 1SO8A 5T8KC 2I66A 2ZCVA 2UV8A 3AY7A 3AI3A 4IXWA 3ZI0A 5KOIA 1NWHA 3RU9A 4MVJI 4IS2A 2O3RA 3L6OO 2NVWA 3I9NA 2GZ1A 5CPFA 5GMOA 3HHPA 4FDAA 2Y1DA 1PU2A 3PQFA 3PHJA 3QVTA 1UXIA 1X1EA 2IRWA 4EJMA 1QKIA 4Y6PA 4WCFB 5TJ9A 1I3KA 4JX8A 3QWAA 2VUSA 4CQMD 2X4GA 4XQ9A 4GGOA 3QP9A 3H8VA 2Y67A 4PZCA 3VPSA 2D4AA 2G82A 4QFDA 5BQFA 5I7VA 2C5AA 3RVDA 1UZLA 2DPGA 3NAQA 4RZHA 4TVOA 1HDCA 2ZYDA 2A4KA 3DMYA 2Q1UA 4GVLA 4AICA 2O4CA 5THQA 2H5LA 1QXSA 3JQ6A 3GMSA 4KDEA 4U5QA 3NGXA 5JAIA 3DBRA 1GTMA 2P68A 3E9NA 1HZZA 5FYDA 1K2WA 4BB6A 3GVPA 3ZW8A 4XRGA 2GASA 4GGPA 3AUAA 3P7MA 1PGNA 3GLQA 2YW9A 5A9TA 1TXGA 1A4UA 1ZCJA 3QV1A 3LT1A 2YV2A 4WE3A 5DOZA 2Y1FA 5JCXA 5L4NA 3TFQA 2VWQA 3M6IA 1P1JA 2FSSA 2VOJA 2AW5A 4F6LA 5DULA 1EFLA 1N1EA 2EERA 2PH5A 3S8MA 3AUUA 3OFSA 4PG4A 3I5MA 1C1DA 1BMDA 2XOXA 4IINA 3I1JA 2I76A 2B37A 3DZJA 3IOYA 3PPIA 4BNJA 5A3JA 4ND4A 5TX7A 1HDGO 3DZHA 3IP3A 5L4LA 1ZZEA 1KEUA 2VHYA 1WMAA 3GRPA 3MOGA 2ZTMA 3WFIA 1JAXA 3PIIA 4YJHB 1VL8A 2VN8A 3I23A 3CH6A 3E6AA 2OP0A 1PJQA 3WIEA 1WDLA 3I6IA 4W9NA 4YAKA 3KSZO 1GEEA 5I9MA 4PLFA 1HDYA 3KXDA 2DBZA 1BWSA 2GGSA 2POQX 2WE7A 3KYDA 4LRTB 4BGUA 4PVDA 4OL9A 4D79A 3RJ5A 1QR6A 3HADA 5T8KA 4DPLA 3GGOA 3VVBA 3HN2A 3E03A 1LBEA 2JD1A 3G49A 4ZICA 3ZWWA 4ZVVA 5BNIA 5G4KB 3WDSA 1NQAO 5KVQA 1DC4A 1H6BA 1QLJA 3HSKA 2RHRA 1OI7A 4ZQBA 4B3IA 3FNFA 2UYYA 3LF2A 4FCCA 1PGQA 2HJRA 4GH5A 3JQBA 4CV2A 1BW9A 2PKQP 3TZQA 4OYRA 2AE2A 1DRUA 2TMDA 3BMCB 2OORA 3ANNA 5C37A 3TF5A 3ZN2A 2WDZA 2Q1WA 4UEKA 4N54A 1ZSNA 5B4VA 5FWNA 3I3OA 5ILGA 2JAHA 4JCOA 4R9SA 4CODB 4E13A 1GV1A 1DIAA 1U5CA 3D4PA 4WCDA 4XJTA 3TZHA 4HFNA 1NFQA 2FSVA 4E5MA 5B12A 1DLJA 1M6HA 4JP2A 4NK5A 1BVUA 1KETA 5TJHA 2BI8A 4LSMA 4YT8A 3BHIA 5JFOA 1IZ0A 3PYMA 3GC6A 1PJ4A 3NDIA 3EDMA 1LLCA 4PLWA 1YRLA 4Z3KA 4XYMA 4GWKA 4TVBA 3H9EO 4J1NA 2JCXA 3OEYA 1MFPA 4L74A 4ZD6A 2VRCD 1DPGA 2EXXA 2F1KA 3F4LA 4FSHA 5A03A 1JA9A 3JYQA 1FJHA 1IZ9A 1RWBA 4RVHA 4DQXA 3G17A 2DQ4A 1DFHA 1LUAA 1PJ2A 4OXNA 4WCFA 4BS9A 1O6ZA 5DBFA 2NM0A 4O1MA 4DIFA 1ZVMA 3KLPX 1GUYA 1LNQA 2HMTA 1F12A 5JE8A 3MJSA 4KZPA 3C1TA 4IMRA 4ALIA 4C7JA 4D42A 2XXJA 3KUXA 3NEPX 4RGBA 1P77A 2GO1A 4CQLB 2W8ZA 4FOSA 3JYNA 3GHHA 2YV3A 1Z7BA 3AM4A 3UCXA 2D0IA 3D1LA 2Q45A 1DEHA 4UVGA 5A9RA 5EJ2A 9LDTA 3ADPA 3VPFA 4A5OA 2OOSA 4IIVA 2V6GA 2WYUA 1KEWA 1JAYA 2D3TA 3U4IA 3ZWVA 3FI9A 3H3FA 4BNVA 4BKOA 1KY4A 3QHAA 1CRWG 4CMEA 4WJZA 1E3JA 4BNWA 3I9KA 3GNSA 4FC7A 2Y99A 2OXIA 5L7WA 1A72A 2YQ4A 1JN0A 2EF1A 3GH3A 4WNIA 3H4VA 2HQ1A 3U4HA 2J5KA 3Q9UA 1R37A 3RASA 2V6BA 1VJ0A 4L73A 3MOIA 2AEMA 3VDQA 2Q1SA 2BGLA 4WUVA 4FFMA 4BO6A 4DBVO 1P1FA 4WKGA 5KNLA 9LDBA 1ISFA 2I9PA 3QW2A 2JFHA 3SXPA 2I99A 3AM3A 1GCOA 3P19A 4I9NA 4JIGA 3UGKA 4CM6A 3GY0A 1LLQA 1DHTA 4L0QA 4AJKA 1LSOA 4R3NA 4CMIA 4CR8A 3RUDA 3FNEA 3PLNA 3WGYA 1PQWA 2GZ3A 3JQ7B 1VJTA 3OBBA 2X9NA 2JJYA 1MX3A 5ER9A 4R69A 3ZWBA 3I6QA 1KC3A 1ZK1A 1NQTA 5U9CA 3DHEA 2AQIA 3FTNA 2FP4A 4ALNA 3UN1A 1F8GA 4E0BA 4IIUA 2NQ8A 1DFGA 2I5PO 3TQHA 3D5QA 1O89A 3ZU5A 4NDNE 5TNXA 4CM3A 2CF6A 5JMWA 5JDCC 4N18A 1KS9A 1JVBA 2WTBA 1YH3A 4E4YA 2HO5A 4J49A 3UUWA 1YDWA 1T2EA 3SX2A 2WE8A 5JC8A 3U4CA 2CDAA 2C5EA 2CD9A 5DN9A 1LRKA 1LX6A 1A4IA 2G76A 5IZCC 4WOKA 2EP7A 2JHFA 4U0KA 4GMFA 4U8GA 1HXHA 4PN3A 4ND2A 2C0CA 1R16A 1XSEA 1E3EA 4PZEA 1SEPA 5ENDA 3PGXA 4R68A 4YT4A 3L4BA 4YEDA 4PLVA 3SLGA 4CQMA 3QVXA 2O2YA 3VKUA 1LLDA 4XGIA 2YDXA 3E8XA 3UF0A 1F14A 4NFHA 3H9UA 3H5NA 2JKVA 2DUWA 3WSWA 4CM9A 1UAGA 5C7LO 3KVOA 3IMFA 3BZUA 1EBUA 3RUFA 3Q2KA 4RPGA 3GNTA 3KSDO 4RQUA 2IXBA 1ZEMA 4J0FA 4DIOA 4KQWA 4YTEA 4M55A 4EUEA 4LRSB 3NTRA 1I01A 4Y9DA 1O0SA 3U4DA 4D41A 1LDNA 1RM4A 3IDSA 3KYDB 2EJVA 5L9AA 3H2ZA 5A9SB 3PGJA 5DBGA 3LU1A 1QRRA 3SC4A 5IFLA 3IS3A 1E7RA 1MV8A 1JWBB 1HEUA 4OOEA 5EINA 4GWGA 4N5NA 3ORFA 1ZNQO 2AQKA 2Q3EA 2ZTVA 3LC7O 1OAAA 2G1UA 5TQVA 4PG8A 3UAGA 1LDYA 1LJ8A 3B70A 3F9IA 5C7IO 5ITWA 3F6YA 1J0XO 5MGBA 2AHRA 2PFGA 2C20A 5FF9A 3IJPA 4TROA 2AXQA 2UUOA 3JD0A 1OBFO 2BELA 3GAFA 4PLHA 4WLFA 1IE3A 5EL0A 2DBRA 3OETA 2Y66A 1E3WA 1YL7A 1H6CA 3ITDA 1Z6ZA 3P5SA 3RFTA 1QV6A 1ZXLA 4EUHA 1B7GO 1BVRA 1EQ2A 2LDXA 4NJMB 5COQA 4DC1A 1V6AA 2PKQO 3BMNB 3COSA 4HADA 3Q3CA 3OMLA 3WQRA 5DBIA 1Y8RA 1NAHA 4W9NC 1HSOA 4E5KA 