3GF3A

Glutaconyl-coa decarboxylase a subunit from clostridium symbiosum co-crystallized with glutaconyl-coa
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
585
structure length
563
Chain Sequence
MYSMPGYFQNMPTIGKELVNPNPENEQEIKAVESDIHESIKKALDAGITSEEKLNERGQLSAMQRINALIDPGTWCPLNSLFNPENNKFGTTNIVNGLGRVDGKWVYIVASDNKKMAGAWVPGQAENLIRCSDAAKMMHLPLIYLLNCSGVEFPNQDKVYPNRRGGGTPFFRNSELNQLGIPVIVGIYGTNPAGGGYHSISPTILIAHQDANMAVGGAGAEQIIAAQIENSKLKVPAPGSVPIHYDETGFFREVYQNDLGVIDGIKKYISYLPAYNLEFFRVDTPKAPQLPAEDLYSIIPMNQKRPYDIYEVIARLFDNSEFSEYKKGYGPEMVTGLAKVNGLLVGVIANVQGLLMNYPEYKQNSVGIGGKLYRQGLIKMNEFVTLCARDRIPLIWLQDTTGIDVGDEAEKAELLGLGQSLIYSIENSKLPSLEITIRKASAAAHYVLGGPQGNNTNVFSIGTGACEYYVMPGETAANAMYSRKLVKAQPIIGKMNDMIQMYTDKSRPKYCTEKGMVDEIVDMTEVRPYIQAFTEAAYQNPQSICPMHQMLTPRSTREFETFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title An asymmetric model for Na+-translocating glutaconyl-CoA decarboxylases
pubmed doi rcsb
source organism Clostridium symbiosum
molecule tags Lyase
molecule keywords Glutaconyl-CoA decarboxylase subunit A
total genus 210
structure length 563
sequence length 585
ec nomenclature ec 4.1.1.70: Transferred entry: 7.2.4.5.
pdb deposition date 2009-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.680 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Helix bin 3gf3A01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3gf3A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3gf3A03
3G64A 4YLHA 2F6QA 5JBXA 3T89A 4MI2A 3K50A 5INIA 1N6DA 2VSSF 2Q2XA 2HW5A 1NZYA 3P2LA 1EY3A 5E0SH 1XNYA 3TDCA 1JXZA 3Q0JA 4OLQA 4JYLA 5KDRA 2PG8A 5DKPA 3IAVA 4KD6A 5E0NX 4KPKA 3KQFA 5JBWA 3QYRA 1DUBA 2VSSE 1X0UA 1XNWA 1XO6A 4OMRA 4ZDFA 2F9IB 3H0UA 3ZW9A 3V5IA 3TZ3A 2ZQQA 2J5II 3BF0A 2D3TA 1UYRA 4QIJA 2FW2A 3HRXA 1OD4A 3T8AA 4Q0GA 2F9YA 4JFCA 3RSIA 3HP0A 3H81A 4Z0MA 3MT6A 3IB9A 4U18A 4ELXA 5CTCA 5E0SA 2ZL4A 4U19A 2Q35A 3MYBA 5KDRB 4JYJA 3GF3A 3ISAA 4NNQA 1K32A 4QIIA 3QK8A 3ZWCA 2VSUF 2FBMA 2J5IA 3LKEA 2VSUE 3IBBA 4MOUA 3H02A 3QXZA 3TRRA 4IZBA 5DU8A 2UZFA 1N6EA 2CBYA 4FN7A 2FZSA 1MJ3A 3ZWAA 1TG6A 3R0OA 2VX2A 2A81A 5DL1A 4L6WA 3OMEA 4B3HA 2W3PA 4B3IA 4ZU2A 2Q34A 1SZOA 2F9YB 4JSBA 2VSUA 4JCQA 2DUBA 3GLMA 4I42A 2EJ5A 4HC8A 3OC7A 2CE3A 4ZDBA 3ZW8A 3BEZA 4FN8A 4IZCA 3K8XA 4IZDA 3ZWBA 1WDMA 3Q0GA 3TVWA 3R9QA 5FUSA 1FC9A 1WDLA 3QREA 2J5GD 3N6RB 4WYOB 2ZL3A 5DTWA 3U9TB 3U9RB 4JWVA 2VREA 5DU4A 3KTGA 4ASIA 3LAOA 2F9IA 3T3WA 3V5EA 1Q51A 4EMMA 3MOYA 3PE8A 3T88A 3SLLA 3MFMA 4JCRA 4K2NA 3TT7A 4FB8A 2ZL0A 3JU1A 4U0GH 5G1QA 3ST9A 2VSSA 4U0GA 2VSUC 1UYTA 4I4ZA 3OT6A 2X58A 1EF9A 1O8UA 2J5SA 3TLFA 3NJDA 1Y7OA 3SWXA 4RCNA 4I52A 1W2XA 5INGA 5G1SA 5DTPA 4WCZA 4WZ8B 2A7SA 1EF8A 3GMAA 4JJTA 3FF6A 5DUCA 5IKLB 1ON3A 3KTJA 1UYVA 3PZKA 4JVTA 4RYFA 4FNBA 4JOTA 4ZDCA 3R9SA 1UYSA 1J7XA 4Q1IA 5KJPA 1HNUA 2WTBA 2NP9A 1HNOA 4FZWA 4EMPA 3R9TA 3HLN1 3Q7HA 3H0SA 3PGQA 1NZYB 3R6HA 4OG1A 1WZ8A 3BPPA 3FDUA 1DCIA 1PIXA 4FZWC 3M6MA 1RJMA 4GM2A 3TV5A 3P5MA 1Q52A 5CTBA 3RSTA 3H0QA 4KWBA 3HINA 2J5IB 1WDKA 2ZQRA 3HE2A 4B3JA 2DEOA 2PPYA 5C90A 1FC7A 3DORA 2A7KA 5DZKH 2QQ3A 2F6IA 2X24A 3U9SB 1FC6A 3PEAA 5G1RA 1XX4A 2C8TA 2ZL2A 4QFEA 4HNKA 1VRGA 1UIYA 4K29A 1RJNA 3QMJA 4ELWA 2GTRA 4MXIA 3WG5A 4JCSA 1SG4A 4FNDA 3VIVA 5INFA 3M6NA 3TVUA 3Q1TA 1TYFA 4F47A 3RRVA 4FJWD 4K3WA 1OD2A 4KNPA 1N6FA 5MGBA 1YG6A 4U1AA 5DUFA 3NJBA 3L3SA 3T8BA 3QXIA 3STAA 3P85A 3QWDA 4ZDEA 3QKAA 1FCFA 1YG8A 1HZDA 2BZRA 4EMLA 5DZKA 2IEXA 1PJHA 4ELSA 3GF7A 3KTIA 4NEKA 4LK5A 1K39A 5C9GA 3KTHA 4JCTA 4ZDDA 4L8KA 3KTKA 4GHNA 3H0JA 5FIFA 3GKBA 4U0HA 4G2RA 3TT6A 2J5GA 3I47A 2PBPA 1ON9A 5DU6A 1XNVA 4RYFH 4DI1A 3DJAA
chains in the Genus database with same CATH superfamily
1CSBA 1EQ7A 3G64A 1NTMJ 4YLHA 2F6QA 3Q5SA 2B88A 1GL2B 2XKMA 4MI2A 1VQ9P 1L0NG 2J59M 2Q2XA 4AQRD 4UB6E 1JY3O 2BCCJ 1LTIC 5AVQB 1EC5A 4WVZA 3S9OA 1KILB 1BCCD 1LT1A 1L4AD 2A45G 1NTZK 3U1AA 3V5BA 2OQQA 5DKPA 2E74B 2OYIC 4W80A 1J1EC 1N73B 5E0NX 3A0HH 3TDKA 2OGUA 3KQFA 1LGHB 1VDFA 4YTPC 5JBWA 3L75E 2VSSE 1EZVI 5BU5A 4WWIA 2O1KA 4L76A 2P67A 1RQUA 1SQXE 4IFFA 1SQPE 1URQD 3I55P 2F9IB 1NVOA 4GT1A 2KSJA 3L72J 2FYNC 1L0LE 1QL1A 1GU5A 1JTHB 2ZQQA 3G3ZA 1NTZD 3PHLA 4EDFA 2Q3EA 2FW2A 4Q0GA 3RSIA 1M1KQ 1KYOE 2L5GB 3CCQP 4Z0MA 2FYNB 3MT6A 1LP1A 3IB9A 3AEFC 5CTCA 1JM0A 5DJUB 3KYQA 3O6QA 3TK1A 2R3SA 3MYBA 3GF3A 2O1JA 1VQ4P 1LTAC 3S4RA 3W68A 1HF9A 5EFWB 4I7ZC 1IZNB 2VSUF 2WPQA 1T6AA 2J5IA 3CCEP 1KTMA 5CHXA 3L37A 2VSUE 2Y0CA 3H02A 1N7LA 3QXZA 3TRRA 3CXHD 3FXDA 4EOTA 5DU8A 4IL6E 3L73E 1LTJC 2A81A 2M3EA 2A45I 2CPBA 4Y99C 4B3HA 3HTKA 2UWJE 1Y47A 1NTZG 3AEEC 5AW8B 2V4HA 1P84D 1EZVD 3L70D 4GIFA 3AE8C 2DUBA 4I42A 1NTZJ 2KIKA 5APTA 2OYIA 3ZW8A 3L35A 2YO3A 1URQB 4IZCA 4IZDA 3VN0A 4C7NB 1WDMA 4LC1A 1E79H 3A0HE 3R9QA 3AE4C 1FJKA 2ZVNB 1G2CB 1GL2C 2J5GD 4OWFA 5DTWA 3EFGA 3KXDA 3U9RB 2VREA 2YMYA 4ASIA 1Q51A 2Y0EA 2AXTH 2YKPA 1NYHA 3L73G 1FZCA 1KN7A 4UB6H 3PE8A 1JMMA 3AEDC 3H32A 3AE5C 2NRGA 1DD4A 1EXJA 3HTKB 2FYUG 2GUSA 3JC22 1NJIQ 1FZFA 4U0GH 2AXCA 2BCCD 3V2QA 2K9JA 5CCGC 2ZJSE 1NTME 1BCCG 1NHLA 1VQ7P 3V2RA 3CWBE 4B86A 3OT6A 2I8DA 2JR8A 2KNCB 2K1AA 1IK9A 1L0NE 3QWOC 3BCCE 4DOJA 2J5SA 1SQQG 1Y8AA 1Y7OA 2P1JA 3L74E 1JNMA 4RCNA 4JF7A 