3GF8A

Crystal structure of putative polysaccharide binding proteins (duf1812) (np_809975.1) from bacteroides thetaiotaomicron vpi-5482 at 2.20 a resolution
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
284
structure length
284
Chain Sequence
b'ECRLSVKFKYDYNMEFADAFHAQVDKVELYVFDKNGKYLFKQAEEGSALSTGNYLMEVELPVGQYQFMAWAGARDSYDITSLTPGVSTLTDLKLKLKREASLIINKRMETLWYGEVINVNFDGTVHQTETINLIRDTKIVRFGFQSYTGSWTLDMNDYDYEIIESNGHLGHDNSLLDDDVLSFRPYYMEQKDPATAYVDMNTMRLMEDRKTRLVLTEKASGKRVFDINLIDYLAMTNAEGKNLSTQEYLDRQSNYHIIFFLSESWLAVQIVVNGWVHRIQEENQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative polysaccharide binding proteins (DUF1812)
publication title A conserved fold for fimbrial components revealed by the crystal structure of a putative fimbrial assembly protein (BT1062) from Bacteroides thetaiotaomicron at 2.2 A resolution
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Carbohydrate binding protein
total genus 69
structure length 284
sequence length 284
ec nomenclature
pdb deposition date 2009-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08842 Mfa2 Fimbrillin-A associated anchor proteins Mfa1 and Mfa2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2090 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3gf8A02
2.60.40.2100 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3gf8A01
3PAYA 4QDGA 3GF8A
chains in the Genus database with same CATH superfamily
1FGVL 3B8YA 2R0KH 1E5UI 4WCYH 1ZV9A 1EZVX 1EO7A 5FUCC 2IQ9L 3H3PL 5LBGA 2XYCA 4E0RA 2Y24A 1A21A 5JW4Q 3UTZA 1JPFA 4QKTA 2O5ZL 2VJ8A 3ILDA 2OW7A 1FDLH 3INOA 5T3ZL 5CN1A 5AQ0A 4B3EA 3GSVB 5F44A 1C5DA 1GKOA 1Z3RA 3QG7L 3DBXB 2YBGA 1HNFA 1XTLA 3FAWA 4OZGB 4YNYB 3OL2A 3WFDL 4OJCA 1AJ7L 3GZOA 1I1RA 2FECL 4YXKL 1J1OL 3JTSB 4XNXH 1INEL 1ZEAL 3BUYA 3AG4B 1RIUH 3T2NH 1Z66A 5BPPA 4IYKA 1I85A 2NYZA 1J0YA 1G1OA 5D2NC 3FC8A 1LEKB 2E6PA 2PYEB 4P49A 5DHMC 5EMYA 4WRLA 2J8UE 3L2MA 2NPLX 2G9HB 2VDMH 4M4RB 5IT2L 5DU7A 3FCUB 3S2CA 2YD7A 4NDMA 5ABAA 5L2KB 1OTSD 3FHQA 3KXFD 5I1IL 3KLSA 3DBSA 3D3VD 1A5FL 2C1OB 1IJNA 3U1SH 4RA3A 4AH2B 3NIDE 2A6KA 5E95B 5HYSB 1YEHL 3P4NA 3FU5A 5HHMD 3WHXB 4XVTL 2NY4B 4PJ7A 4ZYKA 4ODUB 3FBQA 2JXMA 3MV8A 4ZO9A 3RWCA 3WMPA 3X12A 1AP2B 4X83A 4OD1L 1NGZA 3KGUA 2XSKA 1UH2A 3F6IA 4P3DB 5IP4A 1IC7H 2FH8A 2GTWB 1RXLA 5AVXB 5FGBA 1JRHH 2IQAB 2V2TB 5AYTA 4HUUA 2BS8A 3FFCA 2WSPA 1L3WA 3EJPA 3RFZA 2NSMA 1GJUA 3VI4E 3LS5L 4FYTA 4QAWA 5AYQA 3KPRB 1AKJB 2RBLA 2WXGA 5DVNA 3X14A 3O2WL 1EERB 1IBFA 1C12A 2C5DC 3ECUA 3MRDB 4LCWE 2K7QA 2A0LD 2DLFL 1OOAA 4FMFA 4ZJ9A 3QUXD 4HAKA 4WWKD 3T2PA 1EHAA 1K4CA 4XVUC 1XWVA 2KZBA 3HJEA 3FCTA 4PMEA 4OGYH 1F4HA 4ANXA 2BNQA 1A6AA 2JCCF 4NO3B 1T1YA 2X2YA 3LS4L 2VO8A 3U6XS 1MWAL 3IKCB 2FZ3B 2ZCHL 3ZHNA 4OCRH 1P9MA 6FABL 1WISA 3ZGHA 4LLVB 3D18B 4S0SD 4QHMA 2HG5B 2UZXA 5D7IF 3VD1A 1X5KA 1CD0A 2PTVA 3I75A 3H85A 3PL6A 2HH0H 4XRCA 4TQPA 5CJOH 1KY7A 1ACYL 1N7MH 2BSRA 2IJ0C 3O2VL 1XIWD 5BVPH 2ZXDA 3KMDA 3DUUA 1RSFA 2YAFA 3LH2L 4F3FB 1B4JL 1R33A 4KK9D 5D5MB 1RJLB 5EUOB 2BWQA 4DETA 4F80A 3B2XA 4XCCL 2D8KA 4ZS6D 2EIDA 2GC7C 3IS0X 1N59B 3P4OA 3MV9B 4M8VA 2X53A 2J44A 4GSUA 2M83A 3WY4A 2NY3D 3OKYA 4ETQB 5EZIL 5ILTL 1EHKB 1TETL 4HS8L 3HUJE 3MCLH 3W38A 4OB5H 1JDDA 1T66C 2KL6A 4OLWL 3CXDH 3RDTA 4C59B 3WS3B 3QQXA 5TE7H 2XZAH 3M6DA 4Q74A 1YEIL 2VSKB 4PJAA 3NH7H 1G5GA 2EXWC 5A6LA 5J9PB 3DOSB 4HFWB 1QKZH 3V4VL 3QEQB 5DRNA 3FU9A 3K80A 4ZUTB 3QXVA 1H6EA 1I1AB 3MA9H 4EI5A 2VAAA 4NQEB 4UOW1 2R27A 1PX4A 2XIDA 1UOLA 1GHFH 2HJKB 4L8DA 2FGWL 1FL5A 2EE6A 4XO9A 3QXTA 1JCVA 4DKFH 4WSJA 4U7SA 3DVGB 3V52L 2AK4B 4KXCA 5BRPA 4XPGH 3WDHA 2X28A 4LSSL 4P2RE 4TNGA 1A9VA 1MRFL 5GRWA 1HXYA 1CXIA 1ED3A 4YO0B 4YSCA 1M6OA 4XP9H 2LTQB 3UJIL 3IFPA 1Y1UA 3E1ZA 5HJ3B 4A7QA 3D2UA 2V2WA 4HMCA 4P0DA 5EC2A 4AXWB 1AO7E 3U0PA 1IM9B 3VRJA 3NCEB 5LGHH 2FX9L 4JL1A 3OZ9L 1U93A 3UP6A 2QTEA 4KPHL 5J11B 4QOKB 4Y19D 5KG9B 1M7UA 3O6FD 2JELL 2X2JA 5MEQA 1SUJA 2OCFD 5GS2D 4MJHA 4U1GB 1KNOB 1M2VA 4NCC2 4PGDA 5FCSH 4NI6A 2CUIA 4YQXH 1XBRA 4IS6B 1KGJA 2K6WA 4Y4FD 4YGVB 5EU6B 1BJMA 2VLRD 1TNMA 4KKCC 2KLRA 1MIEL 4WFFD 3D51A 3SDDC 1RK0B 1CGSH 4M93C 3DX6A 1E6OH 1OAYL 1HIML 4YZFF 3AROA 4ZO6A 4RMRA 2ZJSL 2A6DB 3DURA 4UZGA 1TMCB 1YMMA 4LKCB 5L8KB 3DJ9A 2I25N 2P5WD 4PVBA 5GRJH 1OB1A 1A8JH 1J11A 4JFED 1ZSDA 1P4IL 2NOYA 1CZ8L 4Q56A 4LQFL 4MDIB 3UZEC 4GG6A 3SPVB 1A9EA 4MCZA 3VU1A 5AAPA 4LASL 1BD2D 1NBZA 3S9DB 2AQ2A 2BOLA 1ULVA 2FLRT 3KYNA 1P4UA 1MLCB 1JZIA 2R1YA 4QF1B 3UERA 1HHKA 4U7KA 2WYIA 2ZXEB 5GIRB 4I85A 4BA8A 1RURH 3NAAH 3WD5L 4CJ0A 2CDGA 1TPXB 1E3FA 2G3NA 2NY2B 3BYTA 4G8EB 3SSGA 1JNHA 1UENA 1PAMA 3O6KL 4F91B 3EFOB 2VNCA 4QXTA 5E8EB 3DA0A 1NDTA 3NDYE 4K94L 4FQXB 1D5MA 4HJUA 4DW2L 5IG7A 5DZLA 1VLXA 5CLXA 2C8NA 1NOLA 3QUZB 4PJHE 3SDAC 1Z2KA 3IXTB 2UZPA 5IVZA 1EZVY 2F54A 5IB2B 2ZX7A 1RJYA 1ASQA 1SY6L 5DS8B 3LEYL 3IDMA 4M4PA 1MFUA 4MJIB 3RJQB 2YMTA 4OFQA 5HYJD 2K6ZA 2VDPH 2Q3AA 3BUQA 4WWPA 1ZLSL 4FQLL 1WHPA 3BP4A 3ZN6A 4DCQA 3S3BB 2CGYA 3ZR6A 1MCDA 1MJUH 3BEWB 2YZ1A 3BWAB 4LLUA 1E5BA 4K71B 4G1EA 1ZHNB 3L2NA 4OSUL 4I2XB 3B6SB 4U1NA 4L4TB 2QDVA 4XWOD 4AV0A 4PS7A 1TQBB 3O3BB 2VITB 3EBAA 3UC0L 1K85A 3P54A 3D69B 