1E5LA 1LTHR 1PL7A 1RYEA 4D3SA 3QWHA 5AVOA 2NLOA 4XWYA 2Q4EA 4UAGA 3GFGA 2EWMA 3KEOA 4XR4A 2EKLA 3PHHA 4Z3DA 4DC0A 2ZKLA 1TT5A 3HFSA 4S3MA 4CUZA 2CMDA 4CLOA 4W7HA 4I9UA 3TN7A 3VPXA 1P74A 1PWZA 1V3TA 2BHLA 4R5HA 5CG1A 1ADBA 1G0NA 5G0VA 5G2OA 3I4CA 3WYEA 3O4RA 2J8ZA 4ALKA 2W4QA 5L53A 5FI3A 1E7SA 4N5MA 1UZNA 2WM3A 2H6EA 3BMQA 2YFHA 3JQAA 1XLTA 3V2UA 4BGVA 3HB5X 1MC5A 1IUKA 2IZ1A 4H16A 4E5YA 4R1TA 4YACA 2P5YA 3GA0A 4II2A 4CM4B 4WLVA 4DQVA 3HB4X 5U1PA 3U62A 2O3JA 3BMOB 4BNMA 3VH1A 5CP8A 4DLBA 4EYEA 4B7XA 7ADHA 5F5NA 2EEZA 1FK8A 3I83A 3K8ZA 3L4BC 2PD6A 1W4ZA 1P3DA 3ETDA 8LDHA 3QQPA 1PQPA 2XAAA 2ZCUA 3A06A 3JQGA 2QYSA 2VHVA 4KTVE 1GU7A 4PLTA 4I5GA 4IQ0A 1UJMA 4MJLA 3VH3A 2UDPA 1YB4A 4IDAA 5F5LA 1Q0HA 3AW9A 1EQUA 1PS8A 1ZJZA 4Z0TA 3DC2A 4ZHSA 3RKUA 1WPQA 4JLWA 5KJFA 4J0EA 3WOHA 3BTUA 4EJ0A 4M54A 3W6ZA 2HJSA 4L4SA 4UVDA 1JKIA 3QE3A 1DAOA 4R41A 4ND5A 1A27A 2DBVO 4RF2A 5T57A 5JPIA 3BMCA 1N2SA 3LC2O 4AJOA 4E6PA 3ZU4A 3SJUA 1ADCA 1EVYA 2RH8A 3BTOA 4J6FA 5DCYA 1JDJA 2BLLA 2VNSA 1DAPA 4RVFA 3MWDB 2C7GA 5TS3A 4IY1A 3JD3A 3ON5A 3AU8A 5ADHA 5ICMA 1SZJG 1ZK0A 1AUPA 2PGJA 1NTOA 2YUTA 1WXDA 3W4KA 1YXMA 3K6JA 3MZ0A 5JC1A 3RUCA 3PTZA 4E12A 5H81A 4GAEA 4FW8A 5LC1A 3D3WA 2R00A 3RBVA 2V7PA 2GN8A 5EN4A 3UOGA 4DPKA 4J1QA 1XHLA 1UXJA 2EG9A 4CLXA 2O48X 3TOZA 2NVUA 2NVBA 2PZJA 2EGHA 3FPCA 2OGUA 3IKVA 3SBOA 4K28A 3UFXA 1NHWA 2OL4A 3FWZA 5JS6A 1LLUA 1PGPA 3PQEA 4HFMA 5HM8A 1DIHA 2HK8A 3A28A 3CZRA 2DU8A 3AU9A 3OJOA 3BMOA 4ZJUA 1GQYA 5TT1A 5TLSA 3FHLA 3HDQA 3PJDA 1IHXA 3PZRA 5G0UA 4CLEA 3OH8A 4KMSA 2CVZA 4I08A 3ST7A 4R1SA 2OBNA 4HNGA 1KVSA 2VRCA 1NX6A 3HNPA 1TT5B 3JD2A 4UVIA 4DLAA 3KTDA 2P5UA 3UXYA 4KDFA 1UDCA 1Q7CA 3PZBA 3RBZA 1X7GA 3F5SA 1ISMA 3DAGA 3HUDA 5G0TA 4B8WA 4BNHA 3U3XA 5KKCA 4EGFA 3L9XA 2WD7B 3F4BA 4D43A 1MFZA 4O63O 3ZWXA 3JSAA 2X22A 2GN4A 5A5EA 2X5JO 1E7QA 1N8KA 3JQFC 3OJEA 1Y1PA 4RDHA 4OQYA 4Q3BA 2JFGA 2VYNA 1EFKA 4GSKA 2RIRA 4EITA 2QYTA 2JAPA 1ARZA 3AWDA 4C7KA 1I24A 4MOWA 5HBRA 4XEHA 3K73O 3OQBA 5ICSA 5KTKA 3JQ8B 2O7SA 5CEEA 4FFNA 2I67A 1PIWA 3KM0A 4FJ2A 5JO9A 3C3XA 3L77A 4JJFA 4E2XA 1R66A 3VPHA 1UR5A 4WOJA 1LEHA 1Q7BA 1SOVA 3RU7A 3WYCA 4BO8A 1C1XA 4YR9A 4OH1A 1ZK4A 3HWRA 2QQ5A 1IHYA 3G3EA 3OIFA 4BO2A 2B5VA 2H9IA 8ADHA 5ITVA 1DSSG 1NPYA 4BHTA 2J3HA 1NQOA 4CM9D 2GN9A 2IEBA 3AUSA 1U3VA 4QUKA 4UUMA 3O03A 3ZNQA 1U3TA 3EAGA 4KOAA 4Z0PA 1KY5A 1GQQA 4E30A 1RKXA 3DAFA 3ZDFA 3PQDA 3AFMA 1DFIA 1H6AA 3WGQA 4E2YA 5THKA 3OQ6A 4CMGA 1KVUA 2HDHA 4AJLA 3F1LA 4CM7A 3RWBA 3PWZA 4YAGA 3K5PA 3GG9A 1CJCA 4GMGA 3GGGA 2J3JA 3PK0A 2F00A 2NU7A 4Y6SA 5EMHA 2G5CA 1D8AA 1O9BA 5DOVA 2ZB8A 3RSHA 5B1YA 1KVQA 2FHSA 1Z75A 1DC6A 1MXFA 3A1NA 3EY4A 1P45A 3RC9A 2CVOA 2B35A 1T2DA 3RROA 4Y8VA 2NWQA 4F46A 3OECA 1E7WA 2VUTA 3H2SA 1KEPA 3DFZA 4YAEA 5BSHA 3ZV4A 4YPOA 1K0UA 5KJ6A 5CEFA 4P8RA 4M86A 3UKOA 3T7EA 3ONEA 1ENYA 2GUGA 2NTVA 3WTCA 1NAIA 5CAEA 3FR8A 1I8TA 1F0YA 3LDHA 2Z95A 1ULUA 1V0JA 4GX0A 4NJOA 1MGOA 2OO5A 1SEVA 5JCJA 1XA0A 2GPTA 5CPBA 4FJ0A 2X9VA 3ZNOA 1ZKMA 2AG8A 2E4AA 2O2SA 4BNNA 5IAAA 2W2KB 3E48A 1ZK2A 1A7AA 5TRTA 4HXYA 3DQPA 2PV7A 2ET6A 4INAA 1OC2A 3OQ1A 4IZHA 2EP5A 4NBVA 1H0KA 4P4GA 4YXFA 3ENKA 5JDIC 3ANMA 1XU7A 5CHEA 2P9EA 2Z1MA 5TC4A 7MDHA 3DZFA 1GAEO 4W82A 1LSSA 4PRLA 2WJPA 2HSDA 2Q2WA 3JQ8A 4GX1A 1K6IA 1NR1A 4I9HA 3ZNPA 1MLDA 4U7WA 1H93A 3OP4A 2VYVA 3OIGA 1BTOA 1M6WA 4XYGA 4D0RA 1DIRA 3NKLA 4K26A 3WG9A 1E1MA 3N7UA 4GLOA 5T67A 2DBQA 4B4VA 5EESA 4IJKA 4AG3A 4KWIA 1KBZA 3PWKA 4YWJA 4P4LA 1XU9A 4BO5A 3ROQA 3LT2A 4UUNA 2WYWA 4MPDA 3JYLA 4LCEA 5BNFA 2ZJ1A 2FPIA 3EZLA 1QV7A 1X0XA 4RCVA 4J9VA 1OMOA 5JXWA 4A2CA 1ZJYA 2EW8A 2PK3A 4MDHA 2E6UX 3V1YA 3WTBA 2GZ2A 6LDHA 3QWIA 4PG7A 4L76A 3K96A 4FIZA 4LK3A 1LC3A 4Y6RA 2HMUA 3SVTA 1DLIA 1VI2A 1PGJA 2C2XA 2O3TA 1E77A 1U2DA 3LT4A 2OHXA 1YQDA 1G1AA 3GFBA 4J7CA 4J4HA 4ZU3A 3W4IA 2AQ8A 3E18A 5FI5A 3KOUA 5EPOA 3VZRA 1CQJA 3K9QO 2JD2A 3R3JA 2HUNA 1Y7TA 1Y9AA 1R4NA 4PG6A 4EI2A 4WNCA 3HE3A 2YYYA 1ONOA 2VOEA 2BGKA 1T1RA 4IJVA 1DBVO 2VQ3A 4HBGA 4EZBA 4XYBA 4YT2A 1EE9A 1K5HA 1X14A 1Y6JA 3DTTA 1IL0A 4HP8A 4NQZA 1L1FA 1TVEA 1Y9EA 3G0OA 1SC6A 1KVTA 3LSYA 4HUJA 1C0KA 4N7RA 1EUZA 5CDUA 3D3EA 2Q4BA 4B3HA 3I4FA 5AXDA 1Y8QA 