2YJGA 3L70E 2WVRA 1KQGB 1RF1B 5AVXB 1EF8A 3S1KA 3FF6A 5DUCA 5IKLB 1N86A 2OYOA 2WSEJ 3JCUH 3VMAA 4ZDCA 3D71A 3TYYA 2Q6QA 2WTBA 1S4XA 5AVTB 1SQPG 4EMPA 1AVYA 3TNUA 3A7OA 3BRTB 3PGQA 2YXRB 3R6HA 3L71E 1WZ8A 3A3YB 4ASWA 1PIXA 5APYA 1L4AB 5APWA 4FZWC 2C0XA 2KB7P 4ZNCA 3CCSP 1KB9I 4QMAA 4JQ0D 3H0QA 2QE7H 2ZQRA 3P8CE 2QSIA 3V2NA 3DORA 4C46A 2X24A 3L74G 1RQVA 2WWWA 1FC6A 1PP9G 1OFCX 1MFTA 2WSEH 2QJPB 2KLVA 4H0LB 1S1CX 1XTCC 1IFMA 1BSHA 2A06E 3VIVA 1Z56A 2RN0A 1M56D 3O6QB 3RL0g 1HGVA 4OVNF 2A06D 3LW5J 3G71P 4D6TJ 1LTBC 2ZAEB 1OD2A 3H1JJ 3EWKA 5MGBA 2FBWC 2QA4P 5GTHH 3T8BA 1D7MA 1KB9E 4IFMA 3HE5B 3WMM0 3P85A 4D6TG 1GL2D 1RH5B 2A06G 3MUDC 1YG8A 2HODA 1P84I 2BZRA 1DIPA 1NKZB 4HYTB 3M0DC 1PJHA 2IBZD 4ELSA 1HBWA 3KTIA 1HGZA 4PV1D 3BVHA 3NMDA 1JY2P 2PRRA 3KTHA 1FC2C 3CCLP 1MFZA 1GL2A 1RHZB 4JCTA 2FYUJ 1Q82Q 1ZV8A 5APUA 1L0NJ 3P32A 4M3LA 3RK3C 3D6YA 2QG4A 1EDIA 1XNVA 3CWBG 2M3BA 4DI1A 1QL2A 5AW0B 5KAFE 1KFMA 1N7SC 4K35A 3K50A 5INIA 3CX5D 2RKLA 3U1CA 1N6DA 4UB8E 3BRVB 1AFOA 2PGDA 4H44C 1BE3E 3VYIA 1HH0A 2O01H 2MJZA 5KJ7D 3Q0JA 2B87A 3AE6C 4JYLA 1OX3A 5CCHD 5GTHE 1GW3A 4KD6A 3PRJA 2NPSC 3L70J 3CD6P 4Z1MH 3TSIA 3U59A 2FKWB 1FAVA 4D6TD 2KUBA 3GHGC 1XNWA 4OMRA 1G1IA 4RO0A 1YTZT 1DX7A 2KYVA 1NAYA 3ZDMA 3L70G 3H0UA 3EFFK 4PD4E 3ZW9A 4IL6H 3WUTA 3V4WA 5K5GB 3B5ND 3TZ3A 4AUWA 3PP5A 1KMIZ 1SQVD 1SQQE 3BF0A 1X9VA 1UYRA 2NPSB 1T3JA 4JFCA 2YNYA 3HP0A 4EI2A 5KLVG 3EQ2A 1NTKJ 1NWQA 1VQKP 4ZKUA 3NXSA 4JBZA 4I6MC 5E0SA 1OVUA 1KILA 2XZRA 2KZJA 2Q35A 3O8ZA 2BCCG 3ISAA 3RK3B 1AVOA 2FXOA 2ZYAA 3AE1C 3WU2E 1NU1G 1L0LD 4ASVA 1JY3N 1VF5C 4XA4A 2KI7B 5CJ0A 1S72P 4OGQC 2FBMA 1LTGC 3LKEA 4J2UA 3VOPA 1BDDA 2P7JA 3OJAB 1NTKD 4IZBA 3H1JG 2FZSA 1IFDA 3R0OA 1SQXJ 5B5EE 4C7NA 5KJ7C 1CZQA 2KZIA 2JKVA 2N1TC 2HLOA 4B3IA 1SS1A 1SQPD 3F5HA 4ZU2A 2F9YB 4JSBA 3CMEP 1FZAA 2BASA 2OARA 2H43A 2QRXA 1M57D 1OZHA 1H88A 1YJWP 2K88A 1YI2P 2EJ5A 3FGAD 5KTBA 1WT6A 5E79H 2P10A 3GHGA 4GKGA 5APVA 1MZ9A 1GDTA 3L75G 3TGUJ 2WMMA 3H1HJ 1SQBD 3Q5PA 4R4LA 2L91A 4AYCA 5FUSA 3B4SA 1Q81Q 1FC9A 2WSCH 1SQXD 3Q5RA 3QREA 1ZN5A 4WYOB 2XV5A 2ZL3A 1SQVJ 4JWVA 5DU4A 1H8AA 3LAOA 2F9IA 1EZVE 1K04A 2IYPA 2P58A 3B5NB 3E1RA 2POHA 1VL2A 5B66H 1M90Q 4JCRA 4WY4D 4K2NA 1DH3A 1FS0E 4OH8B 4FB8A 3JU1A 1QX8A 4TLFA 4HJGH 1SP4A 3H1IE 3HRNA 2Q1KA 4CPGA 1AQ5A 1VPCA 3L73D 4I1LA 3VMZA 1PPJG 2VSUC 5AVUB 3A0BH 3BCCG 3IAOA 1FZGA 3RBXA 1IJDB 5TJHA 1BCCE 3FWNA 4ZKPA 5AVWB 1ZXGA 3II6A 2OTJP 3D6ZA 5CBOA 2CK3H 5KLIB 1FDMA 4YPCA 1QVGO 1W2XA 5CMZA 5INGA 1WMKA 2ZT9B 3GMAA 2HODB 1ON3A 1LTTC 3M9HA 3PZKA 4FNBA 1PGQA 2WSFH 5HUQA 2IFMA 2PP6A 1EZVG 1S5LH 2I1KA 1IC2A 3PJSK 1K8AQ 4Q1IA 2M8RA 2JO1A 4PJ0E 2QJYC 1K9MQ 1OVRA 4KT0J 2WSFJ 3VMXA 3HLN1 3RGUA 3Q7HA 1FOSE 3H0SA 5CCHA 3L75J 1YQ3C 2KSEA 3CL3D 3TGUG 5KAIH 1DCIA 4PD4H 4BRYB 1URQA 3AEAC 1Q52A 5CTBA 2J5UA 2ZXXA 1DEEG 2WT7B 4JYBA 1WDKA 3HE2A 3V2PA 4RESB 3CCUP 2DEOA 1T3UA 1FC7A 1RE4C 4DZOA 2A7KA 1VQ5P 1KILE 2IDBA 1M7LA 2ZYGA 3FX0A 3PEAA 5KLIC 3FXEA 1YQ4C 4MN4C 3L36A 1FZCB 2ZL2A 4NPFX 4HNKA 1SVFA 5APXA 2QJYB 1L4AC 3HD7D 2BEZF 4ELWA 4I2LC 2GTRA 4H44D 1NGMB 5E79E 1RE3A 1OXZA 2W27A 1JO5A 1PPJD 3M6NA 3L74D 2WSCJ 1K73Q 1TYFA 1JY3P 3RRVA 4KNPA 4I7ZB 2QIWA 2XNXA 1N7SA 2FXPA 3NJBA 1L0NK 2JP3A 3QXIA 1QLED 1ZP0C 5CCGD 3QWDA 4ZDEA 1LWUB 1JEKA 3SFDC 1FCFA 3RL0D 1T2KD 5DZKA 2XDJA 5APQA 3B5NC 2W8ZA 1BGYG 1RE4A 4NEKA 4LK5A 5C9GA 1R5LA 2OYHC 3HE4A 3MZWB 4ZDDA 2NZ2A 2Q3IA 3M0DA 2K9JB 1X79B 4U0HA 1NH4A 1JMBA 2WSSH 3G6EP 3BPTA 2WZ7A 2BCCE 3WUVA 3I47A 2PBPA 4RYFH 4BRYA 5BVZA 5JBXA 3T89A 1KYOD 1CI6B 5AW1B 2E76B 1A02J 1GD2E 2E74C 1SFCD 5APSA 4H0LC 4W7ZA 1NZYA 3P2LA 2HFED 1FDOA 3C1LA 1EDLA 5KDRA 2PG8A 4OGQB 2MKVA 3IAVA 5H2FH 2V7QJ 4BXLA 1FZBA 1W5CE 2KXPB 1PFIA 3R2PA 1M1JB 3AE7C 1FU1A 4H13C 1SFCA 3RK3D 1IO4A 2FXMA 1DUBA 3ABVC 1X0UA 4IL6X 3L72G 4PD4I 1RF0C 4U3FE 4DCKA 4ZDFA 3V4QA 3CCJP 4A7PA 2E75C 1VF5B 1NTMG 2KS1B 5AW7B 2YMKA 3L71D 2PAJA 5AW4B 2KOGA 2M0BA 2LKMA 3LW5H 1ZRTD 2Q9IA 2D3TA 1LTJB 1R5SA 4QIJA 2F9YA 4NPDA 3H81A 3CCVP 2C0WA 2KLUA 3L75D 3IR9A 4EIJA 2WQYC 3H1HE 5AW3B 3CX5I 3IN6A 3KZIH 4U19A 2KS1A 3ITKA 3B5NA 2I1JA 3GHGB 2N1TD 1BGYE 3SWKA 4JYJA 5B66E 5KDRB 3H32B 5CJ4A 1NO4A 4QIIA 3L73J 2NPSD 5AW5B 3ZWCA 1S5LX 1QGKB 3H25A 3IBBA 3B71A 1X22A 2WTYA 1LT9B 3VTPC 2UZFA 4L75A 4FN7A 1JUNA 1USDA 2O3JA 1TG6A 2VX2A 3CMAP 3CPWO 4L6WA 3OMEA 1LT9C 2W3PA 4U3FD 5AVYB 4EYYQ 2Z5HA 3HD7A 1SQXG 2Q34A 1SZOA 1ZLLA 1M1JC 2IX7C 5GTIH 3OA7A 1PGOA 1MKMA 2JDIH 2FFDB 3CCRP 4JCQA 3GLMA 3KQGA 4GDOA 1KC8Q 3OC7A 2CE3A 1KORA 3VP8A 3CXHE 2QM8A 3I5CA 1CW5A 3BEZA 3K8XA 1JTHA 3ZWBA 2H8PD 2R32A 2HPCA 3TVWA 3CLQA 5AVSB 3A5TA 3N6RB 1BCCJ 1KILD 4HB1A 3KTGA 2N9YB 2IPPA 2OYHB 3T3WA 3FWLA 3V5EA 1NU1K 2PFXA 3SFEC 1R8EA 3MOYA 3AE2C 4XFJA 2Z4EA 3SLLA 1VQMP 2AEFA 4UB8H 1JCDA 5CCHC 4NPEA 2ZL0A 1AV1A 3P8MC 2GUVA 1L0LJ 2C9NY 1UYTA 1H0TA 2X58A 1NOHA 1BE3D 1L4AA 2E43A 1N2DC 1ZR4A 2XNDH 2N9BA 3TLFA 2IYOA 2IBZI 3SWXA 1LTJA 3MTUE 1HVVA 5AW9B 4I52A 3GW6A 1U57A 4JYCA 5G1SA 4WCZA 4WZ8B 1Q86Q 2A7SA 3T97A 4JJTA 3L71G 2FY8A 4JVTA 1UYVA 4RYFA 4JOTA 1KD1Q 3GG2A 1GK6A 3R9SA 1UYSA 3H1IJ 2QJKB 1N73A 1ZMEC 1J7XA 5AVVB 1KYOH 5KJPA 5L8RJ 1HNUA 3Q3DA 1HNOA 4ZMDA 1WRGA 2JWAA 2JEEA 4U3FG 3CX5H 3H1IG 3H1LJ 1UIIA 1BSNA 3R9TA 