3GF3A

Glutaconyl-coa decarboxylase a subunit from clostridium symbiosum co-crystallized with glutaconyl-coa
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
585
structure length
563
Chain Sequence
b'MYSMPGYFQNMPTIGKELVNPNPENEQEIKAVESDIHESIKKALDAGITSEEKLNERGQLSAMQRINALIDPGTWCPLNSLFNPENNKFGTTNIVNGLGRVDGKWVYIVASDNKKMAGAWVPGQAENLIRCSDAAKMMHLPLIYLLNCSGVEFPNQDKVYPNRRGGGTPFFRNSELNQLGIPVIVGIYGTNPAGGGYHSISPTILIAHQDANMAVGGAGAEQIIAAQIENSKLKVPAPGSVPIHYDETGFFREVYQNDLGVIDGIKKYISYLPAYNLEFFRVDTPKAPQLPAEDLYSIIPMNQKRPYDIYEVIARLFDNSEFSEYKKGYGPEMVTGLAKVNGLLVGVIANVQGLLMNYPEYKQNSVGIGGKLYRQGLIKMNEFVTLCARDRIPLIWLQDTTGIDVGDEAEKAELLGLGQSLIYSIENSKLPSLEITIRKASAAAHYVLGGPQGNNTNVFSIGTGACEYYVMPGETAANAMYSRKLVKAQPIIGKMNDMIQMYTDKSRPKYCTEKGMVDEIVDMTEVRPYIQAFTEAAYQNPQSICPMHQMLTPRSTREFETFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutaconyl-CoA decarboxylase subunit A
molecule tags Lyase
source organism Clostridium symbiosum
publication title An asymmetric model for Na+-translocating glutaconyl-CoA decarboxylases
pubmed doi rcsb
total genus 210
structure length 563
sequence length 585
ec nomenclature ec 4.1.1.70: Transferred entry: 7.2.4.5.
pdb deposition date 2009-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.680 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Helix bin 3gf3A01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3gf3A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3gf3A03
4GM2A 3JU1A 1NZYB 4JSBA 3T3WA 5INGA 1UYRA 4ZDEA 1MJ3A 2F9YB 1HNOA 2F9IB 5DZKH 3RSIA 3U9RB 3H81A 5CTCA 3KTJA 2F6IA 3ZW8A 4FZWA 3TVUA 3NJDA 2FW2A 3KTGA 4OLQA 3DJAA 3K50A 5DU6A 2J5II 4G2RA 5JBXA 1XX4A 3R0OA 2X58A 4FJWD 5INIA 1FC6A 1Q52A 4B3IA 5DTWA 3T89A 3SWXA 4FB8A 3R9TA 1VRGA 2CE3A 4EMLA 3IB9A 4JCQA 1TYFA 4JCRA 2WTBA 3QKAA 3VIVA 2VSSF 3QMJA 2J5SA 3OT6A 3K8XA 3I47A 1XNYA 4LK5A 4ELWA 4MI2A 1EF8A 1UYVA 4JYJA 4RYFA 2VREA 5KDRA 4F47A 3OC7A 4GHNA 1RJNA 4I42A 1RJMA 2A81A 3MYBA 5G1RA 1HZDA 3P85A 3TV5A 1XNVA 4Q1IA 3H0JA 2D3TA 1YG6A 1UYSA 3BF0A 5G1SA 4IZBA 1FC9A 3T8AA 1UIYA 2UZFA 4K29A 4OG1A 5C90A 3BPPA 3RSTA 3DORA 2X24A 1Y7OA 4IZCA 3U9TB 2EJ5A 3GMAA 4NNQA 3GLMA 4ASIA 1EY3A 1OD4A 3GF3A 3M6MA 4EMPA 2J5GA 4I4ZA 4WZ8B 1FCFA 2J5IB 5DKPA 4B3JA 3LKEA 2Q34A 4L8KA 4ZU2A 1DCIA 1ON9A 3SLLA 2ZL3A 4Z0MA 4ZDDA 4QIIA 3Q0GA 2VSSE 2Q35A 4JFCA 1W2XA 5FUSA 4K2NA 3KTIA 2F9IA 1YG8A 3LAOA 3IAVA 4U19A 5KDRB 3QXZA 5E0SA 3H0SA 4YLHA 4WYOB 5IKLB 4IZDA 3PZKA 1SG4A 3QK8A 2VX2A 4WCZA 1J7XA 3OMEA 5DZKA 4RYFH 4MOUA 2BZRA 4JVTA 4QIJA 4JWVA 5C9GA 3FF6A 3QREA 1NZYA 4U0GA 3V5IA 3TZ3A 2F9YA 1Q51A 1XNWA 2ZL4A 5DU8A 2DUBA 3IBBA 3ZWCA 4KWBA 4ELSA 1K39A 2Q2XA 4Q0GA 5JBWA 4K3WA 1N6FA 4U0GH 3KTKA 3BEZA 3PGQA 5INFA 4KNPA 2HW5A 5G1QA 3TT6A 4FNBA 4U1AA 1N6EA 2F6QA 3T8BA 5E0NX 3HP0A 3ZWAA 1PIXA 5DUFA 1WZ8A 2ZQQA 3U9SB 1XO6A 3PE8A 3WG5A 2VSUF 5DUCA 3QYRA 3R9QA 3STAA 3G64A 2VSSA 4ELXA 2PBPA 3R6HA 4L6WA 1UYTA 4KD6A 2A7SA 2VSUC 1WDLA 4HNKA 1FC7A 3H02A 5KJPA 4OMRA 4FN7A 1OD2A 3TVWA 3RRVA 4JCSA 4KPKA 4RCNA 2J5GD 2PPYA 3T88A 5FIFA 5DL1A 3QWDA 3V5EA 4DI1A 2VSUA 2C8TA 2NP9A 3Q1TA 3MFMA 1PJHA 4U0HA 3R9SA 5DTPA 3H0QA 3Q0JA 2FBMA 2QQ3A 1TG6A 3PEAA 5E0SH 2ZQRA 3GF7A 2DEOA 4ZDBA 3TDCA 4MXIA 2W3PA 1WDMA 3P2LA 4HC8A 1ON3A 3H0UA 4U18A 4JYLA 3P5MA 4QFEA 4NEKA 4JOTA 3TT7A 3ZW9A 3ISAA 3MOYA 3FDUA 1EF9A 2ZL2A 1O8UA 1WDKA 3HLN1 2VSUE 1N6DA 3TLFA 2FZSA 2J5IA 3KQFA 3N6RB 1K32A 4EMMA 3TRRA 3L3SA 4FNDA 4FN8A 4JJTA 3HRXA 2ZL0A 3ZWBA 5CTBA 3M6NA 4I52A 2GTRA 1X0UA 3Q7HA 3GKBA 3MT6A 5MGBA 2PG8A 1HNUA 3HINA 1JXZA 1SZOA 5DU4A 4B3HA 2A7KA 2IEXA 1DUBA 3HE2A 4FZWC 2CBYA 3ST9A 3KTHA 4ZDCA 3QXIA 4JCTA 3NJBA 4ZDFA
chains in the Genus database with same CATH superfamily
2SPZA 4GM2A 4EYYQ 4Y99B 2N1TA 2YKPA 1FZCC 2F9YB 3RSIA 3JCUE 4DJGA 2F6IA 3KTJA 5E79E 2FW2A 1LT9C 3KTGA 1EZVE 2W6JH 3DJAA 3IN6A 3L75G 2X58A 3Q2YA 1QVGO 1FC6A 2WQYC 1VQMP 5INIA 4B3IA 3T89A 3R9TA 1FZFA 3FWLA 2HR3A 2CE3A 3VOPA 1T8ZA 4HYTB 1RF1A 5AW4B 3IR9A 1ZOYC 1J1EC 2I1JA 2OQQA 1IC2A 3K8XA 4I7ZC 1XNYA 4LK5A 1GMJA 5KJ7A 1Q82Q 3MHVA 1EF8A 3H1JE 1Q2NA 1SS1A 4F47A 2L5GB 5APWA 1SQXG 1UIXA 1HTLC 4I42A 1YYCA 1LT1A 5G1RA 5KLVG 1S4XA 4H44D 3TV5A 4HB1A 4Q1IA 1FC2C 2QJPC 4IZBA 2PFXA 2W8ZA 2RKLA 1FC9A 2J59M 1GTWA 1JY3N 1TU3F 1KFMA 3MGNA 1M90Q 1YQ3C 2H43A 4OG1A 3CXHI 3BPPA 2D2CC 3RSTA 3HD7C 2X24A 5AW0B 3B5NA 1Y7OA 1KD1Q 4DCKA 3U9TB 4QMAA 2EJ5A 2B89A 3CC7P 3I5CA 2FXMA 4AQRD 2R5DA 2JR8A 1SQXE 4I4ZA 2J5IB 2NPSA 1DCIA 3SLLA 2FYUD 4Z0MA 1URQD 1YJ9P 3H1IJ 5K5GB 1AQ5A 2E74C 1GL2B 1LTJA 3K5BA 4NPDA 4DZOA 3ZDMA 2Q7CA 1FDMA 2QA4P 4A7PA 3H0SA 1VL2A 4BRYA 3AEFC 3CX5E 1ZR2A 3NXSA 1L4AB 1EQ7A 1IJDB 3QWOC 1SG4A 1SQPG 4H0LD 1BDCA 1ZW0A 1VQ9P 4RYFH 3HTKA 4DT0A 1L0NE 1GL2D 1EZVI 2Z5HA 2ZXXA 5C9GA 3FF6A 2N9YB 1NTZJ 5M1BA 3N7NA 1PZQA 4U3FG 1CI6A 3G9RA 2P7JA 2FYUJ 1ZRTE 3TZ3A 4GKGA 4H13C 2R3CA 1KFNA 4IFDK 4YPCA 3L75E 2UWJE 1NTKK 1N7LA 1IFNA 4MN4C 1K39A 2Q2XA 3B5ND 4IL6X 2M0BA 1SQVJ 4U0GH 4WB4A 4BWNA 1FDOA 3JSVC 3TT6A 4FNBA 1FZGA 2QG4A 3D70A 2F6QA 3BRVB 3VP9A 5KAFE 1E5WA 1JMBA 5E0NX 3ZWAA 1GZLA 1SQQG 2YXQB 3KZIH 1WZ8A 1USDA 2A06G 1YQ4C 1VQLP 2YIUC 2CK3H 3WG5A 2YXRB 3L72E 2QEXP 3G4SP 1M1JB 2E76D 1T3UA 2JEEA 3P32A 4WY4C 1AA0A 3CLQA 3MD0A 3W68A 