4YJGA 1E3SA 1T1SA 5F3RA 2CSUA 1LC0A 4ZQGA 5JYEA 2PLAA 1B0AA 2Z5LA 4CMEC 2RCYA 1C0LA 1QYDA 3EYWA 4XB2A 1R0KA 1VL0A 3ZWCA 3KV3O 2AEJA 1N9GB 4J16A 2EKPA 5EIOA 1WWKA 3DAPA 3NT4A 4CMAA 2DFDA 4RLHA 4DWVA 2VHXA 4XD2A 2BI7A 1P0FA 4HV4A 3M1LA 1PZEA 1ZIDA 4YRDA 5F1OA 4AL4A 4DRYA 1KERA 3QY9A 5KJCA 3TFOA 1T24A 3QVSA 2HLPA 4N5LA 2P9GA 5ILOA 1RM5A 1H9AA 4GLLA 3JQDA 3VDRA 1FDTA 2BFPA 2IZ0A 1PJLA 2FWMX 4JK3A 1R0SA 1EVIA 1YB1A 5IN5A 1HDRA 2B69A 4CL8A 3VOSA 2D59A 1CF2O 4R1UA 3NJ8A 3WLFA 1NFRA 1BXGA 3RUAA 4D0SA 3NT2A 2Y1CA 4WLNA 3VVCA 3FCOA 4K6CA 1MXHA 1G6KA 4H7PA 1A5ZA 5H83A 4AJNA 3OEWA 1PJSA 4KTTE 4JROA 3CSDA 2W2LA 2NV6A 2IEDA 1V35A 2ILTA 3GEGA 1H5QA 2NUAA 4Y67A 4UEJA 4DMMA 4MVJD 2NU6A 2GLXA 3W4JA 3GOHA 1DIBA 3GRKA 3OM9A 4IPTA 3A14A 4PCVA 1O5IA 1ULSA 1VJ1A 2PD4A 4O6VA 1GADO 2DTXA 2GDZA 1DO8A 1DJNA 1YWGO 4FR5A 4PIVA 4TRNA 1D1SA 5DT9A 3JQAD 1GYRA 1C1XB 1Q2XA 2D1YA 3C7DB 4B7CA 1OOEA 2R2GA 3QRWA 2ZYGA 4ALLA 1E7YA 1Z45A 3JYPA 2JL1A 2SCUA 2QW8A 3PVZA 5C5IA 4DLLA 3D4NA 3E5MA 5IDXA 1B15A 4RZIA 5BSGA 5BSFA 1E6EA 5G0SA 1GUZA 1V9LA 1P9LA 5KVSA 2VWGA 2X5KO 2NQTA 3GDFA 3KB6A 5T5QA 1TI7A 3TL2A 2GERA 2CDBA 4J7XA 4I8XA 4XIYA 3JQBC 4M8SA 4C4OA 4B79A 2X1HA 4X54A 4QO7A 2FR0A 3OHSX 4M89A 1MG0A 1QYVA 3TWOA 4Q39A 5DP1A 2EIHA 3WGIA 1NASA 2CDCA 1VLLA 1NBOA 1Q1NA 1K3TA 2P2SA 4XCVA 1H9BA 4J2OA 4ZRNA 1FDWA 3VAZA 1QG6A 4LGVA 5MDHA 3WQQA 4H3VA 3WJAA 4BNKA 4DMLA 3DDNA 4G65A 5K9ZA 3F47A 1HL3A 1YB5A 1N9GA 4Q9NA 3A9WA 4XX0A 5I7FA 1ISIA 1ZMTA 2D5AA 2QZ9A 4MVJF 4PLGA 4I1IA 2VCYA 4ZQEA 1BW9B 4YYZA 4RVGA 2NNLD 3O26A 3R0IA 5JCJD 2DPHA 4AFNA 4GPD1 4J4TA 2BD0A 3OJLA 3H9GA 1W0CA 2NVUB 4D46A 3QLJA 3ULKA 3ZGYA 4DIBA 4HY3A 2O3UA 3GK3A 3KBOA 4RPLA 2NTJA 2EW2A 5ENVA 5G4KA 1DJQA 1GEGA 5EQDA 1ADFA 4NIMA 3B1KA 1MUUA 3JQCA 4MP8A 4NR0A 5H82A 4CM4A 1I3NA 3O9ZA 3PYXA 3WSVA 1WP4A 3WLEA 3DB2A 2AE1A 1GL3A 3ABIA 3ZHBA 1B8PA 3ZCXA 2Y05A 4TZKA 4ND3A 4Q3EA 1C0PA 3GHYA 4BOYA 5B37A 1T2FA 5K6AA 4E33A 1OZAA 1PZFA 1ZEJA 1Z7EA 3RD5A 1I30A 4XQGA 1NFFA 4J9UE 1K6XA 1SAYA 2ZQZA 4U6QA 3ZV5A 3ASVA 5BT9A 2WD8A 2PZKA 1FXSA 1HETA 5TIIA 3RIHA 4XA8A 1BXGB 1EE2A 2ZTUA 5JDCA 1H2HA 1UAYA 4NHEA 3NV9A 5EQFA 4BNIA 2WWRA 3GN2A 1VSUA 2Q2VA 1B3BA 2RHCA 3VZSA 3W8DA 4ROSA 5G0WA 2PH3A 1NQ5A 4K9DA 4GVXA 3OJ0A 4OXYA 1I3MA 1ZFNA 3H9JA 4XDZA 1KOLA 3RC2A 1KIFA 2FZEA 1JTVA 1U7TA 4YCAA 1UXGA 4FBGA 4MO2A 2C29D 3UW3A 2IODA 4EW6A 2YHIB 4FPXA 2W98A 3WBFA 3DOOA 2RBEA 1J4AA 1JLLA 5CDTA 2NACA 4DGSA 3C85A 2X58A 4B7UA 1GD1O 1D3AA 1SNYA 3NX4A 3CINA 3FSRA 5F1KA 1HLPA 3WB9A 3STHA 1PSDA 3PI7A 4D3DA 3KRTA 5DNAA 3M2PA 1EVZA 3HDHA 2X23A 5JY1A 1NYTA 4F6CA 3GVXA 4O5OA 1T4BA 1V3VA 2GRAA 2Q99A 4TMFA 1U5AA 3NUGA 4PVCA 2PGDA 2B4QA 1A9ZA 3KHUA 5JSFA 3GAZA 3L6DA 1ZSVA 1XQ1A 1MA0A 2XF8A 3I52A 1P31A 5BSEA 3C24A 3Q11A 1RM0A 3BIOA 4TRJA 1E5QA 5KJEA 1MG5A 1DIGA 1HDOA 3DBLA 1XR3A 2AQHA 3TOXA 4Z0HO 1NPTO 4EDFA 4E3ZA 5EERA 3W6UA 1N1GA 2FZWA 1FDSA 3F1KA 3V1TC 4DL9A 1BHSA 1DDOA 4BNUA 3PEFA 5IN4A 1YS4A 3C7AA 4IJWA 1TB4A 1YGYA 3GUYA 4UVHA 1ZBQA 1I5RA 3ZWAA 4EBFA 2PTGA 4WEQA 1EUDA 3AFNA 4TRRA 2XXBA 1BRMA 3C1AA 3EW7A 1F8FA 4XGKA 4OM8A 2BH9A 3GEMA 2A35A 2OP1A 4Y98A 1XEAA 5JY6A 2JD0A 3H9QA 2V6FA 3CEAA 3WGZA 3GQVA 1MP0A 5TF4A 4MVJH 3WJ7A 4MVJA 3G1UA 3PJEA 1MB4A 4XQEA 5IF3A 4R54A 1CDOA 3OJFA 4YDRA 4YQZA 1VSVA 3TPCA 4E2ZA 4MVJM 3RKRA 4KP7A 1M67A 4NK4A 5JNLA 3OIDA 4RPHA 4ZA2A 5LDHA 5HS4A 5GY7A 4YJHA 5TT0A 3KO8A 1K89A 1A71A 1KVRA 3C1OA 2ZJ0A 1WAMA 5IDWA 4ONEA 3DBHB 1R4MB 2O3QA 1HE5A 4L4RA 2E82A 1YL6A 2ZB3A 1UDAA 4J7UA 2HK7A 3IIEA 1W8DA 1ZW1A 4RQTA 4NBWA 4BO3A 1ZUD1 1Z74A 3ENNA 3EVNA 4BNLA 1B3RA 2FOIA 4YQYA 1LXCA 2X0IA 3PIDA 1J5PA 1PR3A 1RJWA 2CUKA 4G5HA 3LK7A 3FN4A 3PYLA 4RF3A 3H3JA 1HYHA 1E1LA 3LT0A 5TGDA 3SEFA 2GF2A 1M66A 4RPKA 2C7VA 4WPGA 3E1KA 1X7HA 2HMVA 3ZWOA 4EJ6A 2O50A 5U4QA 2QRJA 4ZN6A 1AXEA 1LSUA 1LDBA 3S55A 5GZ3A 2PNFA 1NVMB 4XGNA 1X15A 5L51A 3DHYA 4RO0A 2DM6A 4XR9A 4FGWA 1X13A 3FRJA 2DVMA 3DBLB 1RM3A 3LLSA 3CZMA 2ZQYA 4BO9A 3AI1A 3MTJA 5JLAA 3B1FA 3DOJA 1I36A 4DBZA 2EHDA 1UZMA 3BTSA 3RBXA 4CLDA 2HK9A 4D7AA 3HDJA 4YJDA 4CQMB 1AXGA 1ONPA 1YOVB 4Q3DA 3PHLA 3HDYA 1L7EA 5TSDA 1O8CA 4P4NA 3RUEA 3N74A 5CDSA 1CYDA 3V2GA 1O95A 4RF5A 3X2EA 4KWHA 1BDBA 