3VMYA 3RL0C 2G8YA 1P84E 2JWDA 1OMIA 3MD0A 3BPPA 2Y9ZA 3FDUA 1RF0A 3H1KE 4IOIH 1KQLA 3N4XA 3Q2YA 3MP7B 2YKQA 4GM2A 2N1TA 2OTKE 3TV5A 3P5MA 1OW6A 3H1KD 1RE3C 1SQVK 3KHUA 3Q1MA 4GOFA 1EDJA 1OW8A 3MIWA 2HG5D 3RK2C 4KWBA 2J5IB 3SSUA 4W7YA 1SFCC 4B3JA 2E76C 2R3CA 4DJGA 3H1KJ 2WPRA 2PPYA 2H7HA 1GTWA 1PGPA 3CI9A 5DZKH 3MUDA 2F6IA 1RY3A 3WU2H 1HWTC 1SQQK 1NTKE 2H88C 5M1BA 4HH2A 1USEA 1VQLP 1P84H 2W6AA 5G1RA 2GM4A 4JPZB 1YJ9P 5AW2B 1FBMA 1IK7A 1VRGA 3HE4B 1PP9J 4K29A 2WT7A 1LWUA 1J1DB 2B89A 1SQPK 1RJNA 2Q7CA 1RF1A 4MXIA 3WG5A 1J1DC 1LP1B 3M06A 5INFA 3H6PA 2BEQD 1LJ2A 1FZCC 3CCMP 3JCUE 3M91A 1NTMD 1Q90D 1HTLC 1ZRTE 4H13B 4FJWD 4O9BA 2RH0A 1PPJE 2FYZA 5DUFA 4U1AA 2W83C 1IFIA 1RF1C 3L3SA 3STAA 3HD7B 3AE3C 1SLQA 2SPZA 1LWUC 3TGUE 3H1HD 3VP9A 3TGUD 1HZDA 1L2PA 2IBZG 4RJTA 3CC7P 3P8CD 3AEGC 4KJMA 2KK7A 2XU6A 4WY4A 5KAFH 1J2JB 3K5BA 5AVRB 3M9BA 2NPSA 1KB9H 2YXQB 3RL0B 2JJLA 4L74A 3RBZA 1KQSO 3KTKA 2ZFCA 5C39A 4PD4D 1Q7YQ 4GHNA 3H0JA 3HUSA 3HD7C 3E7KA 1BE3G 2ZT9D 3TT6A 3PTZA 5DU6A 1S2EA 5B5EH 1GK4A 2KP8A 3QH9A 2D2CD 1EDKA 1PV3A 4Y99B 4H44B 1G1JA 1LTSC 2ZT9C 3H1KG 1DEBA 3E1IA 1N73C 2VSSF 1IFPA 2V7QH 2HW5A 1NTMK 5GTIE 3TNUB 1HJ0A 2LR2A 1IFJA 1BGYD 1JCCA 1W2EA 2AXTE 5KKZB 2OYHA 1EY3A 3BCCD 3HUSC 5E0SH 5TISH 1XNYA 1VQNP 3TDCA 5KLVJ 3MGNA 1JXZA 1N7SD 2O01N 2W6JH 1SQVE 1KYOI 3I56P 4OLQA 2K9YA 1A02F 2FYUK 2R44A 4KPKA 2QEXP 2AEJA 2WPVB 1KZUB 1NU1D 3QYRA 1G2CA 1XO6A 1JY2N 4YXWH 1AA0A 2W90A 2IFNA 2K37A 3V5IA 1S3JA 3C9IA 2M5AA 1OWAA 2O01J 2J5II 1U7JA 5CCGA 1HJBA 1CI6A 2Y0DA 4N6JA 4N78D 1SQVG 3CXHI 3HRXA 5AW6B 1OD4A 3T8AA 2GA1A 3BASA 1MUUA 2CPSA 2OTLP 2Y9YA 4U18A 3HUSB 4ELXA 2IBZE 2ZL4A 2AEMA 4BWNA 3SWFA 2E5YA 1AQTA 1S9KD 3D70A 1VQOP 1K32A 4NNQA 3LIEA 1X0TA 1TU3F 2FFDC 3QK8A 1KV4A 1UIXA 4K3AA 1VQ8P 1L0LG 3TF5A 1K05A 3OAKA 4DT0A 1XTGB 2QJKC 1JOCA 2HR3A 1KQFB 4D6TE 3KDPB 2LXCB 4MOUA 1N8RQ 2ZXEB 2QJPC 1KILC 2W6BA 3USSA 1NTKG 3CC2P 1N6EA 2CBYA 2Z5IA 1MJ3A 3ZWAA 2OYIB 3RK3E 1T8ZA 5H2FE 2ITAA 1NU1E 4KHXA 4N3YB 1FZEA 5DL1A 2FYUE 2QVAA 3H1ID 1L0ND 2G3AA 1M1JA 2Q5UA 2FYUD 3CWBJ 3CX5E 2IZ1A 2VSUA 3SWYA 1ZW0A 3M0AA 1QEXA 1JB0J 2DW3A 2KNCA 1NU1J 4HC8A 1EXIA 5DJTB 4ZDBA 1VF5D 4N78E 5BU8B 1YBKA 4FN8A 1ZOYC 3BATA 2YIUB 3L72E 3H1LG 3Q0GA 3HE5A 1BE3J 3OW2O 1WDLA 3BCCJ 1SQXK 2YKOA 3U9TB 1S9KE 1ZR2A 5KKZC 5TISE 1YYCA 4EMMA 3H1LE 3KPEA 1DD3A 2M5AB 4U7JA 3T88A 1YTZI 3MFMA 1HUCA 4GOEA 1NAFA 1SFCB 3AE9C 3TT7A 1NTZE 2P2UA 1T2KC 5G1QA 3L4FA 3ST9A 1M8OB 2VSSA 2QM7A 2ZVOB 2E42A 1PGJA 1IFNA 3CWBD 4OGQD 4U0GA 2D2CB 2HYNA 3LIDA 4I4ZA 3UIAA 4LGDE 1GU4A 1EF9A 1O8UA 4HDTA 4C7RA 2YO2A 3NJDA 2K3RA 1NKNA 5KLVE 5DTPA 1SQBG 4L73A 1U7MA 1H0TB 4WBAA 1PP9E 3KTJA 1YHQP 1YITP 1GMJA 1OVVA 4U3FJ 3G9RA 2H89C 3L72D 2N1TB 3CXHH 1BDCA 2J58A 1H89A 1SQBJ 1NTKK 1W2BO 2WPSA 2NP9A 4FZWA 4XE5B 3AECC 3NFQA 2E76D 5CBNA 2R5BA 3P7KA 3T97B 3B8EB 1NZYB 2C9LY 3H1JE 4OG1A 1PZQA 1SQQJ 3H1JD 1YJNP 3M6MA 1SQBE 3CC4P 1SQPJ 1RJMA 3NTNA 3V6IA 1N7SB 1S5LE 2D2CC 3H1HG 1FE6A 1OW7A 2B9BA 2VRSA 3RSTA 1X8YA 4PV1B 4H0LD 3HINA 4IFDK 3N7NA 3L74J 4Y28J 1JY2O 5C90A 2FFDA 1E5WA 4LLHA 2QQ3A 3U9SB 4PV1C 3RK2B 3F89A 1KB9D 1XX4A 1L0LK 2C8TA 5KLVD 4QFEA 3L71J 2RMZA 1UIYA 1PL5A 1BGYJ 2R5DA 4PJ0H 3PLNA 1PP9D 3QMJA 1GZLA 4WB4A 4JCSA 1SG4A 4FNDA 1LT9A 2E74D 3W67A 3WUUA 5KAIE 2E5TA 3R4YA 3TVUA 3Q1TA 4F47A 1QVFO 3G4SP 3IF4A 4K3WA 4WY4B 3M9QA 1Q2NA 1N6FA 3JSVC 1YG6A 1SQBK 2E75D 1FDIA 1VQ6P 2A45H 3QKAA 3A2AA 3RK2D 4HKZH 3C8VA 4H13D 4RKUJ 4EMLA 3KZIE 4WY4C 2WITA 2IEXA 1OIPA 3PH0A 1LNQA 5AVZB 3GF7A 3A0BE 1VQPP 1KFNA 1Y9BA 1K39A 2HPCB 4GODA 4YXDC 3MHVA 1GW4A 1YIJP 3H1LD 2LXBA 1URQC 1SQQD 4L8KA 4TT3H 1MV8A 4R4MA 5FIFA 3GKBA 1FJPA 4G2RA 1FOSF 2E75B 2J5GA 5KLVK 4NARA 2ZYDA 5KJ7A 2B87B 1J1EB 1AJYA 1ON9A 3AEBC 2YIUC 2IZ0A 3IFMA 3DJAA
chains in the Genus database with same CATH topology
3G64A 4YLHA 2F6QA 2D2CD 3T89A 5JBXA 3Q5SA 1PV3A 4MI2A 3K50A 4H44B 5INIA 2E76B 2ZT9C 1N6DA 2VSSF 2Q2XA 2HW5A 2E74C 1HJ0A 4H44C 4H0LC 1NZYA 3P2LA 1FDOA 1EY3A 3S9OA 5E0SH 1XNYA 3TDCA 1JXZA 3Q0JA 4OLQA 3AE6C 4JYLA 5KDRA 2PG8A 2OQQA 5DKPA 4OGQB 2MKVA 2E74B 2K9YA 3IAVA 4KD6A 2V7QJ 5E0NX 4KPKA 4Z1MH 2WPVB 3AE7C 4H13C 3KQFA 4YTPC 5JBWA 3QYRA 1DUBA 3ABVC 2VSSE 1X0UA 1XNWA 1XO6A 4IL6X 4OMRA 4ZDFA 1RQUA 2F9IB 2E75C 1VF5B 3H0UA 2YMKA 2FYNC 3ZW9A 3V5IA 3TZ3A 2ZQQA 2O01J 2J5II 1KMIZ 3BF0A 2D3TA 1UYRA 4QIJA 2FW2A 3HRXA 1OD4A 3T8AA 4Q0GA 2F9YA 4JFCA 3RSIA 3HP0A 3H81A 4Z0MA 3MT6A 3IB9A 3AEFC 4U18A 4ELXA 5CTCA 5E0SA 2ZL4A 2WQYC 3O6QA 3IN6A 4U19A 2Q35A 3D70A 3MYBA 5KDRB 4JYJA 3GF3A 3ISAA 4NNQA 1K32A 3AE1C 4QIIA 1TU3F 3QK8A 1VF5C 3ZWCA 1UIXA 1HF9A 1S5LX 4I7ZC 1K05A 2VSUF 4OGQC 2FBMA 2J5IA 2QJKC 3LKEA 1KTMA 3H25A 4J2UA 1KQFB 2VSUE 3IBBA 4MOUA 3H02A 3B71A 3QXZA 3TRRA 2QJPC 4IZBA 5DU8A 2UZFA 1N6EA 2CBYA 4FN7A 2FZSA 1MJ3A 3ZWAA 1TG6A 3R0OA 3RK3E 2VX2A 2A81A 5DL1A 4L6WA 3OMEA 4B3HA 2G3AA 2W3PA 4B3IA 4ZU2A 3AEEC 2Q34A 1SZOA 2F9YB 4JSBA 2VSUA 1MKMA 4JCQA 3AE8C 2DUBA 3GLMA 1JB0J 4I42A 4GDOA 2EJ5A 4HC8A 1EXIA 3FGAD 2CE3A 3OC7A 4ZDBA 1KORA 2P10A 3ZW8A 1VF5D 3BEZA 4FN8A 4IZCA 3K8XA 4IZDA 1ZOYC 3ZWBA 3Q5PA 1WDMA 3Q0GA 3TVWA 3R9QA 4R4LA 3AE4C 5FUSA 1FC9A 1WDLA 3Q5RA 3QREA 2J5GD 3N6RB 4WYOB 2ZL3A 5DTWA 3U9TB 5KKZC 3U9RB 4JWVA 2VREA 5DU4A 3KTGA 