3GF3A

Glutaconyl-coa decarboxylase a subunit from clostridium symbiosum co-crystallized with glutaconyl-coa
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
585
structure length
563
Chain Sequence
MYSMPGYFQNMPTIGKELVNPNPENEQEIKAVESDIHESIKKALDAGITSEEKLNERGQLSAMQRINALIDPGTWCPLNSLFNPENNKFGTTNIVNGLGRVDGKWVYIVASDNKKMAGAWVPGQAENLIRCSDAAKMMHLPLIYLLNCSGVEFPNQDKVYPNRRGGGTPFFRNSELNQLGIPVIVGIYGTNPAGGGYHSISPTILIAHQDANMAVGGAGAEQIIAAQIENSKLKVPAPGSVPIHYDETGFFREVYQNDLGVIDGIKKYISYLPAYNLEFFRVDTPKAPQLPAEDLYSIIPMNQKRPYDIYEVIARLFDNSEFSEYKKGYGPEMVTGLAKVNGLLVGVIANVQGLLMNYPEYKQNSVGIGGKLYRQGLIKMNEFVTLCARDRIPLIWLQDTTGIDVGDEAEKAELLGLGQSLIYSIENSKLPSLEITIRKASAAAHYVLGGPQGNNTNVFSIGTGACEYYVMPGETAANAMYSRKLVKAQPIIGKMNDMIQMYTDKSRPKYCTEKGMVDEIVDMTEVRPYIQAFTEAAYQNPQSICPMHQMLTPRSTREFETFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title An asymmetric model for Na+-translocating glutaconyl-CoA decarboxylases
pubmed doi rcsb
source organism Clostridium symbiosum
molecule tags Lyase
molecule keywords Glutaconyl-CoA decarboxylase subunit A
total genus 210
structure length 563
sequence length 585
ec nomenclature ec 4.1.1.70: Transferred entry: 7.2.4.5.
pdb deposition date 2009-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.680 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Helix bin 3gf3A01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3gf3A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3gf3A03
3H0SA 3QREA 2J5II 3I47A 4Z0MA 1YG6A 3PZKA 4B3JA 3QXZA 3H81A 1N6DA 2IEXA 4GHNA 4MOUA 4K3WA 5JBXA 4FB8A 4DI1A 3G64A 3SWXA 3TT7A 1MJ3A 3LAOA 4KPKA 3T88A 4I42A 1PJHA 4ZDCA 2ZL3A 4K29A 1NZYB 2PPYA 5DUFA 3PEAA 3T89A 4FNBA 5FUSA 5DU6A 4NNQA 5KJPA 1UYVA 4JCQA 5INFA 3T3WA 2VSUC 2NP9A 4JSBA 3KTHA 3HLN1 4QIJA 4EMLA 1K32A 1FC7A 2J5IA 5DU8A 4G2RA 1VRGA 2VSSF 2FZSA 4ZDFA 4LK5A 3QWDA 1FCFA 1RJNA 1ON9A 3Q1TA 5E0SH 1W2XA 2C8TA 4U0GA 2D3TA 3ST9A 3KQFA 3P85A 3HE2A 2PG8A 3IBBA 3ZWBA 5FIFA 3GKBA 2F9IB 3ISAA 4K2NA 3U9RB 1RJMA 4RCNA 1YG8A 3ZW9A 2GTRA 1JXZA 3TLFA 1WDMA 4MXIA 5DU4A 5DTWA 1UYSA 2ZL2A 3FF6A 4B3IA 3MOYA 1FC9A 1HZDA 3KTGA 3JU1A 1X0UA 3DJAA 4KNPA 5KDRB 4KD6A 2VSSE 1HNOA 3ZW8A 5KDRA 3DORA 3M6NA 1XX4A 2BZRA 1J7XA 1XNYA 3P5MA 2X58A 4Q1IA 1SG4A 2FW2A 3Q7HA 4FZWA 3QMJA 4U18A 3QKAA 2FBMA 4ZDEA 4ELXA 3N6RB 3RRVA 3WG5A 1Y7OA 1OD4A 4ZU2A 3BPPA 2F9YB 4IZDA 2VSSA 4ASIA 3L3SA 3M6MA 4OG1A 3TRRA 4FN8A 3VIVA 1K39A 1NZYA 2VSUA 3TV5A 3STAA 4EMPA 3TVUA 1EY3A 4FJWD 3R6HA 3HRXA 4QFEA 3R0OA 5E0SA 3PE8A 5DZKA 1XNVA 2EJ5A 5INIA 3V5IA 1FC6A 3HINA 4WCZA 3R9TA 4IZCA 3GLMA 4ELWA 4JWVA 2J5GA 2CE3A 4U0GH 2QQ3A 4JCSA 4HC8A 4JYLA 5G1RA 2UZFA 3K50A 5C9GA 4FZWC 4IZBA 2X24A 3KTKA 3TDCA 4FNDA 1WDLA 3KTJA 3GF3A 4JCRA 3TZ3A 2W3PA 2F9YA 1O8UA 5JBWA 3K8XA 3QK8A 5CTCA 4GM2A 1UYTA 5DL1A 3NJDA 3MFMA 3Q0GA 3P2LA 1EF9A 3QXIA 5DTPA 2CBYA 1WDKA 4RYFA 1ON3A 4WZ8B 2VREA 5E0NX 3FDUA 4U0HA 1TYFA 3T8BA 2J5SA 1OD2A 3MT6A 5DZKH 3PGQA 3ZWCA 3Q0JA 5G1QA 1XNWA 1N6EA 4ZDDA 2Q35A 2J5IB 2Q2XA 3R9QA 1DCIA 4OLQA 4QIIA 3TVWA 4RYFH 2VSUF 4JVTA 3HP0A 4U1AA 4FN7A 5G1SA 4NEKA 2F9IA 1WZ8A 2A7SA 4F47A 2A7KA 5MGBA 2WTBA 2A81A 2F6QA 3R9SA 1HNUA 4JCTA 3U9TB 4ZDBA 3T8AA 2VX2A 2ZQQA 2PBPA 3MYBA 4I52A 3IAVA 3NJBA 3V5EA 1UIYA 5DKPA 1EF8A 3RSTA 3SLLA 1Q51A 2J5GD 1XO6A 2DUBA 4B3HA 1PIXA 4Q0GA 3H0JA 4JFCA 3TT6A 5DUCA 2ZL0A 2VSUE 4U19A 3H0QA 4EMMA 5INGA 1DUBA 4JOTA 4ELSA 2DEOA 5C90A 2HW5A 4HNKA 3OT6A 4JJTA 1TG6A 5IKLB 3KTIA 1Q52A 3U9SB 3LKEA 3OMEA 2ZL4A 3ZWAA 3RSIA 2ZQRA 4L8KA 3BF0A 4OMRA 3IB9A 4YLHA 2F6IA 3BEZA 3OC7A 1N6FA 5CTBA 3GMAA 3H02A 4I4ZA 4WYOB 4L6WA 4KWBA 1SZOA 3H0UA 3QYRA 2Q34A 4JYJA 4MI2A 1UYRA 3GF7A
chains in the Genus database with same CATH superfamily
2HYNA 2J5II 2K88A 4Z0MA 3HE5A 3VTPC 2XDJA 3L71J 1NAFA 3PZKA 5KJ7A 3KZIE 4I7ZB 1AVOA 1HTLC 2IEXA 3AEGC 4MOUA 3H1LJ 1H88A 2KOGA 5APXA 5C39A 2QJKB 2BEZF 1P84D 5M1BA 2BEQD 3G64A 4XE5B 3L73J 3L74E 4ZMDA 5CMZA 1NU1E 1SQXG 3CXHH 3LAOA 4KPKA 1IFPA 2XNDH 1PJHA 2JWAA 5KAIH 4O9BA 3H32A 3H1IE 1PP9G 5B66H 5DUFA 2J5UA 1FOSE 1RQUA 4IL6H 3T89A 2R3SA 1LT9B 3KDPB 1J2JB 1UYVA 3H1KE 5B5EE 5INFA 2AXCA 2VSUC 1SQXK 4UB8E 2R3CA 4BWNA 5AW3B 1FBMA 1BDCA 3CCJP 3HLN1 1DIPA 1RE3C 2FYNC 3FXEA 3MD0A 4NPDA 2Q6QA 4GDOA 1SS1A 1RJNA 4PD4I 2FYUK 1W2XA 2HODA 1Z56A 2Z4EA 3UIAA 2A06G 1T3UA 2FYUD 1NTKD 2Q3EA 3L72G 3HE2A 2WPVB 3U59A 4U3FE 3D6ZA 1L4AB 1KN7A 2W83C 3ZWBA 5FIFA 3L70J 2OYIC 2Y0EA 2AXTE 1JO5A 3OA7A 4RKUJ 2POHA 4M3LA 3ZW9A 2PAJA 3TLFA 4JBZA 1VQ4P 2YIUC 4MXIA 1SQXD 5DU4A 4KT0J 1UYSA 2ZL2A 5CJ0A 2E75D 3PJSK 3CPWO 1IK7A 1LJ2A 1HZDA 1CW5A 4R4MA 1S4XA 2IFMA 1FDIA 2Q9IA 1L0LK 2RKLA 1JMMA 3DORA 3BPTA 5AVTB 2QJKC 4L73A 3P5MA 2H8PD 3S9OA 1QVFO 2B87B 1UIXA 5BU5A 4A7PA 2FKWB 4OGQC 2K9JB 1SQPD 3V2QA 3G4SP 1BGYE 1EQ7A 3Q3DA 1KYOI 4I2LC 3LW5J 1LWUB 1S5LX 4ELXA 1OMIA 2PGDA 1OW7A 2I1KA 2W6AA 1YHQP 3N6RB 2HLOA 1KMIZ 2YO3A 3M9HA 4GOFA 3L3SA 1J1DB 1KYOD 1T3JA 4FN8A 2KS1B 1NZYA 1EZVG 1U7JA 4H0LC 3V6IA 2R32A 4EOTA 2K1AA 3HRXA 1MUUA 2QVAA 4L76A 1L0LJ 4UB6H 2IX7C 1AJYA 1WMKA 3TK1A 1L2PA 3HE4A 4ZKPA 3R9TA 1NTMJ 1IFDA 5KJ7C 3MP7B 3G6EP 1YI2P 3R4YA 1FZFA 3A0HE 5KLIC 2RH0A 2NPSD 3HE5B 3CCQP 5AW0B 4U0GH 3MIWA 1EZVD 2Q1KA 2QG4A 1GU4A 3TGUG 5APUA 1AQTA 1KILB 