2VLLB 5T1LA 5F1IA 1OP5H 1BFOA 2JI3A 2EO9A 3CX2A 5A43C 3F6JA 3GSWB 1HL5A 4NZFA 5CNHA 1BX2A 2GJPA 1ZGLP 3LH9A 2IDCA 5JUEH 4Q9CA 1N6QH 1D6EB 1GZPB 4X7FC 3DROB 1LDPH 5AB2A 1ERNA 4UT9H 1BWWA 4FP8L 2XKNA 4HCGA 2HYMA 1TJGL 2OL3A 3HZVB 4RFNC 2Z31A 4GAYB 1N19A 1IE4A 3QXDA 1V05A 2Y7QB 4J1UA 1BPVA 1IV8A 1RUKH 2CCWA 3DVNB 4KRPD 3OB0H 2DD8L 1URLA 4A1RA 4TSCL 4K07A 4BDVB 4TNWF 1TZGL 2FD6L 4X6DB 2CCVA 1CFVL 1RZKH 4MTMA 4X98A 4L3AA 4F1SA 5G4NA 1DJWA 2ICEB 2IAMB 1MCWW 3EYVB 3TJHC 3II2A 1TO4A 3F7PC 4XMLH 3ZIMA 4ENZA 2X42A 4IMKC 3HG1A 4GRLD 1ZHLB 4HWEH 3H7LA 2ADFL 3V0HA 2DTML 2DYSB 2H1PH 2JMRA 1JCKA 1SLXA 4R4ND 3KXFB 4HZLB 5IROA 3SZKC 3RAJH 3D3VB 4K3DH 3ROLA 5HGGS 1ETB1 1PZDA 1WBZA 1ASPA 3VGDA 2QPFA 3Q6GL 5HHMB 1U3JA 1KJMA 1GSMA 1OPOA 2VABA 4NC2B 5I76B 3EJCA 3S8FB 1IAIM 2QSCH 1U4EA 3DTUB 5HHXH 1ND0A 4FGMA 1GCYA 4CW1B 2D3JA 3BUDA 3WY1A 3MBEA 4N0CD 1TVHB 3WFEH 1AQHA 5JHDB 4JKPL 4WGVB 4DPBX 2X6AA 1WJ3A 3O0RH 3RX5A 5I75C 4ZDHB 2HWZL 2A5UA 4HJ0D 3EDKA 1EK3A 5IWLA 4F15C 2FUTA 4ONGH 2ZICA 2ESVA 5KSAB 4JJ5B 2FAUA 2QZQA 2ITFA 2V5YA 3HC4H 3QUXB 4IIZA 4WWKB 3VXPB 4B0MM 4DO5A 1HKLL 2EDRA 4KROC 4X8JA 2G4EA 4XXDB 4XMWA 3QRLA 1IBGH 4JANB 1AGEB 3ZDXE 2C9VA 5DMJB 4Z7WF 4ZUWA 1JGUL 1FC2D 2JFCA 2YK1H 4UNIA 4ZAKD 1LYQA 1FZOB 5F89B 1HJCA 2JTYA 3NUKA 4LMQI 3RGVB 2EDKA 4J6RL 5H94A 5I1EH 2J56A 2XG5A 2C1PA 4NUJA 2E4FA 4QLRA 1JV5A 1F6AA 3GSOB 5D6CB 5DHVB 1XIWB 5SWZD 4IQHA 1XXFC 4IRSD 1KXTA 2YLKA 1AI1H 4P23C 2BP3A 4HUWB 1DDHB 3SPIA 1W0YT 3WNJA 2JB5L 1MRDH 4XMXA 2B59A 1M1XB 2GI7A 3OLGA 1AVAA 4XVJL 1BVLA 5D7LD 4JN2B 2Q8BL 4YXHH 4EBQH 5HGBA 1E43A 2NY3B 2FX7L 4UBDD 3WTTA 5FV1L 3ULUF 3L4UA 4A7GA 4OD2B 5J06A 3K5RA 3NCMA 5TTRA 3KYOB 4PJGF 3FQYA 4WU7B 3W2DL 3ZQXA 2H2PD 2KYIA 2HLFC 4CU8A 3W3BA 4XN1A 4OBRA 4LPXA 5EUOE 5GQBA 2E9GA 3GSXA 1UKSA 2AQQA 5E70A 3T77B 5I16A 2G2RA 1PD6A 5IHBA 4JG5A 1KN2L 4RMTA 1NGQH 2F53D 4BH7A 3NSYA 2KHAA 2FCBA 3MRQA 1UQSB 3II1A 4MCYA 1RJZA 1FIGL 2UWEF 1A6TA 1G9EA 3G6DH 1MCPL 2K70A 2FO4B 4M6NH 2GJ6A 1QQDA 2VCOA 1DBJH 3AS2A 4CBPA 4F9PA 3ME0A 5LGJB 1IFRA 1YEDB 5FO8A 2VM4A 1J8HD 4QWWC 1NCDL 5D2NE 4X5XA 3NFNA 3WAJA 1UT1A 3W39B 3TVMC 3QDJA 1CLYL 2OFQA 1WZKA 3QORB 1SPDA 1LE5A 4PCTA 4ZTPL 1YYLL 1S7WA 5FFGA 4PRPE 2Y6SC 4JRYA 5C86A 3I9IA 4NQEE 2NYKA 3NZSA 3ECBB 4YHMH 4JDEA 5IVNA 2J5WA 1KGUA 1JGLH 3R18A 5FWRA 2IDSA 4FFZA 3O11B 3O6FB 5ISZD 3V6FA 4Z18A 4NC1E 2WM0A 5DRWA 5MP6H 1AD9A 2AK4E 4PJCA 2X6UA 2DL9A 2FECI 1ZOXA 5I1GL 2PP9A 3FFDB 1B2WL 2DPKA 12E8L 3IU4L 4I3SH 4U3SA 4HHAB 1E2VA 5DJ6B 2Q20A 6CGTA 3FN0H 1VFBB 3IDIA 5CUSH 3E8UH 2H3KA 4Y4FB 2VT0A 5E1GA 3RL1A 1OAKH 1B6UA 3IBEA 3PNRB 4JFWA 1KYAA 5IUCA 1LE9B 2VLRB 4UQCA 1ZT4A 3QJQB 2P43B 4UMSA 3C8KA 1DQKA 2NDFA 5HDBB 5ABDE 5BNXD 1TQCC 2VLJB 3O2DL 4DTGH 1I3UA 4RGND 4ODXB 4AC4A 4MJ2A 2ZXCA 3IJYA 1YEEH 2P5WB 4TQ8A 3HPJA 2V5MA 4JFEB 5GPRA 2Z93A 2IAAC 1PIGA 1A6VL 4JRXD 4Z7IA 5F1NA 5EU6E 5C92A 3EJRA 1A02N 3OTTA 2NY5C 3EFFA 1BD2B 5HYQB 1EIBA 4Z7NB 2B20A 5J1TC 1E4WH 4TQEL 1BLIA 4LEXL 1G7PB 1IAII 1XR8B 2DQEL 4JO8A 1RZJH 3WLWC 1UVQB 3OX8B 1S5HB 3MNWA 3T3PB 3EH3B 3RQ3A 3SO5A 4URTB 4J3TA 1XF3B 4BKLB 3ZQ9A 4MB4A 3RFRA 3EOAA 2H9GB 4JX0A 3EO1A 5J6HB 1U91A 4HXAL 4MWFB 4UT6L 1I8MA 4BK5C 1AGDA 1P6FA 1MREH 3D0VA 4N0YH 2DQHH 2X41A 3AS3A 1UKQA 1WIUA 3ABKB 2EYRB 3TO2B 4GI9A 4S1DD 5BXFB 2TAAA 5GSVA 1B9ZA 3WXVL 3BAEH 3WEOA 4CILA 3WNIA 5CKAA 1MFBH 5HYJB 3NDZE 3MV8D 2GI0A 2DKUA 4R0LA 3O3DB 2A77L 5DQ9A 5AAWC 3KZ8A 3NQKA 3KVDD 5C0AA 3VWJC 5JOPD 2WVTA 1WICA 5ICZA 3MRFB 1EPFA 2HLEB 4P9ML 3BEVA 4HYTB 4KQ3H 4GB9A 4MXWL 2DLIA 4GG8B 4JMXA 3NJKA 5D1ZI 3O4LD 4F8OA 3QQ3A 4YR6A 4BFOA 4GKNA 4G8FB 3M88A 1LK2A 1TJIH 1NAML 3MAWA 4NPYB 3FQ4A 4WUKL 2EDDA 2JCWA 2Q86B 5AVYB 1UYWH 3TT3L 1ZLUH 2BNQD 3U1QA 4QRBA 3UBXI 2YXMA 1VA9A 3DGGA 5J89A 2ZSWB 4LSDA 1FP5A 3FPXA 4KV5E 4PLJD 2QV4A 4KRPB 1Y18B 2E7LC 3N6YA 2CIIA 2WQAA 5L0QC 3FU8A 4QHNB 5ITBH 3PL6D 4ABUA 2EDMA 3OR6A 1K6QH 1E9QA 2PTTB 3S88H 8CGTA 2O93L 2DWSA 5DHXB 5GSRB 3ZJAA 4PJEB 2BSBA 2Q8AH 1AGBA 4GKZA 4YWGL 1A9BB 3TM6A 4JUTA 4KH9A 5L2JA 2CALA 1UJ3B 2EDOA 3KPSA 2ZCZA 4G8GA 4GRLB 4Y9BA 3H3KA 1QP1A 4G7SB 4OI7A 3KM2A 4LHUA 4X7SH 1UWFA 3TOPA 3QCUL 4Z1PA 3ETBJ 2OSXA 4H8UA 4A68A 2FEEI 4X6BB 4CVXB 3F7KA 4P4KC 3VA6A 1SBSL 1KPVB 3FUFA 2I07A 2AMUA 3B83A 3G7TA 2Y1AA 4PJBF 4PJ9A 4X6DE 3A47A 4XMKL 1IBDA 2X7LB 3FQ1A 3RDTD 4TM9A 4XCEB 1DQQA 1SN2A 1E28B 4HOXA 1IC1A 4WI0B 4M62L 3OKOB 2DWEA 5KVGE 2AJZA 4NZTL 4FXGA 2IBGA 2FSDA 4LVNC 2BO0A 4PM1A 5IFHL 1NA8A 3TCLA 1NZRA 4F33B 4EI5D 2UZYA 1DBAL 3KXFE 4I13B 1A6UL 1WH0A 1JK8A 3D3VE 1FVEA 3EW3B 1KJ2B 1OB0A 4OM1H 5DJ2B 3KGSA 3ZPDA 4ZXBC 1CUOA 3ARXA 5HHME 5CEYA 1NM4A 2XTJC 4BKSC 4DGYL 3IXAB 5ALCH 1LNUA 1PQZB 4IHOB 1XVSA 1DUZA 3C6SA 1KB3A 2YBRB 1SJXA 4MHHG 2VXQL 5MHSD 3VFPB 1BFVL 3H4FA 1DZ0A 1QHOA 3D2UD 4IDJH 1J5IA 2R69A 5JHDE 5J13B 4E9LA 2C3WA 1BJ1J 1UCTA 2Y2TA 1AXTH 1WBXA 2KZ1B 1NEUA 5F9AC 4ZAKB 2SEBA 4A6YH 4MA3B 1KJ3L 5DD3H 1YG9A 2BVEA 4M6AA 2XNAA 1VFAB 2EIBA 4PYGA 3BVTA 3KHOA 3CN0A 4LDCA 4R7XA 4CADB 1BQUA 3ET9F 2BS9A 4LCUA 2APTA 3U2SA 2DEWX 1FG2B 4YFDB 2ZOTA 4IRSB 2WKOA 2EDHA 2DI7A 4PD4K 5IK3B 1LO3H 1ZPUA 2XG4B 1PKOA 2YPKB 4TVPD 3EGSB 4IOFD 2XWBB 5F9OH 5IIEB 4W9DC 4JPKL 5IHUL 1NKRA 1KTDB 