4ASIA 3LAOA 2F9IA 3T3WA 3V5EA 1K04A 1Q51A 1R8EA 3SFEC 4EMMA 3MOYA 1DD3A 3AE2C 4XFJA 1VL2A 4U7JA 1NYHA 3PE8A 3T88A 3SLLA 3AEDC 3AE5C 3MFMA 1DD4A 1EXJA 4JCRA 4K2NA 3AE9C 3TT7A 4FB8A 2ZL0A 3JU1A 4U0GH 5G1QA 3ST9A 2VSSA 4OGQD 4U0GA 2D2CB 2VSUC 1UYTA 4I4ZA 3IAOA 3OT6A 2X58A 1EF9A 1O8UA 4HDTA 2J5SA 3TLFA 3NJDA 1Y7OA 3SWXA 4RCNA 3D6ZA 2YJGA 4I52A 1W2XA 5INGA 1WMKA 1U57A 5G1SA 1KQGB 5DTPA 4WCZA 4WZ8B 2A7SA 2ZT9B 3GMAA 1EF8A 4JJTA 3FF6A 5DUCA 5IKLB 1ON3A 3KTJA 1UYVA 3PZKA 4JVTA 4RYFA 2WSEJ 1GMJA 4FNBA 4JOTA 4ZDCA 3G9RA 2H89C 5HUQA 3R9SA 3D71A 1UYSA 1ZMEC 1J7XA 4Q1IA 2JO1A 5KJPA 5L8RJ 1HNUA 2WTBA 2NP9A 3Q3DA 1HNOA 2QJYC 4FZWA 4EMPA 3AECC 2E76D 4KT0J 2WSFJ 3R9TA 3HLN1 3T97B 3Q7HA 3H0SA 3PGQA 2G8YA 1NZYB 3R6HA 4OG1A 1WZ8A 1OMIA 3BPPA 1YQ3C 3FDUA 1DCIA 1PIXA 3Q2YA 3M6MA 4FZWC 1RJMA 4GM2A 3TV5A 3P5MA 1OW6A 3AEAC 2D2CC 1Q52A 5CTBA 3Q1MA 2J5UA 1OW7A 1OW8A 3RSTA 4PV1B 4H0LD 3H0QA 4KWBA 3HINA 2J5IB 1WDKA 2ZQRA 3HE2A 2E76C 4B3JA 4Y28J 2QSIA 2DEOA 2PPYA 5C90A 1FC7A 3DORA 2A7KA 5DZKH 2QQ3A 1KILE 2F6IA 2X24A 2IDBA 3U9SB 1RQVA 4PV1C 1FC6A 2H88C 5M1BA 3PEAA 5KLIC 1YQ4C 5G1RA 1XX4A 2C8TA 2ZL2A 4QFEA 4HNKA 1IK7A 1VRGA 1UIYA 4K29A 4H0LB 1PL5A 1S1CX 1RJNA 2BEZF 3QMJA 4ELWA 2GTRA 4MXIA 3WG5A 4JCSA 1SG4A 4H44D 1NGMB 4FNDA 3VIVA 2E74D 5INFA 2BEQD 3RL0g 3LW5J 3M6NA 3R4YA 3TVUA 2WSCJ 3Q1TA 1Q90D 1TYFA 4H13B 1ZRTE 4F47A 3RRVA 4FJWD 4K3WA 1OD2A 4KNPA 3EWKA 4I7ZB 1N6FA 2QIWA 5MGBA 2FBWC 2FXPA 1YG6A 4U1AA 5DUFA 3NJBA 2E75D 3L3SA 3T8BA 2JP3A 3QXIA 3STAA 1ZP0C 3P85A 3AE3C 3QWDA 4ZDEA 1FDIA 3QKAA 3SFDC 1FCFA 1YG8A 3C8VA 1HZDA 2BZRA 4H13D 4RKUJ 4EMLA 1DIPA 5DZKA 2IEXA 1PJHA 3AEGC 4ELSA 3GF7A 3KTIA 4PV1D 1Y9BA 4NEKA 4LK5A 1K39A 5C9GA 4YXDC 3KTHA 4JCTA 4ZDDA 2NZ2A 4L8KA 4TT3H 3KTKA 4GHNA 4R4MA 3H0JA 5FIFA 3GKBA 2ZT9D 4U0HA 4G2RA 3TT6A 2E75B 2J5GA 4NARA 3D6YA 3BPTA 3I47A 2PBPA 1AJYA 1ON9A 3AEBC 2YIUC 5DU6A 1XNVA 4RYFH 4DI1A 3DJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G64 A;  4YLH A;  2F6Q A;  5JBX A;  3T89 A;  4MI2 A;  3K50 A;  5INI A;  1N6D A;  2VSS F;  2Q2X A;  2HW5 A;  1NZY A;  3P2L A;  1EY3 A;  5E0S H;  1XNY A;  3TDC A;  1JXZ A;  3Q0J A;  4OLQ A;  4JYL A;  5KDR A;  2PG8 A;  5DKP A;  3IAV A;  4KD6 A;  5E0N X;  4KPK A;  3KQF A;  5JBW A;  3QYR A;  1DUB A;  2VSS E;  1X0U A;  1XNW A;  1XO6 A;  4OMR A;  4ZDF A;  2F9I B;  3H0U A;  3ZW9 A;  3V5I A;  3TZ3 A;  2ZQQ A;  2J5I I;  3BF0 A;  2D3T A;  1UYR A;  4QIJ A;  2FW2 A;  3HRX A;  1OD4 A;  3T8A A;  4Q0G A;  2F9Y A;  4JFC A;  3RSI A;  3HP0 A;  3H81 A;  4Z0M A;  3MT6 A;  3IB9 A;  4U18 A;  4ELX A;  5CTC A;  5E0S A;  2ZL4 A;  4U19 A;  2Q35 A;  3MYB A;  5KDR B;  4JYJ A;  3GF3 A;  3ISA A;  4NNQ A;  1K32 A;  4QII A;  3QK8 A;  3ZWC A;  2VSU F;  2FBM A;  2J5I A;  3LKE A;  2VSU E;  3IBB A;  4MOU A;  3H02 A;  3QXZ A;  3TRR A;  4IZB A;  5DU8 A;  2UZF A;  1N6E A;  2CBY A;  4FN7 A;  2FZS A;  1MJ3 A;  3ZWA A;  1TG6 A;  3R0O A;  2VX2 A;  2A81 A;  5DL1 A;  4L6W A;  3OME A;  4B3H A;  2W3P A;  4B3I A;  4ZU2 A;  2Q34 A;  1SZO A;  2F9Y B;  4JSB A;  2VSU A;  4JCQ A;  2DUB A;  3GLM A;  4I42 A;  2EJ5 A;  4HC8 A;  3OC7 A;  2CE3 A;  4ZDB A;  3ZW8 A;  3BEZ A;  4FN8 A;  4IZC A;  3K8X A;  4IZD A;  3ZWB A;  1WDM A;  3Q0G A;  3TVW A;  3R9Q A;  5FUS A;  1FC9 A;  1WDL A;  3QRE A;  2J5G D;  3N6R B;  4WYO B;  2ZL3 A;  5DTW A;  3U9T B;  3U9R B;  4JWV A;  2VRE A;  5DU4 A;  3KTG A;  4ASI A;  3LAO A;  2F9I A;  3T3W A;  3V5E A;  1Q51 A;  4EMM A;  3MOY A;  3PE8 A;  3T88 A;  3SLL A;  3MFM A;  4JCR A;  4K2N A;  3TT7 A;  4FB8 A;  2ZL0 A;  3JU1 A;  4U0G H;  5G1Q A;  3ST9 A;  2VSS A;  4U0G A;  2VSU C;  1UYT A;  4I4Z A;  3OT6 A;  2X58 A;  1EF9 A;  1O8U A;  2J5S A;  3TLF A;  3NJD A;  1Y7O A;  3SWX A;  4RCN A;  4I52 A;  1W2X A;  5ING A;  5G1S A;  5DTP A;  4WCZ A;  4WZ8 B;  2A7S A;  1EF8 A;  3GMA A;  4JJT A;  3FF6 A;  5DUC A;  5IKL B;  1ON3 A;  3KTJ A;  1UYV A;  3PZK A;  4JVT A;  4RYF A;  4FNB A;  4JOT A;  4ZDC A;  3R9S A;  1UYS A;  1J7X A;  4Q1I A;  5KJP A;  1HNU A;  2WTB A;  2NP9 A;  1HNO A;  4FZW A;  4EMP A;  3R9T A;  3HLN 1;  3Q7H A;  3H0S A;  3PGQ A;  1NZY B;  3R6H A;  4OG1 A;  1WZ8 A;  3BPP A;  3FDU A;  1DCI A;  1PIX A;  4FZW C;  3M6M A;  1RJM A;  4GM2 A;  3TV5 A;  3P5M A;  1Q52 A;  5CTB A;  3RST A;  3H0Q A;  4KWB A;  3HIN A;  2J5I B;  1WDK A;  2ZQR A;  3HE2 A;  4B3J A;  2DEO A;  2PPY A;  5C90 A;  1FC7 A;  3DOR A;  2A7K A;  5DZK H;  2QQ3 A;  2F6I A;  2X24 A;  3U9S B;  1FC6 A;  3PEA A;  5G1R A;  1XX4 A;  2C8T A;  2ZL2 A;  4QFE A;  4HNK A;  1VRG A;  1UIY A;  4K29 A;  1RJN A;  3QMJ A;  4ELW A;  2GTR A;  4MXI A;  3WG5 A;  4JCS A;  1SG4 A;  4FND A;  3VIV A;  5INF A;  3M6N A;  3TVU A;  3Q1T A;  1TYF A;  4F47 A;  3RRV A;  4FJW D;  4K3W A;  1OD2 A;  4KNP A;  1N6F A;  5MGB A;  1YG6 A;  4U1A A;  5DUF A;  3NJB A;  3L3S A;  3T8B A;  3QXI A;  3STA A;  3P85 A;  3QWD A;  4ZDE A;  3QKA A;  1FCF A;  1YG8 A;  1HZD A;  2BZR A;  4EML A;  5DZK A;  2IEX A;  1PJH A;  4ELS A;  3GF7 A;  3KTI A;  4NEK A;  4LK5 A;  1K39 A;  5C9G A;  3KTH A;  4JCT A;  4ZDD A;  4L8K A;  3KTK A;  4GHN A;  3H0J A;  5FIF A;  3GKB A;  4U0H A;  4G2R A;  3TT6 A;  2J5G A;  3I47 A;  2PBP A;  1ON9 A;  5DU6 A;  1XNV A;  4RYF H;  4DI1 A;  3DJA A; 