5AW5B 4ELXA 1DEBA 2PBPA 5KLIB 1NTMK 2ZT9B 1EDLA 3R2PA 3AEGC 1WT6A 3CWBD 3M0DA 2PAJA 3UIAA 3I55P 1FJPA 4U3FE 1N73B 1RF0A 1NTMD 2C0WA 4C46A 1SQBG 4NPFX 1KORA 3HE5B 3TK1A 4HJGH 2J58A 4FN7A 4IL6H 1S1CX 3II6A 3RRVA 1RE4C 4JCSA 1R5LA 1FJKA 2J5GD 1FE6A 5FIFA 5AW7B 1MUUA 3OW2O 1GK6A 3KQGA 3LW5J 1NKZB 4OWFA 2LXBA 3H1HE 1IFDA 2QE7H 3MUDA 5DTPA 1ZRTD 2KZIA 3H0QA 2IBZG 2ZAEB 3Q0JA 1SQXJ 4H13D 2QQ3A 3PTZA 3H1HJ 3PEAA 1HF9A 2QVAA 4PJ0E 1VQ8P 3RK3B 4PV1D 1PPJD 2WMMA 2Y0CA 1EDIA 4R4MA 3B5NC 3A0BH 3L73J 1H0TA 3RK3E 2N1TC 3L70G 5TISH 4JYLA 3R4YA 1BE3D 5AVUB 2OYIC 4QFEA 2C9LY 1NGMB 1A02J 3ISAA 2KSJA 1P84H 2M3BA 2XNXA 5KLVJ 3B71A 2D2CD 4U3FJ 1WRGA 3EFGA 1PGOA 5APQA 3AEAC 1WDKA 3BCCG 2VSUE 2VRSA 1N6DA 2FXPA 2KYVA 3AEDC 3KQFA 2XKMA 2E76C 1ZLLA 4L73A 3TRRA 1OX3A 2Y9ZA 2ZVNB 2Y0DA 4FNDA 2QJYC 3P8CD 1M1KQ 2ZL0A 3AE3C 1YITP 1S2EA 2KB7P 3M6NA 2NPSC 3M9HA 1KYOE 5APXA 2GTRA 5KLIC 1KMIZ 3A0BE 1PFIA 1JO5A 2PG8A 1IK7A 1HNUA 2O3JA 2Q3IA 1SFCB 2K1AA 5AW8B 1DUBA 4FZWC 3ITKA 4J2UA 3KHUA 1YHQP 1GD2E 1N7SA 1G1IA 2M5AB 1EDJA 3KTHA 3QXIA 2WT7B 2O01J 1NZYB 3C8VA 4UB6H 1UYRA 4ZDEA 1OFCX 1MJ3A 3T97A 3H81A 4K35A 3HRNA 3ZW8A 2FFDA 1JCCA 2QJKB 3NJDA 3L36A 3TGUD 1OZHA 5TISE 3K50A 2NZ2A 5DU6A 4N3YB 2ZYGA 4D6TJ 3D71A 1S5LX 5JBXA 1NJIQ 2A45I 1XX4A 3R0OA 3N4XA 3L70J 1Q52A 2AEJA 2POHA 2C9NY 4EMLA 1FZCA 2E42A 2FYUE 2RH0A 1DD3A 2QJYB 2J5UA 3QKAA 1HVVA 1N2DC 2W27A 3G3ZA 3L71E 3VIVA 1NHLA 1RHZB 2QSIA 2VSSF 3MTUE 1L0NJ 1BGYG 4KT0J 3OT6A 5AVVB 2KP8A 3E1RA 1VPCA 1H88A 2YO2A 4ELWA 4MI2A 1EZVG 3H1HD 1CW5A 1LTJB 5AVTB 1LTSC 4D6TG 5KDRA 2WSFH 1NTZG 4GHNA 1SLQA 2KXPB 1JY2P 3CCQP 3H25A 3M06A 4U7JA 1KQGB 3EFFK 2ZT9C 3P85A 1L4AA 4GT1A 1N86A 1SQPD 3BPTA 2E43A 4I7ZB 4LC1A 4JYCA 3T8AA 2FYNB 1SQPK 2UZFA 1M1JC 2WTYA 4AYCA 1JY3P 1KILA 4NNQA 1LTIC 1U7JA 1EY3A 2Z5IA 5H2FE 3F89A 3TYYA 1T2KC 1VQKP 2J5GA 1HUCA 4YXWH 4B3JA 2Q34A 3KZIE 2ZL3A 2JP3A 1HGVA 4ZDDA 1U57A 3H1HG 3CPWO 2LXCB 4LGDE 4Y99C 2KK7A 1DD4A 1T6AA 3KTIA 1SQXD 2F9IA 2OARA 3L37A 3IAVA 4U19A 5AW6B 3PRJA 3QXZA 1SQBD 4YLHA 1SQQE 4W7YA 2ZXEB 3HE4B 1QL2A 3PZKA 5CJ4A 3BATA 1AVYA 1JCDA 1YTZT 4WCZA 4OGQB 4ASWA 1PPJE 4I1LA 3KPEA 4R4LA 4XFJA 1HWTC 2N1TD 1Y8AA 2IBZE 2BZRA 4JVTA 1G1JA 1NTZK 2Y9YA 3MP7B 3HUSA 1K73Q 1EZVD 4XE5B 1BE3E 2MKVA 3CD6P 1IFJA 3NFQA 5DU8A 1SQVE 2MJZA 3IBBA 1QGKB 4M3LA 1LNQA 4WWIA 1S72P 1H89A 4EI2A 3L71G 2E74B 3CX5H 1CSBA 3W67A 3H32A 2FYUG 1AV1A 1L0NG 1FZAA 3KTKA 3HUSB 3OAKA 2WSEJ 4KNPA 3V2PA 4ZMDA 4U1AA 2M8RA 3VTPC 3T8BA 3L70D 2W6BA 3HP0A 3M0DC 3VMZA 1URQA 1NU1J 1LP1B 1IK9A 2WSCJ 3IAOA 4JQ0D 3PE8A 2BCCJ 1X0TA 5AVRB 5DUCA 1JY2O 1OW6A 2WSSH 5CCHD 4Z1MH 4K3AA 1NU1G 3P8MC 1K05A 2O01H 3H1KD 1KN7A 1SQVG 3WU2E 3R6HA 3PHLA 4L6WA 3RL0C 2OTKE 2VSUC 2KIKA 1WDLA 5KJPA 4L75A 1KZUB 1JOCA 1NTKE 1BSHA 4C7NA 1FBMA 4GDOA 2W90A 2YMKA 2XNDH 4BRYB 4RCNA 2WVRA 1VQNP 3T88A 2YO3A 1A02F 4RESB 3VN0A 4L74A 2Q1KA 3QWDA 4AUWA 2C8TA 3CCVP 1L0LG 1FZBA 2HPCA 2WPSA 2NP9A 3BRTB 5AVQB 1KYOI 2G3AA 3H1KE 3S9OA 1UIIA 1NOHA 5CCGA 3RL0B 4UB8E 5E0SH 5CHXA 2WSFJ 2ZQRA 4ZNCA 2DEOA 5KKZC 2IYOA 4MXIA 3P2LA 1LWUB 1KQFB 1ON3A 3H1LJ 1KYOD 2A45G 3B4SA 1OW7A 2ZT9D 3MZWB 5KAIE 2AEMA 4HH2A 1R8EA 2H7HA 2JKVA 2HYNA 1P84D 3IF4A 4NEKA 4JOTA 1P84I 2FKWB 1KTMA 3V2NA 3L74G 1BCCE 1DH3A 3RK2D 1Q90D 3E1IA 3O6QA 1EF9A 2ZL2A 1SQVK 1O8UA 3M9QA 3HLN1 2J5IA 1PP9E 5CCHC 3N6RB 1J1EB 2PP6A 2W6AA 4EMMA 2YNYA 1ZN5A 1ZV8A 4D6TD 1RY3A 3GHGA 4JJTA 1SQBJ 3KDPB 3CXHE 1KB9I 3BCCJ 5CTBA 1JY3O 5KJ7D 4ASVA 1X79B 5HUQA 1N73A 1HBWA 4PD4I 1VF5C 1X0UA 1FDIA 1S3JA 3L74J 1RQUA 2IPPA 3G6EP 5DJUB 1W2EA 2KS1A 3L72G 4W7ZA 4NPEA 3LW5H 1AQTA 5MGBA 3HINA 1JXZA 5CBOA 2IEXA 2M3EA 2V7QH 2CBYA 3EQ2A 1KQSO 1P84E 3GHGC 4WY4D 1NTZD 1JNMA 4JCTA 4ZDFA 4GOFA 1BGYE 4JSBA 1GU5A 4EOTA 1LWUC 3JC22 2R3SA 3G71P 5DZKH 5CBNA 3U9RB 5CTCA 5KKZB 1SP4A 4FZWA 1J2JB 3NTNA 4B86A 3HUSC 1G2CB 4RO0A 2KLVA 3CCRP 4FJWD 2BCCG 1DX7A 3SWXA 3SWYA 3CMEP 3GG2A 2WTBA 3SFDC 2IZ0A 4XA4A 2E5TA 4RKUJ 2B87B 5EFWB 1X9VA 1S9KE 3QMJA 2E5YA 1D7MA 4N6JA 3I47A 5GTHH 1M1JA 1DEEG 1W2BO 1UYVA 1PGJA 4RYFA 3AE6C 2VREA 1RF1B 1OVVA 4IL6E 1NTME 3OC7A 4BXLA 2E75D 3AE7C 3CWBE 1N7SB 2HODA 1RJMA 4ZKPA 2AEFA 2A81A 3A0HH 2B87A 2WT7A 1HZDA 2Y0EA 2OTJP 1YG6A 1UYSA 1QX8A 2XDJA 3H6PA 1KB9D 2AXTH 5KJ7C 1UIYA 1K8AQ 1NO4A 4K29A 5C90A 4JPZB 1GK4A 3LIEA 3DORA 3D6ZA 1NKNA 3FXEA 5CCGC 1JMMA 1NTZE 3CX5D 1RH5B 5AW3B 2BASA 3GLMA 1RQVA 3AECC 4EMPA 2G8YA 1H8AA 4WZ8B 3H1IG 3PP5A 1FCFA 2P2UA 4L8KA 3AE2C 3SWKA 1ON9A 2YMYA 1L0ND 1FS0E 1BGYD 3A0HE 2OYHB 2YJGA 3H1KG 4QIIA 4YXDC 1HGZA 2Q9IA 4JFCA 3L75D 5FUSA 1PL5A 3CX5I 5AW2B 4K2NA 2IX7C 2BCCD 3VMAA 3V2RA 2OYIA 1YG8A 1NTMG 5KDRB 5BU8B 5E0SA 3L35A 2CPSA 1FOSF 3H1LG 4IZDA 1PV3A 3L73G 2RMZA 3VP8A 2IFMA 1CI6B 3CCLP 2KS1B 3OMEA 2HFED 2P67A 1VQ4P 4MOUA 3RGUA 4QIJA 1Z56A 1L0LJ 5AVXB 2QRXA 3QREA 1JTHA 3AE5C 4U0GA 1M7LA 3L4FA 3U1AA 2F9YA 1Q51A 2ZL4A 2WZ7A 2DUBA 1JEKA 2WPQA 3ZWCA 2IBZD 1KILB 4KWBA 3CCJP 4Q0GA 2KUBA 3CCMP 1PP9G 2K9YA 3CCEP 1IFPA 2WSCH 4GIFA 3A7OA 1PGQA 2P58A 3MUDC 1KB9E 3H1JJ 3BEZA 5INFA 3PLNA 1N6EA 3H1LE 1XTGB 1L0LD 2K88A 2R44A 1NVOA 3V4QA 3PJSK 1K04A 1PIXA 5DUFA 1VQPP 4TT3H 4GOEA 1VF5D 1BE3G 3WUUA 3HD7D 3NMDA 2BEZF 3SWFA 2PGDA 1CZQA 2KI7B 2XU6A 2ZJSE 4OGQD 3M0AA 3B5NB 1OVUA 2E75B 