3GF8A

Crystal structure of putative polysaccharide binding proteins (duf1812) (np_809975.1) from bacteroides thetaiotaomicron vpi-5482 at 2.20 a resolution
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
284
structure length
284
Chain Sequence
ECRLSVKFKYDYNMEFADAFHAQVDKVELYVFDKNGKYLFKQAEEGSALSTGNYLMEVELPVGQYQFMAWAGARDSYDITSLTPGVSTLTDLKLKLKREASLIINKRMETLWYGEVINVNFDGTVHQTETINLIRDTKIVRFGFQSYTGSWTLDMNDYDYEIIESNGHLGHDNSLLDDDVLSFRPYYMEQKDPATAYVDMNTMRLMEDRKTRLVLTEKASGKRVFDINLIDYLAMTNAEGKNLSTQEYLDRQSNYHIIFFLSESWLAVQIVVNGWVHRIQEENQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative polysaccharide binding proteins (DUF1812)
publication title A conserved fold for fimbrial components revealed by the crystal structure of a putative fimbrial assembly protein (BT1062) from Bacteroides thetaiotaomicron at 2.2 A resolution
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Carbohydrate binding protein
total genus 69
structure length 284
sequence length 284
ec nomenclature
pdb deposition date 2009-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08842 Mfa2 Fimbrillin-A associated anchor proteins Mfa1 and Mfa2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2090 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3gf8A02
2.60.40.2100 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3gf8A01
3GF8A 4QDGA 3PAYA
chains in the Genus database with same CATH superfamily
1JWMB 3VXME 5HYSA 3LEVH 3QUZD 2JKLA 3CVIL 1DQKA 2HT3D 4MS8C 1D7CA 2FIRT 3ARFD 4JPSA 4X6EA 3RL1B 1F45A 3T1WA 1RHFA 2A6IA 5D7HA 1GGIH 3HJEA 3KDPB 5D71H 4DO5A 1N64H 1F3JB 3BD4A 4MJ5B 4QRRB 4NZRL 1U8JB 4OBSA 3WAKA 4EOWL 3BIAX 2YPVH 5KVGH 3CDFA 3RWDB 4ODUA 3GBNH 1ZLWH 3WIHA 4OI7A 5L88H 4JZJA 4LK4A 1N5AB 2XZAL 2BY2A 4AQ1B 5FR3A 3LEVL 1HJCA 1QWHA 4X9GA 4KJWC 1L9MA 3IWUA 2ZKHL 4D9LH 5FB8B 1CL7H 1CB4A 1QO3B 4KAQH 1GGIL 3AREC 5D71L 2AZAA 5IKCA 5I8CB 1N64L 3DTXB 1QSEE 5I73C 3I02B 1ZT4B 1TF4A 5IOPB 1NFKA 3RWHB 2YPVL 5KVGL 3NPSC 5DJYB 1XCQA 3RB5A 3GJFK 3GBNL 1H3UA 3FDWA 3QO0B 3ULUD 2WKLA 4B9ZA 1W0VA 2APXA 1KTLB 3LPPA 5L88L 3CFUA 1KCSH 5AZEH 4APXB 4HULB 4QY8A 5GISH 1NCUA 3FN3A 3KWXA 4MNQA 5DZNA 4KXBA 4EDXA 1PL3A 2VM3A 3DC0A 1ULVA 3HB3D 4F2EA 3QJZA 4D9LL 3S7GA 1CL7L 3ZHLA 2OYPA 4KAQL 1XGUA 3ARWA 5FWQA 7FABH 4HHWA 1GR7A 3A47A 3MTRA 1ZHKA 4RDBA 4UZGA 4L0YA 2ZE0A 2DQJH 4DP4X 4A7TA 4DEPB 2CKBA 2DEYX 1I1FB 3ARZA 1E27B 2CJ3A 3SBRA 1FH5H 2YXWA 5F6HJ 4HKXB 2C1PB 1KCSL 5AZEL 4PTUA 4DH2A 1NMAH 1VFBA 3RY5A 4U3SB 2DL2A 5GISL 3WIIH 1P84K 1DVTA 1ZGLA 2QSCH 3BVXA 5KSUA 3QJFA 2A74A 3QEQD 5AW0B 1P5VB 4LGPB 7FABL 4G80A 1J8KA 3II3A 5IROC 1AMYA 1P4BL 3AWEA 4I0PA 2DQJL 4XX1E 1KLFA 3T2PA 4PCSA 3QORA 2KZBA 2WGXA 1N6QH 4FZ8H 3VD5A 1FH5L 2DQCH 1NOFA 1DCEA 4PJGF 5HVFB 4TNGA 1B9KA 1UC6A 5LCVA 4X4XB 3DX8B 2A6KA 1KYAA 4KK5C 3D87B 4XN2A 1RFDH 4L4VA 5B7EA 4P8QA 3SJVD 3WIIL 3VSVA 4JFOA 3BUTA 4XP9L 2O4EA 3UABA 3KLSA 4A2LA 2P43B 4JRXD 4G9FA 4B5ZA 5HYJA 4WAFA 5JLZB 5EV7A 3KBPA 2ZSWB 1AANA 3MZGB 3WS6C 5I1CL 4F7CA 2BH0A 4JW3A 1RH8A 1A6PA 2Z4TA 5JUEH 2WYHA 5DMKB 3P2DA 2EEAA 3SGJC 1BDYA 4FZ8L 3ZRCC 2CDGB 1N6QL 1G7IA 2DQCL 3O6FB 4YLCA 1MCPH 3GSOA 4P2RD 4PD4J 2HFTA 4Q14A 1LE9A 2FT6A 1AC6A 4Y2DC 3CG8A 1RFDL 5H4YA 3MBEA 3AS2A 5AOMA 5KSBB 5C0DB 3LXUX 3ZTCC 3LNIA 4WHTB 1BZ7A 4KKLC 4RGOH 5JUEL 2C1OA 5AOZA 1W80A 1PD0A 4A39A 4DP1X 1YC7A 5KOMC 3IF1B 1CLOH 1AZCA 4NHCH 2CDEB 1MCPL 3TN0A 4OCLC 3AROA 3TJPA 5TH2A 4KX7A 2X0UA 3O3UN 4EUPA 4H88H 5T33H 1UOWA 2EYTA 1S7VB 3K5SA 1M05A 4IGBD 4BFNA 4ZPVB 1TTUA 5GGVY 3RVVD 1BEXA 3MLWH 4WTXA 2VXTH 1YPZA 1YG9A 2VLKA 3CCHB 4MYWB 4HOWA 1P6FA 2W0PA 1R5VA 5J11B 4TQHA 4RFOH 3HE6C 4RGOL 3E7JA 2PXYA 1BFSA 1FAKT 4U1GC 2WKGA 4ANKA 5E1QA 3D0AA 1XL6A 3FRPA 3TBWA 2I7SA 1CLOL 2HT2C 4NHCL 4GQPH 2F54E 4CN6A 2MRYA 4NPYB 3HG4A 2C3WA 2QKSA 4PI2A 4H88L 5DR5H 3ULVE 4P5KA 3VFTB 3MRGB 4J6RH 3EOBB 1XFPA 4J3OH 3LCYA 2OJZH 4L18A 4KHTH 2UY7B 1UWXK 2F08A 2VXTL 1UZ6E 2H41A 4KROD 5I71B 3ZSTA 3S35H 2AV1B 2QHLA 5TF1H 2FECI 3MGAA 4L4TA 5DVNA 4DOHE 2FJSA 4RFOL 3ARBC 4V1DA 3WMQA 3WI9A 1QZ1A 2X0WA 4B0MB 1KIQA 4GXVH 3OSKA 3QEGL 4HLJA 4ZMQA 3KH4A 3VTTA 1AIZA 5I23A 3WO4B 3QCTL 4M00A 4P2AA 2B3RA 2WKOF 4PCTA 3JVGA 1Z1WA 3TO4A 2VLRE 3FRUA 1I3UA 2WIIA 3JYCA 4E41A 2X1OA 3QA3A 5DR5L 3A23A 4AKOA 2GQHA 5D1ZD 2PP7A 3QDJD 1BGXH 4J6RL 5DMKA 3VA2C 1XF3B 1OPGH 2ESVE 2OJZL 3CZJA 4KHTL 4NQEA 4W6XB 4CGUB 1P6WA 3D33A 2EXTA 2MHAA 3S35L 3WUWG 5TF1L 4HSCX 2EDYA 3EDDA 2OTWB 5F7NC 2XTSA 3V4UH 4MXVF 4PJIF 1N4XH 1XF4B 2QMJA 2E56A 2XWDA 2WWKO 4GXVL 5DJ6B 5HHMB 2J8UB 1MCHA 5B7FA 2C7UA 4A2MA 5C71A 2J21A 1M7DA 1N8ZB 2WJ5A 3MV9E 4X6CB 2ZXEB 3UG3A 4ONOA 1JI1A 1K2DB 3FBKA 3UADA 2NUPB 3VWJC 4HHAB 2X9WA 3RWFA 3GINA 5DJCA 1TFHA 3LIUA 4OCMC 3UDWA 2XG5A 4ZMWA 3U46A 1BGXL 1JWUB 3NG5A 1HDMB 4IHOA 2YRLA 1JPGA 1OPGL 4B9PA 4I13B 4BZ1A 4MWFB 3QJUB 3OGCB 1OCWL 2BOBA 4ORGB 4JFDE 2GIXA 3ARED 3LEXA 1E8ZA 1JRHI 1LQBC 3N91A 3PUUA 4NQDD 3QEHA 4JVUA 3U4EA 8FABA 3V4UL 4DN3H 1N4XL 1W8OA 1JK8A 2LU3A 2V5YA 3PWPE 5IT2H 2BY0A 4MMXB 5GSRB 2Z0UA 4QOKD 3T1FA 5J6GA 3KWUA 4V2CB 1MFCH 3SYOA 2Y06H 5HDOA 2JB5H 3UO8B 4LVNC 4UBDD 1SF3A 3LX9A 1AIFB 2P5EA 1IBDA 1MWAA 4OCYH 4YFLF 2NQ3A 