#chains in the Genus database with same CATH topology
 1CSB A;  1EQ7 A;  3G64 A;  1NTM J;  4YLH A;  2F6Q A;  3Q5S A;  2B88 A;  1GL2 B;  2XKM A;  4MI2 A;  1VQ9 P;  1L0N G;  2J59 M;  2Q2X A;  4AQR D;  4UB6 E;  1JY3 O;  2BCC J;  1LTI C;  5AVQ B;  1EC5 A;  4WVZ A;  3S9O A;  1KIL B;  1BCC D;  1LT1 A;  1L4A D;  2A45 G;  1NTZ K;  3U1A A;  3V5B A;  2OQQ A;  5DKP A;  2E74 B;  2OYI C;  4W80 A;  1J1E C;  1N73 B;  5E0N X;  3A0H H;  3TDK A;  2OGU A;  3KQF A;  1LGH B;  1VDF A;  4YTP C;  5JBW A;  3L75 E;  2VSS E;  1EZV I;  5BU5 A;  4WWI A;  2O1K A;  4L76 A;  2P67 A;  1RQU A;  1SQX E;  4IFF A;  1SQP E;  1URQ D;  3I55 P;  2F9I B;  1NVO A;  4GT1 A;  2KSJ A;  3L72 J;  2FYN C;  1L0L E;  1QL1 A;  1GU5 A;  1JTH B;  2ZQQ A;  3G3Z A;  1NTZ D;  3PHL A;  4EDF A;  2Q3E A;  2FW2 A;  4Q0G A;  3RSI A;  1M1K Q;  1KYO E;  2L5G B;  3CCQ P;  4Z0M A;  2FYN B;  3MT6 A;  1LP1 A;  3IB9 A;  3AEF C;  5CTC A;  1JM0 A;  5DJU B;  3KYQ A;  3O6Q A;  3TK1 A;  2R3S A;  3MYB A;  3GF3 A;  2O1J A;  1VQ4 P;  1LTA C;  3S4R A;  3W68 A;  1HF9 A;  5EFW B;  4I7Z C;  1IZN B;  2VSU F;  2WPQ A;  1T6A A;  2J5I A;  3CCE P;  1KTM A;  5CHX A;  3L37 A;  2VSU E;  2Y0C A;  3H02 A;  1N7L A;  3QXZ A;  3TRR A;  3CXH D;  3FXD A;  4EOT A;  5DU8 A;  4IL6 E;  3L73 E;  1LTJ C;  2A81 A;  2M3E A;  2A45 I;  2CPB A;  4Y99 C;  4B3H A;  3HTK A;  2UWJ E;  1Y47 A;  1NTZ G;  3AEE C;  5AW8 B;  2V4H A;  1P84 D;  1EZV D;  3L70 D;  4GIF A;  3AE8 C;  2DUB A;  4I42 A;  1NTZ J;  2KIK A;  5APT A;  2OYI A;  3ZW8 A;  3L35 A;  2YO3 A;  1URQ B;  4IZC A;  4IZD A;  3VN0 A;  4C7N B;  1WDM A;  4LC1 A;  1E79 H;  3A0H E;  3R9Q A;  3AE4 C;  1FJK A;  2ZVN B;  1G2C B;  1GL2 C;  2J5G D;  4OWF A;  5DTW A;  3EFG A;  3KXD A;  3U9R B;  2VRE A;  2YMY A;  4ASI A;  1Q51 A;  2Y0E A;  2AXT H;  2YKP A;  1NYH A;  3L73 G;  1FZC A;  1KN7 A;  4UB6 H;  3PE8 A;  1JMM A;  3AED C;  3H32 A;  3AE5 C;  2NRG A;  1DD4 A;  1EXJ A;  3HTK B;  2FYU G;  2GUS A;  3JC2 2;  1NJI Q;  1FZF A;  4U0G H;  2AXC A;  2BCC D;  3V2Q A;  2K9J A;  5CCG C;  2ZJS E;  1NTM E;  1BCC G;  1NHL A;  1VQ7 P;  3V2R A;  3CWB E;  4B86 A;  3OT6 A;  2I8D A;  2JR8 A;  2KNC B;  2K1A A;  1IK9 A;  1L0N E;  3QWO C;  3BCC E;  4DOJ A;  2J5S A;  1SQQ G;  1Y8A A;  1Y7O A;  2P1J A;  3L74 E;  1JNM A;  4RCN A;  4JF7 A;  2YJG A;  3L70 E;  2WVR A;  1KQG B;  1RF1 B;  5AVX B;  1EF8 A;  3S1K A;  3FF6 A;  5DUC A;  5IKL B;  1N86 A;  2OYO A;  2WSE J;  3JCU H;  3VMA A;  4ZDC A;  3D71 A;  3TYY A;  2Q6Q A;  2WTB A;  1S4X A;  5AVT B;  1SQP G;  4EMP A;  1AVY A;  3TNU A;  3A7O A;  3BRT B;  3PGQ A;  2YXR B;  3R6H A;  3L71 E;  1WZ8 A;  3A3Y B;  4ASW A;  1PIX A;  5APY A;  1L4A B;  5APW A;  4FZW C;  2C0X A;  2KB7 P;  4ZNC A;  3CCS P;  1KB9 I;  4QMA A;  4JQ0 D;  3H0Q A;  2QE7 H;  2ZQR A;  3P8C E;  2QSI A;  3V2N A;  3DOR A;  4C46 A;  2X24 A;  3L74 G;  1RQV A;  2WWW A;  1FC6 A;  1PP9 G;  1OFC X;  1MFT A;  2WSE H;  2QJP B;  2KLV A;  4H0L B;  1S1C X;  1XTC C;  1IFM A;  1BSH A;  2A06 E;  3VIV A;  1Z56 A;  2RN0 A;  1M56 D;  3O6Q B;  3RL0 g;  1HGV A;  4OVN F;  2A06 D;  3LW5 J;  3G71 P;  4D6T J;  1LTB C;  2ZAE B;  1OD2 A;  3H1J J;  3EWK A;  5MGB A;  2FBW C;  2QA4 P;  5GTH H;  3T8B A;  1D7M A;  1KB9 E;  4IFM A;  3HE5 B;  3WMM 0;  3P85 A;  4D6T G;  1GL2 D;  1RH5 B;  2A06 G;  3MUD C;  1YG8 A;  2HOD A;  1P84 I;  2BZR A;  1DIP A;  1NKZ B;  4HYT B;  3M0D C;  1PJH A;  2IBZ D;  4ELS A;  1HBW A;  3KTI A;  1HGZ A;  4PV1 D;  3BVH A;  3NMD A;  1JY2 P;  2PRR A;  3KTH A;  1FC2 C;  3CCL P;  1MFZ A;  1GL2 A;  1RHZ B;  4JCT A;  2FYU J;  1Q82 Q;  1ZV8 A;  5APU A;  1L0N J;  3P32 A;  4M3L A;  3RK3 C;  3D6Y A;  2QG4 A;  1EDI A;  1XNV A;  3CWB G;  2M3B A;  4DI1 A;  1QL2 A;  5AW0 B;  5KAF E;  1KFM A;  1N7S C;  4K35 A;  3K50 A;  5INI A;  3CX5 D;  2RKL A;  3U1C A;  1N6D A;  4UB8 E;  3BRV B;  1AFO A;  2PGD A;  4H44 C;  1BE3 E;  3VYI A;  1HH0 A;  2O01 H;  2MJZ A;  5KJ7 D;  3Q0J A;  2B87 A;  3AE6 C;  4JYL A;  1OX3 A;  5CCH D;  5GTH E;  1GW3 A;  4KD6 A;  3PRJ A;  2NPS C;  3L70 J;  3CD6 P;  4Z1M H;  3TSI A;  3U59 A;  2FKW B;  1FAV A;  4D6T D;  2KUB A;  3GHG C;  1XNW A;  4OMR A;  1G1I A;  4RO0 A;  1YTZ T;  1DX7 A;  2KYV A;  1NAY A;  3ZDM A;  3L70 G;  3H0U A;  3EFF K;  4PD4 E;  3ZW9 A;  4IL6 H;  3WUT A;  3V4W A;  5K5G B;  3B5N D;  3TZ3 A;  4AUW A;  3PP5 A;  1KMI Z;  1SQV D;  1SQQ E;  3BF0 A;  1X9V A;  1UYR A;  2NPS B;  1T3J A;  4JFC A;  2YNY A;  3HP0 A;  4EI2 A;  5KLV G;  3EQ2 A;  1NTK J;  1NWQ A;  1VQK P;  4ZKU A;  3NXS A;  4JBZ A;  4I6M C;  5E0S A;  1OVU A;  1KIL A;  2XZR A;  2KZJ A;  2Q35 A;  3O8Z A;  2BCC G;  3ISA A;  3RK3 B;  1AVO A;  2FXO A;  2ZYA A;  3AE1 C;  3WU2 E;  1NU1 G;  1L0L D;  4ASV A;  1JY3 N;  1VF5 C;  4XA4 A;  2KI7 B;  5CJ0 A;  1S72 P;  4OGQ C;  2FBM A;  1LTG C;  3LKE A;  4J2U A;  3VOP A;  1BDD A;  2P7J A;  3OJA B;  1NTK D;  4IZB A;  3H1J G;  2FZS A;  1IFD A;  3R0O A;  1SQX J;  5B5E E;  4C7N A;  5KJ7 C;  1CZQ A;  2KZI A;  2JKV A;  2N1T C;  2HLO A;  4B3I A;  1SS1 A;  1SQP D;  3F5H A;  4ZU2 A;  2F9Y B;  4JSB A;  3CME P;  1FZA A;  2BAS A;  2OAR A;  2H43 A;  2QRX A;  1M57 D;  1OZH A;  1H88 A;  1YJW P;  2K88 A;  1YI2 P;  2EJ5 A;  3FGA D;  5KTB A;  1WT6 A;  5E79 H;  2P10 