2FYNC 1SFCC 1J1DC 1PPJG 1M56D 3STAA 2LR2A 1KILE 3Q3DA 2VSSA 3S1KA 1URQC 2Z4EA 1MFZA 2Q5UA 2NPSB 1T3JA 1VQ5P 2A7SA 1NTMJ 1QL1A 2E74D 3CL3D 1FC7A 3H02A 2ITAA 1OVRA 5CJ0A 1BCCD 4IOIH 1LTJC 3TVWA 3L73D 1BSNA 3L74D 1Q86Q 5AVWB 1LTGC 2PPYA 2OYOA 3O8ZA 1BDDA 2IZ1A 3TNUA 4EDFA 5DL1A 3BCCD 4I6MC 5APSA 3V5EA 4DI1A 2VSUA 3T97B 5APVA 1USEA 4RJTA 3Q1TA 2FFDC 2K37A 4U0HA 2XV5A 3R9SA 1S9KD 4HKZH 1GDTA 2FY8A 2WITA 1SQBE 1YI2P 1URQB 1FU1A 3FXDA 1TG6A 3OJAB 3VMYA 1VQOP 1NH4A 1FOSE 1LGHB 2QJKC 5E79H 4WY4B 3TDCA 2E75C 5APYA 3ABVC 5B5EH 4JF7A 3RK3C 2QIWA 2R32A 1IFIA 1S5LH 1VQ7P 1WDMA 4HC8A 3V6IA 1LTBC 1BCCJ 1DIPA 3RBXA 4H44C 4U18A 3BCCE 4IFFA 5KAIH 2LKMA 2Q3EA 2KNCB 2ZYDA 3CXHH 4D6TE 3PH0A 3MOYA 1QLED 1PP9J 4WBAA 3CCUP 1IO4A 1VDFA 2YKQA 3TGUJ 4TLFA 1LTTC 1NYHA 1MZ9A 2ZYAA 3CCSP 3TLFA 2L91A 3VYIA 4IFMA 5B66H 2K9JA 5CMZA 1K32A 1JTHB 4UB8H 1SFCD 1N8RQ 3HRXA 3V2QA 2KNCA 3WU2H 2W83C 1OWAA 4LLHA 1N73C 5GTIH 2XZRA 3C1LA 3HD7A 2M5AA 3A3YB 2HLOA 3AE9C 3Q7HA 4N78E 3GKBA 1JB0J 3H1JD 1RF0C 1SQQJ 3HE4A 2HG5D 2JDIH 1OW8A 1J1DB 4PD4E 4C7NB 2A7KA 3HE2A 1R5SA 3V4WA 1L4AC 5APUA 3ST9A 1LTAC 1M8OB 3AE8C 3L72J 3B8EB 3M9BA 3H1KJ 2OGUA 2HODB 4H44B 3JU1A 3T3WA 3JCUH 5INGA 1IFMA 1GL2C 2WWWA 1HNOA 2F9IB 5B5EE 1GL2A 1NAFA 3TVUA 1KILD 3A5TA 2O01N 4OLQA 2KZJA 3P8CE 1VQ6P 2J5II 1XTCC 3AEBC 4G2RA 3CMAP 2FYZA 3CC4P 5DTWA 2ZFCA 4FB8A 3RK3D 1VRGA 2FFDB 1LWUA 1QEXA 4H13B 2DW3A 3IB9A 4JCQA 1TYFA 4JCRA 3VMXA 2PRRA 3L75J 3TF5A 3H1ID 2E76B 1L0LE 4W80A 2GUSA 4OH8B 1Y9BA 2J5SA 1SQXK 2H88C 2OYHA 2N9BA 1Q7YQ 1EDKA 3O6QB 4JYJA 1RJNA 4WVZA 2GUVA 3KYQA 2OYIB 1M57D 2JO1A 1U7MA 2P10A 1ZR4A 3MYBA 3KXDA 3P7KA 1RF1C 2N1TB 3CI9A 3L71J 1XNVA 3H0JA 2D3TA 2I8DA 3BF0A 5G1SA 2O1JA 1N7SD 1NTKD 2IYPA 3H1JG 1ZXGA 3OA7A 3WUTA 4DOJA 2H8PD 4N78D 3TGUG 1AJYA 4EIJA 2IBZI 1KB9H 2I1KA 3V5BA 1NU1E 2GA1A 1PGPA 4U3FD 2YIUB 2WSEH 3TSIA 4IZCA 1OMIA 2P1JA 3GMAA 3FWNA 3CXHD 4PJ0H 2HPCB 1BE3J 4ASIA 1OD4A 2KSEA 1NWQA 4NARA 3GF3A 3M6MA 3CWBJ 2QM7A 1YIJP 5C39A 5DKPA 3M91A 3LKEA 4ZU2A 3RBZA 3Q5PA 1GU4A 3SFEC 1YBKA 1ZMEC 1YJWP 5KTBA 2C0XA 3A2AA 5L8RJ 3S4RA 3Q0GA 2VSSE 2Q35A 5H2FH 1W2XA 1KILC 3Q1MA 5KLVK 3LAOA 2JWAA 4L76A 5AVYB 4WYOB 4PV1C 5IKLB 1AFOA 1NTKJ 1X8YA 1EXIA 3QK8A 2VX2A 1J7XA 5AW1B 2ZVOB 1NU1D 2JJLA 5DZKA 2JWDA 3USSA 4JWVA 1SQVD 2CPBA 1NZYA 3H32B 3Q5RA 3V5IA 3HE5A 1Q81Q 1JM0A 1XNWA 2GM4A 3SSUA 3C9IA 1BCCG 5AVZB 4ELSA 2FXOA 3E7KA 5JBWA 4K3WA 1NTKG 1KV4A 3QH9A 1H0TB 1N6FA 1LP1A 1KQLA 3PGQA 2HW5A 5G1QA 3TNUB 5KAFH 1W5CE 3U59A 1E79H 2KOGA 2AXTE 1FZCB 3D6YA 3L73E 1RE3C 2NPSD 3L74E 5BU5A 4OVNF 1NAYA 2B88A 3RK2C 2ZQQA 3LIDA 3U9SB 1XO6A 1L0NK 1SQQK 3F5HA 2VSUF 3GHGB 3QYRA 1K9MQ 3I56P 4H0LB 2BEQD 1SVFA 3HTKB 5GTHE 4PD4H 3Q5SA 1L4AD 4O9BA 3AE1C 3R9QA 1FAVA 1T2KD 1LJ2A 4WY4A 2OTLP 2KLUA 1GW3A 3G64A 1MFTA 2A06E 3AEEC 4UB6E 1L2PA 1UYTA 4KD6A 1YTZI 4HNKA 2O1KA 4OMRA 4YTPC 1NU1K 1OD2A 3H1LD 3TDKA 1SFCA 2K3RA 4HDTA 1EC5A 4JYBA 4KPKA 1X22A 2OYHC 4ZKUA 1FZEA 2K9JB 5BVZA 3CC2P 1HJ0A 3MFMA 1GW4A 2V7QJ 1G2CA 3WUVA 1PJHA 2A06D 1SQPJ 5AVSB 1YJNP 5TJHA 2FYUK 3L71D 1WMKA 2FBMA 3HD7B 1PP9D 1S5LE 2D2CB 3L72D 1Y47A 4PD4D 3GF7A 1L0LK 4ZDBA 2NRGA 4H0LC 1BGYJ 2W3PA 1JY2N 3U1CA 2QJPB 1SQBK 5KLVE 3H0UA 3CWBG 1KYOH 5CCHA 3RK2B 1HJBA 1SQQD 2YKOA 1N7SC 2B9BA 3P5MA 1SQPE 1AVOA 3TT7A 3ZW9A 3TGUE 1IZNB 3BVHA 4I2LC 2V4HA 1OXZA 2IDBA 3EWKA 2WPVB 3WMM0 3FDUA 3IFMA 1HH0A 3MIWA 3GW6A 3AE4C 2FZSA 1OIPA 4CPGA 1VF5B 4Y28J 1LT9A 2R5BA 2QM8A 3FGAD 5DJTB 3L3SA 1RE4A 5GTIE 4FN8A 2Q6QA 4C7RA 1KC8Q 1RE3A 3ZWBA 2BCCE 4JBZA 1MV8A 5APTA 1MKMA 5KLVD 3RL0D 4KHXA 2AXCA 2A45H 4I52A 5B66E 2FBWC 3MT6A 2IFNA 1ZP0C 3BASA 1LT9B 3RL0g 1QVFO 1SZOA 5CCGD 5DU4A 4B3HA 4OGQC 1JUNA 3L70E 4GODA 4KJMA 1EXJA 3FX0A 4PV1B 3H1IE 5AW9B 4ZDCA 2WPRA 2H89C 3NJBA 2RN0A
chains in the Genus database with same CATH topology
4GM2A 4H44B 3JU1A 1NZYB 4JSBA 3T3WA 3C8VA 5INGA 1UYRA 4ZDEA 1MJ3A 2F9YB 1HNOA 2F9IB 5DZKH 3RSIA 3U9RB 3H81A 5CTCA 3KTJA 2F6IA 3ZW8A 4FZWA 3TVUA 3NJDA 2FW2A 3KTGA 4OLQA 3DJAA 3K50A 2NZ2A 5DU6A 3IN6A 2J5II 3AEBC 3D71A 1S5LX 4G2RA 5JBXA 1XX4A 3R0OA 2X58A 3Q2YA 4FJWD 1FC6A 2WQYC 5INIA 1Q52A 4B3IA 5DTWA 3T89A 3SWXA 4FB8A 3R9TA 1VRGA 2CE3A 4EMLA 4H13B 3IB9A 4JCQA 1TYFA 4JCRA 1DD3A 2WTBA 2J5UA 3QKAA 3SFDC 4RKUJ 1ZOYC 2E76B 3VIVA 2QSIA 2VSSF 1Y9BA 2OQQA 3QMJA 2J5SA 4KT0J 3OT6A 3K8XA 3I47A 2H88C 4I7ZC 1XNYA 4LK5A 1GMJA 4ELWA 4MI2A 1EF8A 1UYVA 4JYJA 4RYFA 3AE6C 2VREA 5KDRA 4F47A 3OC7A 4GHNA 1RJNA 1UIXA 2E75D 4I42A 3H25A 3AE7C 4U7JA 2JO1A 1KQGB 1RJMA 2P10A 2A81A 3MYBA 5G1RA 1HZDA 2ZT9C 4H44D 3P85A 3TV5A 1XNVA 4Q1IA 3H0JA 2D3TA 1YG6A 1UYSA 3BF0A 2QJPC 3BPTA 5G1SA 4I7ZB 4IZBA 1FC9A 3T8AA 1UIYA 1TU3F 2UZFA 1AJYA 4K29A 1YQ3C 4OG1A 5C90A 3BPPA 2D2CC 3RSTA 3DORA 3D6ZA 2X24A 1Y7OA 4IZCA 3U9TB 1OMIA 2EJ5A 3GMAA 4NNQA 3GLMA 1RQVA 4ASIA 1EY3A 1OD4A 4NARA 3AECC 3GF3A 3M6MA 2G8YA 4EMPA 2J5GA 4I4ZA 4WZ8B 1FCFA 2J5IB 5DKPA 4B3JA 3LKEA 2Q34A 4L8KA 4ZU2A 3AE2C 3Q5PA 1DCIA 3SFEC 1ON9A 3SLLA 2ZL3A 4Z0MA 1ZMEC 2JP3A 4ZDDA 2YJGA 5L8RJ 4QIIA 4YXDC 3Q0GA 2E74C 1U57A 2VSSE 2Q35A 4JFCA 1W2XA 5FUSA 1PL5A 1DD4A 4K2NA 3KTIA 2F9IA 3Q1MA 1YG8A 3LAOA 3IAVA 4U19A 5KDRB 3QXZA 5E0SA 3H0SA 4YLHA 1VL2A 4WYOB 3AEFC 4PV1C 5IKLB 4IZDA 1PV3A 3PZKA 1SG4A 4H0LD 1EXIA 