3GF8A

Crystal structure of putative polysaccharide binding proteins (duf1812) (np_809975.1) from bacteroides thetaiotaomicron vpi-5482 at 2.20 a resolution
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
284
structure length
284
Chain Sequence
ECRLSVKFKYDYNMEFADAFHAQVDKVELYVFDKNGKYLFKQAEEGSALSTGNYLMEVELPVGQYQFMAWAGARDSYDITSLTPGVSTLTDLKLKLKREASLIINKRMETLWYGEVINVNFDGTVHQTETINLIRDTKIVRFGFQSYTGSWTLDMNDYDYEIIESNGHLGHDNSLLDDDVLSFRPYYMEQKDPATAYVDMNTMRLMEDRKTRLVLTEKASGKRVFDINLIDYLAMTNAEGKNLSTQEYLDRQSNYHIIFFLSESWLAVQIVVNGWVHRIQEENQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A conserved fold for fimbrial components revealed by the crystal structure of a putative fimbrial assembly protein (BT1062) from Bacteroides thetaiotaomicron at 2.2 A resolution
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Carbohydrate binding protein
molecule keywords putative polysaccharide binding proteins (DUF1812)
total genus 69
structure length 284
sequence length 284
ec nomenclature
pdb deposition date 2009-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08842 Mfa2 Fimbrillin-A associated anchor proteins Mfa1 and Mfa2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2090 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3gf8A02
2.60.40.2100 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3gf8A01
3GF8A 4QDGA 3PAYA
chains in the Genus database with same CATH superfamily
1IILE 1MQKH 4AY0A 3MLYH 4XOCA 1MQKL 3VTAA 3R19A 1A2YA 3IT8D 1C9SA 3FQTB 3EJJX 3L9RA 3QUML 3TYGH 3X1FA 3FRUB 4RWYL 3GMPB 3LD8B 1GGBH 1YO4A 3OKYA 1CDIA 2B16A 3RVVD 1ZS2A 2E3VA 1KTBA 3EDDA 3V0FA 5C6PB 3P0VH 2A0LD 1Z5HA 2B15A 4FRWA 2H0PA 5E8NB 4BH8B 4PJDA 5AOZA 4EE2A 1A6WH 4PWEA 4Q97A 4XP4H 3SO5A 1T5XA 3U6RB 