3KZIH 3MGNA 1E5WA 4IZBA 4L75A 2X24A 1VF5D 3H1ID 1L4AA 2NPSC 1M90Q 4FNDA 3FWNA 2N1TA 3P8MC 1IFJA 3GF3A 1RH5B 3TZ3A 1LTTC 5B5EH 2F9YA 1KB9D 5JBWA 1FZGA 1LTJC 1SQXJ 3MFMA 2B88A 1CI6B 1ZR2A 3T97A 2YMYA 3FGAD 1RF1A 1ON3A 4WZ8B 3B5NC 2FBWC 4Y99C 3D71A 3MZWB 3RL0C 2J5SA 5KKZB 1EZVI 2FFDC 3GHGB 1SFCB 2IBZG 4DOJA 5H2FH 2OYOA 2FFDB 1LTJA 4NPFX 1IFNA 1LTSC 4DJGA 2XU6A 2M5AB 5AW5B 2Q35A 1NKNA 1DCIA 1SQPE 3B5ND 1JNMA 1UIIA 1FS0E 4RYFH 2MJZA 2H88C 1NTZG 1JY2P 1CSBA 5CCHD 1D7MA 1X22A 4FN7A 5KLVJ 2F9IA 1WZ8A 2O3JA 2A7KA 5MGBA 4C7RA 2F6QA 5GTIH 3AECC 3CXHI 4WVZA 5H2FE 1HNUA 4JCTA 4EIJA 3CXHE 3TGUD 1GK4A 3H1KJ 1KV4A 4H44C 3CCUP 5CHXA 5APVA 5CCHC 1SQVJ 4PJ0E 2PBPA 4K3AA 4I52A 1NU1K 4OH8B 2O01J 2Y9ZA 5DKPA 1HGVA 3PLNA 2LR2A 3SLLA 3HUSC 2NPSA 1KB9H 2E76B 3CWBD 2DUBA 3H1KG 4Q0GA 1LTGC 3H0JA 2WT7A 1HGZA 1FZEA 3TT6A 2ZYDA 3HD7A 2ZVOB 3A3YB 1BGYD 3P8CE 1MFTA 5CCGD 2Q5UA 3W68A 1GW4A 2QM7A 5C90A 1KILA 3H1JD 1PPJE 2WSFH 1NKZB 3H1LG 2P67A 1N73A 2HW5A 1EXIA 2E74D 2A45H 3Q5SA 1TG6A 3NFQA 2GUVA 1Q52A 3LKEA 2ZL4A 3RSIA 3AEFC 2R5BA 1N2DC 3BF0A 3IB9A 4UB6E 2F6IA 3VMZA 1HJ0A 4PD4E 5CTBA 3LIEA 3U1CA 2IYOA 1KC8Q 3GHGC 3PHLA 3H02A 4I4ZA 2VRSA 3B5NA 4WYOB 4H13C 3RK3B 2B89A 2OYIB 2E43A 4BRYB 1G2CB 3B8EB 5GTHE 2BCCE 3S1KA 3H0SA 1NTZE 3I47A 1YG6A 1R8EA 3CX5E 3R2PA 3WU2H 3QXZA 3H81A 1N6DA 1URQC 4GHNA 4H13D 5JBXA 4FB8A 3RK2B 3H1HE 2WT7B 5EFWB 3Q5RA 2YJGA 1ZOYC 1HJBA 2FYUJ 4JF7A 1S1CX 3SWXA 1RF1C 3Q5PA 1KFMA 3W67A 1URQD 4NPEA 1E79H 4ZDCA 4IOIH 2R5DA 2ZL3A 4K29A 1ZP0C 1HBWA 3VOPA 3VP9A 5KKZC 1JUNA 1KILE 1S9KD 1JY3N 4FNBA 1HVVA 1YQ4C 4NNQA 1QX8A 2KNCB 3A7OA 3HD7D 3H25A 2E74C 1YJ9P 2NP9A 1OVUA 2Y9YA 3MTUE 3D6YA 2JWDA 4EMLA 1IFIA 3E7KA 2J5IA 5L8RJ 1LWUA 1OW8A 1VRGA 2WWWA 4ZDFA 3A2AA 1FCFA 3V4WA 3Q1TA 5E0SH 1YTZT 1MKMA 1L0LG 1NTME 2JEEA 3CI9A 2FFDA 2WSCH 1EDIA 1KQSO 4Z1MH 3Q1MA 2D2CC 4DT0A 1VQ7P 2PG8A 3L73D 3IFMA 5AVQB 2CPBA 4NARA 1SQVK 4JPZB 4ASVA 2F9IB 3ISAA 1YYCA 4WY4C 1RJMA 4RCNA 1DEBA 4TLFA 1WDMA 3L75E 1YJNP 3BCCG 3TDKA 1L0LD 1L0NG 2WPRA 1X0UA 3DJAA 4KNPA 3RBZA 5KLIB 1N8RQ 3WU2E 2P7JA 1NU1J 1WRGA 2KB7P 2QM8A 1KZUB 1JB0J 3WUTA 1T2KD 3M6NA 3A0BE 3BCCJ 2BZRA 3AE3C 1J7XA 2A06D 1LTIC 3VN0A 3SWYA 1DX7A 4FZWA 1G1JA 1N7LA 1SFCA 4U18A 1PPJD 2YMKA 1OIPA 1T8ZA 3HUSA 3QKAA 4ZKUA 4WBAA 3JCUH 1FZCB 3L73E 2FBMA 2OQQA 2E75C 5KAFH 1NTKJ 5AW1B 1NHLA 1NTKK 3IAOA 3RRVA 1LTAC 1RE3A 5APQA 1Y8AA 2F9YB 3T97B 4IZDA 1QEXA 4ASIA 3M6MA 2V4HA 1SQPG 2M8RA 3AE7C 2O1JA 2W8ZA 4B86A 3VIVA 1K39A 3LIDA 3CWBG 4IFFA 3HD7C 2VSUA 3TV5A 3STAA 4FJWD 4QFEA 1VQKP 3F5HA 1NYHA 5APYA 3EFGA 1QLED 2K9YA 1KTMA 2WSEJ 4GT1A 1M1JA 1JY2O 2HODB 3GLMA 1ZRTE 4JWVA 2J5GA 1BCCG 1L4AD 5AVWB 1X79B 3BVHA 4JYLA 2IFNA 3MUDA 3GHGA 5KLVD 4WY4B 2UZFA 4FZWC 2IDBA 4JYBA 1VQPP 1RY3A 2FYNB 4DZOA 3TDCA 4PV1D 2M0BA 1ZR4A 3GW6A 1NTZD 2W3PA 2XZRA 3L36A 2W6JH 1UYTA 4TT3H 2YKOA 5APSA 3Q0GA 2E5TA 1BCCE 3QXIA 4LC1A 1RE4C 1WDKA 3BRTB 3NXSA 4RYFA 2LKMA 3FDUA 1HWTC 1BE3G 2KLVA 3ZWCA 2KI7B 3F89A 1VF5C 1HH0A 2JO1A 1M56D 1M7LA 5G1QA 1NTMD 4AQRD 1FC2C 2KZIA 3H1HJ 4QMAA 2N9BA 1M1JB 1U57A 3AEAC 3H1JJ 1GL2C 3O6QA 3N7NA 1MV8A 2QJYC 4JVTA 3RK3D 3CCVP 1LNQA 4NEKA 3TNUB 3NTNA 2NZ2A 2WVRA 1DD4A 5APWA 2WTBA 2JDIH 3R9SA 2QJYB 4AUWA 3H1JG 3U9TB 2D2CD 3L75D 3AEBC 3IR9A 5AW6B 1OFCX 2ZQQA 2I1JA 2E42A 2HPCA 1U7MA 2LXBA 1SQBE 2J58A 1SQXE 2KZJA 3V5BA 3V5EA 1UIYA 3CCSP 1G1IA 3WUVA 3RSTA 1G2CA 2GUSA 1KB9I 1PGQA 3II6A 3H1JE 1PIXA 1FU1A 2DW3A 3L70E 2Q3IA 1K04A 2ZAEB 4GIFA 4U7JA 2ITAA 2YKQA 5DUCA 2ZL0A 5KLVE 2VSUE 2UWJE 1AQ5A 1DUBA 4JOTA 1HUCA 1FJKA 2WZ7A 3TGUE 1VQ5P 1JTHA 4H44D 1IK9A 1NJIQ 1USEA 1GDTA 3NMDA 2Y0CA 3CX5H 1HF9A 2V7QH 1GW3A 1K8AQ 4OMRA 4YLHA 2ZJSE 3OC7A 3B4SA 1NTMG 4YXWH 3M0DA 1K05A 4GODA 2O1KA 2WPSA 4C46A 3L74J 4WB4A 1VQ6P 4L6WA 2E5YA 1SZOA 3AE2C 3L75G 2Q34A 2IZ0A 1UYRA 3GF7A 3P32A 3CWBJ 3QREA 1KYOH 2FYZA 1L0NK 2AEJA 1OWAA 1RF0C 1R5SA 2FYUG 5CCHA 1H0TA 5AW2B 3PRJA 2K3RA 1VDFA 4PV1B 3L4FA 4K3WA 4XFJA 1Q2NA 1BGYJ 1PP9E 2BCCG 3O6QB 2G8YA 3RL0B 3VP8A 1M57D 1NU1G 1N73B 2RN0A 2R44A 2IBZI 4I42A 1J1EB 2QJPB 4D6TJ 1JCCA 2N9YB 2YO2A 2OGUA 2ZT9D 3V2PA 5AVZB 2PPYA 2N1TD 1NVOA 2M3BA 2P58A 1KB9E 2KSJA 3CC4P 5KLVK 5FUSA 3IF4A 5DU6A 3CMAP 4EI2A 3A0HH 3CXHD 3AE1C 2KP8A 3T3WA 1ZN5A 3L72D 5DJUB 3WMM0 1H89A 1IO4A 1KILD 1S9KE 2H43A 4JSBA 2KYVA 3KTHA 3CX5I 1RF1B 2YXRB 2O01N 1LGHB 2NPSB 1K32A 5DU8A 2VSSF 1PP9D 2Z5IA 4IFMA 3PTZA 3QWDA 1FAVA 1BE3J 1KILC 2D3TA 3B71A 3G3ZA 3ST9A 3KQFA 3P85A 1S5LH 5GTHH 3L71G 3IBBA 2FY8A 2ZXXA 4N3YB 3KPEA 1NTMK 2BCCD 3GKBA 3U9RB 4IL6E 2KNCA 1L0NE 2GTRA 1YIJP 1BCCJ 2GA1A 3USSA 1JXZA 3CC2P 2A06E 3VYIA 5KTBA 1GL2A 1FC9A 4JYCA 3KTGA 2E75B 2XV5A 4I6MC 5KDRB 5CBOA 2VSSE 2KXPB 3ZW8A 2FXPA 5KDRA 1BSHA 1LP1B 3HRNA 5AVXB 5CJ4A 1Q90D 4Q1IA 1NAYA 4C7NA 1KQLA 2FW2A 4I1LA 5CCGA 3Q7HA 3QMJA 4I7ZC 4HYTB 1VQNP 3HD7B 1N7SD 4Y28J 3C8VA 1GMJA 3H1LE 1SQQK 3EWKA 3CMEP 1LTBC 3PP5A 3ZDMA 1GU5A 2WSEH 3WG5A 2PRRA 2Z5HA 3BPPA 3FX0A 2ZT9B 5AVSB 5APTA 5DJTB 1N86A 2VSSA 1L0ND 3VMXA 3C1LA 3CCRP 2Q7CA 1NO4A 3TNUA 1VPCA 4EMPA 3TVUA 1EY3A 3BRVB 3L72J 3R0OA 3PE8A 4H13B 5INIA 2QE7H 1NGMB 1IZNB 4WWIA 4RJTA 5KLVG 2RMZA 4CPGA 1LP1A 3HINA 3LW5H 3RGUA 4HB1A 5E79E 3WUUA 4UB8H 3HUSB 5TISH 3V2RA 4HKZH 4W80A 3AE8C 4ELWA 3L35A 1NOHA 