1OCCB 2JIXD 2DWDA 3DOSB 4PJAB 2WLIA 1S8DB 4BIKA 2AHIA 3B9EA 2HRPH 2H32A 1EGJA 1UZ8A 5FLUA 4FNTA 2CA4A 5C0FB 3QI9C 1WQVT 2G3NA 3DOIA 5DO2C 4ZNCD 4XP5H 3GF8A 5DHMC 4DN3L 1Z6JT 4OGAD 3WIHH 5IT2L 3GMPA 1YN6A 3RJDA 3HN3A 2OULB 3WS3B 4H25A 4LPWA 1MFCL 4PGZA 4J4PD 2Y06L 4DN4H 2WVSA 2JB5L 4U1SB 5HHNA 3RIAK 1XTMA 1FNGA 1XCXA 2GFBB 4FYSA 4IOIB 4NOFA 3AXLA 1AQDB 4RIRA 2BWDA 4UF7C 4OCYL 4ANWA 1AHWA 4NQXB 2BHYA 1VGKB 4C4UA 4EZMA 1EHXA 5DWUH 1XHHA 4P2YA 1T04B 2PPFA 2WVUA 2HRPL 3EJYC 1UKQA 1BD2A 4XCFH 1CWVA 3G5YB 3M6DA 4LIQH 1KJVA 5GS0C 4W93A 2GITB 3DURB 1IAOA 1TZOA 2NUTA 3WIHL 4UOW0 3TO2A 5IM7A 2K9FB 2OMUB 1J1PH 4PW9A 4K3HA 4J3WA 4HIJB 5KJ4A 2NNCA 4DN4L 1D5MB 4NN5C 1PJ9A 1J5IA 4KQ4H 2DZEA 5D2NC 5IR1A 2E8YA 1AKJD 4J3SA 1CYXA 2CHXA 4N1CA 1OB1B 1ZIBA 3DRTB 4JANA 2W9LA 4H8HA 5DWUL 3ZE2B 2HJLA 4MCYB 4PS4H 5IJDC 4A7SA 3N3EA 4BSWA 5J1AB 4XCFL 2VE6B 2BRRH 4LIQL 3U2IA 2I5YH 5FYJD 4HAFA 4P57A 2YUZA 1KFAH 4ZOEA 2V3DA 2EEBA 3UO1H 4G8EA 4OZHE 2PTTA 1J1PL 1W0WA 5DDHB 2PO6A 3ZOAA 1LQSR 4KQ4L 2WXRA 1BAFH 1D5XA 3QDME 2N01B 5IFJA 1J9CT 1EVTC 1ZK9A 3L5WA 3TBVA 2A6DB 3UX9B 4GG6B 4NUJB 1R5IB 3LS5H 3QIUC 2Q86A 2BS8A 2UY6B 4G6FD 4Y2DD 3W0WE 3VXQA 4PS4L 2F5AH 4WKZB 1SF5A 4YUEL 4WI5A 4R7VA 4QXTA 3TH3T 2AJXH 4H1LA 2BRRL 4Z8FH 1AGCA 2I5YL 2W5PA 3IBEA 4UCFA 3NGBB 1WFNA 4Y1AB 4HPHA 5IUSA 1KFAL 2A83B 5K33A 5T1LB 1IBFA 1AD9B 3R7RA 3UO1L 1ND0A 4HJGB 3VACA 4GAAA 5ILTH 1IGTB 1KACB 3PGCA 1CGYA 4NZJA 4DCQB 4N5UA 5DLLA 3TT3H 5EU7E 3D25B 1BAFL 2FBOJ 3NIGE 4N5ED 4IKNA 1JERA 2JH2A 4CN4A 4ETQA 5IHHA 3LS5L 4KJQC 2DWEB 2TSAA 2CR3A 3E9UA 1S9XB 1M1SA 3QB7C 4ENED 2F5AL 5KYXA 1SLUA 4PJEB 4PWJA 2W94A 3ARPA 3DHJA 2AJXL 1FBIH 1OAQH 4X6DA 4Z8FL 2C34A 4GBXB 4F7KA 4J12A 3C08H 5IB5B 1U4EA 2FECL 1KTDA 1WFMA 2CM5A 5JZ7C 4MD5A 1FNLA 2IH1A 5LCVL 2ZX8A 4LQFH 2FIKB 4PRPB 1AS6A 1T1WA 5ILTL 4BBWA 3FU7B 3TT3L 3N1FC 3SY6A 4X4ME 5BRPA 4XNZB 1Z3RA 2LV4A 5I6LA 3Q6FA 4DFIA 3CD4A 3G5XB 3AW5A 1JPFA 1FL3B 1FIEA 2CJSA 1WICA 2IH9A 1FBIL 1GGYA 1OAQL 1L0QA 3CHXA 2Y7SA 3ARBD 4RISH 1PVHA 2WANA 2V17H 3FC8A 3NA4A 5IGXH 5DYOA 3C08L 3AABA 3ARQA 3QDGD 5ABZA 1NGWB 2YAMA 4NRZB 5L0QB 4FLHA 2AQTA 4LQFL 4XCNB 4YXKH 1I7RA 3WTSA 2ZICA 5ADOH 2HPOA 3US9A 4HXAH 4U0RB 1PLCA 4ODWB 4HC1H 3GSUA 3JT2A 5F7KC 2BHFA 3OGOE 4FG0A 4DPRA 2Y25A 3POHA 1B0GB 1D5RA 4H13C 4PRID 2NY6B 4PJ6A 2VW7A 1E3FA 2Z31D 1AXTH 1YAZA 3GSXA 4JO2H 3C5ZC 1DANU 4AIXA 4JAMA 3AS3A 4Q52A 2W0FA 1RZPA 1JRHL 1T4KA 4UDUB 1DQDH 2XN1A 5MEQA 4PVNA 2IDUA 2RD0A 4R3SB 3AGVA 4YZFF 4YXKL 5JO5A 3HN8A 5C09B 3IJEB 5C08E 2QR0B 3S35X 2JCCA 3TYFA 5ADOL 3S3BB 4HXAL 4DNLA 2P52A 1S5HA 3CZNA 1LK3H 3P3RA 4FQ2H 3L4ZA 1COBA 3TPUA 4F57H 3QH3A 4Z5RB 2J3SA 3FU9A 4Y4FA 1WH0A 5DJXB 3TJEH 4ZFZB 4BJLA 3QYMA 1CTNA 3SDAA 4D9RE 4M7ZB 3ME0A 4WJ5A 4WK4B 4YDJB 2H26A 4QTHB 1WZAA 1AXTL 2YK1H 4JO2L 3ZKXB 1PZ5A 5C0CD 4K71B 5CCJA 5GPRA 3ZGIA 5IEHB 3WEXB 1DQDL 1FL6B 2XV2A 2IPKA 2F9BT 3FT0A 4G59C 5EU6B 2GJZB 1BIIA 5D1QA 4HWBA 3NSDA 3QJQB 4NCC2 3HS0C 3GSWA 3V79C 1MREH 4YO0A 5F6IC 4OH2A 4NQVB 3MNWB 4YLBA 1NCWH 1LK3L 2VIRA 4FQ2L 4F57L 5A16A 1JN6B 2WMPA 2YJLA 4Q6KA 2BVPB 3TJEL 1SEBA 4NC0B 1BXAA 5IMMB 3L95A 4H26A 2EDLA 2DLIA 2YK1L 1BOGA 4Z7OE 5JW3H 1Z9MA 4IGBB 1AZBA 3X13A 1U3HA 3CXHK 3ECWA 4CKQA 1A1OA 2Q2LA 2VXQA 4PWKA 4HWNA 5C0BA 3OTTA 4MSWA 3B3IA 3ZL4L 3KW7A 3SQOH 1MREL 1P53A 4HD9A 5E4IA 4F7PA 1ORSA 1U41A 1WFUA 2NTSP 1WE5A 1IBGH 3MV7A 4GW5B 4HPOL 4NDMB 3TASA 4BZ1H 1SYSA 2LAGB 3WKPA 4NS0A 4NC2B 3JTTB 4FTVA 3V9EA 1D3CA 2DIEA 2F1EA 4YWGH 4O9HH 3EJYD 1UB5B 4S1DC 5EEWA 4JDZB 5G5DB 4F1SA 1R3JB 3BCFA 3GXFA 5GS0D 4JN2A 2DMCA 5JW3L 1EEUA 1J0ZA 2KI6A 2ZNWA 3U9PH 4IYKA 2BXYA 2IXQB 2VZTA 3HG0A 4NKMA 4UT6A 4WTQA 3WLBA 4B7LA 3PDOA 4JB9H 3LRSB 5HDRA 4C8XA 5DMGD 5LDUA 3HZMB 2WCGA 4BXVA 1YY9C 3SQOL 2FTAA 3RQ3A 2WP3O 3BGMA 1PF3A 4BZ1L 1IBGL 3PIQA 4BYHA 5EIIG 2DD8H 4ZUVA 2HFFA 2ZG2A 4YWGL 3DMMB 2H5UA 3SZKC 2R1YB 2E74C 4M93B 1DYZA 3BHBB 3M1OA 2DQDH 1TVDA 3BAWA 1AAJA 1AXSB 1VFAB 2DF3A 3O3EA 3P4MB 4LSRH 5KYWA 2X1PA 4P2OC 4JB9L 3UTQA 1VCBC 4J7RA 4KPHH 3DBSA 3EG9A 4Z9KB 3ZDXE 5E5MB 1OGAD 2OQJB 4JHUA 5G4OA 2W92A 5HY9B 5CN1A 1WEJH 1WA2X 2J1ZA 4MA3B 4NO2B 1RIUH 1Q94B 3QUMH 4NYLB 2N3JA 4W9IC 4Y5YB 4GKZA 2QL1A 1U58A 5E99H 3D5OF 2VC2B 1Z5HA 3ELQA 1RK1B 2X4QA 4XNXH 1G7QA 2PWGA 2YD7A 4MD4A 1GYVA 2R29H 4MNQE 1UM6H 1T7VA 4LSRL 4DGUA 2FT8A 4HUXA 5DXWA 4KPHL 3AREB 1J8HB 4LL4A 5I73B 2XKNB 3O3BB 1WEJL 1A5FH 1M6UA 1KBBA 1L7IH 1RIUL 3H3PH 3NPSB 5C0AD 4PY8J 4AITA 2CK0L 3HUJA 3LQMA 4I1PA 5E99L 1O7DE 4PSRA 1BF5A 4Y7MA 2IDQA 4AXWB 2YUWA 4XNXL 3IAQA 3DK2A 2R29L 2IF7A 1UM6L 1UFUA 2XXCB 3NFPB 4PR5B 4DF9A 3KS0H 3U9UB 4AH2B 2UZYB 4HUVB 4OD2B 1T80A 4XE0A 4PGDA 2R2BB 1P69B 1W72A 4LCWA 4LCYB 1EANA 4X5WA 4ZMAT 1V7NH 2A6JB 1EH9A 2R2EB 3HNTH 4N2FA 3VFRA 3N1MC 3OKKA 3T3MB 3T77A 1A5FL 2Q3AA 4HKJB 2WOBA 3H3PL 1PY0A 1QFWI 4JY4A 1G6RA 4WDIB 4DGVH 3FKUS 5DFTA 4KZEH 5CLWA 4E9YA 4NPKA 1E65A 4PWGA 1J05A 4HJ0D 1JVOA 3RWJB 5ID0A 3C60C 2P8LA 4L4VE 5GZNA 4I3SH 3RJQB 1IE5A 3LZRA 2IBZX 4NI3A 1Y7VA 4QKXB 4H8QA 4G9FE 5HYJE 1V7NL 3ULVF 2MEJB 1T20A 1A4JB 2EIZB 2ZWZA 3BT2H 3HNTL 3G04A 3QAZC 2GTZB 1CF1A 1U8NB 3LNEA 5INCB 4PJCA 4ECNA 1UZ6F 4O00A 4EVNA 1KGJA 1QRNB 4WHYH 3B9KA 3R8QA 1WAPA 