2HSIA 2NY6B 4F7KA 5K59E 4L8CB 3W3BA 5IHUH 3KCPB 4CKVX 4JJ5B 3RZWA 3ZXAC 3Q06A 4FFZL 1EGJH 3TN0A 3P77A 4FFZH 2XQYG 3I3EA 1B2YA 2BSCA 5D7SL 1PBYA 1MIEL 3FAXA 3O6ML 2BC4A 3C6LB 1MPAL 1QWUA 2EE9A 5EU7C 1S7QA 2FEDC 3E1ZA 4HV8A 3ZT5A 1LD9B 4TUJB 1MCWW 3KDMB 1HHGA 4ES8A 4HWBL 1CQYA 5AUMA 3T09A 2VDQL 3FH7A 3H3PH 4H4NA 1Z5LA 5IJVA 3WKNA 3MRHB 2IQ9H 1PPIA 4G2AA 1QUNB 2WNXA 3V8OA 2OA9A 4BWTA 1YJDH 1PD6A 3ULUH 1HAWA 1X7QB 2A9DA 3NJIA 4UT9L 4YHKL 5DJ0A 1CLZL 4LGRB 4DP2X 3IJHA 4Z7UE 2JJTA 4LPVA 4JDTH 4ZSOE 3QDHA 4JPQA 1MAMH 2NY3B 4MA1B 4N1EA 4Z0XB 4F9PA 2RCSH 3CN4A 1JV2B 2KQMA 3I6GA 4MDJB 4JFHE 3FN9A 1TO4A 4DPCX 3GSWA 3VXSA 3HMWL 5C08A 4Z76A 1DJZA 2F53B 2KS0A 2J8OA 3NIGE 3MLXL 2Y22A 1NMAH 4IRZL 4MX7A 3QFDA 4FLQA 3QCTL 5JHDA 3ARDC 4F8NA 1YEWA 2BVOA 4U6YA 3A4EA 1DBAL 2JI3A 4WHYH 4KK5D 1NJ9A 5ITFA 1FE8H 4PBDA 2IDSA 1YPZF 5IG7B 5LCVL 2AXFB 3GB7A 5FUOL 1KLUB 2G5BB 1U3NA 5IBTL 2VXUL 1OCCB 4UQEA 2DS4A 1R3LB 1L9OA 1LWHA 2HP4A 2JKRM 2VXUH 3KJ6L 4XR8C 1CCZA 2V2XA 1G94A 4FFTA 4XCCL 1BMZA 5CEZE 1PKOA 5FOBA 1XB6A 2OR9L 3N41B 3EJZD 3GO1L 4I5BA 4HOMA 1V05A 5J11B 3DHUA 2NXYC 1KYAA 4Z7NE 2X42A 3E2HB 4MD5A 2NCEA 2Z3FA 1T22B 4HS6A 2V2TA 3KPNB 1TSRA 4KC3B 1YEJH 3SGJC 4OF7A 2ZG1A 5IVNA 1FO0A 1D5RA 2B3IA 2DQJL 4R8WH 1I1YA 2X2YA 3IRZA 1I1CA 1FIEA 5EC2B 2HG5A 3VQLA 3VXPB 1FG9C 2DQJH 4MNGB 5CEZD 3FBKA 4JE0A 2R1YA 1BM3L 1HXKA 5D7JC 4AYSA 4RBPK 4LOFA 5FPIA 3VX1A 3UTSE 1CFVL 4XBGB 2GBUA 4L8SC 4JKPL 2ZAIA 3WMSA 5IVZA 3MLUL 1FVDB 2CO1A 3WEBA 2Z31C 1PZDA 3ABKB 4UTAA 5C08D 2DRUA 1RZFH 3WIIL 4PJXB 2IWKA 3ULVD 3DUUB 4L37B 5LGYA 1HNFA 4Z7NB 5A2AA 1BF5A 1NAMH 4DUVA 2J7LA 4KROB 2J56A 3H55A 2XWRA 4NYLA 4GW4A 5FYLL 4NQXA 4ICWA 4W9KC 3OGCA 5DZJA 3IFNL 2X4NA 5F1NA 1WGOA 4BKLA 4LVNB 4R90H 1PLBA 1UZGA 4TN9A 3QI9C 3RG1C 3CMOL 5EU4A 