3QK8A 2VX2A 4WCZA 4OGQB 1J7XA 3OMEA 4R4LA 4XFJA 4RYFH 5DZKA 4MOUA 2BZRA 4JVTA 4QIJA 4JWVA 5C9GA 3FF6A 5M1BA 3QREA 1NZYA 3AE5C 4U0GA 3Q5RA 3V5IA 3G9RA 1ZRTE 3TZ3A 2MKVA 2F9YA 4H13C 2ZL4A 1Q51A 1XNWA 5DU8A 2DUBA 3IBBA 3ZWCA 4KWBA 4ELSA 1K39A 2Q2XA 4Q0GA 2E74B 5JBWA 4K3WA 2K9YA 4IL6X 1N6FA 4U0GH 3KTKA 3BEZA 1FDOA 3PGQA 5INFA 2WSEJ 4KNPA 2HW5A 5G1QA 3TT6A 4FNBA 4U1AA 1N6EA 3D70A 3D6YA 2F6QA 3T8BA 5E0NX 3HP0A 1K04A 3ZWAA 1PIXA 5DUFA 4TT3H 1VF5D 1WZ8A 2WSCJ 2ZQQA 2BEZF 1YQ4C 2YIUC 3U9SB 3IAOA 1XO6A 3PE8A 3WG5A 2VSUF 5DUCA 4OGQD 3QYRA 1OW6A 4Z1MH 4H0LB 2BEQD 2E75B 2E76D 3Q5SA 2FYNC 3AE1C 3R9QA 1K05A 3STAA 1KILE 3G64A 3Q3DA 2VSSA 4ELXA 2PBPA 3AEEC 3R6HA 2ZT9B 4L6WA 3AEGC 1UYTA 4KD6A 2A7SA 2VSUC 1WDLA 2E74D 4HNKA 1KORA 1FC7A 3H02A 5KJPA 4OMRA 4YTPC 4FN7A 1OD2A 3TVWA 1S1CX 4GDOA 3RRVA 4HDTA 2YMKA 4JCSA 4KPKA 4RCNA 2J5GD 2PPYA 3T88A 5FIFA 5DL1A 3QWDA 3V5EA 4DI1A 2VSUA 3LW5J 3T97B 2C8TA 2NP9A 1HJ0A 2G3AA 3Q1TA 3MFMA 2V7QJ 3S9OA 1PJHA 4U0HA 3R9SA 5DTPA 3H0QA 1WMKA 3Q0JA 2FBMA 4H13D 2QQ3A 1TG6A 3PEAA 5E0SH 1HF9A 2WSFJ 2D2CB 2ZQRA 4PV1D 3GF7A 2DEOA 2QJKC 4ZDBA 3TDCA 5KKZC 2E75C 4R4MA 3ABVC 4H0LC 4MXIA 2QIWA 2W3PA 1WDMA 3P2LA 4HC8A 1KQFB 1ON3A 3H0UA 3RK3E 1DIPA 1OW7A 2ZT9D 4H44C 4U18A 4JYLA 3R4YA 1R8EA 3P5MA 4QFEA 4NEKA 1NGMB 4JOTA 3TT7A 3ZW9A 3ISAA 3MOYA 1KTMA 2IDBA 3B71A 3EWKA 2WPVB 2D2CD 3FDUA 1Q90D 1EF9A 3O6QA 2ZL2A 3AEAC 1O8UA 1WDKA 3HLN1 3AE4C 1NYHA 2VSUE 1N6DA 2FXPA 3TLFA 2FZSA 2J5IA 3AEDC 3KQFA 1VF5B 3N6RB 2E76C 4Y28J 1K32A 4EMMA 3FGAD 3TRRA 3L3SA 4FNDA 2QJYC 4FN8A 4JJTA 3HRXA 2ZL0A 3ZWBA 3AE3C 5CTBA 1MKMA 3M6NA 5HUQA 4I52A 2GTRA 1VF5C 2FBWC 5KLIC 1KMIZ 1X0UA 1FDIA 3AE9C 3Q7HA 3GKBA 3MT6A 1RQUA 1JB0J 5MGBA 2PG8A 1IK7A 1ZP0C 1HNUA 1OW8A 3RL0g 3HINA 1JXZA 1SZOA 5DU4A 4B3HA 4OGQC 2A7KA 2IEXA 1DUBA 3HE2A 4FZWC 2CBYA 4J2UA 1EXJA 3ST9A 4PV1B 3KTHA 3AE8C 4ZDCA 3QXIA 2H89C 4JCTA 3NJBA 4ZDFA 2O01J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GM2 A;  3JU1 A;  1NZY B;  4JSB A;  3T3W A;  5ING A;  1UYR A;  4ZDE A;  1MJ3 A;  2F9Y B;  1HNO A;  2F9I B;  5DZK H;  3RSI A;  3U9R B;  3H81 A;  5CTC A;  3KTJ A;  2F6I A;  3ZW8 A;  4FZW A;  3TVU A;  3NJD A;  2FW2 A;  3KTG A;  4OLQ A;  3DJA A;  3K50 A;  5DU6 A;  2J5I I;  4G2R A;  5JBX A;  1XX4 A;  3R0O A;  2X58 A;  4FJW D;  5INI A;  1FC6 A;  1Q52 A;  4B3I A;  5DTW A;  3T89 A;  3SWX A;  4FB8 A;  3R9T A;  1VRG A;  2CE3 A;  4EML A;  3IB9 A;  4JCQ A;  1TYF A;  4JCR A;  2WTB A;  3QKA A;  3VIV A;  2VSS F;  3QMJ A;  2J5S A;  3OT6 A;  3K8X A;  3I47 A;  1XNY A;  4LK5 A;  4ELW A;  4MI2 A;  1EF8 A;  1UYV A;  4JYJ A;  4RYF A;  2VRE A;  5KDR A;  4F47 A;  3OC7 A;  4GHN A;  1RJN A;  4I42 A;  1RJM A;  2A81 A;  3MYB A;  5G1R A;  1HZD A;  3P85 A;  3TV5 A;  1XNV A;  4Q1I A;  3H0J A;  2D3T A;  1YG6 A;  1UYS A;  3BF0 A;  5G1S A;  4IZB A;  1FC9 A;  3T8A A;  1UIY A;  2UZF A;  4K29 A;  4OG1 A;  5C90 A;  3BPP A;  3RST A;  3DOR A;  2X24 A;  1Y7O A;  4IZC A;  3U9T B;  2EJ5 A;  3GMA A;  4NNQ A;  3GLM A;  4ASI A;  1EY3 A;  1OD4 A;  3GF3 A;  3M6M A;  4EMP A;  2J5G A;  4I4Z A;  4WZ8 B;  1FCF A;  2J5I B;  5DKP A;  4B3J A;  3LKE A;  2Q34 A;  4L8K A;  4ZU2 A;  1DCI A;  1ON9 A;  3SLL A;  2ZL3 A;  4Z0M A;  4ZDD A;  4QII A;  3Q0G A;  2VSS E;  2Q35 A;  4JFC A;  1W2X A;  5FUS A;  4K2N A;  3KTI A;  2F9I A;  1YG8 A;  3LAO A;  3IAV A;  4U19 A;  5KDR B;  3QXZ A;  5E0S A;  3H0S A;  4YLH A;  4WYO B;  5IKL B;  4IZD A;  3PZK A;  1SG4 A;  3QK8 A;  2VX2 A;  4WCZ A;  1J7X A;  3OME A;  5DZK A;  4RYF H;  4MOU A;  2BZR A;  4JVT A;  4QIJ A;  4JWV A;  5C9G A;  3FF6 A;  3QRE A;  1NZY A;  4U0G A;  3V5I A;  3TZ3 A;  2F9Y A;  1Q51 A;  1XNW A;  2ZL4 A;  5DU8 A;  2DUB A;  3IBB A;  3ZWC A;  4KWB A;  4ELS A;  1K39 A;  2Q2X A;  4Q0G A;  5JBW A;  4K3W A;  1N6F A;  4U0G H;  3KTK A;  3BEZ A;  3PGQ A;  5INF A;  4KNP A;  2HW5 A;  5G1Q A;  3TT6 A;  4FNB A;  4U1A A;  1N6E A;  2F6Q A;  3T8B A;  5E0N X;  3HP0 A;  3ZWA A;  1PIX A;  5DUF A;  1WZ8 A;  2ZQQ A;  3U9S B;  1XO6 A;  3PE8 A;  3WG5 A;  2VSU F;  5DUC A;  3QYR A;  3R9Q A;  3STA A;  3G64 A;  2VSS A;  4ELX A;  2PBP A;  3R6H A;  4L6W A;  1UYT A;  4KD6 A;  2A7S A;  2VSU C;  1WDL A;  4HNK A;  1FC7 A;  3H02 A;  5KJP A;  4OMR A;  4FN7 A;  1OD2 A;  3TVW A;  3RRV A;  4JCS A;  4KPK A;  4RCN A;  2J5G D;  2PPY A;  3T88 A;  5FIF A;  5DL1 A;  3QWD A;  3V5E A;  4DI1 A;  2VSU A;  2C8T A;  2NP9 A;  3Q1T A;  3MFM A;  1PJH A;  4U0H A;  3R9S A;  5DTP A;  3H0Q A;  3Q0J A;  2FBM A;  2QQ3 A;  1TG6 A;  3PEA A;  5E0S H;  2ZQR A;  3GF7 A;  2DEO A;  4ZDB A;  3TDC A;  4MXI A;  2W3P A;  1WDM A;  3P2L A;  4HC8 A;  1ON3 A;  3H0U A;  4U18 A;  4JYL A;  3P5M A;  4QFE A;  4NEK A;  4JOT A;  3TT7 A;  3ZW9 A;  3ISA A;  3MOY A;  3FDU A;  1EF9 A;  2ZL2 A;  1O8U A;  1WDK A;  3HLN 1;  2VSU E;  1N6D A;  3TLF A;  2FZS A;  2J5I A;  3KQF A;  3N6R B;  1K32 A;  4EMM A;  3TRR A;  3L3S A;  4FND A;  4FN8 A;  4JJT A;  3HRX A;  2ZL0 A;  3ZWB A;  5CTB A;  3M6N A;  4I52 A;  2GTR A;  1X0U A;  3Q7H A;  3GKB A;  3MT6 A;  5MGB A;  2PG8 A;  1HNU A;  3HIN A;  1JXZ A;  1SZO A;  5DU4 A;  4B3H A;  2A7K A;  2IEX A;  1DUB A;  3HE2 A;  4FZW C;  2CBY A;  3ST9 A;  3KTH A;  4ZDC A;  3QXI A;  4JCT A;  3NJB A;  4ZDF A; 