4DGVL 3FQXB 3SKMB 3ZZQA 3Q8AA 4UQEA 5ANHA 4AYFA 5F3BA 5FGCE 2IAMC 4KZEL 1THCA 5GGVH 1B3IA 2BSSA 4CN1A 4CJ1A 2BOLA 3C5ZD 3T0BA 5CZKA 4G9DA 3EBAA 1J9TA 4XXCC 1Z2KA 1X5JA 4I3SL 5I75C 1BA9A 2ZNXA 5AUMA 1KIUA 1AG6A 2VW4A 4R2GC 3AXHA 5DZPA 4UM9B 4UT9A 4EIGB 5ACZA 4HUWA 1BQUA 1SDAB 1YNTA 2JKSA 4BH8A 1KPVB 1S4IA 3U0PA 3BT2L 3CXHJ 4FQPA 2XN9D 5MI0C 1XCTA 3M7FB 3CZFB 5A2BA 4CDHA 4MX7B 2J1YA 2I85A 4DPCX 3W38A 3HMWH 3L2MA 2QPDB 1HL8A 3IMVA 4LLYA 2A73A 1GGCH 1MIMH 3JV5A 3CDZB 2JJWA 2ZPKL 3O2VH 4Y2DB 1S9KC 4ZUTB 5C2UB 2GBAA 3D48R 1YPZE 4OSUH 3LVTA 2VLKE 1J8RA 1YEFH 1S7XA 3F01A 3O6MH 3VNZA 3FB7B 4PUBH 1HIMH 5CZVH 5EC2B 3GEWB 4D8PB 4IKLA 1QLRA 3GBEA 1FFPB 1ZHLB 3AFLA 3RVUC 1MJ7H 1HOCB 3HMWL 2ENQA 1UKSA 1ZRUA 4W6YB 4MTMA 2MFNA 2I9LB 2HN7A 3SDYH 1NFDA 2CPUA 4NZDA 4I9WD 1GGCL 4Y2NA 3GXPA 3LXAA 4DKTA 2Y5EA 3EYOA 2PKDA 3O2VL 2UUDK 3HAEH 4WI4A 3DJ9A 4A7GF 3EGSA 3OG6B 5GRVL 5DTFA 3T0EA 2BHUA 4OSUL 4FQQB 4ODXB 1FE8H 1YEFL 4L4TE 1CLVA 1UEMA 3O6ML 4M8UA 2ZCLH 4V1DE 2BOCA 4PUBL 5CZVL 3DX1A 3HE6B 2BX5A 2VQ1A 1JPSH 2EABA 2ZCHH 3IFOB 4U1GB 3MOQA 4DZBB 4HGKC 4KVNH 5H94B 3RVXD 4FNPA 1P7QB 2UZXA 4GUPA 3FO9A 2BIPA 2MIZA 3HI6H 2XV3A 5CZRA 2GSIA 4AT6A 1FZKA 2WLJA 2ZXCA 5D1XA 4LRNH 2F7PA 1BQSA 1AO7A 4OLYH 4LLMA 2EEXA 3KYNB 4MJIA 5I28A 4C4KO 1Z9SB 2FBRA 2IBBA 4NQEE 2KKQA 2VLJA 2FEDC 3VMNA 3CZKA 1FE8L 3HBZA 1F86A 5ICXA 4AENB 5L7XH 3K80A 4PRBA 4XVUD 2ZCLL 5ENWA 2EO1A 1ZA3B 1WJ3A 2D7PA 2YD5A 3HLAB 4G7QB 5EMYA 3VFGH 3QDGB 1JPSL 4E5XG 1R75A 1FNEB 3RURA 2IDFA 4LLQA 1JD9A 2F61A 3Q6GH 2UX7A 3DSFH 5DJ2A 5EUOA 4F15C 4MBOA 2JQAA 2B0SH 1BVLA 4CMMA 3F5WA 4M1CD 1MH5B 3KLDA 2Z64C 1HT6A 4OLYL 5DK2B 3DVNB 3FMGH 4FCAA 5EN2A 1SGKA 3HS8A 2ICES 5IB3B 3T6XA 1NUDA 5FFLA 4GI8A 1JNHB 4JO1H 1WIUA 3SSGA 2MQCA 5HI5C 2H3KA 1NLBL 3LNFA 5CMAB 1BFOB 3E80A 5L7XL 2LFGA 1YC8A 2E4FA 2VXUH 2YGOA 4NQCA 5H35B 3VFPB 1A7PH 3SE4C 5H37H 1FCCA 1KGUA 1IO4C 5CXPA 2QZ5A 3T2LA 3Q6GL 4AW7A 1QNZH 3DSFL 2ICWJ 2ITDA 2WLHA 4AQAB 4ERSL 4Z7VA 3CAFA 1U8CB 3WIAA 1MCQA 2B0SL 2CD0A 4QRSA 1QFWH 3NOIA 5BUGA 3TJHD 3VWJB 4YBHA 2V4LA 3FO1B 1YDPB 2P5EE 2JKXA 4OZFA 1E4KC 3WO3B 4AM0B 3FMGL 1DR9A 1T3FB 4MQ7B 4OZHF 1RZKC 3QP3A 4JM2F 2ICWB 4JO1L 3VYNA 4LHJB 2BSEA 2VZVA 4IKIA 2YGNA 1C12A 4YHOH 2E7CA 1HS6A 2Y9RT 3IDMB 2VXUL 1E9OB 2AVGA 3GKZA 3V4PH 1A8ZA 1A65A 1OANA 5CILH 4FQHB 3WD5H 2VN7A 4ZG1A 1QNZL 1A4KB 4IU2A 1LE5B 1J9RA 3MRIB 4NHUB 4U7KA 2UZPA 4Y5XB 2EAEA 4G8GD 5BZXA 3STZB 3VXUB 4LVNB 5T5NF 3ZQ9A 1H0DA 1QFWL 4Z76A 1YRKA 3CC1A 4TOYH 3FUHA 4X99A 5LGYA 4UT6L 2V9TA 3VXTA 1QQDA 3GSQB 4P2QA 4MDJA 1U8PB 1TJXA 4ZW6A 4J3OG 1BD2E 3MRCB 3QI9B 3ARYA 4XMWA 4YHOL 1G43A 3L3GB 3NIGF 5MHSD 4DK6A 4HDIB 3UBHA 1I8IA 4FQLH 4LVEA 3V4PL 4XN9A 4LNVA 3P4OA 5CILL 3VRJB 4OB5H 3WD5L 4HUNB 1NKOA 5K39B 2IAAC 1G7PA 1XF2B 4UAHA 4L1TA 1CXFA 1MHHB 1RK0B 3G5WA 5KZCD 4TOYL 5E95B 1SHWA 3EGDB 5HHPB 4KO6A 3U6XA 3C60D 4ACTA 3GMRB 5LGJA 1K8DB 1KWKA 2HCZX 4B7IA 4MHHI 5E8EB 4YX2H 2FAUA 4XN8A 3LRKA 4GAYA 2HG5B 3NTCH 5JQHC 1B2YA 3BEVA 3E8VA 2BNQD 3Q01A 4FQLL 5CN3A 3US1A 3CPLB 3T0DA 5E1HB 4WNSA 2Z1PA 4OQ1A 1RP8A 2P28B 4OB5L 5D7JD 5ICYB 3LH8A 3D34A 3MOBL 3NN8A 3QDAA 4OZ4A 1WAAA 4LSPH 3TVMA 5I8OH 4NN5B 1EEZA 3EFDH 4GG8A 5D2NB 4NO0A 4RETB 3RBSA 4O2FB 1VACB 2Z7WA 1ODAA 5I1EH 2YEQA 5FUZL 2IMNA 1BYPA 1A0QH 3KLKA 2DBLH 2DV6A 1IAII 4JDVB 2QELA 4L3EB 1CD1A 2L7UA 2WTRB 3D4ZA 5KANG 4YX2L 3UG5A 2VDKB 2PCPB 3NTCL 3QZPA 1JPST 4U6TA 3UCQA 3T0AA 3D7PA 3ILEA 5D6DA 3V0VA 3BZFB 4GKNA 4ZDHB 3SEPA 3GTTA 3EO1B 1T2XA 2XY2A 4LSPL 1CDCA 4NRYA 5I8OL 3TZVC 1GZQA 1NINA 3EFDL 1OT4A 1L9NA 1OAKH 4XO3A 4N0RA 3ZKNC 4PWHA 5A2JH 5FPIA 2CM6A 5CWSA 5KYYB 1KGYE 1OGTA 3LS4H 2D0FA 3IJSA 3DDFA 3QIUB 5E6ID 1W72L 2Z91B 4S2SB 5T3XE 1A0QL 4ZOAA 2DBLL 2XWBB 2NSQA 1TJIH 4K9EC 2FX8H 4F8NA 4GKLA 4AE1A 3PYCA 4IJ3C 3TT1H 4OLVH 4AZ8A 3V0EA 4X6DE 1MIEH 3KVPA 3F8UB 4U1JA 1RXLA 4L3CA 4M1DH 3LRLA 3ZZ1A 2RIKA 1WV7T 1KN4H 4R0LC 5FKPB 4PRAB 3MRQA 3ERXA 4QDGA 2X38A 3IU4L 1QVOA 1EZVY 1KB5A 3H56A 1NOAA 2OZNA 4GSXA 4OT1H 5EB9A 1OAKL 3ULVC 2O93L 3P2TA 3MV8D 3LS4L 4JHWH 2X1QA 4UT9H 4XXDA 5I1GH 2KH2B 5KSAC 2HFEB 1NGZB 5A40E 1TJIL 4M7KH 5AYQA 2AJVH 3DX9A 2FRGP 2FX8L 3PDGA 4QRBA 4ODHH 1HVXA 2OMWB 4OLVL 4PJGB 3S3DB 3TT1L 3TYGH 2CLVA 2UXGA 2K8QA 5DK3A 1Y1DA 1PCXA 1RAMA 3GMNA 3MJ7B 2DKSA 4LLVB 1NCTA 1KN4L 3NEXA 2G5BA 3CFTA 5F0PB 3TL5A 1XT5A 3TGXA 3ESPA 5DWPA 4Z7OF 2Z4QA 3L9BA 3PU7A 4OT1L 3T6WA 4XGZB 3LDBC 4Y16D 3VXMD 1KJ2A 2HLAA 4JHWL 5I1GL 4UT9L 1AMXA 4CKVX 4BELD 5HI3C 2V5RA 4M7KL 2AJVL 4L48A 1DN0B 2QADC 4PRDB 1O0VA 2OP4H 3ILQC 4JQVC 4JQIH 4ODHL 3TYGL 1UXWB 1ZS8A 2GJPA 2CAKA 3A6OA 4EMZA 1YUKB 4RMTA 4WI6A 5EO1A 3RTQC 3G6DH 1H6UA 3M86A 3AQXA 3U83A 3V0DA 4F7TB 2WVVB 3A4AA 3NSFA 1N0XH 3ARDC 2JCCE 2RACA 3QZNA 3KNBA 2OMXB 2MCAA 2CHWA 2XVLA 4R97C 3UTTA 3HBGA 4ZZFA 2N0MA 5DD5H 4U1MB 1PJWA 4LSVH 3RX8A 3QUHA 4ICXA 3N2JA 3KDMB 3N04A 3PL6C 4P5TD 4JFFB 2OP4L 3L1FA 2BCKA 1M6OB 2ZOLB 3MGOA 1QWUA 1SBSH 4JQIL 4WFFE 1SZNA 5DVKA 5FKAB 3WFCH 4B9GA 5I0WA 3DPBB 1QSED 4LASH 1BREA 1B9ZA 4PLJD 5FFOA 5BNXD 5AW6B 5I16B 3MRFB 3VWKD 5IB2B 3G6DL 1AP2B 3DJZA 5D1QE 1WSST 3JWDC 2Y6SC 3BN3B 4JFQB 3BVVA 1F11A 3TF4A 2PP9A 3QNZB 3QUMB 3IU3A 4HCRH 1EO7A 4MJ6B 1A6AB 3D4YA 5AD0B 