1S9VA 4P5TA 3BSHA 1ZA3B 1JGVL 5D7LB 3IDUA 5GS0H 2QADD 1X4XA 4IBQA 4IK6A 5IGXH 1NLDL 1RFDH 5EOQH 2A9AA 1DL7L 4X7TA 5CP3H 5GGSY 3KPPA 1AHMA 1S7RA 4FFVD 1YMMD 2LFGA 5D4IA 5AL0A 2WXNA 3DPBA 4WY7L 1KCRL 2GHZA 2WBJC 5IY5B 1WF5A 4NFBA 4Z7VB 4D9QD 1JF5A 3WIIL 1YN7B 4GINA 5JYLA 1BOGA 2Y07L 1KBBA 2UXVA 3OKLA 4OCMC 3IJ8A 4X6CA 2QBWA 3GO1L 4P4RA 1LEGB 2P49B 2F53B 3D1MC 1JAEA 4JM2F 4DOHE 4OFDA 4BZ2A 4IOIB 1AG0A 1I7ZA 1R3IH 4UTBL 4FNRA 4QGTA 2H3NA 2ZYIA 1FNEB 3R4DA 2L8AA 2WTRB 3SDXB 5MEOA 4IKNA 1BLNB 4G59C 5KVFL 5C0JB 1V7MH 1RUQL 2OYMA 1P53A 2YUXA 2NMSA 2F54D 4UV4H 3SGJC 1I4FB 2WBXA 2VDQH 4ODHL 4GMSL 1XFPA 3UAFA 3HW7A 5K9QI 4APXA 4M1CD 1CGYA 3ZGIA 1Q9OB 4PP1C 1EGJA 2AMGA 3ZO9A 5ISZB 1JHLL 3HG0A 1O0VA 2YD3A 1NSNL 3ARVA 1CLVA 4UIMA 4XC3L 3OM3B 3OGCB 3NJMA 5ETUB 4O02H 4HIIA 2OMXA 4J28A 1CGXA 1U92A 1QA9B 5JHLA 3B7TA 5I74C 3ZMRA 5T1LD 3VGFA 4F58H 3OBAA 2V5SA 1RQ5A 4HETA 4LBEB 4Q2ZB 1YQVH 5FDWB 5EN2A 3TO4C 1IFHH 2WY3B 4HBCL 4EN3A 5GHWH 5IBTL 2ZCLL 1ZHBB 5AW7B 3OKEB 4RGNB 3UTPD 3UTZB 3GWJA 1RLWA 1EJOH 1RKRA 5HSFA 1BVKA 2Z31D 3C87A 4GW1A 4FS0A 1C5DB 1T7WA 1VPOL 4QRUB 2RQ8A 5GGRY 3VFTA 4JRXB 1AMYA 2WTOA 1TTCA 4HD5A 2J20A 5DJAA 3VXME 5ACZA 1DQDL 2B1HH 4R8WH 3X3FH 3VD2A 1IGYA 3V8CA 2VERN 2Y36H 4XVSL 4WFFE 2J6EL 3GTNA 4FNTA 3O9WC 5C6TH 2VLJE 3QC5X 1MCLA 5B39A 1IGFH 1K8DA 2DQUH 2UX6A 2W5PA 4QTHA 3MVSA 1LO0L 4NKIH 5C7XL 3LRKA 2P5WE 3QZWA 4NKMB 3HG1D 4DUWA 2QV2A 5T1KA 4MQSB 3IGLA 1E7UA 5FHBH 1KENL 4ZFOB 4O51A 5A3IC 3HOGA 3NPZB 5IROD 1J8KA 4CUCA 3LZQA 1BF2A 1DJIA 4Z7NE 2QSTA 4NUPA 5HVGB 1T89C 3HHMA 2JJSC 1OARH 3EJQA 4JZOB 1JXFA 2XIIA 3I9PA 5AOJA 1SQ2N 2J5LB 2NNRA 5L88H 1RZ7H 5CD3A 1ETA1 4CGUB 3CJJA 2CLVA 4PJ7B 2RHEA 1N2RB 4Y2LA 2JXMB 2O6PA 5LNGA 3MV8B 4QRRD 3RWCB 3MLPA 5A2IH 5FA4A 3X12B 1NCIA 4WNQA 1NGZB 2MOGA 3AXLA 3L3GB 3CFDA 2VN6A 1ZXKA 5IKCA 3NABH 3MBED 4FXKC 4ODVH 2VDOB 3CDGA 4HUUB 5E2TL 3VXTA 4L8SC 3T65A 3RFZB 2BLFA 2L7UA 3SCMB 4OLUL 3GSNL 3ULUL 1FGVH 2NZ9C 4LOVA 1G0YR 2EVFA 3CZGA 3O4LB 2N7AA 4QKXB 4H1LA 1YO4A 2IQ9H 1H3XA 3H3PH 2KLTA 1N0XL 4J3SA 4OZGF 3JZ7A 1R17A 1C12B 4B60A 5HD8C 2O5ZH 2ESVD 1P84K 5T3ZH 4AYMC 1K4CB 2VR4A 4W81A 3SY0A 5AFAA 2ZP9A 3FCTB 1CDUA 2GPZA 3QG7H 4QJ4B 5F3BB 2BNQB 1KT2A 3WIAA 1T1YB 5DEJA 1YRKA 3HPLA 3WFDH 3FF7A 1AJ7H 1ZLVK 3BYYA 1ACZA 1A6WL 2YPVA 3BIAX 4YXKH 3RZWA 1J1OH 2WXIA 2YD0A 1ZEAH 4QHMB 2IV8A 4PRHE 4UYPA 2C3VA 2UZXB 4OFPA 4XT1C 3I75B 4Y4HC 4ANVA 2K9FB 5DD6A 5CM1A 1L6XA 1NANI 2BSRB 2OYPA 1IBZA 3JVFC 1HYSD 4YPJA 4JE0A 4MDJA 2XWDA 3HG4A 5IT2H 4CN6A 4GT0A 1M3IA 5BRZA 2HA1A 5I1IH 4DPCX 3SYOA 4GXUM 1A5FH 2AS5M 5GZOA 1LILA 1S7SA 1YEHH 5BCAA 5FYJE 2ZWZA 4FLHA 4XVTH 4I0PA 1TYEB 4AG4L 1KCLA 1MAML 2PCFB 4LSRL 2B7DT 4OD1H 3L7EA 2OA9A 3KLHC 1W8NA 2WIIB 3IJ9A 5JLZA 4HGWB 4WV1C 4AMXA 3CQFA 4KKAC 4ANKA 2ZOOA 4M8RA 1KGWA 5DRNB 5AVWB 3V6ZA 1H9DA 4NX0A 4EI5B 3LS5H 4QY8B 4XMVA 4U3CA 4NBZB 3D25A 5CLYA 4Y5XC 3O2WH 4L8DB 4KKRA 3KJ6L 4LP4A 1FL5B 5T5FL 1HCVA 3ZL4L 5DR5L 2DLFH 1I8LA 1HHGA 1ZV5A 2YUVA 3U0TA 2GVYA 3FCGA 3B8SA 4ERSL 3GSUA 3AU0A 5INDA 3BSZL 5FEBA 3LS4H 2Z35B 3QDJD 1MWAH 1HXYB 32C2A 4R4FL 2ZCHH 4JO2L 4KVNL 1AR1D 3IFPB 6FABH 3D2UB 2V2WB 4JRYD 3GTTA 5EC2B 2NSXA 3U0PB 1DFXA 3KS0H 1XBDA 4ILDA 2XZZA 4OJAA 1KTKE 2WLNA 2V2XA 5D5MF 3CBRA 2KPWA 5DS2A 3TX4A 1TTBA 2ZXGA 1USQA 5T3XE 1ACYH 5JYMA 3SE8L 3O2VH 3ZL2A 3OMNB 5MEQB 2ZUQC 1QUNA 2CO1A 3LH2H 1M2VB 1S7TA 4PGDB 5IHHA 1B4JH 2YPLD 5HI5D 5K1JA 4Z23A 4H8PA 4PI0A 3VXUB 1SLWA 3L3OB 4ZPTA 2Y0SA 4XCCH 1KTCA 4L5FE 3BVUA 3MO1A 4BFGA 1X5ZA 3IETA 2KDGA 3QUMA 5FYLE 4ZMTA 5EZIH 1KIRA 4JQXC 2IALA 4Y2DB 5ILTH 1TETH 4HS8H 2VQ4A 3RE0A 1CGVA 4L1BA 2QADB 2DN7A 4OLWH 1R3LA 5GGUB 4JAMA 3T0BA 5K9OA 3PF2A 1VF5C 2WSKA 1YMMB 3VRLF 5C0IA 5LNDA 4TNWK 3D50A 1YEIH 3F7RA 1OB1B 4JDTL 3AUVA 1GY1A 3V4VH 2WN2A 1TTGA 4KXZI 1A9EB 1OSEA 4MCZB 4EVNA 1AOHA 1NBZB 3FUEA 1DCEA 4X8CA 2Z4QB 2Y1YA 1F11A 1IKOP 4BE6A 5EF1A 3KYNB 3CVCA 4RA0C 2R1YB 4N2MA 4RMVA 2FGWH 3A21A 3Q8BA 2CDGB 3VGHA 1G6RA 1KXQE 3V52H 1EUUA 1CD9B 4JHAH 3AQDA 4QXTB 2R83A 4N2NA 1F4YL 4W93A 5LGKA 4LSSH 3QC6X 1MRFH 1D5MB 4YSEA 5IG7B 2HRLA 5I5IA 3UJIH 3GEWB 2F7RA 3PLYA 4K5MA 4UINL 3G6AB 2FX9H 3BHBA 3DJRA 3EH1A 3OZ9H 3QWRA 4KPHH 1NUNB 1E90A 4G7RB 1RJYB 1MW1A 1UT9A 4NXSA 1DN0A 1R47A 1HHIA 3IDMB 2VE6B 2JELH 3OSKA 5KVDL 5JQ6L 1UM6L 3IDXL 1IIKA 2OJZL 5JOFA 3BP4B 1N5AA 4BK5A 2HT4D 1SZNA 3SDXE 5C0AD 4LLUB 2E7CA 3VFUA 3ZL1A 3WY3A 4U1NB 2H8PA 3VH8A 3ZU8A 4KZDL 4HCFA 1O6TA 3EYOA 5EEZA 3DX4A 3KR3L 4K9EC 3N3EA 1MIEH 3DX2A 5F1IB 5T1LB 3WL9A 3NIGF 4W6WB 1FCCA 3BD5A 1OAYH 1HIMH 3F7YB 4XOAA 3U46A 1BX2B 1H8SA 4HW6A 2ZJSH 1TIUA 1FYTA 3SJVA 3RZCC 1BF5A 3VWJA 3WTUA 3Q01A 5C9KA 3WUWG 1XL4A 1A6ZA 5FYKE 3MZGB 4NN6C 3MCKA 2XTJE 4XZUA 5GJSL 2IDUA 1P4IH 2X70A 4QUOA 4B9GA 3H7BA 1QO3A 1CZ8H 1RZKC 2XKNB 2OL3B 3QJZA 4LQFH 3MYZA 1MXDA 2Z31B 2H45A 3QXDB 4J1UB 4LASH 5GS1C 3NEXA 3BPNB 1O7SA 2OJEA 2O30A 1CE1L 1O7DE 1L9PA 3EYSL 4UMGA 4V2CB 2WLLA 4XP6L 1R3JA 3NFPA 3MRGA 4XVUD 1CLCA 3RWJB 3WKNA 3DTDA 3WD5H 3RI5K 4C83A 3F05A 1BSIA 1BVNP 3CQPA 4AQ1A 1DVFA 3O6KH 4X98B 1UG9A 2LGNA 1ADQA 4RRPA 4RGNE 2QVIA 5JIPA 2ZWSA 4YDKL 4K94H 2IBBA 4CJ1A 3ARDC 3ARZA 5D93C 4DW2H 5I1JL 1AQMA 3HG1B 4XNZB 4AUYA 3KPSD 3MKKA 4G8GD 