2OLDA 1MFEL 3WN5C 4O02H 3PPSA 5AG8A 4KQ4L 1S3RA 2ZUYA 4N87A 4NKQB 2NY3D 3VB8A 2CUAA 1J0KA 1MCWM 1MCOL 2GK0A 4I1PA 3W0WA 4WSJA 4GP8B 1E3XA 1F02I 1UVQB 2UX7A 3MAWA 4C8XA 4ABQA 1YY9C 2OMWB 3NJNA 3T08A 4XXDB 1I1FA 2OMVA 4JFDE 1OP4A 1T0NB 1FFNB 2YIHA 1KPUA 4PRDA 4OVUA 1KXQA 3T0ED 1CIDA 1WQVT 5MERB 5C6TL 2DQUL 4PV8B 1L0XA 1KN2L 4MZ2A 3GTTA 1T6BX 1XQ4A 1ZLEA 3IXAA 3MRFB 3LN4A 5IW6B 4JRXB 1E65A 5IROC 3WYRA 1EAQA 2LVCA 5DVKA 5T1MA 4DT2A 5I5IA 2WB1A 5E2VH 2ERJB 2OL3A 1F3DH 3FOMB 3S7GA 2EKJA 2PTUA 1R0AL 5LN8A 4NKIH 4X98A 4MCYB 5DQJB 4KI5C 5HHQA 2R0KL 3V7AG 2FQDA 3BOVA 5DC4B 5F7DA 3S4SA 5DU7A 4AENB 1OGAD 2XLLA 2KQNA 4ZUTA 1FAIL 3IGAA 5HTSA 5GSRA 1SJEA 1ZWIB 3QEQE 4UV7H 4JPKL 1AMYA 5GGVH 1ORQB 5FF6B 1FF5A 3WEXB 5AD0B 2PNDA 4BRVA 4AV4A 2WUCL 2YMXL 3VFNA 3VVWA 1LO2L 1XWVA 4N6RA 4PB0H 5B4MC 1NUNB 5MENA 3MGAA 2VZSA 3QUKB 4XBEL 2XG5B 4CNIB 1BD2B 2DQCH 4K5NA 4H20L 3V6OE 4QF1B 4AIXA 1WZ1L 4HGWB 3ARDB 1UADC 2C3VB 2ZP0T 4A2DA 4ADJA 1HZHL 1U95B 4NAMA 4DN4H 5DJXB 1CFNB 2XZQH 4AQ1B 5ILTL 2J2ZB 1BLNB 2DWSA 2VERA 1QLRB 3LDBC 1H9DA 4YK4B 5L2KD 4FXKB 3F83A 3TO2A 5CBEB 1NWOA 4JFEA 4DUWA 1I1AC 3PQYA 4GOSA 5E9DB 3UJJL 4DPAX 2B2XL 1KBWA 3W56A 5LGKA 4JKMA 2VWEC 2AQPA 3SDYL 4PJ7F 5KBDA 4X2UA 1HH6B 5FA4A 4G8FA 2DIAA 3EYFA 1FORL 1T2JA 4OLEA 3AXLA 3B9KB 2FYYA 5D6CB 3EYSL 3QJVB 5EZIH 3QIBD 5DQ9B 1FLTX 3O4LD 3B2UC 2YOAA 3QQ3A 4EN2A 3L4WA 3O41A 2XWJB 3T77A 1D2OA 4P2OB 3F7YA 4YGAB 3FSAA 3UBXA 2H0EA 4AVHA 4JFPA 4JDEB 3L3OB 1YN6A 4WFGE 5JXEA 4JAMA 5FCUH 2ZWLT 3MREA 3FMGH 3TASA 4GFTB 1F6LL 3N50A 5GS1A 4LMQE 4FFVD 3HOGA 2HVKB 4HZAA 4MDRA 4D0DB 1TQUA 1HS6A 4NZFA 4ERSH 3T0DA 1NDMA 2IDQA 3EHBC 4Q4IA 1MJ8L 4LCWB 1ETB1 3VFGL 1FQ9C 5BCAA 3LX9A 2YA2A 4XX5A 4LCIL 5LGJA 5I8OL 1C5CL 2RJMA 1KGWA 2V4LA 1R5IB 3EYOA 4KY1H 2YPLA 3IJEA 