1LWUC 1Q82Q 2QQ3A 1P84E 3A0BH 3P8CD 1EDLA 4HC8A 1PPJG 3TYYA 1SP4A 1SQBG 5BVZA 4PD4H 5G1RA 3L72E 2B9BA 5C9GA 3H32B 2KSEA 3RK2C 3KTKA 2W6BA 1RE4A 3L70D 1S72P 2BCCJ 4JCRA 2KLUA 1S5LE 1JOCA 3QK8A 5CTCA 4GM2A 3L70G 5DL1A 4ASWA 2ZXEB 3P2LA 1EF9A 3M0AA 1M8OB 3RK3C 5DTPA 3HTKB 1FOSF 2CBYA 3A5TA 5TJHA 2VREA 5E0NX 3HTKA 1TYFA 4U3FJ 3MT6A 1OD2A 1CI6A 2AXTH 2C0XA 3Q0JA 1M1KQ 3RL0g 2OTLP 4PV1C 1OVVA 2J5IB 3R9QA 3OJAB 4MN4C 1KD1Q 4OLQA 5BU8B 1RQVA 4AYCA 2VSUF 2AEMA 3SSUA 4YXDC 1VQLP 4U1AA 5G1SA 3N4XA 3SFDC 2A7SA 4F47A 1QL1A 3SWKA 2D2CB 5KJ7D 1L0NJ 4L74A 2HFED 4HDTA 1LTJB 4ZDBA 5K5GB 4K35A 2VX2A 2WSFJ 1RHZB 2C9NY 1FZAA 2Y0DA 1BDDA 1KYOE 3MYBA 3RBXA 1QVGO 2ZYAA 3H1IG 3IAVA 3NJBA 5KAFE 2WTYA 1EF8A 3EQ2A 2QA4P 3P7KA 1XO6A 1NTKE 4B3HA 3M0DC 4HH2A 1YITP 1A02J 4JFCA 1P84I 3C9IA 4GOEA 1J1EC 2QJPC 2OYHC 3CX5D 3CL3D 4EMMA 5INGA 1KQFB 1Q81Q 3H1LD 3H1HD 4ELSA 2IPPA 2K9JA 3ABVC 1BGYG 3L71E 1VQ8P 4OGQD 4D6TD 3B5NB 3OT6A 2O01H 5IKLB 1SQQJ 1IC2A 1EC5A 3ZWAA 4H44B 1JY2N 5CCGC 2OARA 1FZCC 2QRXA 3MUDC 1AA0A 4L8KA 3L75J 3H6PA 4WY4D 3V4QA 1SFCC 1PGJA 2W90A 1IJDB 2H89C 3EFFK 4U3FD 1LT9A 4KWBA 3JC22 3H0UA 2JP3A 3VMYA 4ZNCA 4JYJA 4MI2A 1Y47A 1NU1D 4EYYQ 5AW7B 2KK7A 2N1TC 1SLQA 3BCCD 5AVVB 1Q7YQ 4B3JA 1ZLLA 1TU3F 1FZBA 4JQ0D 2OYIA 3KYQA 1J1DC 5HUQA 1NTKG 2OYHA 4DI1A 1GZLA 4Y99B 2YNYA 2L91A 3TT7A 1MJ3A 3FWLA 1ZMEC 5AVRB 1PZQA 3T88A 1OW6A 3PH0A 4N78D 2MKVA 4RESB 3I55P 3M9BA 1NZYB 4PJ0H 3S4RA 4YTPC 2KUBA 3PEAA 2JJLA 2WSCJ 1GL2B 4PD4D 1SQQE 2WPQA 1QL2A 5KJPA 3RK3E 4JCQA 3H1HG 2CK3H 3CC7P 2E76C 4QIJA 1MFZA 4HJGH 1BSNA 3G9RA 1FC7A 1S3JA 3L71D 1ZRTD 1Y9BA 2IZ1A 1K9MQ 4G2RA 5AW4B 4DCKA 3FXDA 2FZSA 4LK5A 4U3FG 1SQPJ 1ON9A 2M5AA 3K5BA 1LT9C 3GG2A 3Q2YA 2XNXA 2C8TA 1BE3E 2WMMA 1DD3A 4U0GA 3O8ZA 3SWFA 2ZVNB 4R4LA 1GTWA 3AEEC 1PFIA 2I8DA 1YBKA 1FE6A 1FZCA 3G71P 1W2EA 5CBNA 1DEEG 4IL6X 4K2NA 2A45I 1K73Q 1JMBA 1NTZJ 1YG8A 3TF5A 1NTZK 2OTJP 2A45G 4N6JA 1N7SC 2KS1A 4LGDE 1SQBJ 5DTWA 3FF6A 4B3IA 1IFMA 3E1RA 3MOYA 2YXQB 3JU1A 3E1IA 1SVFA 2HPCB 2P2UA 1CZQA 2QIWA 4KD6A 1JY3P 1HNOA 1N7SB 1VQMP 1AV1A 3L73G 4D6TE 1XX4A 1N7SA 4KHXA 2H7HA 1XNYA 3CCMP 2X58A 1OXZA 2NRGA 1SG4A 2CPSA 1JM0A 1PP9J 2PFXA 1YQ3C 2QEXP 3HE4B 5AW9B 3BASA 3AE9C 2PP6A 1RF0A 3JCUE 4ZDEA 1EDJA 2JR8A 2HG5D 3I5CA 1OVRA 3SFEC 2BASA 5B66E 1Y7OA 1OD4A 1T6AA 1GK6A 3KHUA 1KORA 4ZU2A 3CWBE 1SQPK 3IN6A 1FDOA 1Q86Q 1URQB 3AE6C 2AEFA 3BCCE 4BXLA 4OG1A 4W7YA 1SQBK 3TRRA 4OVNF 5GTIE 1S2EA 4OWFA 1BCCD 2K37A 5AVUB 2C0WA 1FJPA 3R6HA 5E0SA 5DZKA 3RK2D 1XNVA 2FYUE 2EJ5A 4XA4A 1FC6A 3V5IA 2P10A 1YTZI 4WCZA 1EDKA 1X8YA 1EZVE 2HR3A 4IZCA 1OX3A 1H0TB 2IBZD 4W7ZA 1MZ9A 2CE3A 4JCSA 1VQ9P 3JSVC 1AVYA 3U1AA 3BATA 5E79H 3K50A 1T2KC 1GL2D 1WT6A 1W5CE 1WDLA 3KTJA 2C9LY 3TGUJ 2N1TB 1L4AC 2JKVA 3M06A 1O8UA 3K8XA 1PV3A 1R5LA 1SQVE 2ZYGA 3AEDC 2E74B 1SQVD 1ZV8A 1FDMA 3NJDA 1SQBD 2OTKE 1JEKA 2YIUB 3L74D 3QWOC 4U0HA 3T8BA 5AVYB 4EDFA 3MHVA 5DZKH 3AE5C 2LXCB 2YKPA 3PGQA 1XTGB 4WY4A 1VQOP 1NWQA 2L5GB 1EXJA 1XNWA 1N6EA 4ZDDA 2IBZE 3AE4C 3M9QA 2Q2XA 2E76D 1XTCC 1X0TA 4QIIA 3TVWA 2ZFCA 4OGQB 2FXMA 2QSIA 2KIKA 1ZXGA 3KQGA 3CLQA 3M91A 3HP0A 3L74G 3CCEP 1VL2A 3TSIA 1PL5A 1SQQD 1JY3O 1L0LE 4H0LD 2IYPA 3RL0D 2XKMA 2A81A 3H1IJ 4IFDK 2OYHB 1QGKB 4KJMA 1ZW0A 1YJWP 1DH3A 3QH9A 1NH4A 5TISE 2G3AA 5AW8B 1SQQG 3T8AA 2SPZA 3CD6P 1URQA 5KAIE 3V2NA 2W27A 1KFNA 2WQYC 1GD2E 2V7QJ 3CCLP 3VMAA 1KQGB 1Q51A 4BRYA 2J5GD 2M3EA 2FXOA 1SQVG 4C7NB 1P84H 1H8AA 4D6TG 1USDA 1X9VA 1SFCD 4U19A 3H0QA 4RO0A 1OZHA 4H0LB 3KXDA 1BE3D 2P1JA 2WSSH 1A02F 2DEOA 2WITA 1JCDA 1JTHB 1LT1A 1W2BO 4HNKA 1M1JC 1PGPA 3ITKA 4JJTA 3KTIA 3U9SB 1N73C 3OMEA 3OAKA 1VF5B 2ZQRA 4LLHA 1PGOA 3I56P 3BEZA 3H1KD 1N6FA 3OW2O 3GMAA 2J59M 2ZT9C 1AFOA 2GM4A 3L37A 4GKGA 4J2UA 3QYRA 4N78E 4YPCA 3D70A 2B87A
chains in the Genus database with same CATH topology
3H0SA 3QREA 2J5II 3I47A 4Z0MA 1YG6A 1R8EA 3PZKA 4B3JA 1TU3F 4I7ZB 3QXZA 3H81A 1N6DA 2IEXA 4PV1B 4GHNA 3AEGC 4MOUA 4K3WA 4H13D 5JBXA 4XFJA 4FB8A 5HUQA 3Q5RA 2BEZF 2YJGA 4DI1A 2G8YA 1ZOYC 5M1BA 2BEQD 3G64A 1S1CX 3SWXA 3Q5PA 3TT7A 1MJ3A 1ZMEC 3LAOA 4KPKA 3T88A 1OW6A 4I42A 1PJHA 4ZDCA 2MKVA 2ZL3A 2ZT9D 4K29A 1NZYB 1ZP0C 2PPYA 5DUFA 4YTPC 2J5UA 3PEAA 5KKZC 1KILE 1RQUA 2WSCJ 3T89A 4FNBA 5FUSA 5DU6A 1YQ4C 4NNQA 3AE1C 3RK3E 1UYVA 5KJPA 4JCQA 5INFA 3T3WA 2VSUC 3H25A 2E74C 2NP9A 4JSBA 3KTHA 3HLN1 3D6YA 1DIPA 2E76C 4QIJA 4EMLA 3G9RA 1FC7A 1K32A 2J5IA 5DU8A 5L8RJ 1Y9BA 2FYNC 4G2RA 1OW8A 1VRGA 2VSSF 2FZSA 4ZDFA 4LK5A 4GDOA 3QWDA 1FCFA 1RJNA 1ON9A 3Q1TA 5E0SH 3Q2YA 1W2XA 2C8TA 1MKMA 1DD3A 4U0GA 2D3TA 3B71A 4R4LA 3ST9A 3KQFA 4Z1MH 3Q1MA 2D2CC 3P85A 3AEEC 3HE2A 2PG8A 2WPVB 3IBBA 3D6ZA 3ZWBA 5FIFA 4NARA 4IL6X 3GKBA 2F9IB 3ISAA 4K2NA 3U9RB 1RJMA 4RCNA 1YG8A 4RKUJ 3ZW9A 2GTRA 1JXZA 3TLFA 1WDMA 2YIUC 4MXIA 5DU4A 4KT0J 5DTWA 1UYSA 2ZL2A 3FF6A 4B3IA 3MOYA 1FC9A 2E75D 1IK7A 1HZDA 3KTGA 2E75B 3JU1A 1X0UA 3DJAA 4KNPA 4R4MA 2QIWA 5KDRB 4KD6A 2VSSE 1HNOA 1FDIA 3ZW8A 2FXPA 1JB0J 5KDRA 3DORA 3M6NA 3BPTA 1XX4A 2BZRA 2QJKC 3AE3C 1J7XA 1XNYA 3P5MA 1Q90D 2X58A 4Q1IA 3S9OA 1SG4A 2FW2A 3Q7HA 1UIXA 4FZWA 1YQ3C 3QMJA 4I7ZC 4OGQC 4U18A 2YMKA 4Y28J 3C8VA 1GMJA 3QKAA 3AE9C 3Q3DA 3LW5J 1S5LX 2FBMA 3EWKA 4ZDEA 4ELXA 2OQQA 2E75C 1OMIA 1OW7A 3IAOA 3N6RB 