4N90D 4XP1L 4AYEC 5F2FA 1AKPA 5EV7A 4LHUD 4JRXE 1VDGA 4QRAA 4F2MA 3QR0A 5FM5M 5D96B 5DZJA 1U2HA 1SY6H 3ASNB 3LEYH 2Y3AA 3ROLB 2NNAA 1WBZB 3LKPA 4PJ9D 3F7VB 4MX7B 5I5MA 3E3QC 5T5NG 2OZ4A 3MNZA 1JYNA 1NMAL 3NYKA 3PAVA 1AZZC 3H8NA 1HTYA 3B3IA 4FQLH 5LKNA 4ADJA 1KJMB 2Q7YA 2G75B 2N01B 4OGXL 3B9EA 1P2CA 4QRRB 2F8VA 3BMWA 1ND0B 4OSUH 3FRUA 1A1NA 1AYRA 3X1EA 3L4YA 3MBEB 3UC0H 2FL5B 4YSOA 4N8CL 2OMZA 3F3HA 3IBOA 3TWCL 5F1OB 3PHOA 4HXBL 3VGGA 3ZSTA 1ZPLA 3BN9C 3WUWA 3ZE1B 1W72A 2IGLA 3FO9A 4DGWC 5DJZA 2EXWD 4PJ7E 1X5LA 3P2TA 5I8OL 3DO7A 1YMHA 5JDSA 1LLAA 3MV8E 2OPCA 4FP8H 2ESVB 1ZY9A 1TJGH 5JHMA 2FHCA 1YEGL 3NK4A 2PW2A 3DUSA 1U3ZA 2DD8H 1OALA 4TSCH 4L8CA 1VZIA 5E5MA 4ZUWB 2AQNA 2E9JA 4W9JC 1CR9L 1DEEA 1X5HA 1TZGH 3O4LE 2FD6H 5F7HA 4GFXA 1NCWL 4XAKD 5H94B 1CFVH 2XG5B 2DKMA 5BMFL 4OZIA 4NUJB 1JV5B 1F6AB 4G3YL 4WGWB 3Q6FA 2A74C 3SQOL 1KXTB 3SE3A 2ADFH 2DTMH 5HDLA 1AANA 2BOCA 3APFA 2NXYC 2WZPA 1GRWA 1U2CA 3RWEA 2B59B 2DQDL 1TG8A 4KKQA 1IGIL 4EUPH 4ZNCD 1RSYA 3POCA 4P5TD 1BVLB 4KKPA 4LOUD 1AD0A 3AY4C 3FQUA 3Q6GH 5HGBB 2EDEA 2WNWA 2YKLL 1CYXA 2GSIA 2XLLA 1OHQA 3AM8C 4JKNA 35C8L 1N3NA 4HV8A 3PJSA 3VXOA 4X4MA 1RL1A 4E36A 4PIBA 5CU5A 2B77A 3MLUL 3QYCA 3FDWA 4PLOB 4JRFA 3GSXB 2XT1B 5E8NA 3W81A 5I16B 2G2RB 4JKPH 2IWKA 3B9KC 3VM5A 3TBWA 1GGUA 3ZE2B 1WA1X 4W9IC 4BH7B 2YJQA 1CTOA 4ZOCA 3SE4A 1S7VA 1OP9A 3MRQB 4MCYB 5DCCA 3KPNB 1A6TB 3RHWK 2LU4A 2HWZH 4AE1A 2WZ5A 2D2OA 1OLLA 1HU8A 1QQDB 3STLA 5HVFB 3ME0B 5FO8B 1ITCA 1Q0EA 1HKLH 4YSUA 1IQWL 2MKWA 3L5JA 4Y9CA 3L54A 4I5BB 1WP6A 2J3SA 4UM9A 1GKEA 3NFNB 3Q3GA 4XMUA 1OGSA 1QX1A 1HL4A 5DJ8A 1U8IA 4AM0Q 4GKLA 3QDJB 4NQQA 3V0VA 5KANI 1LE5B 4LP8A 3IFNL 1S7WB 4TQIA 4JRYB 1JGUH 1MCBA 3OHMB 3T0XA 2R23A 3HJ0A 3CQQA 4JDEB 2NZIA 4J6RH 4P46A 1SYVA 3HN8A 2VMEA 3FT3B 3CHQA 3V6FB 3TEZA 1GGCL 2B14A 1AD9B 2IANB 1I1CA 1MRCL 2W81C 4PJCB 5IM7A 3VXQA 3K5SA 2O61A 1AQDB 3SGJA 2YPLB 4U3SB 3UZVA 1E0OB 2JB5H 2ICWB 4I0CC 4Y7MA 3IDIB 3EHBD 3LQAL 2WV3A 4XVJH 4DVBA 4WO4A 2Y25A 2Q8BH 1WT5C 1HH9A 1ZT4B 4HKZA 4B9CA 1CJYA 2RD0A 3BE1L 4EN3D 2X9YA 2FX7H 5C07A 4XXWA 2X87A 4GRWH 3L3HA 4PWEA 3OC8A 1BM3L 1NDMB 4YC2C 4FULA 2P42B 3CLEL 1A65A 1UGKA 2E47A 3S8GB 3W2DH 4KI5C 1RZJC 3IJYB 4GUOA 4JZJC 4N5ED 1KJVA 1YEJL 4TPRL 4F9LC 3HPJB 3VXUE 3DX1A 4QYOB 4OLXL 5INCB 3GRWL 2CJTA 4H0LC 3VU2A 5F1NB 3TO4A 1NANH 4UQIM 1KN2H 3TNNB 1MUJA 4JFUA 2OTWB 3EFFB 5A6IA 2Q76A 4LPTA 1G7HA 5CIPH 2OJ1A 1FIGH 3OLIA 3QI9A 5HJGA 1JXDA 5E7BA 1CL7L 1MCPH 2WLKA 3U30B 3STBA 5J4MA 2CUAA 1YEFL 2WBKA 1REIA 4ACPA 3WFZA 4M9OA 1JZ8A 1FI8C 3DDFA 4G7YL 1NCDH 4GLRI 3NSJA 3UC2A 3WNKA 4JFFE 4M3HA 4XHJD 5T1KD 4K5NA 2Y7OA 3EOAB 3QB7C 1CLYH 3EO1B 3MRLA 1U91B 3HZYA 2R9HD 5DFVC 4AEIL 4JCMA 3ATEA 1AGDB 3D0VB 4J27A 1YYLH 4ZTPH 3FCSB 4NZUL 5LUMA 4AWJC 4WO0A 1Z9LA 4K8RL 4X42A 4WLCA 5GSVB 2AXGA 5D9SA 4AIEA 2CBOA 2IGFL 2NY1C 4JRLA 3CH1A 4M48L 2F68X 2O6DA 3CBJB 1DZBA 4ZRGA 4LDEB 4R0LB 4WW2A 1F2XK 5CO1A 2Q6WA 4CU7A 1B2WH 1KZYA 12E8H 1VHPA 3IU4H 4JLRB 5JNYB 1MKFA 1XAUA 4W4OC 5DQ9B 1NC4A 5C0AB 1OXYA 5HDBF 3MMEA 3GZQA 3ARRA 5ICZB 1MQ8A 3ABZA 3I50L 2YAEA 3QEHA 3BEVB 3SGEI 3FH7A 3BGFC 3QZBA 4OZ4B 5C0EA 3FQTA 1FSKB 1AHWC 3VUAA 2YXWA 3AU1A 3RVWC 3C6LC 1JPGB 3O2DH 4PI2A 4BCXA 5JOEA 1JPTL 5DGQA 4YR6B 2R29A 1G1YA 4GKNB 1BEYL 1E8XA 4FXKA 4U1IA 2VERA 2FQGA 4ZUUA 4L8SA 1BBJA 3PNWB 4G1MA 1Q4NX 1X5FA 1A6VH 1EO8L 3J8F7 3UEQA 5E2UL 3BP7A 3T3PF 1BMZA 3RX7A 2JKJA 3GD1C 3U83A 4IU3A 5LN8A 2QQLL 3N42B 4TQEH 5DI8A 4LEXH 4MNQE 2CIIB 1LD9A 2DQEH 3TC9A 3FN3A 4HGKC 3ULVF 4DO4A 3BDXA 1ZIAA 3OR6B 1E9QB 4HZ1A 1JDAA 4YHYB 3BVWA 3TZVA 1IBYA 2YEZA 5CFHA 4QXVA 4DP5X 5TK2A 4XOBA 1FORL 1AGBB 4GKZB 1TDQA 2AQSA 3L9YA 4HXAH 3GMMA 3KBFA 4UT6H 1OV8A 5BRZD 3TH3T 5L2JB 3KPSB 3AB0B 4OZHF 4MDRA 3UOAB 4ZMXA 4LHUB 3HKZA 1M7XA 2VDKL 5GZOD 1QBAA 3ZE0F 2APFA 4HUCA 5KS9E 2F61A 4XI5D 1A47A 2PN5A 4PWHA 5J6GA 4W70A 2G3XA 5C0DA 5E23A 5E5RB 4NNXA 3SZ6A 3WXVH 2OR9L 3H2PA 4DEPC 2CUMA 5C0NC 3TPKA 4PJ9B 3RVXD 2WO3B 4I0PD 1KB5B 2IXQB 1G87A 3PV6A 2A77H 2DWEB 1ILUA 1S4IA 4KK5C 1YAZA 4M9PA 4FXGB 1NL0H 4P9MH 1NC2A 2VN5A 4MXWH 2DLTA 2Z8RA 4ALAC 2PWDA 4LLMA 1B0GA 3ZYOA 4QNPF 3RUGA 2HKHL 1JK8B 4Y8AA 2RFXA 3U4EA 1FVEB 5BQDA 4MS6A 2EYSB 1SFHA 4AZ8B 4NKQB 1YC8A 2C34A 4KHTL 5HJDA 2MCG1 1JK9A 3S98A 2DM7A 4G6AC 1R34A 1BWMA 4LPUA 4WUKH 1PEWA 4QRRE 3TT3H 1ZRUA 3C6SB 4I7ZC 4NB7A 3JTBA 3BOVA 3LZFL 2KZWA 1F42A 3VDAA 4AVHA 5IQNA 4AL8L 1BV8A 4PJEF 3UG4A 3UAAA 1XCQA 4WTXA 3NCBB 4EEEA 1WBXB 3ZE1E 1LWRA 1HZKA 4QWWD 2SEBB 4UQ9A 2XNAB 2CBPA 2JKTM 3GHEL 4LKXA 2NW2A 4YDIL 5GS0C 3DSNA 4LCUB 3U2SB 2LU5A 5ERWA 4YWGH 1GJIA 1RHFA 2VUOA 4EDXB 1NDGA 3DX7A 5KTEL 3GXFA 4NENB 2O5NA 3LNEA 3LRSA 4GEIA 5D1QC 4KTGA 2W80C 4X6FA 1T0PB 3QCUH 1T2QL 1E8YA 3ALWA 5I73C 2V3DA 3BO8A 1MXGA 3NESA 1NWPA 1SBSH 1JWUA 1TEFA 2PPEA 1LXMA 4P5TB 5DHYA 1T3FA 4P2CG 5CFAA 1JWSA 1ZDQA 4XMKH 5LN4A 1NUDA 1LMKA 4X7TB 1ZLVH 3SEPA 2ETWA 2FJGA 1JFQL 3L5XL 3S48A 3LRGA 3DPBB 4M62H 4AW4A 3PAYA 1NFDF 2LAAA 4KOBA 4NZTH 5CWSB 4KVCL 5CGBA 1PGRB 1Q1PA 5IFHH 3FB6A 1TQWA 1BOGB 1DBAH 1BQRA 1A6UH 1CPUA 3AMLA 3OKLB 4ONHB 4Z7UF 4A2GA 4X6CB 1LO5B 1JN6A 4P4RB 3QP3A 4IEFA 5DVMA 1FVCA 4DO6A 4TTGA 4J39A 5HY9B 1OQXA 5D71L 3V95A 1NAKL 1CXFA 1NMCC 