1NCAH 5DD5L 2OYKA 3HI5H 1JZFA 3FO2B 4LSVL 3ZDXF 4AIEA 4EN3C 1FC1A 4M43H 4LHUG 4WNQB 1OTUC 3WFCL 1SBSL 4NQSA 1MXDA 1MHCB 4LASL 4QEGA 2DI8A 5EA0H 1V7MH 4JO5A 2C4FT 2P26A 5C0BE 2PWDA 2D7QA 3DYMA 2IH8A 2BLFA 1XEUA 3HS0B 3RTLA 5D7KE 4HH8A 1ZPUA 2GAZA 2C9RA 3MV7E 2J20A 3MA7A 4HCRL 5CLZA 4FTVE 5JOEA 1NCAL 3IKKA 4P9HC 4XRCA 5HGDA 3HI5L 3VFNA 3ZX1A 4ELDA 3B8YA 4M43L 5JA9A 4BKLA 3H0TB 1T7ZA 4AK2A 2ATKB 4DFHA 3VTMA 1YO4A 1IAIH 1UJ3A 4FKHA 5GQBA 4IBUA 3VCLB 4HW6A 4BZ2H 2ROYA 3NCCB 5DRXA 1X5MA 3ILPB 3K4ZA 3L3IA 5EA0L 1JV2B 1V7ML 3PHQB 1ED3A 4WW1A 4EEEA 3JV4B 4HP5A 5I6PA 3DA0A 4YSRA 3ULSB 2KZKA 3KR3H 1IEAB 5HPOA 4F93B 1OSPH 2DQEH 3BDBA 3JTBA 5I5JA 3IJ9A 4KNUA 4Q2ZA 2JFCA 4FP8H 4PJIB 1BBDH 3FH7A 4AK1A 1RD6A 5FYKE 4PJBA 1UOVA 2XTJE 2C8NA 3LKSA 3GUTB 1NGYB 1AR1C 5FYJU 2P80D 2YKKA 2OV0A 1IAIL 4Z7QE 5EEXA 4BZ2L 2F5BL 1MCJA 3S3PA 1I3GH 4QHNA 1WC7B 1BWMA 3D69B 3QNFA 3IWVA 5IQOA 1P2CA 2V3FA 4JM2C 2XWJB 3KR3L 3UTSB 3KL0A 4B60A 3U2SB 3BQUC 3OR7B 3ZL2A 4MKTA 3RZCC 4MJ4A 1OSPL 2DQEL 1ETB1 4APQC 4NN6C 5JPMA 3GZKA 2QZQA 3IPBA 2UV3A 4JRYB 4QRPA 2BPBA 2VDOH 5TGBB 1DBAH 1KTJA 1ZJBA 3DJTA 4TN9A 4QXGH 2NXZD 2VDLB 1NMCC 4PV1C 2N56A 1I8MA 3DUUA 4X80H 4P2OB 1I3GL 1GW6A 2V5TA 1Y0LB 4FFZH 5IWLA 1CD9B 3OKYA 2GSMB 3MPCA 3TZVD 1DJSA 4YXHH 5LGHH 4HFUH 3U36B 3WTYA 1QWNA 2EIJB 32C2A 4XX5A 1E90A 3F7RA 3Q2LA 5EU7C 1ZV5A 3ZGHA 3ZKND 2B59B 3I3DA 2YMTA 2IO5A 3BFOA 4LEOB 3FB5A 4PW4A 3HUJE 3DXAA 4U2ZA 1RZ7H 2CO1A 2E6PA 2ZUYA 4GS7C 5FYLH 5FOJA 4CRPA 5JHDA 2VDOL 1DBAL 2G9HB 3FCBA 4ZAKC 4GRWB 1C8QA 4QXGL 3BVNB 3ZHKA 5FA4A 3ZDYE 3D09A 3EYFB 4W9DC 4YDLC 4FFTA 4X80L 5EO0A 5AAMA 5BRZB 3W5NA 3S96B 4FFZL 3PFUA 4OUOA 1HH6B 4LCWE 1PPIA 2F54D 4YXHL 5LGHL 3L45A 4HFUL 5JHMA 4LSTH 1BMGA 4MA1C 2BZDA 2CDFA 3TA3A 3NDZE 2CRMA 3R06B 5DS2A 3WEBA 4OKDA 1YPZF 2X4TB 3O3AB 4RMBA 5KSAD 5FYLL 1JVLA 3BYTA 1KXTB 4XH2B 1NM4A 1UA7A 2Q1EA 1FN4A 2WWKT 1AY1H 2XLLA 3QWOB 4WI2A 3LYRA 5BOPA 2L7QA 3LPGA 5DD0H 5DC9B 3TFKD 2NY0D 5PCYA 1OSEA 2V2TA 3TOPA 3EYVA 5E00A 3P4NA 2MOVA 1E3XA 4Q9CA 1CGSH 5K1NA 1VADA 5CJBA 4LSTL 1JF6A 1XBRA 4PJCE 4WJG3 1HKLH 3IDUA 5JPNC 1KTRL 1JHTB 3R8BB 3QJVB 4XMKH 5LLIC 2ESVD 5F72S 3MRDB 4K8RH 5DZ9A 5I26A 1MHEA 5DS8B 4AC2A 1AY1L 3W9DA 4YE4H 4CADA 2ZOTA 2KERA 2CUIA 1RU9H 5DD0L 4W9CC 4CC0A 4YSSA 3IKCA 3THMH 3TBYA 3EAKA 1N2RA 4BQCA 3AT0A 1MRCH 3F58H 5LAXA 4NKIH 5GGTH 2FYYA 3GSNB 5EOTA 3B1TA 1QX1A 4FNQA 4DP6X 3VSTA 1CGSL 1CLCA 1CD8A 4WO4A 3WMSA 3QAZB 3ARDD 2BNQB 5DT1H 5AW4B 2WWNA 3QJOA 4I7ZC 5FM8A 2AQ1A 1HKLL 5I0DA 1NH6A 3P73A 3GIZH 4XMKL 5JOFA 2IAMB 3L1OL 4K8RL 3PL6D 2EVIA 1MAJA 4JFDD 2TSBA 2OMNA 5E94B 4YE4L 3E38A 2XG4A 5L2KB 1RU9L 1SEQH 2BMKB 3VGFA 4JFYA 2ADJB 4CVZA 5EDXA 5I75B 3THML 3S2CA 5CSGA 4R2GB 3QAQA 1MRCL 5IHLB 2R9HD 3F58L 3AS0A 3FZUD 4NKIL 4BEIA 5GGTL 1GL4B 4QCIB 2W80C 5DHVH 5GGUB 4KTGA 2WIMA 3GC3A 5DT1L 4TYUA 2EYSA 5MI0B 1NCBH 1QHPA 2QVKA 1BYNA 3TU6A 1L9SA 1NWPA 2A9CA 2P5PA 3GIZL 1OK8A 1T0MB 4QR7A 3RU8H 3TONA 4AGMA 5AW1B 1NFDE 2H2SC 4XMXA 4N2BA 2QSTA 5B38B 2V7HB 4AVKA 2ZT9C 1TT6A 1XIWD 2MPAH 4EDWL 2DMKA 1SEQL 3BAXA 4HT1H 2ATPB 4K3GA 2ZCZA 1HCVA 1WWBX 3NJFA 3I75A 3T0EE 2LT9A 1E4HA 5JMOC 1X7QA 1TCRB 1FORH 3AWGA 3MJ6A 3QUGA 2E3VA 1CXLA 3CHSA 4GI6A 1TVHA 1OKEA 1NCBL 3MO1A 4CBZA 4G7YH 3DX2A 2ADYA 1KLUA 4WWOA 5D7LD 4AJWA 5D7SH 5F1IA 3S3JA 1LP9A 2EYRB 2MNUA 5D1XE 5J3HC 1BVKA 1QEWB 3KJ4C 4AE0A 1AO7E 3OC5A 2KLRA 1Q1JH 1EHLL 4MJIE 3CZSA 4OFKA 1QA9B 4HT1L 5HGHA 1PZAA 1XR9A 3H7LA 5A7BA 2VLJE 5KBKA 1IAKB 3MXVH 4XZ4A 1F1DA 5LG6A 2CA3A 3FQRB 5DLMH 1FORL 3AS1A 4ZFOL 5GS2H 4BQ8A 1TMQA 2J43A 2ED7A 1DE4A 4WGVB 3E6HA 4IU3A 4G7YL 1TCMA 2R4SH 2CQVA 3O0LA 2VN4A 1NCOA 2RA1A 5EUOE 5D7SL 5E24E 4RESB 2IWFA 3VH8B 4JZJC 2QPEB 2D3LA 4WHYG 2XKSA 2Y7OA 4UNVA 1IEHA 1F00I 1Q1JL 2CLRA 2HTKC 3VXMB 3L6FA 1HL5A 3MJ8B 1ONQB 3MXVL 4QT5B 4YDNA 3V4VB 5KN5B 3B9AA 5DLML 2DYSB 4JM2D 2GT9B 2MJWA 4Y7OC 3SPVA 4HKZB 4MB1A 4NQCE 3SPHA 1NA8A 2XZQL 1U8QB 2GUYA 5E6UB 3MRHA 4APQD 3ZE1E 1NC2A 2R0KH 2APFA 3NFNB 2NY5C 2R4SL 2CK2A 4XNYH 3UPCA 5C0EB 4F15B 5C6PB 3CFKB 3VQLA 3LKQB 1G7HA 1M71B 2WINA 3MUHL 4UQIM 3M88A 2O72A 1T5WA 3BPCB 4G5ZH 2YD8A 1TUPA 3HZYB 3DHMA 1UB6B 1UCTA 3LPOA 3OX8A 3DX6A 1V3LA 2ZWNA 4OIIH 1BFVH 1F2QA 1Q4NX 3U48A 2AXFA 4NWUL 2R0KL 4O51A 2CO6B 4XNYL 1VEPA 2X4SB 3QUZA 4RMUA 2ZKMX 4AMKH 3Q06A 5FGSA 1E67A 4OQTA 1E28B 1O7DC 3ARFA 3EJQA 3KPSB 4DKAA 3M07A 3MYJB 4JZNA 2CH8A 5IHBA 3H7BB 2Z1KA 4G5ZL 4H20H 4P2QE 1WRFA 2MQ0A 4U1KA 2FHCA 4XC1H 4N8UA 4JRFA 1Q9LB 2DIJA 2WUBL 2B4CC 3TNNA 3HAEG 5FF6B 2A74C 4ZO6A 4HAKA 3UBXB 3LY6A 4JKNA 5J56B 4BFEA 4OIIL 1BFVL 4P06A 1CTOA 3GTVA 4I0PC 2B20A 3Q8FA 4LKXA 3QORC 2IALB 1IT9H 2VR3A 4AMKL 4AIOA 2L8AA 3N41B 3WDHA 4X6DF 1JYVA 3D2UD 3UZVB 5DMJB 3VB8A 4CVXB 2BC4A 4IBTA 1SOKA 4H20L 4B9FA 4I8DA 1BZ9B 4XC1L 4NKOA 5B1AB 1HNGA 3PGDA 3X11B 1A9VA 2DWYA 3KM2A 5A2CA 2YD1A 5I1IH 3O3DA 4Z78A 5F9JB 5FW8A 4Y2LA 2DM2A 4F91B 4Y8DC 4Q4IA 2PCXA 2GJRA 2OL3H 2UXTA 2ZSVA 3GS0A 4HUCA 1BPVA 1AGFA 1IT9L 3CIAA 2PYFA 1IGFH 1WAAE 1DJIA 3DVGA 4PJ5B 3MYZA 5E4OA 3REWB 3RL2B 5CIPB 1Q9KB 4G42B 5ES4B 3VD0A 4BFRA 1IQDA 2VERN 4JHZA 4YDVB 2YBGA 4RH4A 3H1ZA 4OAWB 3PG2A 3SPGA 3MBEC 3OJVC 1IM3D 1EBAA 4F8TA 4J3OD 1MVUA 3ZL1A 5I1IL 3H9HA 