4W99A 2IE0A 3FD8A 3JQFA 2BFOA 3WQSB 3DBRB 1HLDA 4W4TA 4ALJA 1NVGA 4BKQA 5CFZA 1NNUA 3NJ4A 3PDJA 5KKAA 5JDIA 3KYCA 3L6EA 2WEKA 4CUKA 1WW8A 2PD3A 3LYLA 4IM7A 2FPPA 1AHIA 3M2TA 4PZDA 5F1PA 1WZIA 3SLKA 5I9NA 1DC3A 5DCUA 1U4OA 2NU9A 4TSKA 1GDHA 4KQXA 4E32A 4YRAA 4QECA 1N7GA 3MJEA 3QA9A 4WECA 4XIJA 4ZQFA 4IQGA 5JW6A 2I3GA 3Q1LA 1EK6A 2B5WA 2YZ7A 2R6JA 1E6WA 1UXHA 3K2BA 3I9JA 1C1DB 3ZW9A 2V6MA 2B36A 3WX0A 1IOLA 3WWZA 5T64A 1U8FO 1CETA 2NSDA 2Z1NA 3DOCA 2BKAA 5L95A 1EDZA 2VT2A 4NU5A 5I9LA 3DR3A 1EDOA 2Q2QA 2W90A 1LDMA 3I9LA 1JW9B 3D64A 4NBTA 2VTDA 4CJXA 3DBVO 3JYOA 1XYGA 4Z9YA 3IQDB 4NFSA 1PQUA 5I8ZA 3GMDA 3H6KA 4IUYA 1D1TA 1QORA 3DHNA 2WYVA 3E82A 3ETEA 3NGLA 2Q50A 4A26A 2BF7A 1QMGA 3AK4A 3HQ4O 3UHAA 1B14A 4II3A 1U28A 1PJ3A 1E92A 3C7CB 3D4OA 4MP6A 4GSLA 4BGIA 4WLEA 1LA2A 3RQSA 1TEHA 2FY8A 2O3SA 4YRBA 1GZ4A 4R5MA 3TJRA 2Y0EA 5KJ1A 3ZHYA 2J3KA 1NP3A 2X86A 4BKRA 3TZKA 4GKBA 3ICPA 4CLRA 1HE4A 4RVUA 3JTMA 1ZXBA 3A4VA 1WNTA 4K1LA 4AJ1A 3VZQA 4Z9XA 3ROPA 4CM1A 4O59O 1JWAB 3RJ9A 5L4SA 3BYZA 3PDUA 3QWBA 5JMPA 3TRIA 2D5CA 3HJAA 3TSCA 3TNLA 3U9LA 4RVDA 5K6AC 1E6UA 1SBYA 1XWFA 2FN7A 3FNGA 2BFAA 4YVFA 3ZU3A 4OAQA 1IYZA 3OF2A 3WYBA 2B0JA 2UAGA 1NXQA 4OXKA 1XIVA 3GZNA 4I5FA 3GPIA 2AEFA 4EEZA 3H5RA 1DHRA 1VPDA 3GDGA 2CZCA 4GX2A 2X6TA 1YKFA 3EMKA 4BMNA 1B8UA 2WSBA 2VZ9A 4DA9A 2GCGA 4ID9A 3DZKA 3ZNNA 4RF4A 1U8XX 1LDEA 1U9JA 1LU9A 2GR9A 1HDXA 4S1VA 3IJRA 4XB1A 3K2EA 3CPSA 1Y8RB 4IDFA 1HE3A 4IDDA 2D2IA 3FBTA 3KYCB 4BNXA 4KUEA 3AY3A 4J4BA 4TKMA 4A03A 1BG6A 3WNQA 2Y1EA 1EZ4A 5CEJA 1E3WB 2QRLA 3Q9NA 1PEDA 4CMKA 2VNAA 4BMSA 4CMJA 1I32A 4MVJP 5IG2A 3H65A 4QSMA 2G17A
chains in the Genus database with same CATH superfamily
2A94A 1FSGA 3ONFA 5FUVA 3T7SA 3PFWO 2QJWA 3UCFA 5HGXA 4JOBA 3S2GA 1WZEA 3AOEA 5B4TA 4CHGA 3V1UA 4I5EA 3HRHA 3WAJA 2AG5A 2QRZA 3UJAA 3DXFA 3A9CA 1PJRA 1WZNA 4L9SA 5BUCA 2QL6A 2YKGA 1GZ6A 4Y1FA 1PDWA 3KUCA 2FRDA 2P4HX 4YLEA 13PKA 4B45A 4LECA 4DMFA 1A8HA 3S1LA 3PHBE 3WHPA 2H63A 1XEXA 2Y1XA 1XJWA 3HVIA 5FEUA 2E4WA 3OOEA 1EX9A 1ZA2A 1CQIA 1IN4A 2JEYA 2OM2A 5CFQA 3EWIA 3KLMX 2PL9A 4ZYYA 4X97A 1DCKA 1S6YA 2GM9A 3N58A 4L3WA 2I6TA 4BASA 3EUFA 1KKUA 2FAXA 3G0CA 3QVWA 3ZXIA 4DQLA 1TECE 2HT6A 1AS2A 1R5JA 4UD6A 4MRAA 1P17A 2XPCA 4JNKA 2PSJA 3V9AA 3OI7A 1WO8A 1M1UA 3MF4A 2WHXA 3THYB 1T26A 3AIKA 2FMXA 4URFA 5K45A 3M70A 1JUDA 1NU6A 1DAMA 1RNLA 3D7MA 1Y6ZA 1C7RA 4O4IB 2OMEA 1NJ5A 2BTQA 4DLUA 5EZYB 3AJRA 3IKTA 3C3DA 2BDTA 2G1AA 1JKFA 1WXQA 1DC5A 2Q5QA 4HGZA 1KDPA 2VZ8A 1E61A 1QZTA 2C88A 3HJCA 4U3JB 3TZCA 3RS0A 4URUR 4DXAA 3NW9A 5JLJA 1CERA 1FP4B 1I80A 3UB3A 1RRCA 1AE1A 1EP9A 3IUPA 2CMKA 3B5JA 3CCFA 3GL9A 4CM5A 1MT3A 4CV3A 5IWCA 1PL8A 3CVVA 2XGJA 5BP7A 4X65B 1MIOB 4JLKA 4R40A 2YJGA 3CMMA 3DZGA 4H7DA 5D3MA 4BQPA 4COOA 1K3UB 2FWBA 4KQIA 3KWJA 4OSEA 3KVVA 4E07A 5AQ1A 1IU9A 3MJFA 4RU1A 2QP9X 3RCBA 3WK5A 3AF0A 1EYZA 2X5OA 1Q7GA 3X1YA 2BIFA 3K31A 4IF4A 3GFSA 1OE0A 3FTPA 1L7NA 4FMCB 1CJVC 4Q66C 2IPXA 3A6ZA 5G4LA 3JD4A 1JJ7A 1BS1A 1HGXA 1EK5A 1M34E 1QWOA 4S1WA 4BXOB 4JP3A 2XA1A 3Q0IA 5E7QA 5GZ6A 4EI8A 1R9MA 3UANA 3CLSD 2W11A 3GCWA 1QO7A 2B8TA 4B0PA 2IYPA 2RKOA 2VJCA 1UBTS 1EGVB 2AS0A 2WF8A 5A5VA 1E2UA 2XYRA 4JLBA 1MU0A 4KFUA 2VRBA 3P2OA 5G3YA 3E9CA 2QK4A 5CVJA 1ORWA 5I48A 2BJHA 3TX2A 1U2EA 3VC7A 5FJJA 3CQ9A 4V02A 1CWUA 1FP4A 4ARUA 3JZDA 2PZFA 5FLEX 4OSPA 2KLBA 2OZKA 2X8WA 4P22A 1TD1A 4GBJA 3GLIA 2XWSA 4BC0A 2PUEA 1XZAA 3PVSA 3RVRA 2B4RO 3R0VA 5IEBA 4D56A 4HPWA 4BX8A 4UTRA 4JN6B 1JR3E 1JHYA 1AQ6A 3LY7A 3PHGA 2P2ZA 1GTZA 1TKBA 4OQQA 1OWNA 3TI9A 1A8UA 2XCTB 3JQ7A 1O96B 2FFRA 3T7CA 4RVSA 4F96A 2Q3DA 2JGAA 4IOJA 3WNCA 4L5AA 1M2EA 5EUMA 3JWGA 1PWXA 1TM5E 3H1TA 2V7WA 2RKWA 4L57A 3SZGA 4A8TA 2F2TA 4WEOA 3MC1A 10MHA 2XSZA 3ZZUA 5IXSA 1EPUA 2B99A 4LCBA 1MO4A 4G09A 3BBLA 5E7IA 4FD3A 3JAKA 4UDNA 2YR0A 4DNFA 1PDVA 2PQ6A 3KAJA 1SIUA 3I4LA 5K0EA 4HNQA 4WL0A 2LPMA 3PIRA 1HFWA 4FE4A 3DOHA 4YRPA 3VH4A 4AKSA 4LFCB 1P1BA 1ZA1A 2PT5A 4JJIA 1N6RA 1O6BA 2OWEA 2GN0A 2KLHA 2TMGA 2VCEA 3JWIA 4HRAA 4ZODA 1GCGA 1YASA 2GOYA 3MUOA 3T5CA 4E31A 3BXFA 3FTDA 1ZVKA 5AVWA 1UUFA 4YJFA 1A8IA 3SP1A 2C2WA 1DWUA 2FZ4A 4LZAA 1B16A 1C0IA 1PV2A 3E27A 1QNFA 2Z2IA 2AXEA 5J63A 3J81A 1K63A 