1N10A 4DGYH 2H3NB 5CZKA 1RVFL 2LFEA 4M8QA 5EU5A 3ESOA 5MEOB 2VXQH 3QPXL 1VGKA 3L17A 4XHQA 1BFVH 4M7LL 3BPOB 5AKVA 3NJVA 1NGWA 3RIKA 1UURA 4PV1C 3B2VL 4M02A 4J5VA 3O4OB 3ZTNL 3UMTA 2QPEB 3ZE2E 4CGTA 3KE0A 1KIUB 1M57B 2XPGB 3ZR5A 1KJ3H 3HE7D 4PH8A 4APXB 3HBQA 1J87A 4N0UA 4S2SB 4W9GC 5KBKA 2H6PA 4L48A 4HAGA 4MD4A 4Q8BA 1WLHA 2ED8A 3AS0A 5TE4L 4DGVL 1HH6A 2HUEA 4UIMB 3BVNA 3PREA 4MS8C 4ZG1A 3MYJA 2W9DL 4MNGA 2XVKA 3QDJE 5EZJA 4HIIB 2BMKA 4Z7OB 1FQ9C 5KYUA 4PYHA 1DHKA 3G5ZB 3EHBB 4JPKH 5IHUH 2Y06L 1BGXL 3C5XA 1JGVH 4OCXL 4Z7VF 5EN2B 4PY8I 3KL3A 1NLDH 3QO1A 3SJVD 1DL7H 1FYTD 5H37A 4EN3B 3W9DB 2YD8A 3AWEA 2NCMA 2CO3A 2IANE 4WY7H 1KCRH 2AV1B 4RBPK 3WIIH 1BVKB 1SNRA 2YPLE 1ZT1A 4EXPX 2MTPA 4GW1B 1JV2A 2VZVA 4PGBA 1XL6A 3VFTB 4Q6IC 4DZ8A 5ACZB 4C4KT 3GO1H 3BQUA 3G5YA 3PJLA 1IGYB 2QELA 4B9JA 5AAMA 4UTBH 4IGBA 4F7CA 1DVFD 1U8JB 1K8DB 4YN3A 2R0ZL 5K93A 3U7AA 4N2FA 1L9QA 3V4PB 4AITA 4ZQKA 3VSVA 3QZWB 4FEMA 1KBWA 4M3KB 3SKJL 5KVFH 4NKOA 5T1KB 1RUQH 4Q14A 5A2BA 3WN5C 4RMQA 1UKTA 5E03A 3DETC 3CAFA 4ODHH 4PVLA 4GMSH 5IB4A 5EU7E 3RURA 2AANA 3DOIA 5CZXD 3D07A 4N22A 4X80H 5CD3B 3ARDA 2ZYSA 1JHLH 2Z7UA 4L4VA 1NSNH 3S5YA 4OT1L 4FA6A 1IIIA 4XC3H 3QG6B 4NAQA 1G7JA 4X4ZA 5EF3A 4D7BA 1XCWA 2G30A 3AXLB 3PY9A 3CFDB 1U30A 4IOSA 1T83C 4F7KA 3LQMA 3CDGB 3VXTB 1HZHL 4X0KB 3FNKA 3T65B 3MGTA 2XDHA 2ZD0A 5B8CC 2ED6A 1R19A 4JDZA 5AW3B 4MVBC 4HBCH 3KLAA 5IBTH 4H0IA 1OM9A 3STZA 3POHA 2ZCLH 1KEML 3NIFF 3RTQC 4AIZB 5DDHA 4FZEL 1IC4L 3OKNA 2N3JA 3BWUF 4XWGL 3W82A 3IMUA 1MHCB 2FBOJ 3B2UC 3L9RA 3SY0B 4KO7A 5C0AE 1BJ8A 1GOHA 1VPOH 5SWSE 3UYOD 1KT2B 4FG6D 1R3KA 4NQVA 1IGCL 1DQDH 4EIBA 5BQ7A 1X9UA 5EEVA 1OZUA 2ZG3A 5HI4C 5HGDA 1T6VN 3IM1A 4XVSH 2J6EH 2CMRL 2PPCA 2J1ZA 3WGVB 3ARPA 2WXMA 3M17B 3UTTA 4LO9A 2C3VB 3WEMA 3MGOA 4Z6AT 2W0FB 3EYFA 5IVXE 1LO0H 1BZQK 5DD6B 4HLZG 5C7XH 3GLAA 2D0FA 4MZ3A 5HVHB 5JTWA 4C56A 1DVUA 4AEFA 1PBYA 1Q9LB 3LTVA 2YRLA 1KENH 1W0VA 4L9LB 2WZPD 2EUXA 2XV2A 4HJJL 4PHZA 3RP1A 1FA4A 4RNRA 2LLGA 3CBKB 1S7SB 2W0PA 5E8OA 1N26A 2FWOA 2ZZUT 2JSFA 2O26U 4PJXB 4R5XA 2OW6A 3OJMB 2KC0A 4I0PB 3L1FA 7PCYA 3AFLA 3BIKA 3QJXA 5A16B 2WVSA 1UXMA 2B2XL 3L7EB 4OVVA 3EYQD 5JLZB 3U6XA 4JKKA 2X4PB 2GTZB 5E2TH 2DLHA 3GB7A 4BGDA 1AS8A 3V6ZB 3VGBA 3VO0A 4GLRH 4OLUH 4R84A 3GSNH 2QQQA 3ULUH 5L6YL 3AM8A 2VMJA 3EBIA 2VXUH 2WP3T 4ZUVB 4RAVA 1N0XH 4U4IA 4OLZL 2F8OA 4YHNA 3TS8A 1F18A 1HHGB 3BFWA 3U0TB 3HS0C 2IDQA 4UM9D 2J6WA 4HQQL 3B9KA 4HOMA 5INDB 1TXKA 5ANHA 32C2B 4RLDA 3BAKA 2VZSA 2GSMB 5D1ZC 1DQML 2CO7B 3R8QA 1A6WH 4J2QA 1I3RA 2JNZA 1LO4L 4GSDL 5K33A 3SN6N 4ELMF 4U33A 1L6PA 1IGTA 2V2XB 4NNPL 4P46D 2WLHA 2VSMB 1DVYA 1CFMA 3CZUB 3CZNA 1AZRA 2GBUA 1DQIA 3T8VA 1QUNB 3JUYA 1KUMA 1SBBA 2EIKB 3OJ2C 1QVOA 2ZKYA 1JERA 2Z4TA 2A4CA 4ZPTB 3PWUA 1IM3A 3RIFF 5MI0C 4U0RC 3H42L 4NRXA 4N8PA 4WO4D 2EC9U 3QUMB 4CL7A 4OF0A 3T1FA 4PWKA 3NCYP 3LCYA 4GS7C 4PJAF 4C58B 3SODB 1IEBA 5C07D 1P5UA 4X9HA 3QQNA 3SBRA 1ZGLM 4HUNB 3NCWA 5FKAA 2P8PA 1R3LB 4AG4H 1MAMH 4OGAC 1T4KB 5BW7C 1Z32X 4IIQC 4LSRH 5C0IB 3I9GL 3QUYA 1SYSB 3H6AA 1XO8A 2FYYA 3HC0A 4QCIA 4Y1AA 3WJJA 4J8QA 3LB6C 4MQXC 5DA4A 4FABL 3L5WA 1LP9A 1W16A 3T09A 5E9NA 3QI9D 4KUCD 3GYRA 2NNCA 1DP0A 2YIHA 3WDIA 1MAJA 2CPUA 5T5FH 3TYFB 3ZL4H 1J9TA 3KJ6H 3PYCA 5DR5H 4F9LA 4Q7DA 4PW4A 2UXTA 4UB0L 4BFRA 1G6RB 1FZJB 1GS6X 5E24E 3C60C 3NP3A 3BZDA 4ERSH 3Q5TA 2QZ5A 1FN4A 3BSZH 4R4FH 3VFMA 3UCRA 5C1MB 4JO2H 3A4EA 4N86A 4KVNH 5ALBL 1TJHL 1O9ZA 4ZSOA 3T1WA 4BFFA 3MRMA 3BHBB 3D0AA 3VD9A 3QIBC 5DO2C 2F7PA 3HN5A 3MLZL 4BFIA 1DN0B 1V7NL 3DHUA 3WLBA 3LIZL 2VWEC 5FECA 2DL2A 1YNTA 3HE7B 5GGVL 1N0LA 3LDBB 3KCPB 3SE8H 3Q9QA 4X5QA 5JOFB 5HDOA 3W0WE 1N67A 1N5AB 4KKZA 5IMKA 9CGTA 1F58L 1U95B 4HAFA 4XX1G 5F7DA 4HKJA 1E9OA 1NC4D 1J10A 3ZMNA 3VFUB 4HK0A 3EH4B 2H8PB 2YD2A 5IESL 4E9RA 3EYOB 2P7TA 1C7SA 4M00A 4K3EL 3WL9B 1ONQA 3NP4A 3C5ZC 3U46B 5B1JC 3SJVB 4GG6F 1FYTB 1A6ZB 4MSWA 1GMIA 3IN2A 3MCKB 4JDTH 3HNSL 1H6TA 3VSQA 2E74C 1CCZA 1QO3B 3H7BB 4LEOA 5ID0B 4N28A 2D7PA 1WIPA 4Q4EA 3ZZLA 4Z7OE 3HB3D 3IJEA 3FF8A 4TF4A 1CTNA 3C6LA 3BH8A 2OJEB 5JPMC 4XB8A 3KGTA 4PJFA 5HD8D 3ASOB 3ARBA 3NFPB 3MRGB 4J12A 2D73A 1RIHL 4NT6A 4C83B 3FB5A 4L37A 3TZVD 4AQ1B 1DVFB 3KYMA 5C2BL 4WTWA 3B5HA 3NCXA 1F4YH 1X5GA 1JPEA 3AACA 4M7ZB 4N2BA 3VFSA 1XGRA 5DJXA 4FNPA 4UINH 1EBPA 4K3JL 2W07A 5AW0B 2B1AL 2A2QT 4LESA 5TF1L 4F2MB 2P24A 1J0JA 1S46A 1TOXA 1WG3A 9PCYA 3B9DA 5JQ6H 2NNAB 2ZP8A 4HUVA 1UM6H 3IDXH 3F5WA 2OJZH 2DJ4A 4CDHA 3B3IB 3DPDA 4HBQA 3HR5A 4J23A 2Q7YB 3APMA 1YDPB 4CMMA 1U3HB 2QFPA 3FHEA 4UQEA 3SD5A 1UWGH 1Z9NA 4GP4B 5GXBB 1OAUL 3WEBA 4KZDH 1A1NB 1X6NA 1F8TL 1SEQL 1NC2D 4NQUA 5K69A 5DUJA 5GRZA 1SJHB 5LG1A 1VIWA 2NY6C 3KR3H 2OMZB 3P0GB 3PHOB 5K59F 2OMBA 1EV2E 4NCDA 2YSTA 1M9WA 3FXIC 2IH1A 3MRKB 2YAQA 3WUWB 3QNXA 4WI9A 4XXCA 5B1BB 3FO9B 4A7TA 4B9IA 5IQMA 5J56B 5DJZB 3L1EA 3W57A 4BBWA 4MJ5A 1KJ2L 3TJEL 4KKAD 3LZNA 3DO7B 4UQBA 1YMHB 5GJSH 5JDSB 3T2LA 43CAA 1OCRB 4OJEH 3G5WA 2CA3A 4E9QA 4J3UA 1WFJA 1HOEA 2Q0ZX 4LSVL 5FKPA 3PUCA 3NGBB 1AG6A 2PW2B 3DUSB 1CE1H 4JVPA 1MG3C 2HPTA 4I89A 3EYSH 3Q1EA 4XP6H 2QT6A 4NN5C 1AFVL 4UOJA 3SOBL 3ZTJH 5M94B 1DEEB 2ZUYA 1PLGL 4Y2OA 4BK8A 3NZUA 4D3CL 2HVKA 1ZE3H 7FABL 3KPQB 