4DERA 3UYOD 4R4BB 1KXVC 4XAKD 3DPDA 5C08D 4G8FB 3FPXA 3GRWA 3ARXA 2OL3L 2VXSH 1SM3H 1FSKC 1IGFL 5H37G 3MROA 4N2HA 4R6UA 1AGDA 3TN0C 4D9RD 5IHZB 3QEQA 1JTTA 2X70A 2ADGA 5MEOA 2MTAA 3DJRA 4LGRB 5I76A 5GS1A 2Y36H 2JCCF 3CSYB 3N85H 1AGBB 1JXGA 2YBRB 3U25A 2C9QA 1L9QA 3KLLA 3TCLA 4YSUA 3T6VA 4QO1A 4XR8C 3SO5A 2PXYC 2VXSL 4LKCA 3SJVA 4KKZA 5E03A 5JHAA 2H2PC 5F1SA 4UTCA 3L3HA 2ZYRA 4B53A 1YEGH 4K7FB 4WV1A 1B0IA 2BSTA 2KUTA 3MUGA 2YD6A 3PJLA 4IJ3B 4NPJA 2WP3T 2Y36L 3M46A 3OWRA 3Q1EA 5D2LA 3EH3B 3W57A 4Q97A 4N0UA 4KQ3L 4P2RA 1J10A 2V7NA 2IANB 4FZEH 4LMQE 4R0LB 1WZ1H 4JPVL 2Q87A 5L6YH 4WK0B 4N3UA 4NB7A 4G6AD 3NA9H 1ZLUH 3R1GH 2F54B 4AOFA 2WWMC 3JVGC 3TO4C 4LXFA 1JVKA 4FJ6A 3UG4A 3UTZA 3SCMD 1I9EA 2NW2A 4J3UA 3LNDA 3MOAH 5KSAB 2CALA 3GYRA 1I3RA 4J1UB 5F88B 1T22A 1Q9WB 3OV6A 5CEYA 5KG9B 1CFQB 5BXFA 4DOHB 5JIIA 1NDTA 4YL9A 2APTA 3BH4A 3QZWA 2FX7H 2MWCA 4LCCA 5DVOA 2BZ7A 5HSFA 3GGWA 4FZEL 1WZ1L 3U6RA 5L6YL 1E5BA 3QRFM 3LKNB 3T3PE 3NA9L 4QYOB 1KC5H 4UDTB 2VLRB 1NIFA 2VERA 1FO0H 3LDBB 3MREA 2AJYH 2HTKD 5J12B 5K9QI 5LG1A 3UTTE 1NIEA 3UDWC 1U33A 3MRPA 4OGYH 3TPKA 3MOAL 3QR2A 4U1IB 1QKZH 2B7DT 4RA3A 4LEBA 5MEND 2QADB 4POUB 2WYZA 1VZHA 3FT2B 3I6LD 1HHKA 2FX7L 2BERA 1PZ3A 1UJTA 3ZKMD 4G1EB 3RTQB 2BSRB 3MV9B 4WWNA 5C8JB 4AY0A 1KC5L 4N2KA 4WUUB 4Y2OB 3STLB 3ARDB 1KIRB 1FO0L 4LDEB 2AJYL 4PB9H 4R97B 5DEFB 4K3DH 2YFOA 3WFHA 3PABB 1LD9B 4TSCH 1RJCA 3OHMB 1QKZL 2F58H 1HQRB 3T65A 3M45A 1A47A 2C3GA 1BM3L 3F2LA 3ECBB 3O41B 4B97A 1GJIA 3PL6B 3H6AA 3EYQD 4NZTH 3ROOA 2NRDA 2PWHA 3PWPB 5C7XH 3D2TA 3IDJB 4GP4B 3S4SB 3BMVA 5EULV 4N2LA 2Z8WC 5IK3A 4G7RB 4HUMB 3D8MA 1EWHA 4PB9L 5FV1L 4K3DL 1GY1A 5IBUB 1UM5H 1AHWC 3EJTA 4TSCL 1WA1X 3C6LA 1LK2B 2VL4A 1AJ7H 6PCYA 4PS8A 4EN3B 3HOGA 1EDYA 5IG7B 4H40A 1R3LB 1TZAA 2WLNA 3MRNA 4NZTL 2FJFB 1DFBH 3QQDA 3MI6A 1O6VA 3QE5A 3HUJF 4JJHA 3QORD 5L4FA 2PTUA 3ESMA 1LVEA 1YEDB 3CZGA 1D6EA 4UAOC 4XBPB 3ZTNL 43C9A 1MDAA 1VENA 2WBXA 3ZDYF 5I2IB 4KKNA 2X2IA 4NQDA 4MNGA 3FCSB 4M8RA 4N9GB 3VFOB 1UM5L 1LEKB 2R2HA 3WTWA 3FFDA 4X9IA 1AJ7L 1WUZA 4PJBE 4QOKA 1QD0A 4A2FA 1MZZA 5I0YA 3L4CA 3OZ9H 4LHUD 1L5GA 4YSTA 4G9FD 4L3FA 2BP0B 5HYJD 4JDTL 2EXYD 4OM1H 2WN2A 5C0RH 2GTWB 1K3ZA 3F7VB 1JCKA 2P7TB 1DLHB 4NUQA 3Q2VA 4UZSA 4LCVA 3OMAB 4M61B 4XO8A 1XF1A 1N59A 1KYFA 4IRSD 4S1SH 2JIXA 2BP5M 3Q7JA 5JDJA 2PO6C 3ZHNA 3V5HA 3S5LA 1U36A 1KBKA 1FFTB 1KLGB 4DIXA 3KPQA 3BLKA 1FAIH 1SPDA 4QRPE 3OZ9L 3I9GH 1WYJA 1AR1B 3H3BC 4J4PA 4ESKA 2EDBA 2F6AA 1NBQA 1UVQA 4OM1L 2XIBA 4PJCF 3WIFA 3ZUNC 5C0RL 5INDB 1JNNL 1UD8A 4XNMA 4UIKH 1A6ZB 3KGTA 4OI9A 3T8MA 5TJWK 4JFXA 1RHHB 1YY8A 4ELMA 3ARRA 4GRLA 4JM2B 4Q6IA 4S1SL 1HFUA 2GPZA 3P3TA 4K2UH 5K5YA 1JAEA 3BQUB 3TN0D 3H55A 3RZCB 2OYMA 3OR6A 5DJDB 3QDMB 4APQB 4NN6B 5BQ7A 3WEOA 4HS8H 3W0WB 3VFWA 2VRKA 3DSNA 3DXAE 2VGLM 3QJTB 4LP4A 4N20A 5JHDE 2ZKXA 1FAIL 1YNTF 5EFIA 3IDNA 5EO9A 4IOFC 3I9GL 1J8SA 2YHGA 5CBAB 3FN0H 3O0RH 3U9WA 3UC2A 2QGBA 1NMCB 1U8IB 3L3DB 5I6NA 1NPUA 1SOQA 4X6BB 4UIKL 1JGDA 4HUKB 1YJDH 1AKJA 2PXYD 5KVMC 3UTOA 1N3NA 3DROB 1SJVA 4X4KA 1JS4A 2J1XA 1PFOA 3IETB 3LRHA 3BVTA 4YFEA 2H2PD 1X9QA 4K2UL 4C4KT 3KYOA 2A3TA 4ALAH 3BZDA 1FH2A 1A1MB 1P1ZA 2GJ6D 3WN5A 2QFPA 3GZQA 3GI9H 2EDWA 4G71B 5D9SB 1FVEA 5BW7A 3PAVA 4JGNA 4M3JA 3BP7B 4HS8L 2GUOA 2G60L 1BQHB 4GS7B 1EXUB 1QR1B 3UBFA 1TITA 2YXMA 2YSSA 3QC5X 5E1AB 1S7UB 3ASNB 4UM8A 5GRWA 4ZAKB 2DYPD 3WCYA 5C86A 1VPOH 3FN0L 3O0RL 4HU2A 4V1DD 1S9YA 4YDLB 4W4OA 2OXGA 3I84A 3AMLA 2NSMA 3V0GA 1NFDF 1NEZB 1T03L 2XETA 1WFIA 2WWMD 5HGAA 3TO4D 1Q1PA 1T1YA 2EVJA 4ALAL 4MA1B 2J8HA 4OZFG 3GI9L 1TTAA 3QQ3A 3BUIA 3IN0A 2ZKYA 4KTEH 4UQ9A 2AAAA 1CI3M 2DQTH 4KHXH 2WSKA 3D2UB 4NX0A 1S78C 3VM5A 1VPOL 3GRWL 5EH1A 4N2AA 3MLTB 2NYKA 3Q43A 1GHFH 3D18B 3EDJA 2ATAA 4HS3A 3FFOA 2P8MA 3CZLA 4G6JL 3LKOA 5ERWA 5KYNA 3MJWA 4JM0A 3KPMB 1I4FB 3FQUA 4QXVA 1QLFB 1AKPA 2OSLA 1I3VA 4JY6A 3SGKA 4HH9A 5AZUA 5HPMA 3LOWA 4PVBA 4HSQA 4KTEL 5JPNB 2DQTL 4W1TA 4Y4FC 5I8EB 4PS3A 5IMKA 4KHXL 4GO8A 1HWGB 3SDAC 1RP9A 5F7DA 4QRTB 2OMYA 1MJJA 3PCYA 3U0WH 5KVEE 4JFVA 3EO9H 3NJHA 4NNYA 1AYRA 4PTTA 4C54A 2XN0A 1GHFL 5EUOF 2AQRA 3AUVA 4EI5A 2VISB 2WZ6A 1FVDB 1IM3B 4GAGH 4OFDA 1NQBA 4BDVB 5FO9B 4A2HA 5F7EH 5D1QC 2VR6A 2GBUA 2R0WH 5ADPH 2EVHA 4NP9A 3IDIA 3T71A 3E2HC 5L8JB 2Y23A 2Z0BA 3SOBH 3BP5A 3EJSA 4HK3N 2IFFH 3V6OA 4JCMA 1U8KA 3OAZK 2VZUA 5AFAA 4Z7UA 4L8BA 4N8VA 4X9BA 5HVGB 2EILB 3U0WL 1UT1A 3EO9L 3F12A 3S48A 3ZE1F 2DKMA 2LOEA 1CFSA 1HHIB 4PV9A 1U3HC 3MGTA 4GAGL 3AZUA 3JVFC 4FDWA 1PLBA 5F7EL 3TTYA 3WE6A 1VIWA 1CFMA 2G4EA 1K6QH 2R0WL 5ADPL 3X1BA 4YSQA 1SY6A 3K6SA 2NNAA 3PHSA 1CFNB 3IRCA 4NCC1 2Z31A 1QPXA 3SOBL 5LXGH 5GGRY 2FWOA 2EEFA 3QW9A 4ZFQA 5FDWB 1LP9E 3MRBB 1U8MB 3FUFA 4QGYA 3GRGA 4HCGA 1L6ZA 4NO5B 5TDOA 2VB5A 5EZJB 3HHSB 3SGEH 1JXFA 3RWGA 2WCSA 3ATDA 1RUMH 3HG1B 4QHKJ 2NY1D 3PAUA 5AOKA 2F8VA 4HJUA 3HCVB 1JP5A 4OLUH 5E2TH 1A66A 1K6QL 4HQQH 3C5SA 2VAJA 3GBLA 4NRXB 1XH3A 3I9AA 1XAUA 3OF6D 5LXGL 1JJUA 2HSIA 4NKDA 5F7BA 4ANXA 2A9AA 1XB6A 1LO5B 4U0QB 3L48A 1WUNT 2FSEB 3UJTH 1A9EA 1HQ4B 2XTJC 4TVPE 1ZK5A 3KJ4B 3EGXB 1OT2A 2AQ3A 1NBCA 3QXUA 2NSXA 4TNFA 5HYSB 2I26N 1RUML 2YMXH 4X6EB 1PIGA 2A6IB 5E2TL 5HDQH 2VQ4A 1HWWA 5AB9A 1Q0XH 