#chains in the Genus database with same CATH topology
 2SPZ A;  4GM2 A;  4EYY Q;  4Y99 B;  2N1T A;  2YKP A;  1FZC C;  2F9Y B;  3RSI A;  3JCU E;  4DJG A;  2F6I A;  3KTJ A;  5E79 E;  2FW2 A;  1LT9 C;  3KTG A;  1EZV E;  2W6J H;  3DJA A;  3IN6 A;  3L75 G;  2X58 A;  3Q2Y A;  1QVG O;  1FC6 A;  2WQY C;  1VQM P;  5INI A;  4B3I A;  3T89 A;  3R9T A;  1FZF A;  3FWL A;  2HR3 A;  2CE3 A;  3VOP A;  1T8Z A;  4HYT B;  1RF1 A;  5AW4 B;  3IR9 A;  1ZOY C;  1J1E C;  2I1J A;  2OQQ A;  1IC2 A;  3K8X A;  4I7Z C;  1XNY A;  4LK5 A;  1GMJ A;  5KJ7 A;  1Q82 Q;  3MHV A;  1EF8 A;  3H1J E;  1Q2N A;  1SS1 A;  4F47 A;  2L5G B;  5APW A;  1SQX G;  1UIX A;  1HTL C;  4I42 A;  1YYC A;  1LT1 A;  5G1R A;  5KLV G;  1S4X A;  4H44 D;  3TV5 A;  4HB1 A;  4Q1I A;  1FC2 C;  2QJP C;  4IZB A;  2PFX A;  2W8Z A;  2RKL A;  1FC9 A;  2J59 M;  1GTW A;  1JY3 N;  1TU3 F;  1KFM A;  3MGN A;  1M90 Q;  1YQ3 C;  2H43 A;  4OG1 A;  3CXH I;  3BPP A;  2D2C C;  3RST A;  3HD7 C;  2X24 A;  5AW0 B;  3B5N A;  1Y7O A;  1KD1 Q;  4DCK A;  3U9T B;  4QMA A;  2EJ5 A;  2B89 A;  3CC7 P;  3I5C A;  2FXM A;  4AQR D;  2R5D A;  2JR8 A;  1SQX E;  4I4Z A;  2J5I B;  2NPS A;  1DCI A;  3SLL A;  2FYU D;  4Z0M A;  1URQ D;  1YJ9 P;  3H1I J;  5K5G B;  1AQ5 A;  2E74 C;  1GL2 B;  1LTJ A;  3K5B A;  4NPD A;  4DZO A;  3ZDM A;  2Q7C A;  1FDM A;  2QA4 P;  4A7P A;  3H0S A;  1VL2 A;  4BRY A;  3AEF C;  3CX5 E;  1ZR2 A;  3NXS A;  1L4A B;  1EQ7 A;  1IJD B;  3QWO C;  1SG4 A;  1SQP G;  4H0L D;  1BDC A;  1ZW0 A;  1VQ9 P;  4RYF H;  3HTK A;  4DT0 A;  1L0N E;  1GL2 D;  1EZV I;  2Z5H A;  2ZXX A;  5C9G A;  3FF6 A;  2N9Y B;  1NTZ J;  5M1B A;  3N7N A;  1PZQ A;  4U3F G;  1CI6 A;  3G9R A;  2P7J A;  2FYU J;  1ZRT E;  3TZ3 A;  4GKG A;  4H13 C;  2R3C A;  1KFN A;  4IFD K;  4YPC A;  3L75 E;  2UWJ E;  1NTK K;  1N7L A;  1IFN A;  4MN4 C;  1K39 A;  2Q2X A;  3B5N D;  4IL6 X;  2M0B A;  1SQV J;  4U0G H;  4WB4 A;  4BWN A;  1FDO A;  3JSV C;  3TT6 A;  4FNB A;  1FZG A;  2QG4 A;  3D70 A;  2F6Q A;  3BRV B;  3VP9 A;  5KAF E;  1E5W A;  1JMB A;  5E0N X;  3ZWA A;  1GZL A;  1SQQ G;  2YXQ B;  3KZI H;  1WZ8 A;  1USD A;  2A06 G;  1YQ4 C;  1VQL P;  2YIU C;  2CK3 H;  3WG5 A;  2YXR B;  3L72 E;  2QEX P;  3G4S P;  1M1J B;  2E76 D;  1T3U A;  2JEE A;  3P32 A;  4WY4 C;  1AA0 A;  3CLQ A;  3MD0 A;  3W68 A;  5AW5 B;  4ELX A;  1DEB A;  2PBP A;  5KLI B;  1NTM K;  2ZT9 B;  1EDL A;  3R2P A;  3AEG C;  1WT6 A;  3CWB D;  3M0D A;  2PAJ A;  3UIA A;  3I55 P;  1FJP A;  4U3F E;  1N73 B;  1RF0 A;  1NTM D;  2C0W A;  4C46 A;  1SQB G;  4NPF X;  1KOR A;  3HE5 B;  3TK1 A;  4HJG H;  2J58 A;  4FN7 A;  4IL6 H;  1S1C X;  3II6 A;  3RRV A;  1RE4 C;  4JCS A;  1R5L A;  1FJK A;  2J5G D;  1FE6 A;  5FIF A;  5AW7 B;  1MUU A;  3OW2 O;  1GK6 A;  3KQG A;  3LW5 J;  1NKZ B;  4OWF A;  2LXB A;  3H1H E;  1IFD A;  2QE7 H;  3MUD A;  5DTP A;  1ZRT D;  2KZI A;  3H0Q A;  2IBZ G;  2ZAE B;  3Q0J A;  1SQX J;  4H13 D;  2QQ3 A;  3PTZ A;  3H1H J;  3PEA A;  1HF9 A;  2QVA A;  4PJ0 E;  1VQ8 P;  3RK3 B;  4PV1 D;  1PPJ D;  2WMM A;  2Y0C A;  1EDI A;  4R4M A;  3B5N C;  3A0B H;  3L73 J;  1H0T A;  3RK3 E;  2N1T C;  3L70 G;  5TIS H;  4JYL A;  3R4Y A;  1BE3 D;  5AVU B;  2OYI C;  4QFE A;  2C9L Y;  1NGM B;  1A02 J;  3ISA A;  2KSJ A;  1P84 H;  2M3B A;  2XNX A;  5KLV J;  3B71 A;  2D2C D;  4U3F J;  1WRG A;  3EFG A;  1PGO A;  5APQ A;  3AEA C;  1WDK A;  3BCC G;  2VSU E;  2VRS A;  1N6D A;  2FXP A;  2KYV A;  3AED C;  3KQF A;  2XKM A;  2E76 C;  1ZLL A;  4L73 A;  3TRR A;  1OX3 A;  2Y9Z A;  2ZVN B;  2Y0D A;  4FND A;  2QJY C;  3P8C D;  1M1K Q;  2ZL0 A;  3AE3 C;  1YIT P;  1S2E A;  2KB7 P;  3M6N A;  2NPS C;  3M9H A;  1KYO E;  5APX A;  2GTR A;  5KLI C;  1KMI Z;  3A0B E;  1PFI A;  1JO5 A;  2PG8 A;  1IK7 A;  1HNU A;  2O3J A;  2Q3I A;  1SFC B;  2K1A A;  5AW8 B;  1DUB A;  4FZW C;  3ITK A;  4J2U A;  3KHU A;  1YHQ P;  1GD2 E;  1N7S A;  1G1I A;  2M5A B;  1EDJ A;  3KTH A;  3QXI A;  2WT7 B;  2O01 J;  1NZY B;  3C8V A;  4UB6 H;  1UYR A;  4ZDE A;  1OFC X;  1MJ3 A;  3T97 A;  3H81 A;  4K35 A;  3HRN A;  3ZW8 A;  2FFD A;  1JCC A;  2QJK B;  3NJD A;  3L36 A;  3TGU D;  1OZH A;  5TIS E;  3K50 A;  2NZ2 A;  5DU6 A;  4N3Y B;  2ZYG A;  4D6T J;  3D71 A;  1S5L X;  5JBX A;  1NJI Q;  2A45 I;  1XX4 A;  3R0O A;  3N4X A;  3L70 J;  1Q52 A;  2AEJ A;  2POH A;  2C9N Y;  4EML A;  1FZC A;  2E42 A;  2FYU E;  2RH0 A;  1DD3 A;  2QJY B;  2J5U A;  3QKA A;  1HVV A;  1N2D C;  2W27 A;  3G3Z A;  3L71 E;  3VIV A;  1NHL A;  1RHZ B;  2QSI A;  2VSS F;  3MTU E;  1L0N J;  1BGY G;  4KT0 J;  3OT6 A;  5AVV B;  2KP8 A;  3E1R A;  1VPC A;  1H88 A;  2YO2 A;  4ELW A;  4MI2 A;  1EZV G;  3H1H D;  1CW5 A;  1LTJ B;  5AVT B;  1LTS C;  4D6T G;  5KDR A;  2WSF H;  1NTZ G;  4GHN A;  1SLQ A;  2KXP B;  1JY2 P;  3CCQ P;  3H25 A;  3M06 A;  4U7J A;  1KQG B;  3EFF K;  2ZT9 C;  3P85 A;  1L4A A;  4GT1 A;  1N86 A;  1SQP D;  3BPT A;  2E43 A;  4I7Z B;  4LC1 A;  4JYC A;  3T8A A;  2FYN B;  1SQP K;  2UZF A;  1M1J C;  2WTY A;  4AYC A;  1JY3 P;  1KIL A;  4NNQ A;  1LTI C;  1U7J A;  1EY3 A;  2Z5I A;  5H2F E;  3F89 A;  3TYY A;  1T2K C;  1VQK P;  2J5G A;  1HUC A;  4YXW H;  4B3J A;  2Q34 A;  3KZI E;  2ZL3 A;  2JP3 A;  1HGV A;  4ZDD A;  1U57 A;  3H1H G;  3CPW O;  2LXC