5IB3B 3KNBA 4OZIB 1IQDA 4YDKH 1MF2L 3PG2A 3Q6FB 2COVD 2Y4SA 1F3RB 4XP1H 4U49A 3TESA 1QOKA 5CR8A 2P9RA 3GXIA 1QZ1A 2BOCB 3EDEA 1NLBL 3N44B 4ZOEA 3SKOB 3RWEB 5ICXB 3V0EA 3B2MA 1RH8A 3RL2B 3MACL 3TLRA 4P3WA 3WN6A 1AD0B 2LHAA 4GW4A 2BOBA 2X89A 3WIFB 1NMAH 5CP3A 2GSIB 2RR3A 1ZAGA 1HQ4A 1JTTA 2K8QA 1Y6MR 4OGXH 4R4BA 4XN2A 3KBPA 5FF6A 1HN1A 4WWNA 4HV8B 2HFFA 3PJSB 1XGPA 1XTMA 3JT0A 2P8LA 4M7LT 4YBLB 3BPCA 4QRPA 4HUMB 5E8NB 4N8CH 4HSAC 3NJHA 1MCFA 4UDTA 3RWHB 3TWCH 5FOBB 4HXBH 3TONA 3TBWB 2DWXA 3P69A 1WK0A 1MHEA 5TE6L 4TXVB 3ZYZA 4ZMVA 2XUWA 3K2KA 4FQ1L 4PJXE 1BHGA 3VFOA 2OM5A 3PJNA 2DH2A 4FDWA 5I8OH 2F19L 2XC8A 1I9JL 4HSQA 3U9UA 3E6FA 3LX9A 2XQYG 2IOOA 2Z3FA 5I15L 3BZ4A 5IJDC 5JORA 1YEGH 4UM9B 4BWTA 1TTUA 3PIQA 1DYZA 3Q3GB 5DJ8B 4X9GA 2W9LA 3V0VB 4EXKA 4PRNA 2QQNL 3GSRA 4M61A 4OJDH 1CR9H 3LKQA 1P0SE 5KYNA 4TNVF 2NUPA 1NCWH 1RK1A 4P46B 5I6XB 1SYVB 2DYPA 3WEXA 5BMFH 4HJTA 4FJ6A 1I7UB 5LGYA 4GQZA 3N43B 4G3YH 3P77B 2Y5TA 4RFOL 1H3WM 4YBQD 5IM7B 3SQOH 1TQVA 2O61B 3MUGA 1B3IA 4BKTC 3UZVB 3TF4A 3H9SA 4AGLA 1CS6A 4R90L 4U2YA 5HHOE 4A7GF 2R4SL 3B9VA 2DQDH 3WAKA 5T3ZE 4UTAH 1IGIH 1UXWA 3GXNA 1J18A 2GKIA 3GBEA 4DVBB 4WO4B 1N4XL 2WWMD 1QRNA 1ZLWK 1DVSA 2YKLH 1HH9B 3QSKB 4HKZB 3C12A 4BZ1A 3MJ9L 2VZUA 5C07B 4I9WD 4JFDA 1NPJA 1U4FA 3L3HB 4XC1L 1SHSA 3D5OF 2B0SL 35C8H 3G6JA 3T6XA 3QIUC 1KJVB 3C2AL 5C7ZA 4GXVL 3WKYA 3KS0J 1AE6L 3T4AC 1JI2A 4Z3JA 1OD7A 2VW6A 2D4FA 3MFFA 1Q72L 1MUJB 3BQUD 2JLPA 4BIKA 4MAYA 2IF7A 3EOTL 4ZMPA 1EO5A 2Q76B 5C08A 3FS9A 3QI9B 4EI6A 1GYVA 4FQ2L 1OTTC 4KVPA 4L3FA 4IGBD 5KOMC 5FW8A 5PAZA 3BXNA 5TDOA 3S35L 3BPLB 3TPUA 2CIKA 1CDGA 2APXA 1QSEA 5D6DA 2A3TA 2XXCB 3TEXA 2I9TA 3VA2C 3MRLB 4K7FA 5AENA 3SBWC 3IFNH 4WJKB 1B0WA 4OJFH 3M1BA 4PJCF 4EO5A 3HMWL 1KIPA 2YKKA 5EWIL 4XX5A 1UACL 4KH2A 2AXGB 2I26N 4RAUB 3ARDD 2EADA 5D9SB 4BINA 3K1KC 4YHPA 1GGCH 3CH1B 4HWBA 3A4FA 2I69A 4P05A 3T6WA 3BRDA 1MRCH 3ENEA 1CXLA 2VZ3A 4WW2B 3EDJA 1SJEB 2BVOA 3QWOA 4IOSD 1MJ7L 1NC4B 2ICES 2EUZA 3MMEB 2WQ8A 3KM1A 2ZOLA 1QSZA 3UJTL 3LQAH 2VQ1A 4N25A 5KSBE 5C0EB 3FQTB 2VDOL 1QZNA 3BE1H 5E4AA 4AM0B 5AOIA 4OH2A 4YDVB 1EEZB 2R15A 2ZOWA 1BM3H 4NZDA 2WQUA 3CLEH 3PE9A 4RGMB 2VGLM 1UZGA 3GKWL 4OKDA 1T83A 1IE5A 3GF8A 3ELQA 4NHUA 4OF8A 1Q1JL 1YEJH 4TPRH 4U1IB 5F7MC 4ZUUB 1PTZA 4OLXH 3GRWH 1YYCA 5E9DE 3S8WA 5FAAA 1P6WA 3BP7B 3HB3B 3JTTB 5LAPA 1XB6A 1MHHA 2BCMA 2CQVA 2DQJL 4RSVA 1L9SA 1QBLH 4IU3B 3LQZB 4KX9A 5DI8B 3RTQA 1S9KC 2FJUB 1CL7H 1TZHA 3KWWA 3UTTD 1LD9B 1I3VA 1E4JA 4KNSA 1FYTE 1L0QA 1HHHA 1YEFH 4WEUD 1EEYA 2FWUA 3UDWA 3QNZA 4TL5A 4AK1A 3KDMA 3TZVB 2YEZB 4G7YH 3SYCA 4C56D 2ZWYA 1IAOA 3SGDH 3IDYB 3W9EA 2UXFA 4AEIH 5JR1L 3GMMB 2P1YA 3ROOA 2AJ3B 4KKBC 5EBMA 3A5VA 5IFAL 4NZUH 2PWGA 3T5WA 3MKGA 4K8RH 1KBPA 8PAZA 2CR0A 1JGDA 3OJDA 5J6GB 5C0DB 4TTDD 4NNXB 1OW0C 2IGFH 1QWUA 4M48H 2IG2L 1GIGL 5D72L 2IVFC 1MVYA 4OUUA 2GYSA 3OF6A 1U8KB 2ADYA 5J57B 3PV6B 3LXUX 1N8OE 1HINL 5EZLA 1HJBC 1NIAA 1WA0X 3B2PA 1PKQA 3X1NA 2WLIA 3I50H 2I85A 3NACL 4O2EB 1WBYA 2PP8A 2WC7A 1NC2B 1EJ6A 3FU3A 4JKMA 1TR7A 5EZOL 4CNIA 5AW8B 4LLMB 1B0GB 3TT1L 1X4YA 3CCHA 4HPHA 4XMZA 5HYSG 2RFXB 3U4EB 3S7GA 4Q9QL 3EDDA 1JPTH 2E86A 1N6UA 1JK9B 1BEYH 3PXHA 1PDKA 1I8KA 3AREC 1T1ZA 1E8WA 2WB7A 3L45A 5F3HA 3QDMD 3R0MA 3VCLA 3N42F 1DJSA 3NJXA 5C6WH 1CIUA 1D2OA 4FLQA 4J4PD 1EO8H 4GOSA 2HTLD 2HFEB 5E2UH 1XH3B 2PPFA 1WGVA 5B1KA 2WPGA 1TQUA 1WVZA 1CTMA 1HEJC 4UUJA 3U48A 2APBA 2QQLH 2FTAA 4HVBA 3QFGA 1XCQB 3ZSSA 2W92A 4X6EA 1WWCA 3FONA 2VWEE 4LKXB 2QMKA 1PY4A 4M1DL 5D1ZA 1FORH 4XMPL 3NRFA 5ERWB 1HEZB 4R7DA 3QXAA 2YMOA 3MNDA 2A6IA 1IM3D 5J3HC 1QHPA 5IQLA 1AZUA 2VDKH 4X6FB 2JCCB 1JE6A 4LPYA 3LKSA 1QFWI 4RRPM 3PS6A 5AW6B 1O9VA 1JWUB 1RJCA 4JFHD 4NHCL 1VADA 2OR9H 1UZ6E 4TVPL 5DHYB 4AI7A 3LHPL 2Z7YA 2F18A 2IPTL 3UGEA 1LM8V 4NQCB 2FJGB 3QUYD 4K3HA 3ATDA 4XAWL 5KZCD 1ZHKA 2VDLL 3TIEA 3U4BL 3P2BA 2EXTA 4AQEA 3V4VA 4XBPA 1H3GA 5JO5B 2YGNA 4ATTA 3FB6B 4I4WB 3RNQA 4OFVA 2HKHH 2AJYL 3R1GL 4LVOB 4UV7L 4GP8B 3TNMA 1OTUC 4MRCA 4IEFB 2E7MA 5BW7A 4D7PA 1INQA 4OIAA 4KHTH 1CFTA 3MROB 4XNDA 2QPSA 1QR1B 3P9MA 4XODA 2AXHA 5IOPA 1FNHA 2BHFA 3AT8A 1JNLL 1URIA 3ZRCC 5JMOC 1KWGA 3A4AA 4EJ1C 5AG9A 4U1HA 4JQIA 2D2CC 5DZ9A 3P3RA 1UA3A 3E8VA 3PABB 5JPNB 4U3XA 4MZRA 3LZFH 4KOCA 1NAMB 1NGWB 2DV6A 4KKNA 3K3QA 4AL8H 2BVUA 5E7FA 2Y7SA 3ILPA 1QABA 1ORSA 4IHBA 4JZNA 2WKOF 3TURA 3C60A 1TF4A 2VMFA 2OX5A 4Y4KC 1T5XB 4CSSA 1TTRA 2WTPA 3GHEH 4N0UB 4BH8B 2YMXL 4YDIH 1SVZA 1SDYA 2H6PB 2VLKE 3PCYA 1RPQA 3PU7A 2I24N 4YE0A 5F6IC 4MD4B 4NUMA 3B5TA 4E41E 4ZD3L 5KTEH 3BVNB 5J12C 3U9WA 2PO6A 4DP1X 4OBSA 4KDTC 3QIBA 1W6WA 1XSJA 4MNGB 4L3EB 2X5PA 2KZKA 2BMKB 4RIRB 5EZJB 5T8IA 4XZ4A 5EOCL 1T2QH 5KYUB 2NY1D 3PWPE 3VTMA 3U9PL 2VB5A 1GGIL 3TP4A 2D7NA 4H7VA 1R5VB 3QO1B 2NY7L 5IJVB 4YS4A 2NXZB 2Y7MA 4QXGL 2CA4A 1JFQH 3L5XH 4NFCA 2ZQKA 3MUUA 2DQ6A 4Q97A 4X6CF 2BIMA 4FD0A 4A67A 4KVCH 2EKSA 4QO1B 2EIMB 1X9RA 3RVWD 3C6LD 4RDBA 3RLSA 2LAGB 2OL3L 2I5YL 3C5ZA 4PRIA 5B1JA 2F7QA 4DZ8B 3BQUB 3ZMEA 3DMMC 2IFFL 3FTGA 3ARBD 5D71H 1NAKH 3NTCL 2X6BA 4K4KA 1OSZA 4KRMB 4IGBB 4F7CB 3H2QA 4AQ8A 1KCVL 1UM4L 2AGJL 3IRZA 2WOYA 3LPGA 4PW9A 2VIRA 3P02A 3UP1A 1RVFH 3QIWA 2L3BA 2DMKA 3BAWA 3R06A 5D2LA 