4JG9A 5BS0D 4G6ML 1A7RL 4UOW0 3CH1B 1NSNH 1CK0H 3CFTA 2E4FA 3MGTA 1A6ZB 1IUZA 3CMGA 4PJAB 1WYJA 3F64A 3MC0A 3OB0K 4XAWL 4MJ2A 3KLAB 3MROA 4UDTB 3UZEA 2R69L 1YC8A 4AIZB 3M8OH 3TWCH 1C1EH 4LAQL 1SVCP 1SHXA 4HUVA 5C3LD 3WFZA 1K72A 3OKKB 2F08A 1PG7H 2IXQA 2OPCA 2YBRB 3L16A 3CZGA 3S36H 1EMTH 5BS0E 4ONGL 2WCSA 2KZWA 4NKMB 4DP6X 5IESH 1AG0A 3MODH 1EJOH 2IAMA 1O9ZA 4BH8A 1KBVA 1P9MC 1R5WB 3PAVA 2XHNA 4X8JA 4LSSH 1HQ4B 3MLRL 2UWEA 1UT9A 4E42A 3TEZA 4ZFOA 3GMPA 3BCFA 4L1TA 3CXDH 5ADPH 2Q3XA 2YGVA 3E0GA 3JWDC 1N2RA 1XSJA 4Z7OF 1NGPL 4L4JA 2PYEA 3OBAA 4L8BA 2Y24A 2CSPA 3KW8A 4DGYL 3FB8B 3F6IA 3L7EB 4W9LC 3P4OA 1UH3A 3MA7B 4QRRE 3OKMB 3S2CA 1SQMA 4FZEH 1CFTB 3Q1SL 1R3JB 4GQ9H 5HVHC 3MRNB 2X70A 4A6YA 4DEUA 3MNZA 2HH0H 4LLQA 1ZHBA 2C3XA 1WUZA 1U41A 1CMOA 3NRFA 3HI6L 3RY6C 1L5GA 4XNZB 2UVEA 3V0VA 4BH7B 2XKNA 4L4VD 2OMXB 4NQDB 3UCQA 5JZ7D 5EC2A 3VXPA 3DV6A 5KBMA 4KV5E 3DVGB 1QLFB 2V33A 5ACZB 4UAHA 2BVUA 3C2AL 4FQLH 1F0LA 4QRRD 2PTTA 1FFTB 4RA3A 5CSZB 4G7RB 3JVFC 3N43B 5DWUL 2IALA 3EYVB 4GAGH 4ZOAA 3FO1B 1QSEA 4XPTH 3FQUA 4KXCA 5DT1H 3APCA 3LQMA 4PJ5D 1IM3A 4PRAB 4XP1L 5JQHC 3PWPD 4JM2F 4RMUA 3TWYA 3FONA 4XN1A 4DGVL 3C6SA 1B3IA 2F18A 4JY5L 3HS0A 4KDWA 5DHXB 1KENH 5FO8B 2C4FT 4PCTA 2WTRA 4FQXA 2QZ5A 2MCG1 2WNKA 2HN7B 1BF2A 1S78D 2X88A 3EGXB 4NN5B 3RX9A 4HK0B 2IDTA 3S3JA 3QHZL 5BZDA 5IB3B 1O5DT 5E1AB 4AYBA 3OF6D 1MELA 5D7KD 2R0WH 5T1KB 2WQUA 4MNQA 1BQ5A 2OJEA 5E6IA 4YL9A 4XN9A 2OL3H 3D85D 3OX8A 1KNOA 4FL4C 4K3GA 4E9WA 1A1NB 2XN9E 3MLWL 4UV4H 3VDBA 3ULVF 2K45A 4LFHD 4WFED 2QADB 1YQVL 5G5DA 3FUMA 1DQMH 2ICWJ 3NPZB 4KKCD 1JHKL 4WEEA 2OMYB 1PLAA 3QJFA 5A3ID 1MW0A 1SXCA 1KPVB 2GHZA 2UWEE 3G6DL 4XN7A 5AALA 4G80A 4PJEE 5E0FA 4A2LA 3VJ6A 3A24A 1IIIA 1AQMA 2XN9D 4J3VA 3LNGA 3EW3B 3KLDA 4QAMB 4X6EB 4WI3A 