B;  4LGD E;  4Y99 C;  2KK7 A;  1DD4 A;  1T6A A;  3KTI A;  1SQX D;  2F9I A;  2OAR A;  3L37 A;  3IAV A;  4U19 A;  5AW6 B;  3PRJ A;  3QXZ A;  1SQB D;  4YLH A;  1SQQ E;  4W7Y A;  2ZXE B;  3HE4 B;  1QL2 A;  3PZK A;  5CJ4 A;  3BAT A;  1AVY A;  1JCD A;  1YTZ T;  4WCZ A;  4OGQ B;  4ASW A;  1PPJ E;  4I1L A;  3KPE A;  4R4L A;  4XFJ A;  1HWT C;  2N1T D;  1Y8A A;  2IBZ E;  2BZR A;  4JVT A;  1G1J A;  1NTZ K;  2Y9Y A;  3MP7 B;  3HUS A;  1K73 Q;  1EZV D;  4XE5 B;  1BE3 E;  2MKV A;  3CD6 P;  1IFJ A;  3NFQ A;  5DU8 A;  1SQV E;  2MJZ A;  3IBB A;  1QGK B;  4M3L A;  1LNQ A;  4WWI A;  1S72 P;  1H89 A;  4EI2 A;  3L71 G;  2E74 B;  3CX5 H;  1CSB A;  3W67 A;  3H32 A;  2FYU G;  1AV1 A;  1L0N G;  1FZA A;  3KTK A;  3HUS B;  3OAK A;  2WSE J;  4KNP A;  3V2P A;  4ZMD A;  4U1A A;  2M8R A;  3VTP C;  3T8B A;  3L70 D;  2W6B A;  3HP0 A;  3M0D C;  3VMZ A;  1URQ A;  1NU1 J;  1LP1 B;  1IK9 A;  2WSC J;  3IAO A;  4JQ0 D;  3PE8 A;  2BCC J;  1X0T A;  5AVR B;  5DUC A;  1JY2 O;  1OW6 A;  2WSS H;  5CCH D;  4Z1M H;  4K3A A;  1NU1 G;  3P8M C;  1K05 A;  2O01 H;  3H1K D;  1KN7 A;  1SQV G;  3WU2 E;  3R6H A;  3PHL A;  4L6W A;  3RL0 C;  2OTK E;  2VSU C;  2KIK A;  1WDL A;  5KJP A;  4L75 A;  1KZU B;  1JOC A;  1NTK E;  1BSH A;  4C7N A;  1FBM A;  4GDO A;  2W90 A;  2YMK A;  2XND H;  4BRY B;  4RCN A;  2WVR A;  1VQN P;  3T88 A;  2YO3 A;  1A02 F;  4RES B;  3VN0 A;  4L74 A;  2Q1K A;  3QWD A;  4AUW A;  2C8T A;  3CCV P;  1L0L G;  1FZB A;  2HPC A;  2WPS A;  2NP9 A;  3BRT B;  5AVQ B;  1KYO I;  2G3A A;  3H1K E;  3S9O A;  1UII A;  1NOH A;  5CCG A;  3RL0 B;  4UB8 E;  5E0S H;  5CHX A;  2WSF J;  2ZQR A;  4ZNC A;  2DEO A;  5KKZ C;  2IYO A;  4MXI A;  3P2L A;  1LWU B;  1KQF B;  1ON3 A;  3H1L J;  1KYO D;  2A45 G;  3B4S A;  1OW7 A;  2ZT9 D;  3MZW B;  5KAI E;  2AEM A;  4HH2 A;  1R8E A;  2H7H A;  2JKV A;  2HYN A;  1P84 D;  3IF4 A;  4NEK A;  4JOT A;  1P84 I;  2FKW B;  1KTM A;  3V2N A;  3L74 G;  1BCC E;  1DH3 A;  3RK2 D;  1Q90 D;  3E1I A;  3O6Q A;  1EF9 A;  2ZL2 A;  1SQV K;  1O8U A;  3M9Q A;  3HLN 1;  2J5I A;  1PP9 E;  5CCH C;  3N6R B;  1J1E B;  2PP6 A;  2W6A A;  4EMM A;  2YNY A;  1ZN5 A;  1ZV8 A;  4D6T D;  1RY3 A;  3GHG A;  4JJT A;  1SQB J;  3KDP B;  3CXH E;  1KB9 I;  3BCC J;  5CTB A;  1JY3 O;  5KJ7 D;  4ASV A;  1X79 B;  5HUQ A;  1N73 A;  1HBW A;  4PD4 I;  1VF5 C;  1X0U A;  1FDI A;  1S3J A;  3L74 J;  1RQU A;  2IPP A;  3G6E P;  5DJU B;  1W2E A;  2KS1 A;  3L72 G;  4W7Z A;  4NPE A;  3LW5 H;  1AQT A;  5MGB A;  3HIN A;  1JXZ A;  5CBO A;  2IEX A;  2M3E A;  2V7Q H;  2CBY A;  3EQ2 A;  1KQS O;  1P84 E;  3GHG C;  4WY4 D;  1NTZ D;  1JNM A;  4JCT A;  4ZDF A;  4GOF A;  1BGY E;  4JSB A;  1GU5 A;  4EOT A;  1LWU C;  3JC2 2;  2R3S A;  3G71 P;  5DZK H;  5CBN A;  3U9R B;  5CTC A;  5KKZ B;  1SP4 A;  4FZW A;  1J2J B;  3NTN A;  4B86 A;  3HUS C;  1G2C B;  4RO0 A;  2KLV A;  3CCR P;  4FJW D;  2BCC G;  1DX7 A;  3SWX A;  3SWY A;  3CME P;  3GG2 A;  2WTB A;  3SFD C;  2IZ0 A;  4XA4 A;  2E5T A;  4RKU J;  2B87 B;  5EFW B;  1X9V A;  1S9K E;  3QMJ A;  2E5Y A;  1D7M A;  4N6J A;  3I47 A;  5GTH H;  1M1J A;  1DEE G;  1W2B O;  1UYV A;  1PGJ A;  4RYF A;  3AE6 C;  2VRE A;  1RF1 B;  1OVV A;  4IL6 E;  1NTM E;  3OC7 A;  4BXL A;  2E75 D;  3AE7 C;  3CWB E;  1N7S B;  2HOD A;  1RJM A;  4ZKP A;  2AEF A;  2A81 A;  3A0H H;  2B87 A;  2WT7 A;  1HZD A;  2Y0E A;  2OTJ P;  1YG6 A;  1UYS A;  1QX8 A;  2XDJ A;  3H6P A;  1KB9 D;  2AXT H;  5KJ7 C;  1UIY A;  1K8A Q;  1NO4 A;  4K29 A;  5C90 A;  4JPZ B;  1GK4 A;  3LIE A;  3DOR A;  3D6Z A;  1NKN A;  3FXE A;  5CCG C;  1JMM A;  1NTZ E;  3CX5 D;  1RH5 B;  5AW3 B;  2BAS A;  3GLM A;  1RQV A;  3AEC C;  4EMP A;  2G8Y A;  1H8A A;  4WZ8 B;  3H1I G;  3PP5 A;  1FCF A;  2P2U A;  4L8K A;  3AE2 C;  3SWK A;  1ON9 A;  2YMY A;  1L0N D;  1FS0 E;  1BGY D;  3A0H E;  2OYH B;  2YJG A;  3H1K G;  4QII A;  4YXD C;  1HGZ A;  2Q9I A;  4JFC A;  3L75 D;  5FUS A;  1PL5 A;  3CX5 I;  5AW2 B;  4K2N A;  2IX7 C;  2BCC D;  3VMA A;  3V2R A;  2OYI A;  1YG8 A;  1NTM G;  5KDR B;  5BU8 B;  5E0S A;  3L35 A;  2CPS A;  1FOS F;  3H1L G;  4IZD A;  1PV3 A;  3L73 G;  2RMZ A;  3VP8 A;  2IFM A;  1CI6 B;  3CCL P;  2KS1 B;  3OME A;  2HFE D;  2P67 A;  1VQ4 P;  4MOU A;  3RGU A;  4QIJ A;  1Z56 A;  1L0L J;  5AVX B;  2QRX A;  3QRE A;  1JTH A;  3AE5 C;  4U0G A;  1M7L A;  3L4F A;  3U1A A;  2F9Y A;  1Q51 A;  2ZL4 A;  2WZ7 A;  2DUB A;  1JEK A;  2WPQ A;  3ZWC A;  2IBZ D;  1KIL B;  4KWB A;  3CCJ P;  4Q0G A;  2KUB A;  3CCM P;  1PP9 G;  2K9Y A;  3CCE P;  1IFP A;  2WSC H;  4GIF A;  3A7O A;  1PGQ A;  2P58 A;  3MUD C;  1KB9 E;  3H1J J;  3BEZ A;  5INF A;  3PLN A;  1N6E A;  3H1L E;  1XTG B;  1L0L D;  2K88 A;  2R44 A;  1NVO A;  3V4Q A;  3PJS K;  1K04 A;  1PIX A;  5DUF A;  1VQP P;  4TT3 H;  4GOE A;  1VF5 D;  1BE3 G;  3WUU A;  3HD7 D;  3NMD A;  2BEZ F;  3SWF A;  2PGD A;  1CZQ A;  2KI7 B;  2XU6 A;  2ZJS E;  4OGQ D;  3M0A A;  3B5N B;  1OVU A;  2E75 B;  2FYN C;  1SFC C;  1J1D C;  1PPJ G;  1M56 D;  3STA A;  2LR2 A;  1KIL E;  3Q3D A;  2VSS A;  3S1K A;  1URQ C;  2Z4E A;  1MFZ A;  2Q5U A;  2NPS B;  1T3J A;  1VQ5 P;  2A7S A;  1NTM J;  1QL1 A;  2E74 D;  3CL3 D;  1FC7 A;  3H02 A;  2ITA A;  1OVR A;  5CJ0 A;  1BCC D;  4IOI H;  1LTJ C;  3TVW A;  3L73 D;  1BSN A;  3L74 D;  1Q86 Q;  5AVW B;  1LTG C;  2PPY A;  2OYO A;  3O8Z A;  1BDD A;  2IZ1 A;  3TNU A;  4EDF A;  5DL1 A;  3BCC D;  4I6M C;  5APS A;  3V5E A;  4DI1 A;  2VSU A;  3T97 B;  5APV A;  1USE A;  4RJT A;  3Q1T A;  2FFD C;  2K37 A;  4U0H A;  2XV5 A;  3R9S A;  1S9K D;  4HKZ H;  1GDT A;  2FY8 A;  2WIT A;  1SQB E;  1YI2 P;  1URQ B;  1FU1 A;  3FXD A;  1TG6 A;  3OJA B;  3VMY A;  1VQO P;  1NH4 A;  1FOS E;  1LGH B;  2QJK C;  5E79 H;  4WY4 B;  3TDC A;  2E75 C;  5APY A;  3ABV C;  5B5E H;  4JF7 A;  3RK3 C;  2QIW A;  2R32 A;  1IFI A;  1S5L H;  1VQ7 P;  1WDM A;  4HC8 A;  3V6I A;  1LTB C;  1BCC J;  1DIP A;  3RBX A;  4H44 C;  4U18 A;  3BCC E;  4IFF A;  5KAI H;  2LKM A;  2Q3E A;  2KNC B;  2ZYD A;  3CXH H;  4D6T E;  3PH0 A;  3MOY A;  1QLE D;  1PP9 J;  4WBA A;  3CCU P;  1IO4 A;  1VDF A;  2YKQ A;  3TGU J;  4TLF A;  1LTT C;  1NYH A;  1MZ9 A;  2ZYA A;  3CCS P;  3TLF A;  2L91 A;  3VYI A;  4IFM A;  5B66 H;  2K9J A;  5CMZ A;  1K32 A;  1JTH B;  4UB8 H;  1SFC D;  1N8R Q;  3HRX A;  3V2Q A;  2KNC A;  3WU2 H;  2W83 C;  1OWA A;  4LLH A;  1N73 C;  5GTI H;  2XZR A;  3C1L A;  3HD7 A;  2M5A A;  3A3Y B;  2HLO A;  3AE9 C;  3Q7H A;  4N78 E;  3GKB A;  1JB0 J;  3H1J D;  1RF0 C;  1SQQ J;  3HE4 A;  2HG5 D;  2JDI H;  1OW8 A;  1J1D B;  4PD4 E;  4C7N B;  2A7K A;  3HE2 A;  1R5S A;  3V4W A;  1L4A C;  5APU A;  3ST9 A;  1LTA C;  1M8O B;  3AE8 C;  3L72 J;  3B8E B;  3M9B A;  3H1K J;  2OGU A;  2HOD B;  4H44 B;  3JU1 A;  3T3W A;  3JCU H;  5ING A;  1IFM A;  1GL2 C;  2WWW A;  1HNO A;  2F9I B;  5B5E E;  1GL2 A;  1NAF A;  3TVU A;  1KIL D;  3A5T A;  2O01 N;  4OLQ A;  2KZJ A;  3P8C E;  1VQ6 P;  2J5I I;  1XTC C;  3AEB C;  4G2R A;  3CMA P;  2FYZ A;  3CC4 P;  5DTW A;  2ZFC A;  4FB8 A;  3RK3 D;  1VRG A;  2FFD B;  1LWU A;  1QEX A;  4H13 B;  2DW3 A;  3IB9 A;  4JCQ A;  1TYF A;  4JCR A;  3VMX A;  2PRR A;  3L75 J;  3TF5 A;  3H1I D;  2E76 B;  1L0L E;  4W80 A;  2GUS A;  4OH8 B;  1Y9B A;  2J5S A;  1SQX K;  2H88 C;  2OYH A;  2N9B A;  1Q7Y Q;  1EDK A;  3O6Q B;  4JYJ A;  1RJN A;  4WVZ A;  2GUV A;  3KYQ A;  2OYI B;  1M57 D;  2JO1 A;  1U7M A;  2P10 A;  1ZR4 A;  3MYB A;  3KXD A;  3P7K A;  1RF1 C;  2N1T B;  3CI9 A;  3L71 J;  1XNV A;  3H0J A;  2D3T A;  2I8D A;  3BF0 A;  5G1S A;  2O1J A;  1N7S D;  1NTK D;  2IYP A;  3H1J G;  1ZXG A;  3OA7 A;  3WUT A;  4DOJ A;  2H8P D;  4N78 D;  3TGU G;  1AJY A;  4EIJ A;  2IBZ I;  1KB9 H;  2I1K A;  3V5B A;  1NU1 E;  2GA1 A;  1PGP A;  4U3F D;  2YIU B;  2WSE H;  3TSI A;  4IZC A;  1OMI A;  2P1J A;  3GMA A;  3FWN A;  3CXH D;  4PJ0 H;  2HPC B;  1BE3 J;  4ASI A;  1OD4 A;  2KSE A;  1NWQ A;  4NAR A;  3GF3 A;  3M6M A;  3CWB J;  2QM7 A;  1YIJ P;  5C39 A;  5DKP A;  3M91 A;  3LKE A;  4ZU2 A;  3RBZ A;  3Q5P A;  1GU4 A;  3SFE C;  1YBK A;  1ZME C;  1YJW P;  5KTB A;  2C0X A;  3A2A A;  5L8R J;  3S4R A;  3Q0G A;  2VSS E;  2Q35 A;  5H2F H;  1W2X A;  1KIL C;  3Q1M A;  5KLV K;  3LAO A;  2JWA A;  4L76 A;  5AVY B;  4WYO B;  4PV1 C;  5IKL B;  1AFO A;  1NTK J;  1X8Y A;  1EXI A;  3QK8 A;  2VX2 A;  1J7X A;  5AW1 B;  2ZVO B;  1NU1 D;  2JJL A;  5DZK A;  2JWD A;  3USS A;  4JWV A;  1SQV D;  2CPB A;  1NZY A;  3H32 B;  3Q5R A;  3V5I A;  3HE5 A;  1Q81 Q;  1JM0 A;  1XNW A;  2GM4 A;  3SSU A;  3C9I A;  1BCC G;  5AVZ B;  4ELS A;  2FXO A;  3E7K A;  5JBW A;  4K3W A;  1NTK G;  1KV4 A;  3QH9 A;  1H0T B;  1N6F A;  1LP1 A;  1KQL A;  3PGQ A;  2HW5 A;  5G1Q A;  3TNU B;  5KAF H;  1W5C E;  3U59 A;  1E79 H;  2KOG A;  2AXT E;  1FZC B;  3D6Y A;  3L73 E;  1RE3 C;  2NPS D;  3L74 E;  5BU5 A;  4OVN F;  1NAY A;  2B88 A;  3RK2 C;  2ZQQ A;  3LID A;  3U9S B;  1XO6 A;  1L0N K;  1SQQ K;  3F5H A;  2VSU F;  3GHG B;  3QYR A;  1K9M Q;  3I56 P;  4H0L B;  2BEQ D;  1SVF A;  3HTK B;  5GTH E;  4PD4 H;  3Q5S A;  1L4A D;  4O9B A;  3AE1 C;  3R9Q A;  1FAV A;  1T2K D;  1LJ2 A;  4WY4 A;  2OTL P;  2KLU A;  1GW3 A;  3G64 A;  1MFT A;  2A06 E;  3AEE C;  4UB6 E;  1L2P A;  1UYT A;  4KD6 A;  1YTZ I;  4HNK A;  2O1K A;  4OMR A;  4YTP C;  1NU1 K;  1OD2 A;  3H1L D;  3TDK A;  1SFC A;  2K3R A;  4HDT A;  1EC5 A;  4JYB A;  4KPK A;  1X22 A;  2OYH C;  4ZKU A;  1FZE A;  2K9J B;  5BVZ A;  3CC2 P;  1HJ0 A;  3MFM A;  1GW4 A;  2V7Q J;  1G2C A;  3WUV A;  1PJH A;  2A06 D;  1SQP J;  5AVS B;  1YJN P;  5TJH A;  2FYU K;  3L71 D;  1WMK A;  2FBM A;  3HD7 B;  1PP9 D;  1S5L E;  2D2C B;  3L72 D;  1Y47 A;  4PD4 D;  3GF7 A;  1L0L K;  4ZDB A;  2NRG A;  4H0L C;  1BGY J;  2W3P A;  1JY2 N;  3U1C A;  2QJP B;  1SQB K;  5KLV E;  3H0U A;  3CWB G;  1KYO H;  5CCH A;  3RK2 B;  1HJB A;  1SQQ D;  2YKO A;  1N7S C;  2B9B A;  3P5M A;  1SQP E;  1AVO A;  3TT7 A;  3ZW9 A;  3TGU E;  1IZN B;  3BVH A;  4I2L C;  2V4H A;  1OXZ A;  2IDB A;  3EWK A;  2WPV B;  3WMM 0;  3FDU A;  3IFM A;  1HH0 A;  3MIW A;  3GW6 A;  3AE4 C;  2FZS A;  1OIP A;  4CPG A;  1VF5 B;  4Y28 J;  1LT9 A;  2R5B A;  2QM8 A;  3FGA D;  5DJT B;  3L3S A;  1RE4 A;  5GTI E;  4FN8 A;  2Q6Q A;  4C7R A;  1KC8 Q;  1RE3 A;  3ZWB A;  2BCC E;  4JBZ A;  1MV8 A;  5APT A;  1MKM A;  5KLV D;  3RL0 D;  4KHX A;  2AXC A;  2A45 H;  4I52 A;  5B66 E;  2FBW C;  3MT6 A;  2IFN A;  1ZP0 C;  3BAS A;  1LT9 B;  3RL0 g;  1QVF O;  1SZO A;  5CCG D;  5DU4 A;  4B3H A;  4OGQ C;  1JUN A;  3L70 E;  4GOD A;  4KJM A;  1EXJ A;  3FX0 A;  4PV1 B;  3H1I E;  5AW9 B;  4ZDC A;  2WPR A;  2H89 C;  3NJB A;  2RN0 A; 