3RRVA 3SFEC 3WG5A 1Y7OA 1OD4A 4ZU2A 1KORA 1KMIZ 3BPPA 2ZT9B 3IN6A 1FDOA 2F9YB 3T97B 4IZDA 2VSSA 4ASIA 3L3SA 3M6MA 3AE6C 3AE7C 4OG1A 3TRRA 4FN8A 3VIVA 1K39A 1NZYA 4H0LC 2VSUA 3TV5A 3STAA 4EMPA 3TVUA 1EY3A 4FJWD 3R6HA 3HRXA 4QFEA 3R0OA 5E0SA 3PE8A 5DZKA 1XNVA 1AJYA 2EJ5A 4H13B 1NYHA 5INIA 3D70A 1FC6A 3V5IA 1WMKA 2P10A 1NGMB 3HINA 4WCZA 3R9TA 2K9YA 1KTMA 4IZCA 3R4YA 2WSEJ 5KLIC 3AE8C 3GLMA 1ZRTE 4ELWA 4JWVA 2J5GA 2CE3A 4U0GH 2QQ3A 4JCSA 4HC8A 4JYLA 5G1RA 2UZFA 3K50A 5C9GA 4FZWC 4IZBA 2X24A 2IDBA 3KTKA 1VF5D 3TDCA 4PV1D 4FNDA 1WDLA 3KTJA 3GF3A 4JCRA 3TZ3A 2W3PA 2F9YA 1O8UA 5JBWA 3K8XA 1PV3A 3QK8A 5CTCA 4GM2A 1UYTA 3AEDC 2E74B 4TT3H 5DL1A 3NJDA 3MFMA 3Q0GA 3P2LA 1EF9A 3QXIA 5DTPA 3FGAD 2CBYA 1WDKA 4RYFA 1ON3A 4WZ8B 2VREA 2FBWC 5E0NX 3FDUA 4U0HA 3D71A 1TYFA 3T8BA 2J5SA 1OD2A 3MT6A 5DZKH 3AE5C 3PGQA 3ZWCA 3Q0JA 1VF5C 3RL0g 1EXJA 2JO1A 4PV1C 5G1QA 1XNWA 1N6EA 4ZDDA 2Q35A 3AE4C 2J5IB 2Q2XA 3R9QA 1DCIA 2E76D 4OLQA 4QIIA 1RQVA 3TVWA 1U57A 4RYFH 3AEAC 4OGQB 2QSIA 3O6QA 2H88C 2VSUF 2QJYC 4JVTA 4YXDC 3HP0A 4U1AA 4FN7A 5G1SA 1VL2A 1PL5A 4NEKA 2F9IA 3SFDC 2A7SA 1WZ8A 4F47A 2NZ2A 1DD4A 4H0LD 2A7KA 5MGBA 2WTBA 2D2CB 2A81A 2F6QA 3R9SA 3AECC 1HNUA 4JCTA 3U9TB 2D2CD 2G3AA 3AEBC 4HDTA 4ZDBA 3T8AA 2VX2A 2WSFJ 4H44C 2ZQQA 2PBPA 3MYBA 4I52A 3IAVA 3NJBA 3V5EA 2O01J 1UIYA 5DKPA 2WQYC 1EF8A 2V7QJ 3RSTA 3SLLA 1KQGB 1Q51A 2J5GD 2E76B 1XO6A 2DUBA 4B3HA 1PIXA 4Q0GA 3H0JA 1K04A 4JFCA 4U7JA 5DUCA 3TT6A 2QJPC 2ZL0A 2VSUE 4U19A 3H0QA 4EMMA 5INGA 1KQFB 1DUBA 4JOTA 4H0LB 4ELSA 4H44D 2DEOA 5C90A 3ABVC 4OGQD 2HW5A 1EXIA 2E74D 4HNKA 3Q5SA 3OT6A 4JJTA 1TG6A 5IKLB 3KTIA 1HF9A 1Q52A 3U9SB 3LKEA 3OMEA 2ZL4A 4H44B 3ZWAA 3RSIA 3AEFC 1VF5B 2ZQRA 4L8KA 3BF0A 4OMRA 3IB9A 4YLHA 2F6IA 1HJ0A 3BEZA 3OC7A 1N6FA 5CTBA 3GMAA 3H02A 4I4ZA 1K05A 2ZT9C 4WYOB 2H89C 4H13C 4L6WA 4KWBA 4J2UA 1SZOA 3AE2C 3H0UA 3QYRA 2JP3A 2Q34A 4JYJA 4MI2A 1UYRA 3GF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H0S A;  3QRE A;  2J5I I;  3I47 A;  4Z0M A;  1YG6 A;  3PZK A;  4B3J A;  3QXZ A;  3H81 A;  1N6D A;  2IEX A;  4GHN A;  4MOU A;  4K3W A;  5JBX A;  4FB8 A;  4DI1 A;  3G64 A;  3SWX A;  3TT7 A;  1MJ3 A;  3LAO A;  4KPK A;  3T88 A;  4I42 A;  1PJH A;  4ZDC A;  2ZL3 A;  4K29 A;  1NZY B;  2PPY A;  5DUF A;  3PEA A;  3T89 A;  4FNB A;  5FUS A;  5DU6 A;  4NNQ A;  5KJP A;  1UYV A;  4JCQ A;  5INF A;  3T3W A;  2VSU C;  2NP9 A;  4JSB A;  3KTH A;  3HLN 1;  4QIJ A;  4EML A;  1K32 A;  1FC7 A;  2J5I A;  5DU8 A;  4G2R A;  1VRG A;  2VSS F;  2FZS A;  4ZDF A;  4LK5 A;  3QWD A;  1FCF A;  1RJN A;  1ON9 A;  3Q1T A;  5E0S H;  1W2X A;  2C8T A;  4U0G A;  2D3T A;  3ST9 A;  3KQF A;  3P85 A;  3HE2 A;  2PG8 A;  3IBB A;  3ZWB A;  5FIF A;  3GKB A;  2F9I B;  3ISA A;  4K2N A;  3U9R B;  1RJM A;  4RCN A;  1YG8 A;  3ZW9 A;  2GTR A;  1JXZ A;  3TLF A;  1WDM A;  4MXI A;  5DU4 A;  5DTW A;  1UYS A;  2ZL2 A;  3FF6 A;  4B3I A;  3MOY A;  1FC9 A;  1HZD A;  3KTG A;  3JU1 A;  1X0U A;  3DJA A;  4KNP A;  5KDR B;  4KD6 A;  2VSS E;  1HNO A;  3ZW8 A;  5KDR A;  3DOR A;  3M6N A;  1XX4 A;  2BZR A;  1J7X A;  1XNY A;  3P5M A;  2X58 A;  4Q1I A;  1SG4 A;  2FW2 A;  3Q7H A;  4FZW A;  3QMJ A;  4U18 A;  3QKA A;  2FBM A;  4ZDE A;  4ELX A;  3N6R B;  3RRV A;  3WG5 A;  1Y7O A;  1OD4 A;  4ZU2 A;  3BPP A;  2F9Y B;  4IZD A;  2VSS A;  4ASI A;  3L3S A;  3M6M A;  4OG1 A;  3TRR A;  4FN8 A;  3VIV A;  1K39 A;  1NZY A;  2VSU A;  3TV5 A;  3STA A;  4EMP A;  3TVU A;  1EY3 A;  4FJW D;  3R6H A;  3HRX A;  4QFE A;  3R0O A;  5E0S A;  3PE8 A;  5DZK A;  1XNV A;  2EJ5 A;  5INI A;  3V5I A;  1FC6 A;  3HIN A;  4WCZ A;  3R9T A;  4IZC A;  3GLM A;  4ELW A;  4JWV A;  2J5G A;  2CE3 A;  4U0G H;  2QQ3 A;  4JCS A;  4HC8 A;  4JYL A;  5G1R A;  2UZF A;  3K50 A;  5C9G A;  4FZW C;  4IZB A;  2X24 A;  3KTK A;  3TDC A;  4FND A;  1WDL A;  3KTJ A;  3GF3 A;  4JCR A;  3TZ3 A;  2W3P A;  2F9Y A;  1O8U A;  5JBW A;  3K8X A;  3QK8 A;  5CTC A;  4GM2 A;  1UYT A;  5DL1 A;  3NJD A;  3MFM A;  3Q0G A;  3P2L A;  1EF9 A;  3QXI A;  5DTP A;  2CBY A;  1WDK A;  4RYF A;  1ON3 A;  4WZ8 B;  2VRE A;  5E0N X;  3FDU A;  4U0H A;  1TYF A;  3T8B A;  2J5S A;  1OD2 A;  3MT6 A;  5DZK H;  3PGQ A;  3ZWC A;  3Q0J A;  5G1Q A;  1XNW A;  1N6E A;  4ZDD A;  2Q35 A;  2J5I B;  2Q2X A;  3R9Q A;  1DCI A;  4OLQ A;  4QII A;  3TVW A;  4RYF H;  2VSU F;  4JVT A;  3HP0 A;  4U1A A;  4FN7 A;  5G1S A;  4NEK A;  2F9I A;  1WZ8 A;  2A7S A;  4F47 A;  2A7K A;  5MGB A;  2WTB A;  2A81 A;  2F6Q A;  3R9S A;  1HNU A;  4JCT A;  3U9T B;  4ZDB A;  3T8A A;  2VX2 A;  2ZQQ A;  2PBP A;  3MYB A;  4I52 A;  3IAV A;  3NJB A;  3V5E A;  1UIY A;  5DKP A;  1EF8 A;  3RST A;  3SLL A;  1Q51 A;  2J5G D;  1XO6 A;  2DUB A;  4B3H A;  1PIX A;  4Q0G A;  3H0J A;  4JFC A;  3TT6 A;  5DUC A;  2ZL0 A;  2VSU E;  4U19 A;  3H0Q A;  4EMM A;  5ING A;  1DUB A;  4JOT A;  4ELS A;  2DEO A;  5C90 A;  2HW5 A;  4HNK A;  3OT6 A;  4JJT A;  1TG6 A;  5IKL B;  3KTI A;  1Q52 A;  3U9S B;  3LKE A;  3OME A;  2ZL4 A;  3ZWA A;  3RSI A;  2ZQR A;  4L8K A;  3BF0 A;  4OMR A;  3IB9 A;  4YLH A;  2F6I A;  3BEZ A;  3OC7 A;  1N6F A;  5CTB A;  3GMA A;  3H02 A;  4I4Z A;  4WYO B;  4L6W A;  4KWB A;  1SZO A;  3H0U A;  3QYR A;  2Q34 A;  4JYJ A;  4MI2 A;  1UYR A;  3GF7 A; 