4OQ1A 3BFOA 4YHPA 3P9MB 3VFRA 4OCXL 4PUBL 1T20A 4O02A 1MHPH 2YRZA 2WQWA 1WE5A 4APQD 1CICD 1BQHB 5KSVA 3BGFC 4CSZA 3ZGHA 3WLWD 1B2WL 2F8VA 1U3HD 2BXYA 5DJYB 5D2NE 1ET7A 4U4BA 4R4ND 3SD2A 5T3ZD 4Y9GA 4HJTA 3I2CH 1TVBA 3S5ZA 2PUQT 1BBJB 4AMKH 2FE0A 3SDXA 4E5XA 5T1LB 4IKNA 2VR3A 4B5ZA 3CGTA 2NY4D 4ILDA 2DICA 1TQCC 2VXQA 5GIRA 1BVOA 4X6FB 4KX7A 4LDOB 4AQAB 3K8KA 3W9DB 43CAA 2ZYHA 4LCYB 4DN3H 4H0GA 3G04B 2AJ3A 2F53D 4XO3A 4D8PA 3EUUA 1H6EA 4U6HB 3UYPA 3BRDA 3T71A 2BVQA 2OXGA 2D4FA 5CNHA 3JWDL 3VWKA 4LL1A 1JHLL 1T21A 2Y5EA 3CSFA 5J9PA 3FT2B 3B4NA 4QMEA 3UO1L 1UH2A 1E9PB 3QCUH 3D2UD 2Y6TE 3SPGA 2CE6A 3L95A 2VDQH 1X5HA 2GJ6A 3K0WA 2EP6A 2ZSWB 1SEBA 4KXZI 1NIEA 1SYSA 1GZPB 3EH4B 2HKHL 4NB7A 4CBPA 4GSUA 3ZDZB 3ZE1E 1WJ3A 2BVPA 5JDSA 2F53E 1F6AB 1P5VB 2P5WB 2OW7A 2ZKHH 1AJ7L 3GMOA 1RQ5A 3O45A 4YVUA 5KYUA 5HHVL 1GS6X 1PLGL 4IS6A 4J6RH 1L0YA 5C86A 5I6NA 2R7EB 3FF7A 4HK0A 3W38A 4E5XB 3S3DB 1N4XH 4JAMB 1E8YA 4F9LA 4JL2A 4P04A 4ZW8A 2AEQH 3L81A 3T0AA 4AK2A 1S7XA 2GBVA 2RTTA 4O58L 4U1NA 3V0DA 4GP4B 3UC2A 1GPOL 5D7JB 4YZWA 4AWJC 2DBJA 4TL4A 5IT2L 5EOCL 2AC0A 3ARFD 3DHMA 1UD5A 1IC0A 4K2UH 4FTDA 5CKAA 1N8ZA 1YN7B 2E27H 2GT9B 3VE0B 2IANB 2L3BA 5EIIA 3PFQA 3BWAA 4FC3E 4PJBF 5F9JA 4LPTA 4IMLB 1F41A 2OMNA 2IAND 4GMSL 3B6SB 3HPLB 3KPOB 3T0VA 4X6CB 3N0PB 3RWDA 2R0ZL 2EO9A 3FMGL 1TJMA 3CZFB 1USZA 3IAPA 1ERNA 5C09A 5IB5A 3MLXH 5A1AA 1OD7A 2E86A 1ZV5A 4XPFH 1WISA 2AV1A 1UXSB 2AQ3A 2DAVA 2AQNA 4NXKA 4BK4A 4PJDF 3BAEL 4L9LA 5B8CA 5EZLA 1WH0A 1YJDC 5C0AA 1LEGA 4UYPA 3EZJB 1ZAGA 3CPLB 3O0LA 3QQDB 5D71L 1BD2D 3KYMB 4L8DA 2X6CA 2HJKB 1NTDA 2FECL 4YH6A 2ZUVA 1X6LA 2ZTBA 4BFJA 5KANG 3QUXD 5F0LB 3UMNA 5HHPA 4XHJD 3LMJL 3P0YL 2P9RA 4H8UA 2UXVA 3NJGA 1UZ6E 2C3GA 1DVQA 1LWJA 1U8LA 2P46B 4B7LA 2GSIB 2ATKB 5C2BL 1FV1A 