A;  3GHG A;  4GKG A;  5APV A;  1MZ9 A;  1GDT A;  3L75 G;  3TGU J;  2WMM A;  3H1H J;  1SQB D;  3Q5P A;  4R4L A;  2L91 A;  4AYC A;  5FUS A;  3B4S A;  1Q81 Q;  1FC9 A;  2WSC H;  1SQX D;  3Q5R A;  3QRE A;  1ZN5 A;  4WYO B;  2XV5 A;  2ZL3 A;  1SQV J;  4JWV A;  5DU4 A;  1H8A A;  3LAO A;  2F9I A;  1EZV E;  1K04 A;  2IYP A;  2P58 A;  3B5N B;  3E1R A;  2POH A;  1VL2 A;  5B66 H;  1M90 Q;  4JCR A;  4WY4 D;  4K2N A;  1DH3 A;  1FS0 E;  4OH8 B;  4FB8 A;  3JU1 A;  1QX8 A;  4TLF A;  4HJG H;  1SP4 A;  3H1I E;  3HRN A;  2Q1K A;  4CPG A;  1AQ5 A;  1VPC A;  3L73 D;  4I1L A;  3VMZ A;  1PPJ G;  2VSU C;  5AVU B;  3A0B H;  3BCC G;  3IAO A;  1FZG A;  3RBX A;  1IJD B;  5TJH A;  1BCC E;  3FWN A;  4ZKP A;  5AVW B;  1ZXG A;  3II6 A;  2OTJ P;  3D6Z A;  5CBO A;  2CK3 H;  5KLI B;  1FDM A;  4YPC A;  1QVG O;  1W2X A;  5CMZ A;  5ING A;  1WMK A;  2ZT9 B;  3GMA A;  2HOD B;  1ON3 A;  1LTT C;  3M9H A;  3PZK A;  4FNB A;  1PGQ A;  2WSF H;  5HUQ A;  2IFM A;  2PP6 A;  1EZV G;  1S5L H;  2I1K A;  1IC2 A;  3PJS K;  1K8A Q;  4Q1I A;  2M8R A;  2JO1 A;  4PJ0 E;  2QJY C;  1K9M Q;  1OVR A;  4KT0 J;  2WSF J;  3VMX A;  3HLN 1;  3RGU A;  3Q7H A;  1FOS E;  3H0S A;  5CCH A;  3L75 J;  1YQ3 C;  2KSE A;  3CL3 D;  3TGU G;  5KAI H;  1DCI A;  4PD4 H;  4BRY B;  1URQ A;  3AEA C;  1Q52 A;  5CTB A;  2J5U A;  2ZXX A;  1DEE G;  2WT7 B;  4JYB A;  1WDK A;  3HE2 A;  3V2P A;  4RES B;  3CCU P;  2DEO A;  1T3U A;  1FC7 A;  1RE4 C;  4DZO A;  2A7K A;  1VQ5 P;  1KIL E;  2IDB A;  1M7L A;  2ZYG A;  3FX0 A;  3PEA A;  5KLI C;  3FXE A;  1YQ4 C;  4MN4 C;  3L36 A;  1FZC B;  2ZL2 A;  4NPF X;  4HNK A;  1SVF A;  5APX A;  2QJY B;  1L4A C;  3HD7 D;  2BEZ F;  4ELW A;  4I2L C;  2GTR A;  4H44 D;  1NGM B;  5E79 E;  1RE3 A;  1OXZ A;  2W27 A;  1JO5 A;  1PPJ D;  3M6N A;  3L74 D;  2WSC J;  1K73 Q;  1TYF A;  1JY3 P;  3RRV A;  4KNP A;  4I7Z B;  2QIW A;  2XNX A;  1N7S A;  2FXP A;  3NJB A;  1L0N K;  2JP3 A;  3QXI A;  1QLE D;  1ZP0 C;  5CCG D;  3QWD A;  4ZDE A;  1LWU B;  1JEK A;  3SFD C;  1FCF A;  3RL0 D;  1T2K D;  5DZK A;  2XDJ A;  5APQ A;  3B5N C;  2W8Z A;  1BGY G;  1RE4 A;  4NEK A;  4LK5 A;  5C9G A;  1R5L A;  2OYH C;  3HE4 A;  3MZW B;  4ZDD A;  2NZ2 A;  2Q3I A;  3M0D A;  2K9J B;  1X79 B;  4U0H A;  1NH4 A;  1JMB A;  2WSS H;  3G6E P;  3BPT A;  2WZ7 A;  2BCC E;  3WUV A;  3I47 A;  2PBP A;  4RYF H;  4BRY A;  5BVZ A;  5JBX A;  3T89 A;  1KYO D;  1CI6 B;  5AW1 B;  2E76 B;  1A02 J;  1GD2 E;  2E74 C;  1SFC D;  5APS A;  4H0L C;  4W7Z A;  1NZY A;  3P2L A;  2HFE D;  1FDO A;  3C1L A;  1EDL A;  5KDR A;  2PG8 A;  4OGQ B;  2MKV A;  3IAV A;  5H2F H;  2V7Q J;  4BXL A;  1FZB A;  1W5C E;  2KXP B;  1PFI A;  3R2P A;  1M1J B;  3AE7 C;  1FU1 A;  4H13 C;  1SFC A;  3RK3 D;  1IO4 A;  2FXM A;  1DUB A;  3ABV C;  1X0U A;  4IL6 X;  3L72 G;  4PD4 I;  1RF0 C;  4U3F E;  4DCK A;  4ZDF A;  3V4Q A;  3CCJ P;  4A7P A;  2E75 C;  1VF5 B;  1NTM G;  2KS1 B;  5AW7 B;  2YMK A;  3L71 D;  2PAJ A;  5AW4 B;  2KOG A;  2M0B A;  2LKM A;  3LW5 H;  1ZRT D;  2Q9I A;  2D3T A;  1LTJ B;  1R5S A;  4QIJ A;  2F9Y A;  4NPD A;  3H81 A;  3CCV P;  2C0W A;  2KLU A;  3L75 D;  3IR9 A;  4EIJ A;  2WQY C;  3H1H E;  5AW3 B;  3CX5 I;  3IN6 A;  3KZI H;  4U19 A;  2KS1 A;  3ITK A;  3B5N A;  2I1J A;  3GHG B;  2N1T D;  1BGY E;  3SWK A;  4JYJ A;  5B66 E;  5KDR B;  3H32 B;  5CJ4 A;  1NO4 A;  4QII A;  3L73 J;  2NPS D;  5AW5 B;  3ZWC A;  1S5L X;  1QGK B;  3H25 A;  3IBB A;  3B71 A;  1X22 A;  2WTY A;  1LT9 B;  3VTP C;  2UZF A;  4L75 A;  4FN7 A;  1JUN A;  1USD A;  2O3J A;  1TG6 A;  2VX2 A;  3CMA P;  3CPW O;  4L6W A;  3OME A;  1LT9 C;  2W3P A;  4U3F D;  5AVY B;  4EYY Q;  2Z5H A;  3HD7 A;  1SQX G;  2Q34 A;  1SZO A;  1ZLL A;  1M1J C;  2IX7 C;  5GTI H;  3OA7 A;  1PGO A;  1MKM A;  2JDI H;  2FFD B;  3CCR P;  4JCQ A;  3GLM A;  3KQG A;  4GDO A;  1KC8 Q;  3OC7 A;  2CE3 A;  1KOR A;  3VP8 A;  3CXH E;  2QM8 A;  3I5C A;  1CW5 A;  3BEZ A;  3K8X A;  1JTH A;  3ZWB A;  2H8P D;  2R32 A;  2HPC A;  3TVW A;  3CLQ A;  5AVS B;  3A5T A;  3N6R B;  1BCC J;  1KIL D;  4HB1 A;  3KTG A;  2N9Y B;  2IPP A;  2OYH B;  3T3W A;  3FWL A;  3V5E A;  1NU1 K;  2PFX A;  3SFE C;  1R8E A;  3MOY A;  3AE2 C;  4XFJ A;  2Z4E A;  3SLL A;  1VQM P;  2AEF A;  4UB8 H;  1JCD A;  5CCH C;  4NPE A;  2ZL0 A;  1AV1 A;  3P8M C;  2GUV A;  1L0L J;  2C9N Y;  1UYT A;  1H0T A;  2X58 A;  1NOH A;  1BE3 D;  1L4A A;  2E43 A;  1N2D C;  1ZR4 A;  2XND H;  2N9B A;  3TLF A;  2IYO A;  2IBZ I;  3SWX A;  1LTJ A;  3MTU E;  1HVV A;  5AW9 B;  4I52 A;  3GW6 A;  1U57 A;  4JYC A;  5G1S A;  4WCZ A;  4WZ8 B;  1Q86 Q;  2A7S A;  3T97 A;  4JJT A;  3L71 G;  2FY8 A;  4JVT A;  1UYV A;  4RYF A;  4JOT A;  1KD1 Q;  3GG2 A;  1GK6 A;  3R9S A;  1UYS A;  3H1I J;  2QJK B;  1N73 A;  1ZME C;  1J7X A;  5AVV B;  1KYO H;  5KJP A;  5L8R J;  1HNU A;  3Q3D A;  1HNO A;  4ZMD A;  1WRG A;  2JWA A;  2JEE A;  4U3F G;  3CX5 H;  3H1I G;  3H1L J;  1UII A;  1BSN A;  3R9T A;  3VMY A;  3RL0 C;  2G8Y A;  1P84 E;  2JWD A;  1OMI A;  3MD0 A;  3BPP A;  2Y9Z A;  3FDU A;  1RF0 A;  3H1K E;  4IOI H;  1KQL A;  3N4X A;  3Q2Y A;  3MP7 B;  2YKQ A;  4GM2 A;  2N1T A;  2OTK E;  3TV5 A;  3P5M A;  1OW6 A;  3H1K D;  1RE3 C;  1SQV K;  3KHU A;  3Q1M A;  4GOF A;  1EDJ A;  1OW8 