1KTIA 4R0NA 4C1NA 2OCPA 1KAGA 2IYVA 2WWIA 4TXLA 5E4JA 4CYMA 2C96A 3P2YA 1H6DA 3MAAC 821PA 3L8FA 1FVFA 4RC9A 1MGPA 4L4XA 3FOAA 3R7SA 4UQOA 4WLOA 2RHGB 4H6VA 4XX1A 4EUFA 1JHQA 4AG6A 1QDUA 3EUWA 5F1YA 4NXNB 2D2XA 1TIBA 2AFIA 1YR7A 1JVSA 1CIVA 1SBQA 1VMIA 4HNHA 1P61B 2PL3A 2R2AA 5ALXA 1QS0B 2VSXA 4QELA 2HRCA 1L4HA 4A8JB 1R0CA 5B3LA 1RHRA 2W2QA 3FGNA 2X6RA 4WKOA 4F4DA 3V5NA 3ECCA 3VHXB 3SKVA 3OA0A 4FT2A 1D6NA 3GFVA 3H5AA 3ROMA 3HSYA 4TKLA 1YCDA 4GXTA 3O74A 1UM9B 2P2LA 4MW0A 5I7SA 3TGPA 5ICCA 1HNXB 3WRXC 4YO7A 4OX9B 2KPOA 3ZJYA 2H2HA 4E88A 3SHWA 4JU8A 1CEYA 3P0JA 1HI9A 4ILKA 2BFFB 1TA4A 2IBMA 4G0XA 5KREA 4WBNF 4MUBA 2QAIA 3LDGA 4YMUA 2BMVA 4FQ8A 1G7RA 4O1IA 4BKPA 5HQ3A 3LMKA 1U8EA 1LS6A 4O2AA 4RD2A 1K08A 1YQ9A 3BMNA 4RD1A 4B3RB 2O2EA 3GAMA 1MX1A 4BKUA 3DVLA 3D6MA 2DKOA 1ZD5A 4DCOA 1HE1C 1V47A 1G3MA 3L0CA 5AOVA 3TZ6A 3ZY3A 1UP4A 1MJNA 4CZ2A 2ZB7A 1A8PA 1RP1A 1ISGA 3N75A 2R1TB 3KFLA 5CDGA 1JFFB 1WHSA 2ZDGA 5I5GA 2VHTA 2EQAA 3SNHA 1ZZGA 4MV1A 3OPVA 3KZVA 1US8A 3SBEA 1JAIA 3CJTA 4AWXA 3L1HA 2BRUA 2AUTA 4FOPA 2UVQA 3FDJA 1HT3A 4RORA 3OSUA 4F7WA 2FR1A 1GPJA 4Y2YA 4YAWA 3MBKA 1ABBA 2I7TA 5MN4A 1FUKA 4BKMA 4RZSA 2QBYA 4UTPA 1NP6A 2XX3A 1LBTA 2AFIE 2QSUA 4GX5A 3P9SA 4LW8A 1J99A 4QU5A 4P4SB 3VHLB 1QU3A 4R8LA 4NMWA 4AO7A 4NFYA 3MLEA 4NU6A 3IHTA 2VPZA 3FIJA 4HQ6A 1KP3A 2GD2A 4I4CA 4J7AA 1GY8A 4H4DA 5K3FA 1KO4A 2OBYA 2C9CA 1DDGA 3GMIA 4IV8A 2VR1A 3LDUA 4HF7A 2I4IA 1GUBA 1HQDA 1KXZA 3SVLA 5IVPA 5F3WB 3G1TA 4NPCA 1WHTA 4YBZA 2IY9A 3IO5A 4N0DA 3WFJA 4GYKA 1HYQA 1NXSA 2DH5A 4JSRA 4CVNA 2ACVA 1XTKA 2PT9A 1KSFX 4HLUC 2YC4C 2HMYB 4NBSA 4NH0A 1HTBA 3TLCA 3R75A 2VCHA 4PQGA 3V4PB 1Y4ZA 4OK3A 1GSAA 1Q0QA 1J09A 5BR7A 5WRFA 1Z15A 3AB7A 1HDZA 5TPWB 2GCEA 2PZMA 4HWRA 2XWJI 4RY9A 4LVUA 1UBKS 4B09A 4N0MA 5FR2A 1TYZA 1N4DA 2W0SA 5FBLB 3DBHA 4R51A 2EAUA 1JB1A 2XTAA 3EBPA 3H4MA 1FP2A 4DMRA 3MMXA 5IHPA 5EXDA 2HJGA 3IBGA 1HKHA 1HDIA 2WU1A 1NF9A 4KV9A 4UUOA 3Q85A 3B12A 1ONNA 1N5IA 1YUNA 2WV9A 4MYTA 4I3HA 1UKBA 2WYOA 4H6WA 2WHRA 3UUGA 2HIAA 4E08A 5JAQA 3SHFA 2IXTA 4P92A 4TKZA 1QSGA 5HRCA 1BROA 2JFNA 3M6UA 1OASA 3ZV3A 4EJSB 3U9SA 2RARA 2K5UA 3DWIA 4B6GA 3ZK7A 2QL9A 1PWYE 2CWWA 1NVTA 1ORHA 2IPNA 1QHGA 4MW1A 4YMWA 1R64A 2O23A 4BY9E 2A57A 4Y3UA 2OZEA 3U1VA 4GD3Q 3PGMA 5D1NA 5L45A 2Z4SA 3BB3A 1Z6GA 3O38A 4OFBA 3TI7A 1UPUA 2PX4A 3BWDD 4ZOLF 2YJNA 3B6MA 5FBWB 4YRTA 3BDVA 1A4XA 1SG0A 1YR3A 1C9KA 2AN5A 3C3AA 2C1XA 4RHEA 1NVDA 4QXQA 3S44A 3TLJA 4TKVA 1I51A 1XD8A 3ZVKA 1PG5A 4HNAA 4IJUA 4IDGA 3INRA 4L02A 4UUPA 4BFYA 4F3YA 3U1BA 4WXEA 1TEZA 3NVAA 3NFRA 3L2OB 1NPDA 3OZSA 4DCGA 5DM60 3GEEA 4CKZA 3ER6A 1OWMA 3LWNA 2H7YA 4YT5A 2HIHA 3I9MA 1WCYA 3JR7A 3N5CA 2CXRA 1MB2A 3ONDA 5AXBA 5A04A 3A1UA 4PLZA 1PGOA 5C3MA 4CCYA 3LWZA 1N5DA 3SJBA 1WD7A 3I5XA 4QQ8A 2JIRA 3HEMA 2P9ZA 4G97A 2JFOA 5JG7A 2QLMA 4TTSA 4XJVA 1ODFA 3O92A 2BMAA 1GZ5A 1O08A 2QUIA 1E99A 1R7RA 2XNHA 3GAAA 2VC2B 1E1YA 4XIFA 3R7AA 2YWJA 2ZSIA 4AZWA 2GJKA 1UPBA 4G81A 3VSDA 3L06A 2X8LA 1FE8A 2QKYA 3BXOA 3JX9A 3R7DA 4H60A 1GV0A 2V5AA 3N3BC 1BCSB 1QJCA 4M1KA 1KJ9A 1TM7E 4UTZA 5FXMA 1OXMA 4BO0A 2CWDA 1QC5A 2JZNA 3P1JA 3FTCA 1WLYA 2JFYA 1F6BA 1JILA 4HDRA 3ZHZA 4J3NA 1Q57A 1O96A 2LP4Y 2NT4A 3LBHA 4B5KA 2GBFA 1QC5B 5TGTA 1R50A 3OZXA 4CMIB 4NV3A 4K6FA 4OIMA 4D9JA 1WVMA 3QLTA 1I33A 5BUQA 1EFVA 3R6TA 3ZHOA 3KSRA 1SU4A 3C8MA 4JUAA 5JASA 4L5JA 4RD0A 2XF2A 5DMHA 5I6DA 4HWKA 1R4MA 2CNBA 1JEQA 1SU7A 2PPVA 1MAUA 3R5FA 4IICA 3IBSA 4NNJA 5COAA 3BN3A 5DZSA 5K0BA 1MV5A 2DE0X 5KQRA 4URYR 4JQCA 1WB9A 2HR1A 4OGWA 4AZVA 1JIKA 1GNQA 3E22B 4LF4B 4WZAE 2X0JA 4PSVA 4ZCIA 2J0QA 3FLBA 3A9RA 1GCUA 1LWOA 2R7LA 3DXZA 4IOMA 1KRWA 1OX4B 1E3LA 4CKYA 1YQXA 3RARA 1YVEI 3EN0A 1ZIYA 3S2YA 4BV9A 1D5CA 3B5IA 1TTHA 4HAWA 3WXBA 3ZXYA 4BU0A 2DHQA 4PTLA 4G1BA 1RHMA 3AMVA 3AHEA 2P2YA 4L9WA 2DR0A 4OHPA 2A0WA 3BE6A 5BQ3A 3R23A 3GDOA 1RBQA 4ITVA 1HDEA 3FKSD 1CRQA 1CFZA 3W04A 1S96A 1C8KA 2HF2A 3MCTA 2OHJA 3CNLA 4FBLA 4B4UA 1QFJA 5LDDC 3ZU2A 1XDSA 2XMRA 3ZDZB 1K5GA 5IAOA 3PJFA 4TWZA 3JVIA 4QBKA 3CLRC 3U7QA 3L79A 2ZU0C 1VYVA 4D3YA 3BPSA 3RTEA 1MAHA 1H2XA 2QGZA 2B78A 1MO2A 5EPEA 4B85A 1ZICA 4M9SA 5BYKA 5HRAA 2RD2A 1LF0A 1ZQ1A 4GRIA 3INTA 4NCHA 2QT9A 