4HQQL 1ZTXE 5IUCA 4MMZA 4ODUB 2ZAGA 1HCZA 2Y5QA 1C5DA 4LLDA 3ROLB 1PW3A 2XNAA 3I50H 1LWRA 3NCYS 3MU3A 2L04A 3UAEA 4OLZH 3AWFA 1A3LH 3KGRA 3PPSA 4L4JA 1ZLVH 4H0GA 2FO4B 3OXSA 2YMXL 4FG4A 5LGKA 3GZOA 3LRGA 3VMOA 1CICD 1WAAF 4WK2B 2WBJA 2GC7C 35C8H 1UZGA 4U1LA 1JV5A 4EKXA 5HDQL 3KLHC 2K3HA 3IMWA 3L7EA 2DQFB 2VDQH 1RJYA 4ES8A 3CVHH 3BMWA 4QAMB 1XCQB 4HXBH 3OLIA 1KN2H 1W0VB 1F6AA 1F3DH 3I50L 1N6UA 4RRPG 4OLZL 4OFYD 4PHZA 1A3LL 1IC4L 2MKLC 1XCWA 1BLNB 2X44D 2AQQA 4MNQB 3MRKA 1FNSH 4V11A 5AOIA 3OLEA 4K07A 4FQCH 4WTZG 1M3JA 35C8L 5I5MA 1YUHB 1XGUB 4S1RH 5FIEA 2UVFA 3LKRA 2P24A 4TM9A 1WCQA 3T2OA 2VDQL 2X2YA 3CVHL 3ETSA 2BSCA 3VNYA 2DI9A 2CKBB 4HXBL 4YSCA 1D5BA 1HHJA 4NZ8A 1JZ5A 3KPLA 4NUMA 4BSVA 1GH7A 5GGSY 2WQXA 2V2XA 4PTUB 1MCDA 3HG3A 1VFBB 5E6RB 1QAWA 1OGAA 1FNSL 2JJVA 1Q9OA 5GZNC 1ZGLB 4FQCL 1EJOH 3QR0A 3D0LA 3L9RA 5KSUB 3QJFB 3AT8A 2A74B 3QQ4A 2WLLB 4S1RL 5B39G 3ULUE 4G80B 1G7JA 4R7DA 1XGRA 4KX8A 1JDAA 3V6FA 4JHVA 4I0PB 4R5VA 5TTRA 5DSCA 1KLFB 5ELIA 3QORB 1AD0B 3PWUA 3B9KC 3DBXA 1A7QL 2WJ7A 1MW2A 1ZAGA 2R4RH 4X8GA 1YECH 3V5KB 2A6KB 2GBVA 2BVTA 1R6VA 4L4VB 4JFOB 4DTGH 1EJOL 3E1ZA 5C0AA 1B90A 4Y4HD 5CZXD 1O9VA 2DM3A 3IJHA 2H6OA 2UZIH 2WB1A 3WHXA 5AAWA 4K15A 4F7CB 2RAMA 3NJGA 2VDPH 1TKWA 3A4EA 1H9VA 1FVCA 2DQUH 3WFDH 5G55A 4Y4FD 1G7IB 3JV6A 1MFUA 2BS71 5FGCB 3GSOB 3GZPA 4HZLB 1M4KA 1MSPA 2R4RL 4MBRA 2HKHH 3QEQE 4ABUA 4YHYC 2B39A 3VUAA 4WFFD 1YECL 3AY2A 5I6KA 4F7MA 5C0ND 2X40A 3DX4A 1M7UA 2HRLA 3EDFA 1IE4A 3MBEB 3T3PF 4DTGL 1I1AC 1HYSC 5B3SB 2WZ0A 4R7NA 1KXQE 3FQWA 2UZIL 2ZUVA 4N25A 3FPYA 1RZQA 3KPNA 1C7SA 1BZ7B 1MI5D 1SQ2N 2AITA 2VDPL 2C1OB 5HHVH 4XP6H 2DQUL 1KJMA 3M17A 3PXHA 1KYOK 2BNRB 3SJVE 3WFDL 4XNQA 4P23D 5L2JA 4PRNA 4BFFA 2DQGL 1QMUA 3TN0B 4RAVA 5TH2B 1XF5A 2HKHL 3VXSA 3ES6A 4EUPB 2EYTB 1DTUA 3OL2A 3QZMA 5HGBB 1M05B 5JTWA 4XAWH 5FW6A 3T0EC 2Y69B 2D2CC 3IM1A 2VLKB 4MKMA 1QUPA 2Q0ZX 5D2LE 3F6IA 1R5VB 5C0BD 1FNHA 4EXKA 4JKMA 2X53A 3MRJA 1B88A 3MFGB 3RUGA 4N0UE 3WGVB 4P2RE 3FQTA 4CW1A 3MV7D 2PXYB 5HHVL 5TD4A 4XP6L 4UU9A 1ZE3C 3FRPB 4AL8H 2EKSA 3EHBC 4ELKA 3TBWB 1MFNA 4ZS7H 1TOXA 5CJOH 1G6VK 2CO3A 4LSUH 5EOQH 5CFAA 4AYDC 43CAB 3REVA 5D1XC 3S34H 2G0KA 25C8L 1IX2A 3SBWA 1AZUA 4X98A 4QNPE 4P5KB 2CUMA 2ITCA 3D9AL 1JYNA 3BPNC 4XAWL 5DJZA 3VG9C 2XN9A 3L8QA 4O02A 5KOVC 4ZW5A 3VXRB 5C07D 4L4TB 1NIBA 3ZR5A 2ZWYA 3OM3B 4V1DB 3B56A 2R2CA 3S6CA 1KIQB 2X3BA 3WXVL 3WJMA 1X9UA 4AL8L 5DC0A 3V2AR 1CURA 4K7PH 3OAYH 4ZS7L 5CJOL 4JO4H 5EOQL 4LSUL 4LL1A 2KLSA 2WYIA 1QZNA 3FRUB 3TO4B 2WIIB 3S34L 4E41B 2OSYA 3QJHA 3LZQA 2AERT 3GRBA 3MLVH 4HIQA 4ZXBA 5DHYB 5J6SA 4EIBA 3QZBA 4JPQA 3VFMB 2WAHA 1DVQA 3GMQA 4NQEB 5DEGB 5SWSE 2MHAB 4P3WA 4ZK8A 5L8KB 4WHCA 1O6SA 3FUKA 5DUMH 2WY3B 5EOCL 2JV6A 4F58H 4RMRA 2NXYC 2QGDA 4FQXB 1KZYA 4PJBF 5JQ6H 2C7UB 1M7DB 1QOKA 4K7PL 4JO4L 4PS7A 3VGDA 3K5RA 5IQ9A 3T4YA 3RKDC 3B8SA 4U6HA 3RWFB 5GRVK 5DJCB 2IQAB 3Q5YA 4H2AA 3MLVL 4OLXH 3U46B 2K9UA 4IHOB 1W15A 2VNCA 1LO0L 4S1QH 4BKSC 5A2FA 2CJTA 1A3RL 3KLHD 3JWOH 1NCGA 1IRAY 5DUML 1PEWA 3QEHB 1FZOB 1NAMA 8FABB 2BY1A 1CIDA 1W6WA 1ZMYA 1JK8B 1EERB 3AADB 5E6YA 3T1FB 5J6GB 4GIOA 5JQ6L 3ABMB 2NX5D 1ZKAA 3DHPA 2JNZA 4O2CA 4YC2C 2OJ1A 2P5EB 3BKMH 1MWAB 3LVEA 1D9KB 3RFZA 4OLXL 1IJ9A 2AK1L 2AEQH 3K3QA 4K0OA 4N90D 1EIBA 2DWDB 1ZT7A 2H32B 4U1HB 1D7FA 5E4EC 3BH9A 3JWOL 1UWFA 2DLEA 5F9WC 3VU1A 4JLRB 2ZG3A 4E68A 1MCRA 3U7WL 3ZMEA 5I30H 2G2RA 3DO3A 1YN6B 1A6VH 2OI9B 4H25B 1MQKH 4OZGA 4F20A 4BQ6A 1LO4H 1A1NA 2IWKA 5HHNB 3LV3B 2WQSA 4A6YH 1FNGB 1FYTB 5CHNA 4YGAB 3BKML 4NQDE 1X4YA 3BVDB 4MNGE 4RIRB 5BV7H 5EF0A 1UTDA 4PCYA 1AHWB 5TDNA 3DETC 3RL1A 3T5WA 1GGBH 5DA4A 5GZND 1DJWA 2AEQL 2HTLD 4YHNA 3UGUA 1JBJA 1EVUA 4QOKE 7CGTA 5E9NA 1BD2B 3S36X 3IDYC 3UPRB 1IAOB 3FOMB 2NUTB 3L81A 5FC9A 2AMGA 2EIEA 1A6VL 4GQQA 4OLWH 1AC0A 5JDSA 1BW8A 3TO2B 1TJHH 5IM7B 3BUYA 1SLWA 4ATWA 4UAOB 2CRZA 4AQ1A 4BFJA 1LO4L 3BVWA 3TVMC 4POZD 3WUWA 4A6YL 3VI3A 2HX9A 5IR1B 1DBBH 5BV7L 4ZI8A 2CPCA 5K9OA 5FB8A 3L7FA 4JANB 4Z0XB 4J8RA 2HJLB 2KDGA 2OMVA 2MNWA 5I8CA 3PPEA 4BSWB 4JUTA 1ZT4A 5IOPA 4G8GA 3X1NA 5LKNA 4DKFH 5DJYA 4P57B 3NCJH 3RIKA 4YSOA 5EPMB 4YZWA 3QO0A 4K5NA 5D6DC 2P49B 4OLWL 4FKEA 4UV7H 2AJZA 1TJHL 2PTTB 2YGVA 4ELME 3KYMA 4APXA 1FZMA 5E9DA 4CNIA 1G7LA 2PO6B 4Y9CA 2AVFA 1UENA 2A7BA 3AG2B 2M8XA 1D5XB 5IFJB 1DBBL 4BM7A 3TBVB 4JN1H 2Q86B 5A1AA 5B8CA 3ATAA 3VXQB 3H9ZA 1DUZA 1GY2A 1VHPA 2GCYB 3NP3A 1BX2B 2XWZA 4QXTB 1J7VR 4H1LB 1AGCB 3V4LA 1SUJA 4DKFL 5E9AA 4EE2A 2BP3A 3BWAA 3L4YA 2BFVL 5CD5C 4UV7L 3PGCB 5DI8A 1VERA 3IRPX 4Z7IA 4QJ4B 3OJDA 4QTFA 1UA3A 5FYJE 4JN1L 1O75A 2HUEA 7TAAA 4RGND 3QJSB 4OFQA 2JKWA 3D0VB 5KYXB 1CK0H 3C5JB 5D7JA 2M2DA 2E59A 4MDRA 4MAZA 2V0AA 3Q1SH 4NCDA 3U6XS 3G08A 4YHMH 3ULAB 4MD5B 4OFIA 2IH1B 2KT6A 2G0LA 3EHBD 5TK2A 1H3VA 2J6WA 3BIKA 3KYAA 1MVFA 4AG4H 2XC8A 2YJQA 4PGEA 1T1WB 4LOFA 2FNWA 2BW4A 1YMHB 3MFFB 3NBNA 3MRLA 1KGWA 4IMKA 3Q9QA 5EBGA 2HMID 1JTOA 4ISVA 2IEPA 3Q6FB 1XZ0A 1T0NA 2ICEA 3DV6A 8PAZA 2VLJD 2FSDA 4IQHA 1CK0L 4Q9BA 5EBMA 4OJYA 3FSWA 4OU3A 1NIDA 1X7TA 2Z7YA 1TG8A 3BUDA 1GOHA 4HUUA 5AEAA 2ROXA 1Q0YH 3IMUA 2YLHA 3Q1SL 5HJ3B 4YHML 3O6FA 1LP9F 5E6IA 1DBJH 2LU7A 1JFQH 4AG4L 5JW5A 2QDVA 4AJ0A 3QARA 