A;  3MIW A;  2HG5 D;  3RK2 C;  4KWB A;  2J5I B;  3SSU A;  4W7Y A;  1SFC C;  4B3J A;  2E76 C;  2R3C A;  4DJG A;  3H1K J;  2WPR A;  2PPY A;  2H7H A;  1GTW A;  1PGP A;  3CI9 A;  5DZK H;  3MUD A;  2F6I A;  1RY3 A;  3WU2 H;  1HWT C;  1SQQ K;  1NTK E;  2H88 C;  5M1B A;  4HH2 A;  1USE A;  1VQL P;  1P84 H;  2W6A A;  5G1R A;  2GM4 A;  4JPZ B;  1YJ9 P;  5AW2 B;  1FBM A;  1IK7 A;  1VRG A;  3HE4 B;  1PP9 J;  4K29 A;  2WT7 A;  1LWU A;  1J1D B;  2B89 A;  1SQP K;  1RJN A;  2Q7C A;  1RF1 A;  4MXI A;  3WG5 A;  1J1D C;  1LP1 B;  3M06 A;  5INF A;  3H6P A;  2BEQ D;  1LJ2 A;  1FZC C;  3CCM P;  3JCU E;  3M91 A;  1NTM D;  1Q90 D;  1HTL C;  1ZRT E;  4H13 B;  4FJW D;  4O9B A;  2RH0 A;  1PPJ E;  2FYZ A;  5DUF A;  4U1A A;  2W83 C;  1IFI A;  1RF1 C;  3L3S A;  3STA A;  3HD7 B;  3AE3 C;  1SLQ A;  2SPZ A;  1LWU C;  3TGU E;  3H1H D;  3VP9 A;  3TGU D;  1HZD A;  1L2P A;  2IBZ G;  4RJT A;  3CC7 P;  3P8C D;  3AEG C;  4KJM A;  2KK7 A;  2XU6 A;  4WY4 A;  5KAF H;  1J2J B;  3K5B A;  5AVR B;  3M9B A;  2NPS A;  1KB9 H;  2YXQ B;  3RL0 B;  2JJL A;  4L74 A;  3RBZ A;  1KQS O;  3KTK A;  2ZFC A;  5C39 A;  4PD4 D;  1Q7Y Q;  4GHN A;  3H0J A;  3HUS A;  3HD7 C;  3E7K A;  1BE3 G;  2ZT9 D;  3TT6 A;  3PTZ A;  5DU6 A;  1S2E A;  5B5E H;  1GK4 A;  2KP8 A;  3QH9 A;  2D2C D;  1EDK A;  1PV3 A;  4Y99 B;  4H44 B;  1G1J A;  1LTS C;  2ZT9 C;  3H1K G;  1DEB A;  3E1I A;  1N73 C;  2VSS F;  1IFP A;  2V7Q H;  2HW5 A;  1NTM K;  5GTI E;  3TNU B;  1HJ0 A;  2LR2 A;  1IFJ A;  1BGY D;  1JCC A;  1W2E A;  2AXT E;  5KKZ B;  2OYH A;  1EY3 A;  3BCC D;  3HUS C;  5E0S H;  5TIS H;  1XNY A;  1VQN P;  3TDC A;  5KLV J;  3MGN A;  1JXZ A;  1N7S D;  2O01 N;  2W6J H;  1SQV E;  1KYO I;  3I56 P;  4OLQ A;  2K9Y A;  1A02 F;  2FYU K;  2R44 A;  4KPK A;  2QEX P;  2AEJ A;  2WPV B;  1KZU B;  1NU1 D;  3QYR A;  1G2C A;  1XO6 A;  1JY2 N;  4YXW H;  1AA0 A;  2W90 A;  2IFN A;  2K37 A;  3V5I A;  1S3J A;  3C9I A;  2M5A A;  1OWA A;  2O01 J;  2J5I I;  1U7J A;  5CCG A;  1HJB A;  1CI6 A;  2Y0D A;  4N6J A;  4N78 D;  1SQV G;  3CXH I;  3HRX A;  5AW6 B;  1OD4 A;  3T8A A;  2GA1 A;  3BAS A;  1MUU A;  2CPS A;  2OTL P;  2Y9Y A;  4U18 A;  3HUS B;  4ELX A;  2IBZ E;  2ZL4 A;  2AEM A;  4BWN A;  3SWF A;  2E5Y A;  1AQT A;  1S9K D;  3D70 A;  1VQO P;  1K32 A;  4NNQ A;  3LIE A;  1X0T A;  1TU3 F;  2FFD C;  3QK8 A;  1KV4 A;  1UIX A;  4K3A A;  1VQ8 P;  1L0L G;  3TF5 A;  1K05 A;  3OAK A;  4DT0 A;  1XTG B;  2QJK C;  1JOC A;  2HR3 A;  1KQF B;  4D6T E;  3KDP B;  2LXC B;  4MOU A;  1N8R Q;  2ZXE B;  2QJP C;  1KIL C;  2W6B A;  3USS A;  1NTK G;  3CC2 P;  1N6E A;  2CBY A;  2Z5I A;  1MJ3 A;  3ZWA A;  2OYI B;  3RK3 E;  1T8Z A;  5H2F E;  2ITA A;  1NU1 E;  4KHX A;  4N3Y B;  1FZE A;  5DL1 A;  2FYU E;  2QVA A;  3H1I D;  1L0N D;  2G3A A;  1M1J A;  2Q5U A;  2FYU D;  3CWB J;  3CX5 E;  2IZ1 A;  2VSU A;  3SWY A;  1ZW0 A;  3M0A A;  1QEX A;  1JB0 J;  2DW3 A;  2KNC A;  1NU1 J;  4HC8 A;  1EXI A;  5DJT B;  4ZDB A;  1VF5 D;  4N78 E;  5BU8 B;  1YBK A;  4FN8 A;  1ZOY C;  3BAT A;  2YIU B;  3L72 E;  3H1L G;  3Q0G A;  3HE5 A;  1BE3 J;  3OW2 O;  1WDL A;  3BCC J;  1SQX K;  2YKO A;  3U9T B;  1S9K E;  1ZR2 A;  5KKZ C;  5TIS E;  1YYC A;  4EMM A;  3H1L E;  3KPE A;  1DD3 A;  2M5A B;  4U7J A;  3T88 A;  1YTZ I;  3MFM A;  1HUC A;  4GOE A;  1NAF A;  1SFC B;  3AE9 C;  3TT7 A;  1NTZ E;  2P2U A;  1T2K C;  5G1Q A;  3L4F A;  3ST9 A;  1M8O B;  2VSS A;  2QM7 A;  2ZVO B;  2E42 A;  1PGJ A;  1IFN A;  3CWB D;  4OGQ D;  4U0G A;  2D2C B;  2HYN A;  3LID A;  4I4Z A;  3UIA A;  4LGD E;  1GU4 A;  1EF9 A;  1O8U A;  4HDT A;  4C7R A;  2YO2 A;  3NJD A;  2K3R A;  1NKN A;  5KLV E;  5DTP A;  1SQB G;  4L73 A;  1U7M A;  1H0T B;  4WBA A;  1PP9 E;  3KTJ A;  1YHQ P;  1YIT P;  1GMJ A;  1OVV A;  4U3F J;  3G9R A;  2H89 C;  3L72 D;  2N1T B;  3CXH H;  1BDC A;  2J58 A;  1H89 A;  1SQB J;  1NTK K;  1W2B O;  2WPS A;  2NP9 A;  4FZW A;  4XE5 B;  3AEC C;  3NFQ A;  2E76 D;  5CBN A;  2R5B A;  3P7K A;  3T97 B;  3B8E B;  1NZY B;  2C9L Y;  3H1J E;  4OG1 A;  1PZQ A;  1SQQ J;  3H1J D;  1YJN P;  3M6M A;  1SQB E;  3CC4 P;  1SQP J;  1RJM A;  3NTN A;  3V6I A;  1N7S B;  1S5L E;  2D2C C;  3H1H G;  1FE6 A;  1OW7 A;  2B9B A;  2VRS A;  3RST A;  1X8Y A;  4PV1 B;  4H0L D;  3HIN A;  4IFD K;  3N7N A;  3L74 J;  4Y28 J;  1JY2 O;  5C90 A;  2FFD A;  1E5W A;  4LLH A;  2QQ3 A;  3U9S B;  4PV1 C;  3RK2 B;  3F89 A;  1KB9 D;  1XX4 A;  1L0L K;  2C8T A;  5KLV D;  4QFE A;  3L71 J;  2RMZ A;  1UIY A;  1PL5 A;  1BGY J;  2R5D A;  4PJ0 H;  3PLN A;  1PP9 D;  3QMJ A;  1GZL A;  4WB4 A;  4JCS A;  1SG4 A;  4FND A;  1LT9 A;  2E74 D;  3W67 A;  3WUU A;  5KAI E;  2E5T A;  3R4Y A;  3TVU A;  3Q1T A;  4F47 A;  1QVF O;  3G4S P;  3IF4 A;  4K3W A;  4WY4 B;  3M9Q A;  1Q2N A;  1N6F A;  3JSV C;  1YG6 A;  1SQB K;  2E75 D;  1FDI A;  1VQ6 P;  2A45 H;  3QKA A;  3A2A A;  3RK2 D;  4HKZ H;  3C8V A;  4H13 D;  4RKU J;  4EML A;  3KZI E;  4WY4 C;  2WIT A;  2IEX A;  1OIP A;  3PH0 A;  1LNQ A;  5AVZ B;  3GF7 A;  3A0B E;  1VQP P;  1KFN A;  1Y9B A;  1K39 A;  2HPC B;  4GOD A;  4YXD C;  3MHV A;  1GW4 A;  1YIJ P;  3H1L D;  2LXB A;  1URQ C;  1SQQ D;  4L8K A;  4TT3 H;  1MV8 A;  4R4M A;  5FIF A;  3GKB A;  1FJP A;  4G2R A;  1FOS F;  2E75 B;  2J5G A;  5KLV K;  4NAR A;  2ZYD A;  5KJ7 A;  2B87 B;  1J1E B;  1AJY A;  1ON9 A;  3AEB C;  2YIU C;  2IZ0 A;  3IFM A;  3DJA A; 