3CS3A 1KBQA 2ZIFA 3EVBA 4OA8A 3QENA 4IJQA 4BMDA 4RL6A 4M9QA 4BNDB 1AQNA 4L8GA 4B4OA 4A2PA 2V1UA 3GRFA 3ICQB 1P6XA 3BCHA 1KI9A 1OA1A 3C5CA 5LP6C 5TQ0B 3VGJA 4CEJA 2HHLA 1QAQA 3K4PA 1E0DA 1RKUA 2CLLB 4AKGA 5EIAA 5FBVB 2H1IA 4GNRA 5L6LB 3W9BA 1HRKA 3HA7A 1E9CA 1WJGA 4OSOA 1MAWA 1T2NA 1VKZA 2X3UA 2MYNA 4L8VA 3OZIA 4RDIA 2X0FA 1E94E 1AGNA 1FS4A 4JUDX 3ZWPA 2C3MA 2WMDA 3O21A 5BN3A 2GEDA 2E6KA 2VF7A 1XMVA 1ENZA 4PLCA 2YJZA 5ALYA 1YZKA 1YO6A 4M7PA 1RIFA 1W6UA 5J23A 1ZXXA 2VUUA 1A9TA 5FOQA 1JEEA 1M2KA 4R6XA 3VZCA 1UFRA 3U7QB 1G98A 1GG9A 1KPIA 1NSFA 2JRLA 2W6MA 4JGBA 4TS4A 5J43A 2ODWA 2X4DA 4MROA 4B0OA 4FHEA 3KYJB 5ALFA 1Y3AA 4BFUA 4B7AA 4J90A 2NYAA 2R1ZA 2ZKIA 1AGPA 1Z62A 2JCGA 3B6ZA 1Z56C 4MMYB 3A1DA 1XHFA 4F5DA 2XECA 3IAS6 4BFLA 2BCEA 2R6CA 3VOAA 4BMVA 2QTRA 1QB8A 2H29A 3QNWA 1PBNA 2PR2A 1KEKA 1DV2A 2VH5R 3CBGA 3OE7A 1L5VA 2I6UA 4F9TA 4NDZA 3ZC3A 1QANA 2W2LD 5CA0A 5SV2A 4JKIA 5JSYA 1LQTA 4XOUA 1P1CA 4FN4A 2VF5X 5TMDA 2B8WA 1N7HA 5E3IA 5ALVA 1NY5A 4W7IA 1BGWA 3ETCA 4CL3A 2OCBA 3IQEA 4RANA 4TV8B 3SJ7A 4EEKA 4Z99A 1T5DX 2W2VA 3LHDA 3VYTB 3MT9A 3K0FA 4FS3A 3WK7A 4AJIA 4CM8B 3GZJA 3LLUA 2QL7A 4P3NA 2QR2A 5ALIA 4BNFA 5CDYA 3EGIA 1ENPA 3LKBA 3KTOA 1TK9A 1FFEA 1LPNA 2FG7C 2WVAA 3DZIA 3MCVA 4W5HA 4C2TA 1PR9A 2ZTLA 2PUVA 1ZNWA 4MQUA 2Z83A 1NMQA 4JA0A 1L4MA 3FR7A 5CB6A 5KIAA 2INGX 3DEIA 4K9MA 2HCTA 5JO0A 1FRNA 1KYQA 1NVXQ 2XQVA 1L4YA 5MN5A 2CVQA 2AT1A 3QX3A 1VG8A 2F3RA 2IC5A 3LF1A 4PSCA 1EFUA 3R3SA 1WDMA 3EK2A 4O0LA 3CJQA 5D3ZA 5HA5A 2DT8A 4BEWA 1D2MA 4JY7A 5TDHA 2XQJA 3SHQA 3E35A 3NT5A 4MW4A 5NLLA 3P4UA 5FAKA 1TAUA 4YX9A 5F9FA 2R1VA 1LQUA 1TGYA 3IV9A 5C4IA 2WRZA 3R6DA 3ZEIA 1AX9A 1V1MB 3C8UA 4MINA 2DGDA 4MIEA 2O2JA 2EJTA 5AWFC 1NVVQ 4XEUA 4C22A 4C6HA 4FZ5A 1YR6A 4F3KA 4JSTA 3RU3A 3WMFA 3N8KA 1FYWA 2A9QA 2G7MC 3HCDA 4WXHA 3DDWA 1GP2A 2ZETA 3H2JA 4UBNA 4CDNA 4W5NA 4UDYX 4D92A 2APJA 2X15A 3JCZA 3FETA 1Z26A 4XYEA 4IJ6A 3W5SA 4Z4FA 3RHSA 4LHWA 1SC1A 4JGIA 1HORA 4Y2VA 5EMMA 4D96A 3CZ5A 1JQKA 5JAPA 3O2NA 4AG5A 3B5EA 5AW3A 4QYMA 5LSAA 4JLAA 5KYTA 3V8VA 2BAGA 4LNUA 2R6ZA 1G5PA 2WNHA 1WL8A 1XLVA 4I8DA 5AJWA 1C7FA 3VI4B 4YRJA 3RSFA 1RQ2A 3THWB 2F8SA 1X0VA 2WJYA 3QIVA 4KO3S 1IJBA 3T5TA 3VJRA 4DAEA 4QUAA 3GT4A 5IVDA 2ZI7A 1JSLA 2II6A 2W4MA 1BCRA 1C3VA 3FUCA 4MHTA 3OQIB 2O1WA 2PSDA 1U2GA 4L0MA 3FRIA 1JVNA 1P62B 1U0HC 2B21A 5LUBA 1EB9A 3RTAA 2RGCA 2VPPA 4NZZA 4EA6A 3GLGA 2IF0A 2N47A 4J0CA 3VTFA 1SQSA 1V3UA 3GRZA 4P82A 3G0HA 1ND6A 3NPMA 421PA 2XUKA 1NXTA 2W22A 1ATIA 4WESB 2YHUA 4ZAYA 3WL6A 2FR8C 2NO9A 3W5DA 2ONZA 1MC1A 2VJMA 3LCUA 1T0PA 3IAEA 2RGDA 4RSMA 2GK6A 5AT1A 4BNTA 5B2EA 3U61B 3DNMA 1M2WA 5KAMA 4JR0A 3HZZA 1GNLA 2F43A 3B6JA 1X19A 5K0LA 3WHIA 4Y6LA 3NNDA 2ZBQA 5ERYA 3Q8LA 2QG4A 3TL3A 2DLCX 2JCVA 5KVVA 2Q6IA 3MTBA 1UIRA 2QRUA 3SC6A 4NH4A 1OZFA 2CXUA 3K32A 3EMDA 4QVKA 4PPNA 2P7IA 3NYQA 3D0OA 1SOWA 2QD4A 3A1SA 4CTNA 3LZ6A 1BDIA 1PJCA 3JZFA 3RWOA 1MH1A 3F2IA 1G8PA 3MSXA 1PR2A 1QZUA 1EAMA 4KJZA 4DQUA 4GC9A 1H9CA 3H16A 4NC9A 2D7DA 3RTBA 4BQRA 2AN1A 2FW6A 2R6HA 3MWEB 4KFSA 1PN3A 4WINA 4WHMA 4UNNA 1RXUA 4DLPA 3DT6A 2HYDA 2IWRA 2EHJA 2VAWA 3GV0A 4NOKA 3U7EB 3DZBA 2FMUA 2L82A 5FFFA 3O95A 4FOTA 5KSZA 1B6SA 4G0QA 4FX2A 2I66A 5T8KC 1U9ZA 2A9RA 1VIYA 1H42A 2GBGA 5KOIA 1NWHA 4JVMA 4LJYA 1JA0A 3RU9A 4MVJI 2EG5A 4IS2A 3TSZA 1OR8A 3B51X 5K0NA 1SURA 3IGFA 4KSBA 4XSHA 3L3BA 1D2HA 5FPQA 3QVTA 2VG8A 3ETHA 4GVPA 3RJMA 1QKIA 5LP6B 1DX9A 1CHDA 2OEPA 4EATA 2C2MA 2O8CA 1BJRE 1W36C 1XUOA 3N8HA 4MYDA 2E4YA 2X4GA 1O2DA 1X77A 2PZEA 4NWIA 4XQ9A 2YWBA 1WRBA 4RNDB 5EJ9A 4IDHA 2DH6A 1W5TA 1UMKA 2FCAA 2G82A 4QFDA 5E8RA 1TF2A 5HF8A 4DIEA 4XWWA 3QLUA 1DG3A 1I2MA 1SHZA 3ZDXB 3L8GA 4QGBA 3TCXB 2HA0A 2XY4A 1IJKA 1EGMB 1I0IA 1T3LA 1WDWB 2ZYDA 3BD9A 3O2JA 4JB0A 2O4CA 3EXEB 5THQA 2B8NA 2G6TA 2G36A 1UJBA 2DPYA 1QXSA 1OAKA 4GFDA 2UYHA 2Q29A 5KNDD 1GAXA 2PMWB 4KDEA 3DV0B 3M6MD 3NGXA 4U5QA 3WLRA 5FYDA 3HCAA 2YXLA 3U9TA 3GW8A 4BB6A 3ZW8A 4ABYA 3GIDA 4XRGA 3ZY4A 4GGPA 1F2UA 1R18A 1WD5A 2XE4A 3P7MA 4HO1X 1J2JA 3GLQA 1SUBA 2YW9A 5E0KB 4N39A 5EZYF 5A9TA 4MKHA 3N2IA 5FUXA 3WLQA 4O4HA 1ZCJA 3IQZA 4LE1A 7YASA 1U9CA 5CMLA 1XQXA 2GZAA 3Q9SA 2PUWA 1SXQA 3M6IA 4KIUA 5IUKC 2VQDA 3A1FA 