3ZO0A 1S2EA 2EDTA 3QPXH 4Y16A 5D1XA 4ZQKB 5BV7B 5DRZA 4M7LH 3VRIA 4P2QA 1P7QA 3JQOB 4NKOB 2FO8A 2IC2A 3GLDA 4RMBA 3PWLA 3F58L 3B2VH 3RGBA 3RPIB 3ZTNH 4NO2A 2YEVB 3CFMA 2BNUB 3L4ZA 1DVQA 5IB4B 2K45A 2WXQA 3NCFB 2LE9A 4J3XA 2CAKA 3RVTD 1LQBC 1T1XA 3R8BB 1LVEA 4EN2A 5F0JB 1IBHA 5C3LD 2W65B 1TZIA 5DURD 3BQVA 1YCSA 5TE4H 1N6VA 1FCGA 2W9DH 1WYJA 4RMUA 3VXRA 2EXYC 3T0VA 2PXYC 2YQGA 3ETBF 1WIOA 1ECZA 4H8HA 1T7XA 4TLSA 3OQ3B 3WU1A 2FNBA 2E27L 3CZJA 2Y06H 5I6KA 1BGXH 3ZZSA 4OCXH 2AAVA 4JDZB 2QDWA 3HVDA 3STZB 2ZXQA 1IRAY 3ESVF 4KK5D 3K1DA 2XPYA 4UM8A 1C08A 5FHAL 5CD5C 4G5ZL 2ED7A 3GIZL 3NCCB 3K8KA 2WXFA 3ATBA 1Q0XL 4H26A 1SDDB 3OKNB 4HUXA 1CE6A 3FMGL 3HI5L 3L9RB 5I0DA 5KSVA 1MHPL 1WFTA 1WDAA 3MV11 4PSRA 5EHFA 1R3KB 4KTEL 3GMPA 5AW4B 4NQVB 1NIFA 2PUQT 5BQ7B 4J3VA 5ENWB 4G6AD 2D3LA 4GXFA 5HGDB 1QFOA 2LU7A 1X9QA 1X3DA 2BP5M 2YFNA 1G7IA 1ROWA 2I7OA 4RSYA 2EH7L 3HN3A 3UTTB 1S7XA 1CICC 3BD4A 4KJYA 2R0ZH 3MGOB 4N1CA 5D7KE 3EYFB 3IGKA 3VGAC 4JY4A 1AIZA 4NGHL 2EDQA 4O5LL 2NQDA 2R2CA 1A4JB 3SKJH 4WTQA 4C56B 4YHLL 2FNWA 2XV0A 3D0LA 4PGEA 3FO0L 5KVGH 1H15A 5F0MB 5IEKA 4L1SA 3NJGA 3JYBA 3FSAA 2FK9A 2GIYA 1EHXA 2HJFB 4JY6A 5AKSA 3WJMB 4E2OA 5E8OB 5HJBA 15C8L 1TCRA 2X89D 5F71A 1T4WA 4S11A 3QRBA 2AEOA 3DV6B 4GFTB 1WCQA 4L1LA 4OT1H 5DJ0A 4PFEA 4H8VA 1ZVYA 5FXCH 3CSBA 1L5GA 1MI5A 5C9JA 3WNLA 3LRLA 2PCXA 4QRPD 1PNDA 1CD8A 4BELD 1HC1A 2J2ZB 1HZHH 2P52A 3UJJL 3GB7B 3I3BA 3MHZA 5TPWL 1S9XA 4XTRD 2H47C 2YD9A 1UB6A 5DD0L 4DT2A 3IWVA 3HFFA 2VLMD 3IPFA 1NGPL 1KEMH 3GBNL 1F02I 2OMYA 4RAVB 1F1DA 1JPST 2R1XA 1HCYA 3F01A 1X7SA 3ESNA 4FZEH 1FH2A 1IC4H 5TJWK 2Z9TA 4XWGH 4YHNB 1J86A 3K7UA 2F08A 1NJ9A 2WHVA 2BSSA 3QDMB 1QSFA 1UUSA 1U8CA 3FT4A 1IT9L 4XBMA 3DHJA 2P28B 3ZKMC 3QA3B 4UANA 2MIZA 1IGCH 3I6SA 1Q94A 1RZPA 4FRWA 4N9GA 1NCUA 3L5HA 1HVXA 2CMRH 2HRPL 1I1FB 1IGTB 3S3SA 5IR1B 1WZMA 2DYPD 1E4HA 2RALA 5E1AB 1JZGA 2AQ1A 2QVMA 1RP8A 1X5XA 1IO4C 3NEOA 4R2GD 1K5NB 2YR3A 4FFZL 2A83A 2EDLA 2BINA 5KJRL 4HIXL 2JJTC 5DHVH 1F5WA 3HHRB 1IX2A 3H9SD 2XWEA 3PWUB 1M7IA 4G43A 4HJJH 1KBVA 2Q9OA 4KGLA 4NRXB 4YLCA 5I8KL 2JLLA 4LFHG 2E9IA 1KXVC 1PEZA 3DJTA 1QRND 5E0FA 3T1FB 4X50A 5CZRA 4X4YA 1X5IA 3F04A 4WU5A 2E3VA 1IEBB 1P5UB 4UNVA 5MEND 4MS8D 2CCLA 2HX9A 5FKAB 2P8PB 2GJRA 4K73A 2EO7A 1P4BL 1A22B 2CDFA 2HRGA 1X9LA 1DVXA 2B2XH 3QUYB 3I3EA 4N6QA 1JXGA 4NAMA 3VXSA 3Q9PA 5KZCB 3N1GC 2UYLB 2VSDA 1F45A 2FYYB 2ZXBA 3HBZA 4PS3A 4QCIB 5AB1A 4NPJA 4R83A 2JCCE 3S36L 3L5WB 4MAYD 1LP9B 2EP6A 3FUIA 1P6AB 5C08D 4F5CE 5L6YH 3BISA 1SN5A 4OLZH 4UWQB 1FJ1A 5D7IE 4NQCE 1RCYA 1QSED 4OU3A 2VRQA 1P84J 3N91A 2L0DA 4HQQH 1FN4B 2MWCA 1U3YA 1IILE 3GJFB 2ZCKL 4HH9A 2GW5A 3D4ZA 4P3CL 3VFMB 1Y7VA 4KZEL 4JQVC 4ZSOB 2WO2B 1LO4H 4GSDH 3OMAB 2ZTBA 1V10A 3ZRFC 5IBLD 4NNPH 1FFPA 2BY0A 4JM2D 4BFIB 2WWKO 3WLBB 5FECB 4QJ5B 4XN9A 1A1OA 1FBIL 1N0LB 4L4JA 2FHFA 3EXJA 2NQ3A 4XB3A 4JPVL 5IMKB 3RVUD 3OJVC 2NTFB 5F7DB 2JB6A 4HKJB 1E9OB 1MFEL 4P5SA 4XNUL 4AQOA 5GS2H 2K6YA 4HC1A 3I85A 4GBXA 3ULSA 5M7QA 4HK0B 3WDJA 3H42H 3VDCA 3BCDA 1P7HL 5I1CL 3L4CA 3L16A 2P7TB 1PFCA 2AJSL 5HHQA 5D8JL 4MMZB 1ONQB 2FT7A 1JZ5A 3GC3A 4UAOC 3AG1B 2E7HA 3I9GH 4FCAA 4FZ8L 4GH7B 3UTSA 1FYHB 2OI9B 3SKNB 2HMID 2WLMA 3MNMA 2V7HA 4LEOB 4MD0A 1OP4A 4PTTB 4FABH 5JIDA 4L3EE 1YEKL 4FFYA 3V9EA 4HWUA 3VQMA 3C6LB 3J7HA 3BH8B 3CXHJ 3ARBB 1DBKL 1A3LL 2Z6FA 4NT6B 4UB0H 4L37B 1ORQA 1RZIA 5FO7A 4QGYA 2Z0BA 3ZKND 3UAJC 3KYMB 1QFWH 1ZLWH 4IRZA 3ZT7A 5HI4D 2X1OA 3MUZ1 4S1SL 5ALBH 1TJHH 3VFSB 1XGRB 1XMEB 3HRZC 5DJXB 4PJDA 3KH3A 4MXQC 2W07B 5CLWA 1R5IA 2RACA 3MN8A 2P24B 3MLZH 1F3DH 4QXWA 1V7NH 1A7QL 3LIZH 4HUVB 3MJGX 3WELA 4H4NA 4P2OC 5AW1B 5GGVH 4HJ1A 4L8BA 4AJ0A 3OF6D 2OULB 3HR5B 4OIFA 4YZFE 3KJ4B 1F58H 4CMMB 5DURB 3SDYL 5K9KA 1KB5L 5F9JA 2ZIDA 1I75A 4Y8DC 5IESH 2V9RA 1T20B 1TFPA 3UPAA 4K3EH 4PLKD 2XKSA 3UFIA 4JFOB 4QRSA 3OKMA 3VXNA 4IJTA 3QNXB 3OB0K 1RK7A 2H3XC 3QO0A 4MJ5B 4ZI8A 4LCCA 1VZGA 3LZOA 3MLSL 3HNSH 5J8OA 4KJPD 1ZE3C 4G9FD 2VL5A 1BIHA 5FKPB 5CBAA 4B5EA 4HWNA 3KL0A 3QJOA 3APCA 3C8HA 1EA9C 5E6YA 3HAEG 1KN4L 2OCJA 2R69L 3AREA 3H56A 1RIHH 1YECL 1FV1B 4LLYA 5D70L 2CJSA 1RY7B 3MRCA 2HVKB 4JG9A 3GNML 4QTIH 2WLYA 5EIVA 5C2BH 3S4SG 5JMRA 1Y0LA 4HWZA 1IQDB 5D1ZD 4X5LA 1YA5A 3QFJA 3Q06A 4XP5L 3CFJA 3DRTB 4W9ZA 5KVMC 2ZYHA 1VJSA 4K3JH 2B1AH 5TF1H 2NCEA 4J8RA 4X4KA 2XN9A 1T22A 5I9QC 1JI1A 3U7YL 3VTAA 1M56B 2BPBA 3UAEA 5E6IA 4GW4B 1KXHA 4F7PB 2AITA 2VAJA 4OQTA 5C09A 2NLJA 1HQ4B 2P5ED 3J2PA 5AVTB 2D7QA 5HI3C 3EXLA 5DHEA 1U8OA 1OANA 3HHSA 3Q7JA 5FF6B 5JW3L 1OAUH 4C56E 1R1CA 2HFFB 1WWWX 3V2AR 1F8TH 1SEQH 1XGPB 3N1MC 3ZUCA 2P8LB 4LDLB 5EULV 4L9DA 2GBVA 4IRJC 3VX1A 4QRPB 3RWGA 3SBQA 2FLBT 4OGAD 1B6DA 5GGTA 1FNGA 4AEHL 1MHEB 5KVFE 4AENB 2R1WB 1KJ2H 3RY6A 3TJEH 3U1PA 3T0EA 5FPIA 3LB6D 3U9UB 4BZ2L 4FL4B 1J48A 2FJHA 2QKSA 3K71B 2LVEA 4M03A 5BVJB 1S7QA 3JVGC 4K2UL 4LSVH 4N1HB 4OZIF 1JUFA 3BKYL 4AOFA 1AFVH 3S34L 4PJIA 3GSRB 4M61B 3SOBH 2B9AA 3LKQB 3C60D 1PLGH 1KPUA 1IAKA 2NUPB 1IEHA 1CFQB 3QDGA 1RK1B 4D3CH 2GEEA 2DYPB 3KPMA 4PWIA 1T2XA 3WEXB 4PGCB 4HDIA 1MF2H 1BFTA 5AD0B 1XD1A 5T5NF 3FPYA 3HNVL 4R2GB 1CF8L 3NRQA 3QDME 1R9FA 2PO6D 1EGJL 3EH2A 3MUGB 4WHYH 1S78D 5KSUB 3H9SB 1NLBH 3O8XC 5I0VA 