#chains in the Genus database with same CATH homology
 3G64 A;  4YLH A;  2F6Q A;  2D2C D;  3T89 A;  5JBX A;  3Q5S A;  1PV3 A;  4MI2 A;  3K50 A;  4H44 B;  5INI A;  2E76 B;  2ZT9 C;  1N6D A;  2VSS F;  2Q2X A;  2HW5 A;  2E74 C;  1HJ0 A;  4H44 C;  4H0L C;  1NZY A;  3P2L A;  1FDO A;  1EY3 A;  3S9O A;  5E0S H;  1XNY A;  3TDC A;  1JXZ A;  3Q0J A;  4OLQ A;  3AE6 C;  4JYL A;  5KDR A;  2PG8 A;  2OQQ A;  5DKP A;  4OGQ B;  2MKV A;  2E74 B;  2K9Y A;  3IAV A;  4KD6 A;  2V7Q J;  5E0N X;  4KPK A;  4Z1M H;  2WPV B;  3AE7 C;  4H13 C;  3KQF A;  4YTP C;  5JBW A;  3QYR A;  1DUB A;  3ABV C;  2VSS E;  1X0U A;  1XNW A;  1XO6 A;  4IL6 X;  4OMR A;  4ZDF A;  1RQU A;  2F9I B;  2E75 C;  1VF5 B;  3H0U A;  2YMK A;  2FYN C;  3ZW9 A;  3V5I A;  3TZ3 A;  2ZQQ A;  2O01 J;  2J5I I;  1KMI Z;  3BF0 A;  2D3T A;  1UYR A;  4QIJ A;  2FW2 A;  3HRX A;  1OD4 A;  3T8A A;  4Q0G A;  2F9Y A;  4JFC A;  3RSI A;  3HP0 A;  3H81 A;  4Z0M A;  3MT6 A;  3IB9 A;  3AEF C;  4U18 A;  4ELX A;  5CTC A;  5E0S A;  2ZL4 A;  2WQY C;  3O6Q A;  3IN6 A;  4U19 A;  2Q35 A;  3D70 A;  3MYB A;  5KDR B;  4JYJ A;  3GF3 A;  3ISA A;  4NNQ A;  1K32 A;  3AE1 C;  4QII A;  1TU3 F;  3QK8 A;  1VF5 C;  3ZWC A;  1UIX A;  1HF9 A;  1S5L X;  4I7Z C;  1K05 A;  2VSU F;  4OGQ C;  2FBM A;  2J5I A;  2QJK C;  3LKE A;  1KTM A;  3H25 A;  4J2U A;  1KQF B;  2VSU E;  3IBB A;  4MOU A;  3H02 A;  3B71 A;  3QXZ A;  3TRR A;  2QJP C;  4IZB A;  5DU8 A;  2UZF A;  1N6E A;  2CBY A;  4FN7 A;  2FZS A;  1MJ3 A;  3ZWA A;  1TG6 A;  3R0O A;  3RK3 E;  2VX2 A;  2A81 A;  5DL1 A;  4L6W A;  3OME A;  4B3H A;  2G3A A;  2W3P A;  4B3I A;  4ZU2 A;  3AEE C;  2Q34 A;  1SZO A;  2F9Y B;  4JSB A;  2VSU A;  1MKM A;  4JCQ A;  3AE8 C;  2DUB A;  3GLM A;  1JB0 J;  4I42 A;  4GDO A;  2EJ5 A;  4HC8 A;  1EXI A;  3FGA D;  2CE3 A;  3OC7 A;  4ZDB A;  1KOR A;  2P10 A;  3ZW8 A;  1VF5 D;  3BEZ A;  4FN8 A;  4IZC A;  3K8X A;  4IZD A;  1ZOY C;  3ZWB A;  3Q5P A;  1WDM A;  3Q0G A;  3TVW A;  3R9Q A;  4R4L A;  3AE4 C;  5FUS A;  1FC9 A;  1WDL A;  3Q5R A;  3QRE A;  2J5G D;  3N6R B;  4WYO B;  2ZL3 A;  5DTW A;  3U9T B;  5KKZ C;  3U9R B;  4JWV A;  2VRE A;  5DU4 A;  3KTG A;  4ASI A;  3LAO A;  2F9I A;  3T3W A;  3V5E A;  1K04 A;  1Q51 A;  1R8E A;  3SFE C;  4EMM A;  3MOY A;  1DD3 A;  3AE2 C;  4XFJ A;  1VL2 A;  4U7J A;  1NYH A;  3PE8 A;  3T88 A;  3SLL A;  3AED C;  3AE5 C;  3MFM A;  1DD4 A;  1EXJ A;  4JCR A;  4K2N A;  3AE9 C;  3TT7 A;  4FB8 A;  2ZL0 A;  3JU1 A;  4U0G H;  5G1Q A;  3ST9 A;  2VSS A;  4OGQ D;  4U0G A;  2D2C B;  2VSU C;  1UYT A;  4I4Z A;  3IAO A;  3OT6 A;  2X58 A;  1EF9 A;  1O8U A;  4HDT A;  2J5S A;  3TLF A;  3NJD A;  1Y7O A;  3SWX A;  4RCN A;  3D6Z A;  2YJG A;  4I52 A;  1W2X A;  5ING A;  1WMK A;  1U57 A;  5G1S A;  1KQG B;  5DTP A;  4WCZ A;  4WZ8 B;  2A7S A;  2ZT9 B;  3GMA A;  1EF8 A;  4JJT A;  3FF6 A;  5DUC A;  5IKL B;  1ON3 A;  3KTJ A;  1UYV A;  3PZK A;  4JVT A;  4RYF A;  2WSE J;  1GMJ A;  4FNB A;  4JOT A;  4ZDC A;  3G9R A;  2H89 C;  5HUQ A;  3R9S A;  3D71 A;  1UYS A;  1ZME C;  1J7X A;  4Q1I A;  2JO1 A;  5KJP A;  5L8R J;  1HNU A;  2WTB A;  2NP9 A;  3Q3D A;  1HNO A;  2QJY C;  4FZW A;  4EMP A;  3AEC C;  2E76 D;  4KT0 J;  2WSF J;  3R9T A;  3HLN 1;  3T97 B;  3Q7H A;  3H0S A;  3PGQ A;  2G8Y A;  1NZY B;  3R6H A;  4OG1 A;  1WZ8 A;  1OMI A;  3BPP A;  1YQ3 C;  3FDU A;  1DCI A;  1PIX A;  3Q2Y A;  3M6M A;  4FZW C;  1RJM A;  4GM2 A;  3TV5 A;  3P5M A;  1OW6 A;  3AEA C;  2D2C C;  1Q52 A;  5CTB A;  3Q1M A;  2J5U A;  1OW7 A;  1OW8 A;  3RST A;  4PV1 B;  4H0L D;  3H0Q A;  4KWB A;  3HIN A;  2J5I B;  1WDK A;  2ZQR A;  3HE2 A;  2E76 C;  4B3J A;  4Y28 J;  2QSI A;  2DEO A;  2PPY A;  5C90 A;  1FC7 A;  3DOR A;  2A7K A;  5DZK H;  2QQ3 A;  1KIL E;  2F6I A;  2X24 A;  2IDB A;  3U9S B;  1RQV A;  4PV1 C;  1FC6 A;  2H88 C;  5M1B A;  3PEA A;  5KLI C;  1YQ4 C;  5G1R A;  1XX4 A;  2C8T A;  2ZL2 A;  4QFE A;  4HNK A;  1IK7 A;  1VRG A;  1UIY A;  4K29 A;  4H0L B;  1PL5 A;  1S1C X;  1RJN A;  2BEZ F;  3QMJ A;  4ELW A;  2GTR A;  4MXI A;  3WG5 A;  4JCS A;  1SG4 A;  4H44 D;  1NGM B;  4FND A;  3VIV A;  2E74 D;  5INF A;  2BEQ D;  3RL0 g;  3LW5 J;  3M6N A;  3R4Y A;  3TVU A;  2WSC J;  3Q1T A;  1Q90 D;  1TYF A;  4H13 B;  1ZRT E;  4F47 A;  3RRV A;  4FJW D;  4K3W A;  1OD2 A;  4KNP A;  3EWK A;  4I7Z B;  1N6F A;  2QIW A;  5MGB A;  2FBW C;  2FXP A;  1YG6 A;  4U1A A;  5DUF A;  3NJB A;  2E75 D;  3L3S A;  3T8B A;  2JP3 A;  3QXI A;  3STA A;  1ZP0 C;  3P85 A;  3AE3 C;  3QWD A;  4ZDE A;  1FDI A;  3QKA A;  3SFD C;  1FCF A;  1YG8 A;  3C8V A;  1HZD A;  2BZR A;  4H13 D;  4RKU J;  4EML A;  1DIP A;  5DZK A;  2IEX A;  1PJH A;  3AEG C;  4ELS A;  3GF7 A;  3KTI A;  4PV1 D;  1Y9B A;  4NEK A;  4LK5 A;  1K39 A;  5C9G A;  4YXD C;  3KTH A;  4JCT A;  4ZDD A;  2NZ2 A;  4L8K A;  4TT3 H;  3KTK A;  4GHN A;  4R4M A;  3H0J A;  5FIF A;  3GKB A;  2ZT9 D;  4U0H A;  4G2R A;  3TT6 A;  2E75 B;  2J5G A;  4NAR A;  3D6Y A;  3BPT A;  3I47 A;  2PBP A;  1AJY A;  1ON9 A;  3AEB C;  2YIU C;  5DU6 A;  1XNV A;  4RYF H;  4DI1 A;  3DJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...