2OJZL 3F7LA 4BCXA 2R59A 4RGMB 2W9EH 4TVPH 1XGQA 1PY0A 4NUMA 2X4TB 5BZZA 1V3MA 3VQ2C 1C1EL 4XMTA 3OG6B 4YJZL 1L7TL 1HWGB 1AHWA 1KDJA 1UZ8B 2MQCA 3GMNA 3QIWC 4F7EA 3HZYA 4G1EA 3ZUCA 3CH8A 3GIVB 4FKHA 4J3OF 3ARBB 3RX8A 1D7DA 3GRGA 4HS8L 2JJSA 3KD4A 3STLA 4KOCA 4FTVA 5JIPA 2ZKYA 4HWZA 4JO1L 4BQBA 1KDIA 3OZKA 1A7PH 4JM2A 1A21A 2BOLA 1SM3H 4HIIA 1A5FH 3VXUB 1JXKA 2CRIA 2QPSA 3TIEA 3WGUB 5C71A 1BOGA 2R4SL 3KM2A 2QGCA 4LO9A 2PWFA 4U7KA 3FF8A 3FQXB 1LO0H 4N0RA 4UWQB 5I0WA 3HB3D 2Z31D 1QX1A 3GXDA 3H9ZA 2P45B 3KCWA 2KPNA 2WXPA 3FHQA 4HX1A 3T65B 2XKNB 4NQDA 1S7WB 4QHKJ 1INEH 3STZB 1RI8A 1EO8L 2O1AA 2IADA 2V17H 2VT0A 3P73A 5DC0A 1C08B 2F19L 2GSIA 5MEPB 3CDYA 3O81A 4G11A 5HPMB 1LM8V 4LCCB 4J8QA 2MHAB 3CFKA 4GW5B 5KYYA 3RP1A 4FHBD 4WHTA 1PFOA 1SF5A 2QQLL 4NC1E 1FLRH 2VJ0A 4F2MA 3OKDB 4APQC 4FA7B 4K3EH 1N5AA 1RHHA 1U8QB 4XH2B 4HSQA 1P69B 3QYMA 5EOTA 2XKUA 1WHPA 5I6MA 1WZMA 4TXVB 4FEIA 4CN1A 4YBHA 2QDWA 3UC0L 1E50A 2WBJD 3G08A 1HH9B 1T80A 5DEGB 3RWEA 4ZNCD 5JIMA 3CXHJ 1INDL 3O41B 4K3HA 4PBVC 2IXQB 3SPIA 4KVNL 2WKOA 1ZT1B 2MH4A 4KY1L 3CSTA 2EC9U 5IROD 5IW3A 4R7DA 5HPMA 2LE9A 2AQRA 2C9UA 2YMXH 5E2UH 1EQWA 1MFEH 5I1IL 4KKNA 1ZE3C 4NO3A 3IU4H 1U3YA 4LHQB 1JBJA 1K4CB 2AQ2A 3SE3C 3IU4L 5EU6A 1PZ5A 5E1AA 4H40A 1AQKL 1XVSA 1FAIH 5I9QC 3BPOB 4WI2A 3WFDL 4NO2A 3N6YA 3H54A 3QRFM 1NCAH 4S2SB 1S5IL 3H2PA 2VQ4A 1XDTT 3ML9A 2FJGB 2XWBA 4NKOB 4WWID 1HZKA 3QDME 2OK0H 1JZEA 3OG4B 3LHPH 1XCTB 3V4PH 1QTSA 3G6JA 1QO3B 4P5MB 4XN5A 3SY0B 3S8FB 4FABL 2PW1A 1L9MA 1U8PA 1E5UI 4KI5E 1ZSDB 3MGOA 1LE5B 3AWGA 2C3HA 4ZOBA 5I18L 1CGSH 2XZQL 4M8RA 5E4OA 1A7BA 2E9WA 2NXZC 4GRMB 2FJFA 4WNQB 1JSYA 5E7BA 1SZNA 4OCRL 1YCSA 2XYCA 3UJIL 4EDWL 3RZCD 3FU7B 3V6BR 2AXFA 2TRYA 1UWXK 4Y4HB 4Z7QF 5CSZA 4HPOL 2IBZX 2EYTB 4A2HA 2IWEA 3QDMD 2DWEA 