#chains in the Genus database with same CATH topology
 2HYN A;  2J5I I;  2K88 A;  4Z0M A;  3HE5 A;  3VTP C;  2XDJ A;  3L71 J;  1NAF A;  3PZK A;  5KJ7 A;  3KZI E;  4I7Z B;  1AVO A;  1HTL C;  2IEX A;  3AEG C;  4MOU A;  3H1L J;  1H88 A;  2KOG A;  5APX A;  5C39 A;  2QJK B;  2BEZ F;  1P84 D;  5M1B A;  2BEQ D;  3G64 A;  4XE5 B;  3L73 J;  3L74 E;  4ZMD A;  5CMZ A;  1NU1 E;  1SQX G;  3CXH H;  3LAO A;  4KPK A;  1IFP A;  2XND H;  1PJH A;  2JWA A;  5KAI H;  4O9B A;  3H32 A;  3H1I E;  1PP9 G;  5B66 H;  5DUF A;  2J5U A;  1FOS E;  1RQU A;  4IL6 H;  3T89 A;  2R3S A;  1LT9 B;  3KDP B;  1J2J B;  1UYV A;  3H1K E;  5B5E E;  5INF A;  2AXC A;  2VSU C;  1SQX K;  4UB8 E;  2R3C A;  4BWN A;  5AW3 B;  1FBM A;  1BDC A;  3CCJ P;  3HLN 1;  1DIP A;  1RE3 C;  2FYN C;  3FXE A;  3MD0 A;  4NPD A;  2Q6Q A;  4GDO A;  1SS1 A;  1RJN A;  4PD4 I;  2FYU K;  1W2X A;  2HOD A;  1Z56 A;  2Z4E A;  3UIA A;  2A06 G;  1T3U A;  2FYU D;  1NTK D;  2Q3E A;  3L72 G;  3HE2 A;  2WPV B;  3U59 A;  4U3F E;  3D6Z A;  1L4A B;  1KN7 A;  2W83 C;  3ZWB A;  5FIF A;  3L70 J;  2OYI C;  2Y0E A;  2AXT E;  1JO5 A;  3OA7 A;  4RKU J;  2POH A;  4M3L A;  3ZW9 A;  2PAJ A;  3TLF A;  4JBZ A;  1VQ4 P;  2YIU C;  4MXI A;  1SQX D;  5DU4 A;  4KT0 J;  1UYS A;  2ZL2 A;  5CJ0 A;  2E75 D;  3PJS K;  3CPW O;  1IK7 A;  1LJ2 A;  1HZD A;  1CW5 A;  4R4M A;  1S4X A;  2IFM A;  1FDI A;  2Q9I A;  1L0L K;  2RKL A;  1JMM A;  3DOR A;  3BPT A;  5AVT B;  2QJK C;  4L73 A;  3P5M A;  2H8P D;  3S9O A;  1QVF O;  2B87 B;  1UIX A;  5BU5 A;  4A7P A;  2FKW B;  4OGQ C;  2K9J B;  1SQP D;  3V2Q A;  3G4S P;  1BGY E;  1EQ7 A;  3Q3D A;  1KYO I;  4I2L C;  3LW5 J;  1LWU B;  1S5L X;  4ELX A;  1OMI A;  2PGD A;  1OW7 A;  2I1K A;  2W6A A;  1YHQ P;  3N6R B;  2HLO A;  1KMI Z;  2YO3 A;  3M9H A;  4GOF A;  3L3S A;  1J1D B;  1KYO D;  1T3J A;  4FN8 A;  2KS1 B;  1NZY A;  1EZV G;  1U7J A;  4H0L C;  3V6I A;  2R32 A;  4EOT A;  2K1A A;  3HRX A;  1MUU A;  2QVA A;  4L76 A;  1L0L J;  4UB6 H;  2IX7 C;  1AJY A;  1WMK A;  3TK1 A;  1L2P A;  3HE4 A;  4ZKP A;  3R9T A;  1NTM J;  1IFD A;  5KJ7 C;  3MP7 B;  3G6E P;  1YI2 P;  3R4Y A;  1FZF A;  3A0H E;  5KLI C;  2RH0 A;  2NPS D;  3HE5 B;  3CCQ P;  5AW0 B;  4U0G H;  3MIW A;  1EZV D;  2Q1K A;  2QG4 A;  1GU4 A;  3TGU G;  5APU A;  1AQT A;  1KIL B;  3KZI H;  3MGN A;  1E5W A;  4IZB A;  4L75 A;  2X24 A;  1VF5 D;  3H1I D;  1L4A A;  2NPS C;  1M90 Q;  4FND A;  3FWN A;  2N1T A;  3P8M C;  1IFJ A;  3GF3 A;  1RH5 B;  3TZ3 A;  1LTT C;  5B5E H;  2F9Y A;  1KB9 D;  5JBW A;  1FZG A;  1LTJ C;  1SQX J;  3MFM A;  2B88 A;  1CI6 B;  1ZR2 A;  3T97 A;  2YMY A;  3FGA D;  1RF1 A;  1ON3 A;  4WZ8 B;  3B5N C;  2FBW C;  4Y99 C;  3D71 A;  3MZW B;  3RL0 C;  2J5S A;  5KKZ B;  1EZV I;  2FFD C;  3GHG B;  1SFC B;  2IBZ G;  4DOJ A;  5H2F H;  2OYO A;  2FFD B;  1LTJ A;  4NPF X;  1IFN A;  1LTS C;  4DJG A;  2XU6 A;  2M5A B;  5AW5 B;  2Q35 A;  1NKN A;  1DCI A;  1SQP E;  3B5N D;  1JNM A;  1UII A;  1FS0 E;  4RYF H;  2MJZ A;  2H88 C;  1NTZ G;  1JY2 P;  1CSB A;  5CCH D;  1D7M A;  1X22 A;  4FN7 A;  5KLV J;  2F9I A;  1WZ8 A;  2O3J A;  2A7K A;  5MGB A;  4C7R A;  2F6Q A;  5GTI H;  3AEC C;  3CXH I;  4WVZ A;  5H2F E;  1HNU A;  4JCT A;  4EIJ A;  3CXH E;  3TGU D;  1GK4 A;  3H1K J;  1KV4 A;  4H44 C;  3CCU P;  5CHX A;  5APV A;  5CCH C;  1SQV J;  4PJ0 E;  2PBP A;  4K3A A;  4I52 A;  1NU1 K;  4OH8 B;  2O01 J;  2Y9Z A;  5DKP A;  1HGV A;  3PLN A;  2LR2 A;  3SLL A;  3HUS C;  2NPS A;  1KB9 H;  2E76 B;  3CWB D;  2DUB A;  3H1K G;  4Q0G A;  1LTG C;  3H0J A;  2WT7 A;  1HGZ A;  1FZE A;  3TT6 A;  2ZYD A;  3HD7 A;  2ZVO B;  3A3Y B;  1BGY D;  3P8C E;  1MFT A;  5CCG D;  2Q5U A;  3W68 A;  1GW4 A;  2QM7 A;  5C90 A;  1KIL A;  3H1J D;  1PPJ E;  2WSF H;  1NKZ B;  3H1L G;  2P67 A;  1N73 A;  2HW5 A;  1EXI A;  2E74 D;  2A45 H;  3Q5S A;  1TG6 A;  3NFQ A;  2GUV A;  1Q52 A;  3LKE A;  2ZL4 A;  3RSI A;  3AEF C;  2R5B A;  1N2D C;  3BF0 A;  3IB9 A;  4UB6 E;  2F6I A;  3VMZ A;  1HJ0 A;  4PD4 E;  5CTB A;  3LIE A;  3U1C A;  2IYO A;  1KC8 Q;  3GHG C;  3PHL A;  3H02 A;  4I4Z A;  2VRS A;  3B5N A;  4WYO B;  4H13 C;  3RK3 B;  2B89 A;  2OYI B;  2E43 A;  4BRY B;  1G2C B;  3B8E B;  5GTH E;  2BCC E;  3S1K A;  3H0S A;  1NTZ E;  3I47 A;  1YG6 A;  1R8E A;  3CX5 E;  3R2P A;  3WU2 H;  3QXZ A;  3H81 A;  1N6D A;  1URQ C;  4GHN A;  4H13 D;  5JBX A;  4FB8 A;  3RK2 B;  3H1H E;  2WT7 B;  5EFW B;  3Q5R A;  2YJG A;  1ZOY C;  1HJB A;  2FYU J;  4JF7 A;  1S1C X;  3SWX A;  1RF1 C;  3Q5P A;  1KFM A;  3W67 A;  1URQ D;  4NPE A;  1E79 H;  4ZDC A;  4IOI H;  2R5D A;  2ZL3 A;  4K29 A;  1ZP0 C;  1HBW A;  3VOP A;  3VP9 A;  5KKZ C;  1JUN A;  1KIL E;  1S9K D;  1JY3 N;  4FNB A;  1HVV A;  1YQ4 C;  4NNQ A;  1QX8 A;  2KNC B;  3A7O A;  3HD7 D;  3H25 A;  2E74 C;  1YJ9 P;  2NP9 A;  1OVU A;  2Y9Y A;  3MTU E;  3D6Y A;  2JWD A;  4EML A;  1IFI A;  3E7K A;  2J5I A;  5L8R J;  1LWU A;  1OW8 A;  1VRG A;  2WWW A;  4ZDF A;  3A2A A;  1FCF A;  3V4W A;  3Q1T A;  5E0S H;  1YTZ T;  1MKM A;  1L0L G;  1NTM E;  2JEE A;  3CI9 A;  2FFD A;  2WSC H;  1EDI A;  1KQS O;  4Z1M H;  3Q1M A;  2D2C C;  4DT0 A;  1VQ7 P;  2PG8 A;  3L73 D;  3IFM A;  5AVQ B;  2CPB A;  4NAR A;  1SQV K;  4JPZ B;  4ASV A;  2F9I B;  3ISA A;  1YYC A;  4WY4 C;  1RJM A;  4RCN A;  1DEB A;  4TLF A;  1WDM A;  3L75 E;  1YJN P;  3BCC G;  3TDK A;  1L0L D;  1L0N G;  2WPR A;  1X0U A;  3DJA A;  4KNP A;  3RBZ A;  5KLI B;  1N8R Q;  3WU2 E;  2P7J A;  1NU1 J;  1WRG A;  2KB7 P;  2QM8 A;  1KZU B;  1JB0 J;  3WUT A;  1T2K D;  3M6N A;  3A0B E;  3BCC J;  2BZR A;  3AE3 C;  1J7X A;  2A06 D;  1LTI C;  3VN0 A;  3SWY A;  1DX7 A;  4FZW A;  1G1J A;  1N7L A;  1SFC A;  4U18 A;  1PPJ D;  2YMK A;  1OIP A;  1T8Z A;  3HUS A;  3QKA A;  4ZKU A;  4WBA A;  3JCU H;  1FZC B;  3L73 E;  2FBM A;  2OQQ A;  2E75 C;  5KAF H;  1NTK J;  5AW1 B;  1NHL A;  1NTK K;  3IAO A;  3RRV A;  1LTA C;  1RE3 A;  5APQ A;  1Y8A A;  2F9Y B;  3T97 B;  4IZD A;  1QEX A;  4ASI A;  3M6M A;  2V4H A;  1SQP G;  2M8R A;  3AE7 C;  2O1J A;  2W8Z A;  4B86 A;  3VIV A;  1K39 A;  3LID A;  3CWB G;  4IFF A;  3HD7 C;  2VSU A;  3TV5 A;  3STA A;  4FJW D;  4QFE A;  1VQK P;  3F5H A;  1NYH A;  5APY A;  3EFG A;  1QLE D;  2K9Y A;  1KTM A;  2WSE J;  4GT1 A;  1M1J A;  1JY2 O;  2HOD B;  3GLM A;  1ZRT E;  4JWV A;  2J5G A;  1BCC G;  1L4A D;  5AVW B;  1X79 B;  3BVH A;  4JYL A;  2IFN A;  3MUD A;  3GHG A;  5KLV D;  4WY4 B;  2UZF A;  4FZW C;  2IDB A;  4JYB A;  1VQP P;  1RY3 A;  2FYN B;  4DZO A;  3TDC A;  4PV1 D;  2M0B A;  1ZR4 A;  3GW6 A;  1NTZ D;  2W3P A;  2XZR A;  3L36 A;  2W6J H;  1UYT A;  4TT3 H;  2YKO A;  5APS A;  3Q0G A;  2E5T A;  1BCC E;  3QXI A;  4LC1 A;  1RE4 C;  1WDK A;  3BRT B;  3NXS A;  4RYF A;  2LKM A;  3FDU A;  1HWT C;  1BE3 G;  2KLV A;  3ZWC A;  2KI7 B;  3F89 A;  1VF5 C;  1HH0 A;  2JO1 A;  1M56 D;  1M7L A;  5G1Q A;  1NTM D;  4AQR D;  1FC2 C;  2KZI A;  3H1H J;  4QMA A;  2N9B A;  1M1J B;  1U57 A;  3AEA C;  3H1J J;  1GL2 C;  3O6Q A;  3N7N A;  1MV8 A;  2QJY C;  4JVT A;  3RK3 D;  3CCV P;  1LNQ A;  4NEK A;  3TNU B;  3NTN A;  2NZ2 A;  2WVR A;  1DD4 A;  5APW A;  2WTB A;  2JDI H;  3R9S A;  2QJY B;  4AUW A;  3H1J G;  3U9T B;  2D2C D;  3L75 D;  3AEB C;  3IR9 A;  5AW6 B;  1OFC X;  2ZQQ A;  2I1J A;  2E42 A;  2HPC A;  1U7M A;  2LXB A;  1SQB E;  2J58 A;  1SQX E;  2KZJ A;  3V5B A;  3V5E A;  1UIY A;  3CCS P;  1G1I A;  3WUV A;  3RST A;  1G2C A;  2GUS A;  1KB9 I;  1PGQ A;  3II6 A;  3H1J E;  1PIX A;  1FU1 A;  2DW3 A;  3L70 E;  2Q3I A;  1K04 A;  2ZAE B;  4GIF A;  4U7J A;  2ITA A;  2YKQ A;  5DUC A;  2ZL0 A;  5KLV E;  2VSU E;  2UWJ E;  1AQ5 A;  1DUB A;  4JOT A;  1HUC A;  1FJK A;  2WZ7 A;  3TGU E;  1VQ5 P;  1JTH A;  4H44 D;  1IK9 A;  1NJI Q;  1USE A;  1GDT A;  3NMD A;  2Y0C A;  3CX5 H;  1HF9 A;  2V7Q H;  1GW3 A;  1K8A Q;  4OMR A;  4YLH A;  2ZJS E;  3OC7 A;  3B4S A;  1NTM G;  4YXW H;  3M0D A;  1K05 A;  4GOD A;  2O1K A;  2WPS A;  4C46 A;  3L74 J;  4WB4 A;  1VQ6 P;  4L6W A;  2E5Y A;  1SZO A;  3AE2 C;  3L75 G;  2Q34 A;  2IZ0 A;  1UYR A;  3GF7 A;  3P32 A;  3CWB J;  3QRE A;  1KYO H;  2FYZ A;  1L0N K;  2AEJ A;  1OWA A;  1RF0 C;  1R5S A;  2FYU G;  5CCH A;  1H0T A;  5AW2 B;  3PRJ A;  2K3R A;  1VDF A;  4PV1 B;  3L4F A;  4K3W A;  4XFJ A;  1Q2N A;  1BGY J;  1PP9 E;  2BCC G;  3O6Q B;  2G8Y A;  3RL0 B;  3VP8 A;  1M57 D;  1NU1 G;  1N73 B;  2RN0 A;  2R44 A;  2IBZ I;  4I42 A;  1J1E B;  2QJP B;  4D6T J;  1JCC A;  2N9Y B;  2YO2 A;  2OGU A;  2ZT9 D;  3V2P A;  5AVZ B;  2PPY A;  2N1T D;  1NVO A;  2M3B A;  2P58 A;  1KB9 E;  2KSJ A;  3CC4 P;  5KLV K;  5FUS A;  3IF4 A;  5DU6 A;  3CMA P;  4EI2 A;  3A0H H;  3CXH D;  3AE1 C;  2KP8 A;  3T3W A;  1ZN5 A;  3L72 D;  5DJU B;  3WMM 0;  1H89 A;  1IO4 A;  1KIL D;  1S9K E;  2H43 A;  4JSB A;  2KYV A;  3KTH A;  3CX5 I;  1RF1 B;  2YXR B;  2O01 N;  1LGH B;  2NPS B;  1K32 A;  5DU8 A;  2VSS F;  1PP9 D;  2Z5I A;  4IFM A;  3PTZ A;  3QWD A;  1FAV A;  1BE3 J;  1KIL C;  2D3T A;  3B71 A;  3G3Z A;  3ST9 A;  3KQF A;  3P85 A;  1S5L H;  5GTH H;  3L71 G;  3IBB A;  2FY8 A;  2ZXX A;  4N3Y B;  3KPE A;  1NTM K;  2BCC D;  3GKB A;  3U9R B;  4IL6 E;  2KNC A;  1L0N E;  2GTR A;  1YIJ P;  1BCC J;  2GA1 A;  3USS A;  1JXZ A;  3CC2 P;  2A06 E;  3VYI A;  5KTB A;  1GL2 A;  1FC9 A;  4JYC A;  3KTG A;  2E75 B;  2XV5 A;  4I6M C;  5KDR B;  5CBO A;  2VSS E;  2KXP B;  3ZW8 A;  2FXP A;  5KDR A;  1BSH A;  1LP1 B;  3HRN A;  5AVX B;  5CJ4 A;  1Q90 D;  4Q1I A;  1NAY A;  4C7N A;  1KQL A;  2FW2 A;  4I1L A;  5CCG A;  3Q7H A;  3QMJ A;  4I7Z C;  4HYT B;  1VQN P;  3HD7 B;  1N7S D;  4Y28 J;  3C8V A;  1GMJ A;  3H1L E;  1SQQ K;  3EWK A;  3CME P;  1LTB C;  3PP5 A;  3ZDM A;  1GU5 A;  2WSE H;  3WG5 A;  2PRR A;  2Z5H A;  3BPP A;  3FX0 A;  2ZT9 B;  5AVS B;  5APT A;  5DJT B;  1N86 A;  2VSS A;  1L0N D;  3VMX A;  3C1L A;  3CCR P;  2Q7C A;  1NO4 A;  3TNU A;  1VPC A;  4EMP A;  3TVU A;  1EY3 A;  3BRV B;  3L72 J;  3R0O A;  3PE8 A;  4H13 B;  5INI A;  2QE7 H;  1NGM B;  1IZN B;  4WWI A;  4RJT A;  5KLV G;  2RMZ A;  4CPG A;  1LP1 A;  3HIN A;  3LW5 H;  3RGU A;  4HB1 A;  5E79 E;  3WUU A;  4UB8 H;  3HUS B;  5TIS H;  3V2R A;  4HKZ H;  4W80 A;  3AE8 C;  4ELW A;  3L35 A;  1NOH A;  1LWU C;  1Q82 Q;  2QQ3 A;  1P84 E;  3A0B H;  3P8C D;  1EDL A;  4HC8 A;  1PPJ G;  3TYY A;  1SP4 A;  1SQB G;  5BVZ A;  4PD4 H;  5G1R A;  3L72 E;  2B9B A;  5C9G A;  3H32 B;  2KSE A;  3RK2 C;  3KTK A;  2W6B A;  1RE4 A;  3L70 D;  1S72 P;  2BCC J;  4JCR A;  2KLU A;  1S5L E;  1JOC A;  3QK8 