3RRFA 1J7KA 3L0SA 2AW5A 2KMLA 5TQ2A 3VFDA 3U4QB 2EERA 3CG0A 3UH0A 5TS2A 2JJQA 2OXCA 2HQOA 4F7DA 4BX3A 3L46A 5IM4A 2Q3FA 3OFSA 4PG4A 3STUA 2EX0A 2KI5A 3I9FA 1C1DA 4KXFB 4UAJA 5ARDA 3K9FC 1S8AA 2VUHB 1G17A 2V3VA 4GICA 3PPIA 2B37A 3IOYA 5D01A 5BYAA 1L5ZA 2G28A 4LS3A 4ND4A 2UZ3A 5TX7A 1YIOA 2OYRA 1ZZEA 1T3SA 2VHYA 3CF0A 3GRPA 3ND5A 3MOGA 1VPVA 5AK3A 1SM4A 3VBCA 3O82A 2VN8A 3I23A 5FLKA 4XIGS 1GL7A 1TCUA 3DV0A 4MWBA 5FRDA 5K0GA 3UHOA 4JP8A 4W9NA 4DV6B 2DQZA 2BTEA 3KSZO 1GEEA 3A7DA 3KXDA 2IYTA 2DBZA 2POQX 3F6EX 3HB7A 3NHJA 1TA9A 4LXXA 9ATCA 1S2GA 4Q16A 4PVDA 4JVNA 3QTBA 4OL9A 2NG1A 3EXG2 4AIIA 4V0KA 2QXUA 2R97A 1H69A 2PEYA 3E03A 2JD1A 4FFBB 4KFCA 5JFGA 5KYYA 5A7GA 4N7JA 1U2ZA 3OAAD 5G4KB 3KEGA 1FZTA 1NQAO 1AK9A 1Q20A 3NHMA 3OCJA 4PYMA 1ZD4A 5ECYA 3KZXA 1F2VA 5I4CA 1H6BA 1BD3A 3MG9A 3GLFB 3HSKA 4G4IA 4R84A 3C41J 3PXUA 3FNFA 1XKLA 3K6SA 4HATA 1KQ3A 2NOAA 1V7QA 3LF2A 5BV1A 3NHWA 3OQPA 2IUYA 2OCYC 3IHWA 4BVEA 3JQBA 4IAOA 3CUUA 3O2SB 3R7LA 2GM5A 4YCBA 1QIMA 3TZQA 4TMXA 1GTVA 1CE8B 4DOMA 3EEOA 2AE2A 1VE1A 2TMDA 4MQ6A 3BMCB 2OORA 3NOQA 3TX6A 2Z2ZA 3NANA 2TMYA 5FQOA 4YMGA 1CUUA 3DKVA 1NN1A 2YS6A 4DA6A 1PVVA 3KJQA 4N54A 4QUHA 1U2RA 1XMIA 3WJ1A 5DB4A 5FWNA 4KVZA 3WLOA 4JXXA 2A5FA 1W5EA 3BSSA 4E13A 2BEVA 4L5IA 4NCIA 2FZVA 2PU7A 3EGEA 1U5CA 1W44A 1UM9A 4P35A 3R7BA 4QBGB 5D6OA 3HPRA 2HF9A 3EXAA 3FCXA 1DLJA 1IOVA 4JP2A 3LPCA 1BVUA 4CTMA 3C3PA 3F71A 2IEIA 2BI8A 2ECPA 3G5TA 5A3QA 2ICAA 3B7GA 1ZRNA 4RFLA 3GC6A 1NOJA 2F3UA 1LLCA 1S3SA 2XDYA 2P2NA 4KH0A 2QN8A 4GWKA 3HR7A 4J1NA 4OHMA 4ENVA 3GZTB 1MFPA 4WBXC 4C21A 2VRCD 3NHUA 2BFFA 2QW0X 2GEKA 3VV2A 1JA9A 2G4LA 3JYQA 1FJHA 4FSXA 2WHQA 4BVKA 3A9TA 3ER9A 3IXQA 5E3HA 3G17A 5IKMA 3CNNA 3OZWA 4V0ME 1LUAA 3M4JA 4OXNA 4WCFA 2VQEB 4DSUA 2C0QA 3B9PA 1NNI1 1PK7A 1PT8A 2XUGA 3K0FB 1AK1A 3SZMA 4DIFA 2A33A 1FS6A 2GFIA 4DM7A 5AFSA 1GUYA 3W2IA 1SD1A 4TLLB 2Q4DA 5JE8A 2R8EA 1TF7A 2G6BA 3LT5A 1DKNA 3RVOA 3VKGA 4O4LA 5DSXA 1G3QA 3REOA 1A7UA 1PLKA 3OLWA 4ALIA 2VRNA 2XXJA 2DY0A 4HFRA 4F5YA 2P9QA 3JASA 4X61A 2YV3A 5C18A 2IZ5A 5GGXA 2D0IA 4UVGA 1DEHA 1HTTA 2MJLA 5DHFA 3KQKA 4FNMA 1YKSA 1EUCB 4RDCA 3V8PA 3VR3D 5FPTA 3UTDA 4ACAA 4QREA 4YJ2B 2XMQA 4A5OA 3B48A 2BW0A 2OOSA 3A31A 4IIVA 5KQPA 3MS7A 2VP3A 4Q15A 4BE9A 5AVJA 5KSWB 4UPEA 2D3TA 3R20A 2WD9A 3N05A 2VT7A 3OZGA 1W35A 1QFSA 3NZEA 1P80A 3MOSA 3QHAA 5T4BA 5CX1B 2W6ZA 1Z8FA 5FQNA 4FK8A 4WVFA 2R1UA 5J4HA 3I9KA 3GNSA 3F3MA 4JJKA 3AXTA 4A15A 2FTKE 5L7WA 3EOZA 1KYVA 1CZHA 1A72A 1V25A 4G4SO 3I62A 2AF3C 1TO6A 5TB5A 3LPLA 4MUGA 4RMJA 1R37A 3T38A 1NR5A 2J6BA 3WLSA 1WOMA 3MOIA 1TYDE 3FAKA 4GZ3A 1ODSA 4R1MA 3U26A 3HYNA 3IDZA 2BGLA 3DPSA 2QRGA 4G8BA 9LDBA 3DEKA 1J00A 2VO1A 4ZARA 1AUXA 2J3MA 5CVCA 4C07A 2RGGA 1O87A 2FX5A 2I99A 3EQZA 3P19A 3UGKA 4CM6A 3VC2A 2HK6A 1Q3HA 4C89A 4B3MB 2A78A 3K5WA 4R3NA 3RUDA 3FNEA 5IVIA 2HCRA 3PLNA 3L7NA 4O2BA 4DIMA 1VJTA 2H5JA 5FH9A 2O59A 2ZAIA 1SWWA 1UWVA 3AUKA 3I6QA 4R69A 1QAOA 2R48A 4MSUA 4PPQA 1Q22A 1O57A 3GJ7A 4JIMA 3O8NA 3TLEA 1XEWX 3ZDRA 5KTOA 1SUWA 3FPFA 4CETA 4TL8A 4F04A 3L43A 3MT8A 2V7QD 4NENB 5EE5B 4IIUA 4N4AA 1N7JA 3T7AA 2GKGA 2Y4OA 3F49S 4D98A 1KAMA 1O89A 1MIHA 4PZYA 2CE7A 1AZSC 4ETMA 4OBBA 4IHJB 1JVBA 2COUA 4IIJF 4EVIA 1AO3A 1PFKA 2WTBA 5GADl 5C31A 4E4YA 5AUPB 3VR1A 7REQA 4HX9A 2WY2D 1YDWA 1ZYUA 4S0XA 3QEMB 4O8CA 4X6UA 5EXXA 3SX2A 4EQ6A 4EKEA 3SDBA 1ZJ4A 1XMXA 3UV6A 4UTNA 5JQGB 3D6HA 1FY2A 2EP7A 1UBRS 2YWCA 4Q9LA 1MVNA 3I37X 1QBKC 5LP1A 2FYTA 2VPTA 2FUEA 1XSEA 1E3EA 1WCXA 2PBRA 2PX3A 3ORQA 3P0RA 3BX1A 5FORA 3SVZA 3RRBA 4AMZA 4PLVA 1FXWA 2OKGA 2ZI5A 3SLGA 1EVQA 3EZNA 3MGBA 4AO8A 4OHWA 4L5BA 5H70A 2QD3A 1RLOA 3ND6A 3MRTA 3QVXA 1WUTA 3BJRA 1BN6A 4BX0A 2E5LB 4CEHA 2AR7A 1OX5A 3SF8A 4XGIA 1UANA 2VA9A 3H83A 3IT3A 4EY7A 5LOVF 5KPJA 1WMFA 4YRIA 3BIFA 4ZVSA 4EFLA 4HDRB 2ZE6A 4RZ2A 1P81A 3CPHA 4PANA 4Q02A 3Q2KA 1VSTA 3P9NA 221PA 2Z5VA 4PYKA 3N59A 5LYJA 2FPSA 5ALOA 4ODIA 2NO1A 3T7IA 4JLDA 4U2DA 2XCSB 1TQ8A 2H1CA 4J0QA 1EK0A 4N3NA 3O73A 1ZD8A 3NTRA 3BK7A 4LRSB 4Y9DA 5FA5A 3RAGA 1RM4A 3TLAA 5IUJC 5K8TA 2C5BA 2EJVA 3T6KA 5B5SA 2RB4A 1JX6A 7AT1A 5IFLA 1L9XA 4EPXA 2P6UA 3L0YA 4D02A 2IUEA 4Z3OA 4ND6A 1OX4A 4Y2SA 5JEDA 2ZW9A 1HEUA 2WYIA 