2AV7B 1U42A 2E56A 5IB5A 3MACH 2XX0A 3LKRA 1QRNB 3IFLL 3WIHA 5MENB 2QEJA 2W91A 2QLVB 3IF1A 1SM3L 3G6JB 3I2CL 4ODWB 3ARFC 1IC5L 1L0PA 4POZC 2BZCA 2E4TA 3MFFB 3C5ZD 4PRID 4MAYB 5D4QA 5TE6H 2WJ7A 5C2UB 5C08B 4FQ1H 1HFUA 4Z7WE 1UZ8B 4EI6B 2F1EA 2CKBA 3VTTA 2EDJA 3MC0A 2F19H 4EI0A 3BXNB 1I9JH 2W60B 3QIWD 1MCIA 5TH2A 3BVVA 5I15H 3B9AA 5D1XD 3TPUB 4Y16D 2CIKB 5IV2A 1QSEB 4HPYL 4P2QD 1P7QD 4WI2A 3HTLX 3DMMA 1NFDA 1TYJA 5TFSL 4OLYL 3V4PL 2I9TB 1FLTX 1RAMA 1J1PH 3CX5J 4ISVB 4K7FB 2X9WA 4H5SB 4XO4A 2QQNH 3N43F 2C4XA 2YHGA 1WRFA 2Z64C 2VXTL 3M1BB 4Z7UA 4HJEA 3S5LG 1QNZL 2FJFA 1KIPB 3H2WA 4L0PB 4D8PA 1XF2A 4AY0A 1NH6A 4PBDA 4JM2B 2BW4A 3PQYE 4YHPB 4R26L 1QLRA 3D08A 4RFOH 3ULUE 2W59A 5FB8A 2XICA 4N3UA 4PJGE 3SDCC 3BLBA 3VXRD 3VI3F 4Z8FL 2ADIA 4R90H 2R4SH 4H25A 1O7VA 4KNTA 3EGXA 1BQHG 3WG7B 5F21B 5F88A 4BQCA 2I27N 1N4XH 3MRNA 2D7MA 1EZLA 1Z0MA 3NPSB 2KDYA 4AGOA 4XPTL 3BAJA 3MJ9H 4KMLB 4E9TA 4RH4A 1C8PA 3RWFA 4XC1H 2UWEE 4GAFB 5L7XL 2PXYA 1VKXA 2B0SH 2Y22A 2NY6D 3C2AH 2D31A 4GXVH 5CEZD 1AE6H 1S7UA 2K3HA 4KUCF 4YSSA 1HNYA 1P1ZA 1EFXD 2G5RA 1Q72H 4LVEA 2FWSA 4NZRL 3Q1SH 4NRYA 2GK2A 2V8MA 1EAOA 3EOTH 3VFNA 3FULA 3KLKA 1VSCA 4WHTA 5ESQA 4XNBA 1IBBA 2ORBL 3NJJA 4FQ2H 3KWWB 1C16A 1CQYA 4K8RC 2FR4A 2PMZA 4RAHA 4MD5A 4LB8A 1EEYB 4NM8L 1VACA 3QNZB 3S35H 3KDMB 5HGAA 3GS7A 3V8OA 4AV5A 2A9DA 3TJPA 3CGTA 4FTVA 1IAOB 1QHQA 2FEJA 3W9EB 3QAQA 3ROOB 5MEPB 2NY4C 2YAOA 3S5LA 4RWYL 3MUJA 4MNHA 1CURA 1CICA 2FEDD 1SLUA 3K74B 4LNVA 4DESA 3HMWH 3WTYA 1JGDB 5EWIH 3OJDB 1UACH 4XR8C 4FA7B 4WEEA 3OWRA 3DXAA 3PDDA 4LSPL 2WK2A 2NX5A 2EC8A 3FU7A 4OUUB 5DYFA 5IB1A 1MI5D 3BGMA 1QEWA 2M26A 1U58A 1O6SA 1BQHA 1MJ7H 2NTSP 5EZLB 5EIQA 1PKQB 4HULB 1QD0A 1T7YA 3UJTH 4OFYA 3I6KA 1VZHA 3TN0B 4CNIB 1ZLUK 3BH9B 2VDOH 4ICXA 4S0HA 2X3AA 4ZNEA 2H2SC 3CIAA 2Q10A 1KFAL 2HPOA 4I88A 2D0HA 1KPRA 1HDMA 4XX1E 5DXWA 4NS0A 1TSHA 4JFQA 1EZUA 4DAGL 1PDKB 1I8KB 3TL5A 1Q1JH 2ICWI 1AS6A 1T1ZB 5D7SL 5F3HB 3VCLB 4PJ5A 1MNUL 1VGEL 1Z1WA 1HWHB 4B0MB 4LIQL 2TRHA 2HT2D 4ZFQA 4G9FB 4CSZA 3ERXA 3ZDZF 3K6NA 5G5DA 2DQJH 3GS0A 3HS8A 4ZW6A 5KYWA 4UUJB 2BCKA 4A2MA 2MJWA 1D3CA 3IU3A 3O6LL 4X6EB 5EU3B 4KJQD 3GMQB 2BVPA 3FONB 4WEMB 5CBEB 2BNRB 4PVMA 5D1ZB 4D9RE 3QAZB 2X40A 1MELA 2B1OA 2XA8L 4RCAA 3QXAB 4R7DB 3V5KA 5JR1H 2A6IB 3VACA 1XQ4A 4GQRA 5IFAH 4LNRA 3OHXB 3LNGA 1JDCA 3CVHA 3UABA 5DVLA 2WZ6A 3LKSB 4KKLC 2RJMA 4G42A 4JE4B 3TYGL 4Y1SA 1G0DA 1VADB 3ISYA 3QUML 3QXUA 2IG2H 1GIGH 4KRLB 1XXDC 2Z7WA 2Z91A 5D72H 3T8XB 3ETSA 1DQLL 1I1AC 3G08B 2P5EB 3RUGF 3VXSD 1HINH 3P9WB 4I18A 5AL8A 4MMXA 3MDJA 3PWVA 2IV9A 2WUCL 4RDQF 2DTSA 4AQEB 1KXVA 1FO0A 3NACH 4HPOL 3QJTB 1T04A 4JO4L 3L81A 3VWKA 1MQKL 5EZOH 3RNQB 2FIRT 4NC1C 3TT1H 1F3JB 2ID5A 2HX7A 1NWOA 1KCWA 4KFZC 5D7JA 2EE9A 3TNMB 1OHZA 5H8DA 4JN1L 4ZX4A 4Q9QH 3BJ91 3EGDA 4Z77A 1INQB 4AL8C 3GMLA 2EDXA 4ODSL 2LTQC 1L3NA 4PY8J 3T0AA 3P9MB 4F57L 4NC0B 4ZZKA 4DSYA 5KVDE 1T0NA 3FO1A 2FB4L 4ORGB 3ABLB 1G6RL 4HMEA 4U1HB 5J11C 4ZX3A 3O3EA 4QRPE 2CO4A 2NY5L 3U25A 1G1KA 4FMKA 4U1GC 2CHWA 4LARL 3ILPB 5FUZL 4F2FA 3QWNA 1D7FA 3KWUA 1UH3A 4JO1L 2QJDA 4CC4C 3C60B 2OX5B 1Y07A 2X88A 4B9YA 1K3ZA 5TQ2L 4B3VA 4PJBE 2P8MA 4M1DH 2FRGP 4XMPH 5SX5H 3V7AG 1FAIL 1RPKA 3U36A 2VUYA 4GBXD 4LFHD 2PO6B 3PWNB 3D39D 5EPMA 1IVLA 1UB5A 4WKZB 5ICYB 1AAJA 1B0RA 2Y69B 5TK4A 1EHLL 2KQMA 2R0WL 1F6FB 5F8QC 4M3JA 3BRFA 2QVTA 1U0QA 3N1QC 4M56A 4NHCH 4PJ6A 4TVPH 5GZNA 1R5WA 3LHPH 1CMOA 3QQ4A 4ELMA 1O6VA 4QAMB 2VDKB 2IPTH 2ZAHA 3KWVA 3T3MB 3ZY7A 5KN5A 3IT8D 3UTSD 4XAWH 3VQ1C 4E9WA 2VDLH 3FB7A 3IYLW 2WAQA 3U4BH 1AYOA 5FYJU 2EKSB 3HG5A 4DN3L 2J8UA 5CJXC 5CGMA 1TPXC 2D7TL 1QBBA 2NY2C 3UIZA 2AJYH 3R1GH 2OSLB 4UV7H 4PRIB 2C9SA 3EAKA 4WFEE 4BFNA 3HE6A 5JW5B 3FTGB 3P0VL 2HT3C 1QRNE 4FQXC 3MGAA 2IEPA 2Q7AA 3QUZC 4DHLA 1OSZB 2YC1B 5MENE 2NT1A 3JWOH 4LSTL 4UOQA 2VIRB 1SN0A 3H9HA 3QIWB 5DD5L 1A14L 5D2LB 2VM9A 1GY2A 5D1XB 5EA0L 4Y16B 1ZJAA 2N56A 4P2QB 1P7QB 3GIVA 3V5HB 1DO5A 4PBWD 1PYWA 1WFIA 4NO2B 2Q5BA 3TA3D 5C08E 4PP2A 3BZFA 1GA2A 5EH1A 4K71C 1NUGA 4G9DA 3D8MA 1YUHA 4W9CC 4JREB 3VI4A 4GW5B 4N2AA 4U6HB 2YMXH 2OXGA 3TBSA 1TQBC 1T1XB 1UA7A 2BRRL 1KDJA 3HRZA 3L3KA 2OZ4L 3V0AC 4ZD3H 4LCWA 4KWUA 1LMIA 2R7EA 4NQXA 3WTWA 5FFOA 4L05A 3IGFA 4R97B 3FAXA 3VXRB 5KBNC 4XPAL 3FT1A 5EOCH 4P2OA 3U9PH 4P5KB 1GGIH 3CZSA 5HHPB 2YS4A 3JBG7 4KMQA 3L9EA 1H6FA 4FYQA 4JW3A 2AW2A 1C7TA 2NY7H 5C0BD 4QXGH 3UO8B 4FA8A 1DUYB 4JL2A 4N0RA 2P3YA 1C08B 2LLLA 3MXVL 4H26B 1W72L 3UXFA 4HUXB 2Q3XA 1CE6B 5EIIG 4QXUL 4CDGC 5KSVB 4XNMB 3RIAK 2CU9A 1EFXB 1FIEA 2OL3H 2IPKA 2I5YH 3GMPB 3S2AA 1DVZA 4FFTA 4PS4L 5E8PB 4DQAA 2ICEC 3VGEA 2IAMC 2IFFH 5JXEC 3ARED 2XTLA 3NTCH 1G7IB 3G04B 1JXKA 3WNNA 1TLKA 3RWIA 3BUBA 3NIGB 1S7XB 4KJYB 1KCVH 1UM4H 2AGJH 5CSZA 2JE8A 4FF9A 4JY4B 3TFBA 3QFJD 4EKXA 3U82B 3CHSA 1DANU 1WSST 3WEAA 1EXUA 2ODHA 3K6DA 1A0QL 3F58H 2XKUA 4PGEB 2XN9D 3ECWA 2F2HA 3EJZD 3VAEA 2HVJB 5LCVA 4JY6B 1EXGA 4L3CA 1K9TA 3T0WA 5E6ID 1JYXA 3ARGA 1TCRB 4MQTB 4MHHI 2V9UA 1YHPA 2DEXX 5C09D 3ULVD 4GEJA 3BT2L 2X6CA 3MREB 2LR4A 1WWBX 2GAZB 2B3IA 4F7MB 1JGIA 2ILLA 4FQQB 4XN4A 3K81A 1M7DA 1NCNA 4L1HA 1MI5B 1SFDA 4KZCA 5C9JB 1OAJA 2PW1B 1G1CA 5KYXA 3CSYA 4EQ3A 1WV7T 1B3JA 4P2RA 2XPZA