A;  5CTC A;  4GM2 A;  3L70 G;  5DL1 A;  4ASW A;  2ZXE B;  3P2L A;  1EF9 A;  3M0A A;  1M8O B;  3RK3 C;  5DTP A;  3HTK B;  1FOS F;  2CBY A;  3A5T A;  5TJH A;  2VRE A;  5E0N X;  3HTK A;  1TYF A;  4U3F J;  3MT6 A;  1OD2 A;  1CI6 A;  2AXT H;  2C0X A;  3Q0J A;  1M1K Q;  3RL0 g;  2OTL P;  4PV1 C;  1OVV A;  2J5I B;  3R9Q A;  3OJA B;  4MN4 C;  1KD1 Q;  4OLQ A;  5BU8 B;  1RQV A;  4AYC A;  2VSU F;  2AEM A;  3SSU A;  4YXD C;  1VQL P;  4U1A A;  5G1S A;  3N4X A;  3SFD C;  2A7S A;  4F47 A;  1QL1 A;  3SWK A;  2D2C B;  5KJ7 D;  1L0N J;  4L74 A;  2HFE D;  4HDT A;  1LTJ B;  4ZDB A;  5K5G B;  4K35 A;  2VX2 A;  2WSF J;  1RHZ B;  2C9N Y;  1FZA A;  2Y0D A;  1BDD A;  1KYO E;  3MYB A;  3RBX A;  1QVG O;  2ZYA A;  3H1I G;  3IAV A;  3NJB A;  5KAF E;  2WTY A;  1EF8 A;  3EQ2 A;  2QA4 P;  3P7K A;  1XO6 A;  1NTK E;  4B3H A;  3M0D C;  4HH2 A;  1YIT P;  1A02 J;  4JFC A;  1P84 I;  3C9I A;  4GOE A;  1J1E C;  2QJP C;  2OYH C;  3CX5 D;  3CL3 D;  4EMM A;  5ING A;  1KQF B;  1Q81 Q;  3H1L D;  3H1H D;  4ELS A;  2IPP A;  2K9J A;  3ABV C;  1BGY G;  3L71 E;  1VQ8 P;  4OGQ D;  4D6T D;  3B5N B;  3OT6 A;  2O01 H;  5IKL B;  1SQQ J;  1IC2 A;  1EC5 A;  3ZWA A;  4H44 B;  1JY2 N;  5CCG C;  2OAR A;  1FZC C;  2QRX A;  3MUD C;  1AA0 A;  4L8K A;  3L75 J;  3H6P A;  4WY4 D;  3V4Q A;  1SFC C;  1PGJ A;  2W90 A;  1IJD B;  2H89 C;  3EFF K;  4U3F D;  1LT9 A;  4KWB A;  3JC2 2;  3H0U A;  2JP3 A;  3VMY A;  4ZNC A;  4JYJ A;  4MI2 A;  1Y47 A;  1NU1 D;  4EYY Q;  5AW7 B;  2KK7 A;  2N1T C;  1SLQ A;  3BCC D;  5AVV B;  1Q7Y Q;  4B3J A;  1ZLL A;  1TU3 F;  1FZB A;  4JQ0 D;  2OYI A;  3KYQ A;  1J1D C;  5HUQ A;  1NTK G;  2OYH A;  4DI1 A;  1GZL A;  4Y99 B;  2YNY A;  2L91 A;  3TT7 A;  1MJ3 A;  3FWL A;  1ZME C;  5AVR B;  1PZQ A;  3T88 A;  1OW6 A;  3PH0 A;  4N78 D;  2MKV A;  4RES B;  3I55 P;  3M9B A;  1NZY B;  4PJ0 H;  3S4R A;  4YTP C;  2KUB A;  3PEA A;  2JJL A;  2WSC J;  1GL2 B;  4PD4 D;  1SQQ E;  2WPQ A;  1QL2 A;  5KJP A;  3RK3 E;  4JCQ A;  3H1H G;  2CK3 H;  3CC7 P;  2E76 C;  4QIJ A;  1MFZ A;  4HJG H;  1BSN A;  3G9R A;  1FC7 A;  1S3J A;  3L71 D;  1ZRT D;  1Y9B A;  2IZ1 A;  1K9M Q;  4G2R A;  5AW4 B;  4DCK A;  3FXD A;  2FZS A;  4LK5 A;  4U3F G;  1SQP J;  1ON9 A;  2M5A A;  3K5B A;  1LT9 C;  3GG2 A;  3Q2Y A;  2XNX A;  2C8T A;  1BE3 E;  2WMM A;  1DD3 A;  4U0G A;  3O8Z A;  3SWF A;  2ZVN B;  4R4L A;  1GTW A;  3AEE C;  1PFI A;  2I8D A;  1YBK A;  1FE6 A;  1FZC A;  3G71 P;  1W2E A;  5CBN A;  1DEE G;  4IL6 X;  4K2N A;  2A45 I;  1K73 Q;  1JMB A;  1NTZ J;  1YG8 A;  3TF5 A;  1NTZ K;  2OTJ P;  2A45 G;  4N6J A;  1N7S C;  2KS1 A;  4LGD E;  1SQB J;  5DTW A;  3FF6 A;  4B3I A;  1IFM A;  3E1R A;  3MOY A;  2YXQ B;  3JU1 A;  3E1I A;  1SVF A;  2HPC B;  2P2U A;  1CZQ A;  2QIW A;  4KD6 A;  1JY3 P;  1HNO A;  1N7S B;  1VQM P;  1AV1 A;  3L73 G;  4D6T E;  1XX4 A;  1N7S A;  4KHX A;  2H7H A;  1XNY A;  3CCM P;  2X58 A;  1OXZ A;  2NRG A;  1SG4 A;  2CPS A;  1JM0 A;  1PP9 J;  2PFX A;  1YQ3 C;  2QEX P;  3HE4 B;  5AW9 B;  3BAS A;  3AE9 C;  2PP6 A;  1RF0 A;  3JCU E;  4ZDE A;  1EDJ A;  2JR8 A;  2HG5 D;  3I5C A;  1OVR A;  3SFE C;  2BAS A;  5B66 E;  1Y7O A;  1OD4 A;  1T6A A;  1GK6 A;  3KHU A;  1KOR A;  4ZU2 A;  3CWB E;  1SQP K;  3IN6 A;  1FDO A;  1Q86 Q;  1URQ B;  3AE6 C;  2AEF A;  3BCC E;  4BXL A;  4OG1 A;  4W7Y A;  1SQB K;  3TRR A;  4OVN F;  5GTI E;  1S2E A;  4OWF A;  1BCC D;  2K37 A;  5AVU B;  2C0W A;  1FJP A;  3R6H A;  5E0S A;  5DZK A;  3RK2 D;  1XNV A;  2FYU E;  2EJ5 A;  4XA4 A;  1FC6 A;  3V5I A;  2P10 A;  1YTZ I;  4WCZ A;  1EDK A;  1X8Y A;  1EZV E;  2HR3 A;  4IZC A;  1OX3 A;  1H0T B;  2IBZ D;  4W7Z A;  1MZ9 A;  2CE3 A;  4JCS A;  1VQ9 P;  3JSV C;  1AVY A;  3U1A A;  3BAT A;  5E79 H;  3K50 A;  1T2K C;  1GL2 D;  1WT6 A;  1W5C E;  1WDL A;  3KTJ A;  2C9L Y;  3TGU J;  2N1T B;  1L4A C;  2JKV A;  3M06 A;  1O8U A;  3K8X A;  1PV3 A;  1R5L A;  1SQV E;  2ZYG A;  3AED C;  2E74 B;  1SQV D;  1ZV8 A;  1FDM A;  3NJD A;  1SQB D;  2OTK E;  1JEK A;  2YIU B;  3L74 D;  3QWO C;  4U0H A;  3T8B A;  5AVY B;  4EDF A;  3MHV A;  5DZK H;  3AE5 C;  2LXC B;  2YKP A;  3PGQ A;  1XTG B;  4WY4 A;  1VQO P;  1NWQ A;  2L5G B;  1EXJ A;  1XNW A;  1N6E A;  4ZDD A;  2IBZ E;  3AE4 C;  3M9Q A;  2Q2X A;  2E76 D;  1XTC C;  1X0T A;  4QII A;  3TVW A;  2ZFC A;  4OGQ B;  2FXM A;  2QSI A;  2KIK A;  1ZXG A;  3KQG A;  3CLQ A;  3M91 A;  3HP0 A;  3L74 G;  3CCE P;  1VL2 A;  3TSI A;  1PL5 A;  1SQQ D;  1JY3 O;  1L0L E;  4H0L D;  2IYP A;  3RL0 D;  2XKM A;  2A81 A;  3H1I J;  4IFD K;  2OYH B;  1QGK B;  4KJM A;  1ZW0 A;  1YJW P;  1DH3 A;  3QH9 A;  1NH4 A;  5TIS E;  2G3A A;  5AW8 B;  1SQQ G;  3T8A A;  2SPZ A;  3CD6 P;  1URQ A;  5KAI E;  3V2N A;  2W27 A;  1KFN A;  2WQY C;  1GD2 E;  2V7Q J;  3CCL P;  3VMA A;  1KQG B;  1Q51 A;  4BRY A;  2J5G D;  2M3E A;  2FXO A;  1SQV G;  4C7N B;  1P84 H;  1H8A A;  4D6T G;  1USD A;  1X9V A;  1SFC D;  4U19 A;  3H0Q A;  4RO0 A;  1OZH A;  4H0L B;  3KXD A;  1BE3 D;  2P1J A;  2WSS H;  1A02 F;  2DEO A;  2WIT A;  1JCD A;  1JTH B;  1LT1 A;  1W2B O;  4HNK A;  1M1J C;  1PGP A;  3ITK A;  4JJT A;  3KTI A;  3U9S B;  1N73 C;  3OME A;  3OAK A;  1VF5 B;  2ZQR A;  4LLH A;  1PGO A;  3I56 P;  3BEZ A;  3H1K D;  1N6F A;  3OW2 O;  3GMA A;  2J59 M;  2ZT9 C;  1AFO A;  2GM4 A;  3L37 A;  4GKG A;  4J2U A;  3QYR A;  4N78 E;  4YPC A;  3D70 A;  2B87 A; 