#chains in the Genus database with same CATH homology
 4GM2 A;  4H44 B;  3JU1 A;  1NZY B;  4JSB A;  3T3W A;  3C8V A;  5ING A;  1UYR A;  4ZDE A;  1MJ3 A;  2F9Y B;  1HNO A;  2F9I B;  5DZK H;  3RSI A;  3U9R B;  3H81 A;  5CTC A;  3KTJ A;  2F6I A;  3ZW8 A;  4FZW A;  3TVU A;  3NJD A;  2FW2 A;  3KTG A;  4OLQ A;  3DJA A;  3K50 A;  2NZ2 A;  5DU6 A;  3IN6 A;  2J5I I;  3AEB C;  3D71 A;  1S5L X;  4G2R A;  5JBX A;  1XX4 A;  3R0O A;  2X58 A;  3Q2Y A;  4FJW D;  1FC6 A;  2WQY C;  5INI A;  1Q52 A;  4B3I A;  5DTW A;  3T89 A;  3SWX A;  4FB8 A;  3R9T A;  1VRG A;  2CE3 A;  4EML A;  4H13 B;  3IB9 A;  4JCQ A;  1TYF A;  4JCR A;  1DD3 A;  2WTB A;  2J5U A;  3QKA A;  3SFD C;  4RKU J;  1ZOY C;  2E76 B;  3VIV A;  2QSI A;  2VSS F;  1Y9B A;  2OQQ A;  3QMJ A;  2J5S A;  4KT0 J;  3OT6 A;  3K8X A;  3I47 A;  2H88 C;  4I7Z C;  1XNY A;  4LK5 A;  1GMJ A;  4ELW A;  4MI2 A;  1EF8 A;  1UYV A;  4JYJ A;  4RYF A;  3AE6 C;  2VRE A;  5KDR A;  4F47 A;  3OC7 A;  4GHN A;  1RJN A;  1UIX A;  2E75 D;  4I42 A;  3H25 A;  3AE7 C;  4U7J A;  2JO1 A;  1KQG B;  1RJM A;  2P10 A;  2A81 A;  3MYB A;  5G1R A;  1HZD A;  2ZT9 C;  4H44 D;  3P85 A;  3TV5 A;  1XNV A;  4Q1I A;  3H0J A;  2D3T A;  1YG6 A;  1UYS A;  3BF0 A;  2QJP C;  3BPT A;  5G1S A;  4I7Z B;  4IZB A;  1FC9 A;  3T8A A;  1UIY A;  1TU3 F;  2UZF A;  1AJY A;  4K29 A;  1YQ3 C;  4OG1 A;  5C90 A;  3BPP A;  2D2C C;  3RST A;  3DOR A;  3D6Z A;  2X24 A;  1Y7O A;  4IZC A;  3U9T B;  1OMI A;  2EJ5 A;  3GMA A;  4NNQ A;  3GLM A;  1RQV A;  4ASI A;  1EY3 A;  1OD4 A;  4NAR A;  3AEC C;  3GF3 A;  3M6M A;  2G8Y A;  4EMP A;  2J5G A;  4I4Z A;  4WZ8 B;  1FCF A;  2J5I B;  5DKP A;  4B3J A;  3LKE A;  2Q34 A;  4L8K A;  4ZU2 A;  3AE2 C;  3Q5P A;  1DCI A;  3SFE C;  1ON9 A;  3SLL A;  2ZL3 A;  4Z0M A;  1ZME C;  2JP3 A;  4ZDD A;  2YJG A;  5L8R J;  4QII A;  4YXD C;  3Q0G A;  2E74 C;  1U57 A;  2VSS E;  2Q35 A;  4JFC A;  1W2X A;  5FUS A;  1PL5 A;  1DD4 A;  4K2N A;  3KTI A;  2F9I A;  3Q1M A;  1YG8 A;  3LAO A;  3IAV A;  4U19 A;  5KDR B;  3QXZ A;  5E0S A;  3H0S A;  4YLH A;  1VL2 A;  4WYO B;  3AEF C;  4PV1 C;  5IKL B;  4IZD A;  1PV3 A;  3PZK A;  1SG4 A;  4H0L D;  1EXI A;  3QK8 A;  2VX2 A;  4WCZ A;  4OGQ B;  1J7X A;  3OME A;  4R4L A;  4XFJ A;  4RYF H;  5DZK A;  4MOU A;  2BZR A;  4JVT A;  4QIJ A;  4JWV A;  5C9G A;  3FF6 A;  5M1B A;  3QRE A;  1NZY A;  3AE5 C;  4U0G A;  3Q5R A;  3V5I A;  3G9R A;  1ZRT E;  3TZ3 A;  2MKV A;  2F9Y A;  4H13 C;  2ZL4 A;  1Q51 A;  1XNW A;  5DU8 A;  2DUB A;  3IBB A;  3ZWC A;  4KWB A;  4ELS A;  1K39 A;  2Q2X A;  4Q0G A;  2E74 B;  5JBW A;  4K3W A;  2K9Y A;  4IL6 X;  1N6F A;  4U0G H;  3KTK A;  3BEZ A;  1FDO A;  3PGQ A;  5INF A;  2WSE J;  4KNP A;  2HW5 A;  5G1Q A;  3TT6 A;  4FNB A;  4U1A A;  1N6E A;  3D70 A;  3D6Y A;  2F6Q A;  3T8B A;  5E0N X;  3HP0 A;  1K04 A;  3ZWA A;  1PIX A;  5DUF A;  4TT3 H;  1VF5 D;  1WZ8 A;  2WSC J;  2ZQQ A;  2BEZ F;  1YQ4 C;  2YIU C;  3U9S B;  3IAO A;  1XO6 A;  3PE8 A;  3WG5 A;  2VSU F;  5DUC A;  4OGQ D;  3QYR A;  1OW6 A;  4Z1M H;  4H0L B;  2BEQ D;  2E75 B;  2E76 D;  3Q5S A;  2FYN C;  3AE1 C;  3R9Q A;  1K05 A;  3STA A;  1KIL E;  3G64 A;  3Q3D A;  2VSS A;  4ELX A;  2PBP A;  3AEE C;  3R6H A;  2ZT9 B;  4L6W A;  3AEG C;  1UYT A;  4KD6 A;  2A7S A;  2VSU C;  1WDL A;  2E74 D;  4HNK A;  1KOR A;  1FC7 A;  3H02 A;  5KJP A;  4OMR A;  4YTP C;  4FN7 A;  1OD2 A;  3TVW A;  1S1C X;  4GDO A;  3RRV A;  4HDT A;  2YMK A;  4JCS A;  4KPK A;  4RCN A;  2J5G D;  2PPY A;  3T88 A;  5FIF A;  5DL1 A;  3QWD A;  3V5E A;  4DI1 A;  2VSU A;  3LW5 J;  3T97 B;  2C8T A;  2NP9 A;  1HJ0 A;  2G3A A;  3Q1T A;  3MFM A;  2V7Q J;  3S9O A;  1PJH A;  4U0H A;  3R9S A;  5DTP A;  3H0Q A;  1WMK A;  3Q0J A;  2FBM A;  4H13 D;  2QQ3 A;  1TG6 A;  3PEA A;  5E0S H;  1HF9 A;  2WSF J;  2D2C B;  2ZQR A;  4PV1 D;  3GF7 A;  2DEO A;  2QJK C;  4ZDB A;  3TDC A;  5KKZ C;  2E75 C;  4R4M A;  3ABV C;  4H0L C;  4MXI A;  2QIW A;  2W3P A;  1WDM A;  3P2L A;  4HC8 A;  1KQF B;  1ON3 A;  3H0U A;  3RK3 E;  1DIP A;  1OW7 A;  2ZT9 D;  4H44 C;  4U18 A;  4JYL A;  3R4Y A;  1R8E A;  3P5M A;  4QFE A;  4NEK A;  1NGM B;  4JOT A;  3TT7 A;  3ZW9 A;  3ISA A;  3MOY A;  1KTM A;  2IDB A;  3B71 A;  3EWK A;  2WPV B;  2D2C D;  3FDU A;  1Q90 D;  1EF9 A;  3O6Q A;  2ZL2 A;  3AEA C;  1O8U A;  1WDK A;  3HLN 1;  3AE4 C;  1NYH A;  2VSU E;  1N6D A;  2FXP A;  3TLF A;  2FZS A;  2J5I A;  3AED C;  3KQF A;  1VF5 B;  3N6R B;  2E76 C;  4Y28 J;  1K32 A;  4EMM A;  3FGA D;  3TRR A;  3L3S A;  4FND A;  2QJY C;  4FN8 A;  4JJT A;  3HRX A;  2ZL0 A;  3ZWB A;  3AE3 C;  5CTB A;  1MKM A;  3M6N A;  5HUQ A;  4I52 A;  2GTR A;  1VF5 C;  2FBW C;  5KLI C;  1KMI Z;  1X0U A;  1FDI A;  3AE9 C;  3Q7H A;  3GKB A;  3MT6 A;  1RQU A;  1JB0 J;  5MGB A;  2PG8 A;  1IK7 A;  1ZP0 C;  1HNU A;  1OW8 A;  3RL0 g;  3HIN A;  1JXZ A;  1SZO A;  5DU4 A;  4B3H A;  4OGQ C;  2A7K A;  2IEX A;  1DUB A;  3HE2 A;  4FZW C;  2CBY A;  4J2U A;  1EXJ A;  3ST9 A;  4PV1 B;  3KTH A;  3AE8 C;  4ZDC A;  3QXI A;  2H89 C;  4JCT A;  3NJB A;  4ZDF A;  2O01 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...