The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
69
|
sequence length |
284
|
structure length |
284
|
Chain Sequence |
b'ECRLSVKFKYDYNMEFADAFHAQVDKVELYVFDKNGKYLFKQAEEGSALSTGNYLMEVELPVGQYQFMAWAGARDSYDITSLTPGVSTLTDLKLKLKREASLIINKRMETLWYGEVINVNFDGTVHQTETINLIRDTKIVRFGFQSYTGSWTLDMNDYDYEIIESNGHLGHDNSLLDDDVLSFRPYYMEQKDPATAYVDMNTMRLMEDRKTRLVLTEKASGKRVFDINLIDYLAMTNAEGKNLSTQEYLDRQSNYHIIFFLSESWLAVQIVVNGWVHRIQEENQ'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
A conserved fold for fimbrial components revealed by the crystal structure of a putative fimbrial assembly protein (BT1062) from Bacteroides thetaiotaomicron at 2.2 A resolution
pubmed doi rcsb |
molecule keywords |
putative polysaccharide binding proteins (DUF1812)
|
source organism |
Bacteroides thetaiotaomicron vpi-5482
|
molecule tags |
Carbohydrate binding protein
|
total genus |
69
|
structure length |
284
|
sequence length |
284
|
ec nomenclature | |
pdb deposition date | 2009-02-26 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF08842 | Mfa2 | Fimbrillin-A associated anchor proteins Mfa1 and Mfa2 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulin-like | ||
Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulin-like |