#chains in the Genus database with same CATH homology
 3H0S A;  3QRE A;  2J5I I;  3I47 A;  4Z0M A;  1YG6 A;  1R8E A;  3PZK A;  4B3J A;  1TU3 F;  4I7Z B;  3QXZ A;  3H81 A;  1N6D A;  2IEX A;  4PV1 B;  4GHN A;  3AEG C;  4MOU A;  4K3W A;  4H13 D;  5JBX A;  4XFJ A;  4FB8 A;  5HUQ A;  3Q5R A;  2BEZ F;  2YJG A;  4DI1 A;  2G8Y A;  1ZOY C;  5M1B A;  2BEQ D;  3G64 A;  1S1C X;  3SWX A;  3Q5P A;  3TT7 A;  1MJ3 A;  1ZME C;  3LAO A;  4KPK A;  3T88 A;  1OW6 A;  4I42 A;  1PJH A;  4ZDC A;  2MKV A;  2ZL3 A;  2ZT9 D;  4K29 A;  1NZY B;  1ZP0 C;  2PPY A;  5DUF A;  4YTP C;  2J5U A;  3PEA A;  5KKZ C;  1KIL E;  1RQU A;  2WSC J;  3T89 A;  4FNB A;  5FUS A;  5DU6 A;  1YQ4 C;  4NNQ A;  3AE1 C;  3RK3 E;  1UYV A;  5KJP A;  4JCQ A;  5INF A;  3T3W A;  2VSU C;  3H25 A;  2E74 C;  2NP9 A;  4JSB A;  3KTH A;  3HLN 1;  3D6Y A;  1DIP A;  2E76 C;  4QIJ A;  4EML A;  3G9R A;  1FC7 A;  1K32 A;  2J5I A;  5DU8 A;  5L8R J;  1Y9B A;  2FYN C;  4G2R A;  1OW8 A;  1VRG A;  2VSS F;  2FZS A;  4ZDF A;  4LK5 A;  4GDO A;  3QWD A;  1FCF A;  1RJN A;  1ON9 A;  3Q1T A;  5E0S H;  3Q2Y A;  1W2X A;  2C8T A;  1MKM A;  1DD3 A;  4U0G A;  2D3T A;  3B71 A;  4R4L A;  3ST9 A;  3KQF A;  4Z1M H;  3Q1M A;  2D2C C;  3P85 A;  3AEE C;  3HE2 A;  2PG8 A;  2WPV B;  3IBB A;  3D6Z A;  3ZWB A;  5FIF A;  4NAR A;  4IL6 X;  3GKB A;  2F9I B;  3ISA A;  4K2N A;  3U9R B;  1RJM A;  4RCN A;  1YG8 A;  4RKU J;  3ZW9 A;  2GTR A;  1JXZ A;  3TLF A;  1WDM A;  2YIU C;  4MXI A;  5DU4 A;  4KT0 J;  5DTW A;  1UYS A;  2ZL2 A;  3FF6 A;  4B3I A;  3MOY A;  1FC9 A;  2E75 D;  1IK7 A;  1HZD A;  3KTG A;  2E75 B;  3JU1 A;  1X0U A;  3DJA A;  4KNP A;  4R4M A;  2QIW A;  5KDR B;  4KD6 A;  2VSS E;  1HNO A;  1FDI A;  3ZW8 A;  2FXP A;  1JB0 J;  5KDR A;  3DOR A;  3M6N A;  3BPT A;  1XX4 A;  2BZR A;  2QJK C;  3AE3 C;  1J7X A;  1XNY A;  3P5M A;  1Q90 D;  2X58 A;  4Q1I A;  3S9O A;  1SG4 A;  2FW2 A;  3Q7H A;  1UIX A;  4FZW A;  1YQ3 C;  3QMJ A;  4I7Z C;  4OGQ C;  4U18 A;  2YMK A;  4Y28 J;  3C8V A;  1GMJ A;  3QKA A;  3AE9 C;  3Q3D A;  3LW5 J;  1S5L X;  2FBM A;  3EWK A;  4ZDE A;  4ELX A;  2OQQ A;  2E75 C;  1OMI A;  1OW7 A;  3IAO A;  3N6R B;  3RRV A;  3SFE C;  3WG5 A;  1Y7O A;  1OD4 A;  4ZU2 A;  1KOR A;  1KMI Z;  3BPP A;  2ZT9 B;  3IN6 A;  1FDO A;  2F9Y B;  3T97 B;  4IZD A;  2VSS A;  4ASI A;  3L3S A;  3M6M A;  3AE6 C;  3AE7 C;  4OG1 A;  3TRR A;  4FN8 A;  3VIV A;  1K39 A;  1NZY A;  4H0L C;  2VSU A;  3TV5 A;  3STA A;  4EMP A;  3TVU A;  1EY3 A;  4FJW D;  3R6H A;  3HRX A;  4QFE A;  3R0O A;  5E0S A;  3PE8 A;  5DZK A;  1XNV A;  1AJY A;  2EJ5 A;  4H13 B;  1NYH A;  5INI A;  3D70 A;  1FC6 A;  3V5I A;  1WMK A;  2P10 A;  1NGM B;  3HIN A;  4WCZ A;  3R9T A;  2K9Y A;  1KTM A;  4IZC A;  3R4Y A;  2WSE J;  5KLI C;  3AE8 C;  3GLM A;  1ZRT E;  4ELW A;  4JWV A;  2J5G A;  2CE3 A;  4U0G H;  2QQ3 A;  4JCS A;  4HC8 A;  4JYL A;  5G1R A;  2UZF A;  3K50 A;  5C9G A;  4FZW C;  4IZB A;  2X24 A;  2IDB A;  3KTK A;  1VF5 D;  3TDC A;  4PV1 D;  4FND A;  1WDL A;  3KTJ A;  3GF3 A;  4JCR A;  3TZ3 A;  2W3P A;  2F9Y A;  1O8U A;  5JBW A;  3K8X A;  1PV3 A;  3QK8 A;  5CTC A;  4GM2 A;  1UYT A;  3AED C;  2E74 B;  4TT3 H;  5DL1 A;  3NJD A;  3MFM A;  3Q0G A;  3P2L A;  1EF9 A;  3QXI A;  5DTP A;  3FGA D;  2CBY A;  1WDK A;  4RYF A;  1ON3 A;  4WZ8 B;  2VRE A;  2FBW C;  5E0N X;  3FDU A;  4U0H A;  3D71 A;  1TYF A;  3T8B A;  2J5S A;  1OD2 A;  3MT6 A;  5DZK H;  3AE5 C;  3PGQ A;  3ZWC A;  3Q0J A;  1VF5 C;  3RL0 g;  1EXJ A;  2JO1 A;  4PV1 C;  5G1Q A;  1XNW A;  1N6E A;  4ZDD A;  2Q35 A;  3AE4 C;  2J5I B;  2Q2X A;  3R9Q A;  1DCI A;  2E76 D;  4OLQ A;  4QII A;  1RQV A;  3TVW A;  1U57 A;  4RYF H;  3AEA C;  4OGQ B;  2QSI A;  3O6Q A;  2H88 C;  2VSU F;  2QJY C;  4JVT A;  4YXD C;  3HP0 A;  4U1A A;  4FN7 A;  5G1S A;  1VL2 A;  1PL5 A;  4NEK A;  2F9I A;  3SFD C;  2A7S A;  1WZ8 A;  4F47 A;  2NZ2 A;  1DD4 A;  4H0L D;  2A7K A;  5MGB A;  2WTB A;  2D2C B;  2A81 A;  2F6Q A;  3R9S A;  3AEC C;  1HNU A;  4JCT A;  3U9T B;  2D2C D;  2G3A A;  3AEB C;  4HDT A;  4ZDB A;  3T8A A;  2VX2 A;  2WSF J;  4H44 C;  2ZQQ A;  2PBP A;  3MYB A;  4I52 A;  3IAV A;  3NJB A;  3V5E A;  2O01 J;  1UIY A;  5DKP A;  2WQY C;  1EF8 A;  2V7Q J;  3RST A;  3SLL A;  1KQG B;  1Q51 A;  2J5G D;  2E76 B;  1XO6 A;  2DUB A;  4B3H A;  1PIX A;  4Q0G A;  3H0J A;  1K04 A;  4JFC A;  4U7J A;  5DUC A;  3TT6 A;  2QJP C;  2ZL0 A;  2VSU E;  4U19 A;  3H0Q A;  4EMM A;  5ING A;  1KQF B;  1DUB A;  4JOT A;  4H0L B;  4ELS A;  4H44 D;  2DEO A;  5C90 A;  3ABV C;  4OGQ D;  2HW5 A;  1EXI A;  2E74 D;  4HNK A;  3Q5S A;  3OT6 A;  4JJT A;  1TG6 A;  5IKL B;  3KTI A;  1HF9 A;  1Q52 A;  3U9S B;  3LKE A;  3OME A;  2ZL4 A;  4H44 B;  3ZWA A;  3RSI A;  3AEF C;  1VF5 B;  2ZQR A;  4L8K A;  3BF0 A;  4OMR A;  3IB9 A;  4YLH A;  2F6I A;  1HJ0 A;  3BEZ A;  3OC7 A;  1N6F A;  5CTB A;  3GMA A;  3H02 A;  4I4Z A;  1K05 A;  2ZT9 C;  4WYO B;  2H89 C;  4H13 C;  4L6W A;  4KWB A;  4J2U A;  1SZO A;  3AE2 C;  3H0U A;  3QYR A;  2JP3 A;  2Q34 A;  4JYJ A;  4MI2 A;  1UYR A;  3GF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...