4JC5A 5G53C 4ZEOA 5DSZA 4RYDA 4FN5A 1CJTC 4RKRA 1FYFA 1OAAA 2CLIB 2EKZA 4BRSA 5A4KA 4PG8A 1HT2E 5KOJA 1EGHA 3T9CA 1LDYA 2QVGA 3SEZA 3B70A 5KYNA 3EPHA 5ITWA 3F6YA 1J0XO 2LTAA 2AHRA 5J2TB 3WZMA 1E66A 3AIMA 2WTEA 2C20A 3N2GA 4TROA 2K7ZA 3C5HA 1CVRA 1H8HA 2RGRA 1OBFO 4PLHA 2O8BB 3K35A 1USGA 1CUGA 4KXLA 5ED0A 4ARSA 3G13A 3A4LA 1E3WA 1T1IA 1KU6A 2PGAA 3P5SA 4FEYA 3RFTA 2R8ZA 1ZXLA 2OAGA 2Q5EA 3L8HA 4DC1A 4EUHA 3ERCA 1V6AA 2PKQO 3IUYA 2XRFA 4A92A 3RADC 3OMLA 4JX9A 4DNXA 3RK4A 2O2ZA 4W9NC 4YPFA 1PL7A 5DBEX 4EF4A 1II0A 2EFEB 3QWHA 1U11A 2H1LA 4EO4A 2XXAB 3UGTA 2IP2A 5K8LA 3KEOA 4XR4A 3UAYA 5CH5A 3PHHA 2BFDA 1GGKA 2HFKA 3HFSA 5AJZA 4BCBA 2Z6UA 4CLOA 5KQSA 1ULTA 5H7XA 4DBLC 4I9UA 1N75A 3E7PA 4HQNA 1G0NA 5G0VA 4HQ0A 3I4CA 5CH3A 1BJTA 3BXHA 1NX9A 2W4QA 1X94A 2ATIA 3ZTTA 4C0KA 3REQB 3PE3A 1UZNA 1UOQA 2H6EA 4NOMA 1DAHA 3HY3A 4NCNA 2A1IA 1IUKA 2IZ1A 3RRNA 4H16A 3CISA 4CKBA 4E5YA 4R1TA 5DYNA 1CJUC 4RTSA 1TQ2A 3GA0A 5H80A 4DQVA 3MT7A 2PUAA 2AWOA 1UZAA 4EDHA 1E4OA 1ITZA 3FMPB 2BGIA 3M1YA 2W37A 4QOIA 4RGVA 3ID6C 3WL7A 1SG6A 4X8HA 1W2WB 1Z2DA 2VJQA 3KEMA 5CP8A 3T0IA 4BNMA 3FOCA 3DLBA 2Y0BA 1ONBA 2B61A 1GNPA 2WC1A 4HYQA 5LQJA 1FP6A 4JOCA 4XOIA 3TQTA 3QQPA 3LA8A 2WVJA 1L7MA 2ZCUA 3R6GA 4PLTA 1H1LB 1EK1A 1JLKA 1GU7A 1L7RA 2I4TA 3KKMA 4WXRA 3V4OA 4I5GA 1W94A 2B3DA 1L4EA 1GGEA 1L5QA 3RIXA 1FJXA 4EB6A 5KYXA 3L4EA 3A3OA 3AZPA 4IDAA 1KZYC 1Q0HA 5ARCA 3B3QA 4DCUA 3AW9A 4LSGA 4FVTA 2NPFA 1PS8A 3ENVA 2UXBB 1ELOA 4WDQA 3RKUA 1WPQA 2BI4A 3CNBA 3EODA 4HEHA 2QRVB 2CNLA 4MCAA 4MUYA 1YJCA 3C6MA 4S1OA 2YFKA 1ZH4A 2CL5A 3MGCA 2H1VA 3LH5A 2GM4A 3AFHA 3ND9A 1YT5A 1XF9A 4MR7A 1URPA 2PQMA 2XYPA 3NI2A 3W6ZA 1SQ5A 4CT5A 2GEJA 3WIOA 5ADWA 3VU8A 1MABB 2J1LA 1R9GA 1FFCA 3F5MA 3QE3A 4R41A 3RV3A 2ZVDA 2P77A 4ND5A 4RF2A 3UJ8A 2C4HA 2VTBB 5EFZA 1JU3A 3LC2O 3ZU4A 3V3TA 1C8BA 1LI5A 1WXGA 1SVKA 3L7OA 3F90A 4CDGA 3BCUA 1JDJA 3DM9B 3A3KA 3BBPA 3VDNB 1ODKA 1S01A 4MGYR 4Q7QA 2R7MA 4INJA 5E0OA 5FL7D 2IPLA 1NW9B 4P98A 3THSA 4HDSA 2FRDC 2NO5A 1OFTA 2ZIXA 5E6SB 5TS3A 2OVFA 1DKPA 2SKCA 4I2NA 1ZCAA 1JG1A 2DQYA 4GPZA 2MSWA 2EX4A 1CY1A 1T5LA 4KR7A 1NRWA 4XGRA 5LKAA 3MGGA 1YB6A 2CFSA 1B74A 2YUTA 1OZHA 2PKYX 1YXMA 2DP4E 3K6JA 4EA8A 1W75A 3QKSB 4OA5A 4LTDA 2RGBA 5A0VA 2X1LA 1IN7A 1EDBA 1GXSB 1PJAA 3PTZA 4WQMA 3RIGA 4E12A 1TVKA 1EI9A 4KDRA 4EJSC 2BKEA 5ITZA 1CXZA 4K7JA 1DKOA 1L4UA 1TD9A 3HUTA 4FW8A 5LC1A 4G8JA 3IT1A 2OECA 3FCYA 3IUBA 3AR8A 2HCFA 1LQ2A 2PQ2A 3PDHA 4MYSA 4LX0A 4QDZA 5EN4A 3UOGA 5I8PA 2FDCA 4ZV7A 4IFTA 4OCZA 1GA6A 4DAOA 3EB9A 1UJ2A 2O48X 2WJ3A 4Q9KA 3VR5A 5EXTA 3IAXA 3JR3A 5AI0A 2PZJA 2OGUA 3O7MA 1YA8A 3WADA 2QRPA 3FWZA 2R6R1 4X20A 1YU9A 4WFKA 2R8OA 4D8TA 1GAQA 4ARIA 1EX7A 2Z43A 3GJ3A 4DLVA 4ZXPA 1BKDR 2ECKA 1ULBA 2JVIA 2XLCA 5TMPA 1MQSA 1IB0A 2DU8A 3AU9A 2IYFA 5SZKB 2RK6A 3MXTA 3O91A 4ND8A 4DQ0A 1JBEA 4GE3A 3HSSA 2JZOA 2R5WA 3FHLA 3PJDA 3MJDA 3KPVA 2GILA 3HL4A 1IHXA 2Q7OE 3SJCA 3H9BA 1R3UA 3FZQA 2XSZD 3OH8A 4CLEA 4KMSA 1U99A 4I08A 3FF1A 1S2NA 3VXKA 1E8NA 1R8XA 1KVSA 3ZVRA 4BQFA 2PMDA 4HGYA 3IOMA 2G0NA 1TK3A 4NABA 1HR0B 1N8NA 5KVAA 4KG7A 4Z4IA 4N6GA 2AFVA 2X1VA 2O20A 3LUPA 4B8WA 1ISMA 2QQEA 2Q41A 1ZITA 4UQLA 1JFFA 4FW9A 4LYAA 4OTZA 3T1YB 4IIDA 1NGSA 2WD7B 3F4BA 2GCPA 1AKMA 3AKEA 1ST2A 3L01A 4JV5B 3A26A 4LJLA 4O63O 4WA7A 1KJYA 3JSAA 3Q1KA 3DWEX 1AZWA 1PZMA 2B3TA 1UFKA 5A5EA 3A2KA 5KOHB 3QVLA 3W05A 3OHPA 4GSKA 4EITA 4R9UC 5EJ7A 1C8LA 4PW0A 4G0UA 2F4NA 4HYEA 4MOWA 5CM2Z 1FNMA 2PWBA 3O1IC 4ZP1A 5GINE 3HJBA 3JQ8B 2ACEA 4BQOA 4JA2A 3WLPA 4FLMA 5H5JA 5CEEA 8OHMA 1KQPA 1OLSA 2ZPTX 4DEXA 1OIXA 4GP6A 1T2VA 2BFBA 4KLNA 4RMGA 4Z7JA 1OKKD 4K6MA 3GUUA 3L77A 3U4MA 3VPHA 1YJ5A 2QB5A 4MYRA 4WOJA 4N6OA 5AVZA 3WYCA 3AT1A 4HUTA 2VP0A 3PGA1 1KDRA 4OH1A 3NG1A 1ZK4A 4MULA 1M1YB 1M0WA 2HBYA 1IHYA 2QQ5A 1QPBA 3QUSA 1U0TA 4WZZA 2B5VA 4BO2A 2A5GA 4JR1A 4PC1A 3MRSA 3I76A 4DLNA 1DSSG 1XVAA 4X3PA 5IMSA 1NPYA 2J3HA 2ZUEA 4EIWA 3QX7A 2SHKA 3QVKA 4CM9D 1XTQA 1DJMA 2R84A 3ZHQA 1Z38A 2ID7A 4NCAA 1K4YA 2VAXA 3AUSA 2QUZA 2HZ7A 3HUEA 3QYPA 1Y8ZA 3F6BX 4O4JA 1IXKA 1CP3A 1B6TA 1ZH2A 2H11A 3LXUX 3KZCA 1ZNZA 1E58A 3TXXA 4B2PA 4LV5B 1L7VC 3OEHD 4E30A 3DAFA 2ERXA 1FYEA 1Y1QA 3WGQA 3KQPA 4U2KA 1K7FB