1I7RB 2E9JA 3MDJA 5ECGA 1BHGA 5D93C 4JHBA 3GSUB 2J8OA 3UAFA 3HG2A 2YR3A 5CCKL 4XB7A 4KJPC 2JK5A 2VZ1A 3K0YA 2Q2EB 5I1DA 3CWGA 2B08A 3GSXB 1DQQA 4JAMB 1VZGA 3VRIB 1UASA 2W0FB 1WAEA 1Q0YL 4KKAC 1BJ1J 5LAPA 1T4KB 2EADA 4S0TD 2CDEA 4XBEH 2ALAA 2K7PA 1DBJL 3MV8A 5MEQB 2WHVA 4WTWA 3C87A 1JFQL 5T1MA 5D6CA 2JCCB 3TYFB 3M1BB 2R69H 4O02H 1UOLA 2VKXA 4FFVD 3VAEA 1Z66A 1FI8C 1S5HB 4WFHD 3TPUB 3V6OE 1XMWA 2C3HA 3QH3B 3SE3A 4DGYH 3WV0A 4Z7UE 2HFGH 3IGKA 1KB9K 4P2CG 3SDAB 2FH6A 1JYWA 3ME0B 2BY3A 2H26B 2MOGA 1DQMH 4K7PX 4R4FH 2Y7MA 3ZYIA 4FQJL 1PZ5B 2YQBA 3NFSH 2W9EL 4E9RA 2A9BA 4HFWB 4KO9A 3LH9A 2WVTA 4XB8A 5LDSA 3RWEB 3LZNA 1F4WH 5E8NA 2X4OA 2OJEA 2IPKB 2OXHA 4XBEL 3WTTA 4NPYA 3F62A 5F6HI 5KUMA 1BIIB 5D1QB 4UB0H 2VDQB 4X5PA 3KGSA 4JVWA 3K6NA 3GSWB 3DV4B 1S7SA 5DVLA 1KPRA 2AK4D 4YO0B 5CAYB 1JIBA 2YA0A 5F3HA 4O02L 3IEAA 2UY7A 3QXAA 2VIRB 4WU7B 5A16B 2WMPB 1MFDH 2Q5BA 3VFSB 1KCBA 4DGYL 1SEBB 2HFGL 1UXSA 5DHXB 5LNEA 3L95B 5KEZA 4H26B 1DQML 5K9QG 2BHZA 4R4FL 1AOZA 3B2VH 2DH3A 1UJ3C 3NFSL 1U42A 1WDAA 3PQYD 1ESOA 1JZGA 4XE5B 2NY3C 3U2JA 4F24A 4WEEA 1F4WL 1MCLA 1U3HB 3BLPX 3X13B 1A02N 1A1OB 3DO7A 4UB0L 5IEKA 3B3IB 1P5UA 2VMEA 3TCXA 1R3IH 4P5TA 2AS5M 2ED9A 3C12A 4F7PB 4B6ZA 1ORSB 4U6YA 3MV7B 2VYRE 3WKQA 4NP4H 4FTVB 4IDJH 1MFDL 3KYKH 5H4ZA 1PZ2A 4GLRI 4X4ZA 1NFAA 4E36A 3VWKA 5FYLD 2CO4A 2X10A 4JN2B 3B2VL 5MEPA 2BNUB 5JXEA 3X12B 3DI2B 3WLBB 1N8ZA 4NKMB 4KTDL 2IPTH 3PDOB 1KUMA 1B3JA 1AHKA 1P7KB 3TVMD 4C83A 1V55B 2UWEA 2XJKA 1R3IL 4NO0D 5FEBA 3BGMB 4OF8A 4QRAA 4R84A 5JPMC 3PIQB 4NP4L 1S9VA 1BIHA 3S9DB 4ZUVB 1V05A 2HFFB 3BJ91 3KYKL 4NFDA 3LQAH 3ULUF 2Y72A 2F2HA 2XTJB 3NQKA 1DLFL 3UYPB 1YSOA 4AW4A 3GM0A 3OLGA 1DZ0A 3N1GC 1HI6A 4U6XA 1FFNA 1XR8A 3FUDA 1J1OH 3HN5A 4AVIA 4Z7QB 2UVEA 3BLBA 2WNWA 3CVDA 5KYWB 3ABZA 5IWLC 1QBAA 1XQ4A 2RJMA 1C1EH 3CLFH 1NEPA 3EG9B 4ODVL 4QKTA 1ZWIB 1SYVA 4PJ9D 3ZVVA 4OD3H 1N8OE 1ZCRA 1YYLH 3JWNE 3DOHA 2IGLA 2FL5A 1S8DA 5IVOA 1T5XA 4FEIA 2XA3A 4GKZB 2HLFC 2WXQA 3BSZH 1U58B 3LQAL 1N9PA 1ZVNA 2Q3XA 5FO8A 3JT0A 3BDYH 4K8RD 3BGAA 1G7QB 2VR5A 4MD4B 3CDYA 1XXFC 4L1HA 2K0RA 1KTKE 4B27A 2FEJA 3GLDA 3OBAA 5AAMC 4OZIA 1UA6H 2NZ1A 1KG0A 3BZ4B 1C1EL 1QI5A 1X4ZA 3CLFL 4HUXB 4U1SA 4WQOA 2YD9A 4UTBA 4FLSA 1OCZB 2OZ4A 4IS6A 4OM0H 4OD3L 1R47A 4XCYB 2AQNA 3TA3C 2P80A 2QPUA 3G5VA 1H3TA 1CO1A 2GBTA 2KBGA 4G43B 1EDQA 3HUJB 5I15H 3G5YA 5DZOA 3BSZL 1RUKH 1E7VA 5ICUA 4GO9A 1XMEB 3OB8A 5EZPA 2XZCH 2IWEA 1CBJA 3SIKA 1OGAE 2K4WA 1Z9NA 2DMHA 3LHPH 4LCUB 5KW9H 3T6ZA 3RA7H 1RKRA 4WSGA 3QFDA 5KVDH 1RPUA 1D5MA 4PGDB 3KH3A 4LVOB 3TA4D 4M1GH 3PP3H 4LCWB 5AVRB 5HYFA 4JFZH 4FRWA 1H3XA 4XOEA 4U49A 4L1LA 1OB1A 5DUBA 4OM0L 3VFRB 4KK8C 3OKKB 4C56D 1QG3A 3T77B 4C58B 2D73A 3IMSA 4JY4B 3VFUA 4MCYA 1G6RB 3UTPD 3P0YH 4FCHA 3I6GB 5I15L 4ZFFA 5D2LF 4XB3A 1RUKL 4QRUB 4Q56A 2X88A 1UWEH 2XZCL 4UQAA 2I60L 2R56H 1J05B 5J57B 5ID0B 1UGNA 4WNJA 2P8LB 3LHPL 2UX6A 4X9FA 3RA7L 1PNCA 4ENZA 3RWCA 5C0AE 1FQ9C 3UJIH 3LB6C 3HR5A 3VB9A 5EIIA 4M1GL 4PWFA 5DYFA 4ZS6C 3QCVH 4LDLB 3QHFH 4JFZL 2NYYD 4QNPF 4WO4C 3ALXA 2WXNA 3QR1A 4NO3B 5D70H 2J12B 3V9CA 4XTRC 4PJCB 3QYCA 2QQNH 5JOPE 4WKZA 3MJ9A 4I48A 3B9KB 3P0YL 1P1VA 4DKDC 3ARVA 5IF0A 4OJAA 4AYFB 5F3BB 4XNAA 5C92A 4M8VA 3C8DA 4Q9QH 3QJXA 1UWEL 5ECJE 4W4NA 5ISZD 2BSSB 2R56L 5AKSA 4BRJA 2IG2H 5T1LA 3ASWA 5F0MB 4G9DB 4NFCA 1AD9A 3BSGA 5F89A 3AITA 2QKIC 1XXDC 3OSVA 4UIMB 5AUMB 1KIUB 1Y07A 4E9TA 1N12A 1UXLA 3LMJH 3AQZA 4TUJA 5ACZB 4HUWB 5I1AB 3QCVL 3QHFL 1IEBA 1YNTB 3B2UC 4NAQA 4BH8B 2DMBA 1FG9C 1E6OH 1OOWA 1TZHA 5FXCH 1XCTB 3QPQC 3B3BA 5GS2D 2Q3ZA 2QQNL 4AUYA 3A3YB 3BO8A 1NMBH 1FV1B 2HB0A 4YHYB 2A73B 1ZDQA 3WBDA 1DVXA 4M5TA 3VXSE 3RGVD 4HOZA 3PNWB 1HXKA 3K2MC 1MCCA 2I07A 4OJFH 2CIIA 3VXOA 1BF8A 3OWEA 2X6BA 2ED6A 1RPQA 4EZLA 4DESA 1I1AB 2FIKA 4F8LA 3VD1A 3LMJL 3FU7A 1BVNT 3UZEA 3WG7B 1EFQA 2ESVA 2XZZA 3CHQA 4B3EA 1BZ8A 3RUGE 1E6OL 4AM0Q 3S5LG 3DX7A 3M1CA 2V9UA 1QLRB 2HVJA 2OMZA 3G5XA 5IP4A 1L6XA 2YC1A 5CP3H 2R51A 4BFGA 1NMBL 2VH5L 5D5MA 2WAQA 3P0VH 4YDKH 1NFDB 3FTXA 4KO7A 3HPLA 4OJFL 4JKKA 4AYSA 3IE4A 4NRZA 1CN4A 1GMEA 2BIQA 1OP3K 1JZEA 3EGSB 2XN9E 2DJUA 1VF5C 3BT0A 4J28A 3K8MA 4N0YL 5DTFB 5EBLB 3S3SA 3T0EB 4AYBA 5IY5B 5AW3B 1NBYA 4K94H 2E76C 2BOCB 3LKPA 4ODWA 3EUUA 3H9SB 4AMWA 2E75C 1OAUH 3OMNB 1P4UA 2ZOUA 3F6LA 4GO6B 2XYCA 3EHBB 3GXNA 4GYBA 2UZXB 4GUPB 5LXVA 3UCRA 2Y2TA 3FO9B 3P9WB 4AT6B 1GKOA 3P0VL 4YDKL 1FZKB 5D1XB 2XTLA 3TH4T 1AO7B 3MMEB 4LLMB 4MJIB 1PMYA 3QRLA 4BHUI 2H0FA 1JK9A 3RDJA 3HE7D 3VG9B 3VM7A 4KZ0A 1OZTG 2GEQA 1ZXKA 4JZOA 3FCTA 2RB8A 4PRHA 2YPVA 3IYLW 4PRBB 4K94L 5AENA 2K7QA 1NWOA 4KGLA 4I85A 1ACYH 3D05A 4I9WE 1OAUL 4Z5RA 4PJDA 1XIWA 1KBGH 2HPTA 4LLQB 4PYGA 2GK2A 1DANT 5DJ2B 1MY5A 3SDDD 1X5FA 1U8OA 1C5BL 2H45A 3K2UH 4FD0A 3F5WB 4CMMB 2QFRA 3WLWD 4NSKB 5EN2B 1OE2A 3MBXH 4XN5A 5F1NA 3OPUA 5I82A 5HJDA 5D7LA 2BFGA 4NQVA 4LCIL 1UXMA 4NUGL 4NQCB 1ACYL 2NXYB 1E3ZA 3QUKA 4YHPA 1KBGL 5C9JB 1GYUA 3JTSB 2EDFA 3GJFH 3QUZC 5EU5B 4ZW7A 2ITDB 3DXAD 5IMMA 2HLFD 4Z7VB 4BZYA 4QRSB 3ARFC 4PGCA 4C59B 3LQZA 3QIWD 2B9BA 4WWKD 5D8JH 2QQLH 2O5ZH 5BPPA 4AV4A 4X8XA 3WL9A 1OSYA 3MBXL 4ELMF 4HETA 2Q8BH 3GLAA 5J13C 5F7YC 1MCWM 5E8PA 4X7SH 4NDMA 4BE5A 2G2PA 4PJFA 4OZGE 1QFUH 4Z3JA 2DPKA 5G5DA 4IU2B 3W37A 2A77H 1F4XH 1H0DB 1TEFA 4Z76B 2H1PH 3ARGA 4TVSa 1QSFD 4YC2B 4X99B 4GUOA 3VXTB 1QQDB 2QQLL 2O5ZL 4P2QB 4MDJB 5E6SB 5T1KA 1P9MA 2Q8BL 4K5OA 2F53D 4TPRH 3NDYE 1I85A 3S37H 3NZHH 1C08A 5E4EB 4WIQA 3ULUC 3U1SH 4X7SL 1XDTT 1I8IB 1HH9B 5KVFH 2V9QA 3GSRA 1V27A 1ZLEA 3P4OB 3CSFA 4AC4A 3ZHFA 3DMMA 4N87A 1NGQH 1QFUL 3B5GA 5CKAA 3P40A 2R1YA 1G7PB 2A77L 1F4XL 4WFED 2H1PL 3VI3E 3C6SB 3QULA 3OG4B 1E7UA 1MOEA 5DZLA 4X7TB 4XXWA 5SX4H 2GW5A 2WD0A 3ZDWA 4UTBH 4EKJA 5LGJB 1L3WA 2F1AA 5CM1A 2HP4A 4E5XA 1EDHA 1QYGH 1ROCA 1TQSA 3LB6D 3S37L 1OSZA 3NZHL 3PP4L 2KS0A 3IDYB 4JKWA 3TBCA 4WO4D 4G8GE 4NO2A 3GPEA 1ES0A 4TL4A 2LU5A 3BEVB 4H8VA 1C7TA 3M8OH 4N2OA 4Y5YA 5CKGA 5IQLA 5KVFL 4DW2H 1TTGA 2O6CA 3PV6B 2BVOB 1NGQL 1JZ3A 4LPVA 3NN8B 4OZ4B 4ZUWA 5E9DE 3TVMB 4FHBD 1MAMH 3IRZA 4MXQD 1EEZB 4BKTC 4GG8B 3K1KC 2AMUA 4OCSH 2L7EA 4U1NA 2F18A 5MHSE 3MLXH 4UTBL 4KFZC 1SHSA 5ABDE 1QYGL 5GXBB 3BDXA 4HV8A 1CD1B 2LR4A 5GS1C 4L9LA 1L0YA 4KRLB 2DM7A 1A3QA 3IBOA 3B2UD 3O3BA 2EUVA 2ZUQC 1IBYA 3KWWA 4CMHC 2PR4H 3M8OL 1FDLL 1DJXA 2ZQKA 4DW2L 3V0VB 4GKNB 1JF1A 1DVUA 2KPNA 3IXTA 1N0LB 1ACZA 3V0WL 5C0GA 1MAML 2APBA 1EO5A 4E2OA 4PR5A 3NFPA 3D3VA 3U9UA 1YAIA 1BLIA 5CWSB 2E9IA 5FDYA 1OGTB 3MLXL 4OD2A 3IJSB 4WV1C 2H6UA 1U3NA 4ES9A 1IGCH 5I66B 2V8MA 3QUXD 1X5AA 4LP5A 3HZ3A 3KBHE 5LBSH 1C5CH 4AZ8B 3GMMA 2C26A 2X4NA 3BP6A 4U1JB 4HKJA 4ZQKA 2PR4L 1WWAX 1TMCB 4L3CB 4NJ9H 4AV5A 2ZUUA 3O8XD 4Z7UF 5IBLC 4TXVB 4P99A 3RLSA 1J5HA 3MRQB 2RH0A 4O5LH 5KAQG 1QVOB 1KB5B 3IFPA 4PYHA 4OFPA 2HJKA 3IVKA 4AQ8A 1QSZA 1THAA 4XXDB 2AXHA 1QLEB 1UWXH 1IGCL 3DX9B 4ZBJA 1A4JA 3CVCA 4MB4A 5CP7B 5LBSL 1C5CL 1RZIA 2CLVB 3C8KA 2CCLA 1QRNA 4LCCC 4NJ9L 2P9RA 3IPFA 3GDBA 3SKMA 2G5BB 2DW5A 2A9DA 3APMA 4JM4H 5I1KH 4X5XA 4O5LL 1KPUA 2F74A 1I7ZA 3J2PA 3TP4A 1CFBA 2Z4QB 5FLVA 3APFA 1KJ2B 2HLAB 2PW1A 3MNMA 4UM9A 3CFCH 2Z8RA 1UD6A 3DUHA 4HJEA 3GK8H 2F7QA 1YN7A 3CN0A 3OKEA 4L8CA 1HN1A 3QG6B 1ZS8B 5KBMA 3KCWA 3WUZA 4FNSA 1B6UA 5H2BA 1NC2D 1BZQK 4OGQC 1GSMA 2WXOA 3MV8E 5EO1B 4JG5A 1FC2D 4JM4L 1WG3A 5I1KL 3T3PB 4KROC 4P3DA 1T89A 3NK4A 1J12A 1WHPA 1PD6A 3I2CH 3KNBB 4LFHG 3UTTB 4IBLT 4QHLA 5CCHE 4N2MA 2A5UA 3CFCL 5AVQB 4L8DA 3CV5A 3GK8L 3MGOB 1TEYA 3HLKA 3GO1H 4LSSH 1VFOA 2A38A 1FFPA 1GC1H 3GPSA 1H3PH 5SWZA 3IAPA 4PY8I 2X87A 3SCMA 5KAQF 4XVOA 5D1ZC 5IHWA 3WDIA 2EXSA 4WVRA 3VW3H 1XZWA 4KK9D 2C4FU 1EFXD 4G8AC 2X42A 5EIVA 3T09A 1F11B 1M56B 3I2CL 1MCBA 3UZQB 1RQ5A 3FTZA 3IU3B 5GGSB 4ODXA 3C6LC 1J1XH 4FXKA 4I1NB 4WWID 1GS8A 1MJ8L 2YAFA 3K6FA 3TNMA 3ZRSA 3EXLA 1GCFA 2O61B 3LIZH 3MN8A 4M6NH 3GO1L 4LSSL 4L1BA 4DZBA 1GC1L 3SO3C 3CSPA 1H3PL 2O5XL 3B2XA 4YJZL 3FHEA 3OC8A 5BUAA 3NSYA 2UXFA 1PCSA 1GIGH 4AUUA 2MKWA 4X5RA 5MENA 4RWHA 2ZAIA 5AW9B 4H44C 4PPTA 3MA7B 5JW4N 2OSWA 3MUUA 4F2MA 5HGDB 3TM6A 4XRCB 3VFNB 1J1XL 4V2BA 3EOAB 1IIKA 3MSPA 5IFHH 1BPLB 1G9NC 4BKLB 1DHKA 2A0LD 2F8XC 3LIZL 2J7LA 1MELA 4M6NL 4NIYE 2X6UA 4G70B 1UJ3B 1VSCA 2EEDA 4UBDC 5GZOD 2NY3B 2P5WD 2QHRH 5DRXB 3ZYZA 3WEAA 4QRQA 2Z65C 4LVHC 3L3IB 2X0VA 1JF5A 3C8HA 4WW1B 1ED3B 2CLZA 5KSVA 5AALA 2NY2D 1IUZA 1GIGL 1MH5A 1BXUA 1NC4B 4EI6A 4S0HA 3DVNA 2UWEE 4KUCD 2Z7UA 4M5ZH 4Q2ZB 4OV5B 3CDCA 2DLTA 5TE4H 4OGAC 4XMTA 4K3JH 4AYGA 4PJBB 3LKSB 3IGAB 3PJSB 2DS4A 2VQTA 2UYLA 1J87A 4J4PC 1GZHA 5DJ8A 5KANI 5DQDH 4AQAA 3L4UA 2QHRL 5SX5K 1X4XA 2AXGA 4QHNB 2DJ4A 4L5FE 1X9LA 4GRLC 1P2CB 3FO1A 4Q6IC 4YOKA 2OBGA 1BJMA 1LYQA 2Z35A 1WBXA 3FF8A 3S37X 3F7QA 1JGUH 4ZODA 1TJGH 4N2NA 5FHBH 4B9CA 4M5ZL 2JQZA 5JPMB 3RBGA 5TE4L 3B2MA 1E4XI 1OAXH 3KBEA 5C0JA 4K3JL 2ZXAA 5CJQH 4QRPB 5TE6H 1EX0A 1WZKA 5EN3A 2D3VA 2E0PA 1WD9A 2BVQA 4H8WH 3CN2A 2OTPA 4K73A 4LPCA 3DUUB 4RFEA 2R23B 3G6AA 1NMAL 4AV0A 3SDXB 4Y5XA 4OZIE 3UEZA 1GSKA 2NNRA 2JKRM 3V7AG 4HLEA 5BO1H 2QSCL 4Q7DA 1G1KA 4LHUA 4KRPC 4D9QE 3WN5C 1JGUL 1U8PA 3L9YA 2VDNB 1TJGL 3KW8A 5FHBL 3RY6A 5BW7C 5IIEB 1SOSA 3QUYD 1O7VA 1NFIA 2X6VA 2VJXA 4JG0H 1OAXL 3DXAB 2QPFA 4OCRH 5KBLA 3MRCA 4QLWA 5JHDB 5CJQL 3L3GA 5TE6L 4J2XA 5B1JA 2Y7QA 2W59A 5LVEA 4IRSA 3RDTD 4H8WL 1A2YB 5FA4B 3KXFD 2VC2H 4W4OC 5EO0B 1PLAA 3Q2CA 5IBLD 2HZHA 3FOLA 5LHDA 3UAJD 4YGVA 5BO1L 4FQIH 3GMRA 4PI0A 2CDFB 3TA3B 3OJMB 4H5SB 3DVIA 3HPJA 3H3KA 5KS9A 4X0KA 4OCRL 5E8EA 3PLYA 4RMQA 3AXIA 3VG0H 4I4WB 1G94A 2HG5A 4URKA 3RUGF 1FN4B 3UP6A 2QTEA 4OY9A 4M6AA 2ZWSA 3LEYH 1UOKA 5ICYA 2VC2L 4I5BA 4N5EC 1MF2H 2V2TB 3EYVB 4UZUA 5E00B 3P4NB 3X17A 1J9SA 2P45B 4QGTA 2PCFA 4ENEC 1VADB 4HC1A 2DM4A 4FQIL 4G7SB 3JBG7 3U4AA 3OKNA 2CNZA 4KNSA 4W9JC 1B4LA 2VJ0A 1DSYA 1ACXA 4XPGH 1XEDA 2N1KA 4HWZA 5SWSD 5BVJA 2PCPA 1MW1A 5ANMB 4JMXA 2ETWA 3W9DB 3WELA 4ABVA 4CADB 3LD8C 3LEYL 2LFEA 3IKCB 2GJ6A 2E86A 5T33L 3TBYB 4EI5C 2ICWI 4RFNC 2CJUH 2ZOKA 5LAXB 3DNKA 3IDGA 2FYYB 4XHQA 5EOTB 1G0YR 5JXAH 1ZGLM 3MLWL 3V0IA 2BSBA 2DWTA 4YBLB 3N43F 2QV4A 3RIFF 4AIZA 2DYPA 4WSJA 5LO7A 1JMZA 2XWBA 3SYCA 4XPGL 2BJMH 2OR7A 3P73B 4NGHH 4W9HC 4YPJA 1H6EA 3V6OC 5JOFB 1LXMA 4M4RA 5B1BB 2DEWX 5K69A 2WCPA 4KZDH 2H47C 3O4LD 4NZFA 4ZO8A 1XGYH 2XG4B 5PAZA 2QKIB 4HK0A 4IBZA 5F7LB 2CJUL 3VU2A 1MFAH 5JXAL 5DFVD 3MCLH 2V9RA 4TF4A 3VYOA 1HHHA 4UOQA 2EYSB 1YQ2A 2Q6WA 5E0FA 2Z31C 1U2CA 2HFEA 2IADA 3FYIB 3GJFB 1RPKA 3C6LD