4QTHA 3D5OF 4HLZH 4XP5L 4QT5B 4IKJA 2FJUB 5CU9A 1I1AD 4L3ED 4KQ3H 2B39A 2Z7WA 3D3VD 4X98B 3RI5F 5HHQB 5HHNB 4K8RL 4RAVB 4OLZH 2HRPL 5AVSB 5D1ZA 1XIWB 1M1XA 3DHJA 4LLYB 4EKXA 2YBGA 1GTNA 2BNQB 2F7QA 1OLZA 5E00A 1BGXH 4A63A 1ETJA 1T1WB 1OF0A 2K78A 3APNA 4MJ4A 4ONHA 2HT3D 4R97C 4HWEH 1Q9LA 2ZQKA 4FP8L 2JXMA 3RRQA 3VD7A 1T5WA 2NY0B 3MRDA 5FYJH 2NY5H 4QXWA 2IH1A 1ZA6A 4XC1H 3CU1A 2DL9A 3MKGA 4RETB 1M3IA 4Y1TA 3OC8A 2Z93B 2ITDA 1YYMH 4PJFF 4DAGH 1JYNA 4W70A 5IR1B 5JMRA 3QPKA 3FUDA 4YLQT 1I9JL 1B4LA 1KB5L 2EDKA 3ARRA 5DJXA 1G7JB 3WJJC 3HAEG 2CWRA 1NCJA 3NFNA 2FL5A 1NC4A 2B7DT 3ULUF 1A7RH 3SYPA 4G80B 4R5VA 3SO3B 2AI0L 4FG4A 4MA1C 4QRSA 1F1AA 2X89D 2KUTA 4QRTB 3LEVH 4MXVF 2EXYD 2BFGA 2AAVA 2JB5H 4PV9B 3AM8C 4GH7B 2BNQA 2W8CA 3SDDA 2LABA 4XNMB 4NIYE 1EFXA 3V10A 4APXA 3ZHNA 1QFOA 2VLKB 4L4TD 1VEOA 2YA0A 1NGZB 3TA3B 4KXZH 3EOTH 5GGRY 2F1AA 4IDJL 3MLWH 1RZ7H 3TBWA 3E6FA 1M05B 3KPMB 2IIJA 4MQSB 4PVLA 2Y5TB 3WHXA 4G5AA 2R2BB 1CXEA 2VXVH 4FQ1H 2NZ1A 1CG9B 1FVCA 2PXYA 3VFTB 1J05A 4QRQB 2NNFA 1ETZA 1J5OL 2PO6C 5AYUL 3O3EA 1IFHH 3C5JB 1EGJL 4BZYA 3LEXB 3QUZA 1GJIA 3WCYA 1JD7A 4U6TA 4UOJA 3TV3H 4L4TE 2DB8A 4MLSA 4EDXA 3US1A 2GJ6D 5IESL 1GHFH 2AJUH 2LW3A 1B4RA 5EDSA 1QQDB 2UYLA 2VXSH 4LVOC 2OSLA 4D9RE 1MI5D 2DJ4A 3QUYD 5FX3A 3V4UL 4D8PB 2B0SL 4OCXH 1N12A 3WE6A 3MRQB 1J8HE 2CIIB 2Y06H 1KCUL 3SDXE 4WY7H 4O2EA 4Z7UF 5C0AE 4G6MH 1XF1A 4GSQA 4LLDA 2JVUA 1OGAB 4GT7A 3SDCA 3L3DB 3C60A 1JG9A 1K8DB 5K1VA 4GKNB 4WUUE 2FEEL 1BFOB 2XICA 4KZDL 1SDYA 4POUB 5E99H 2XI9A 1FYTD 3V55A 5FLVA 1RUML 2YD1A 3N1PC 4ICXA 4ZXBB 3RNQA 3GB7B 1I3GH 4FERA 4ISVB 5FK9A 4L29A 4LSUL 3AWFA 5DJAB 4UM9B 3HI6H 3VSUA 3ULSA 5EC1A 5C0ND 5DA0B 1M1XB 3HE7D 3N85H 2RFXB 4DN3L 1WBYA 1T20B 4O02B 4KHTL 4WJG3 2HCZX 3VI4B 3VTMA 4J3OD 5EZOL 2Z4TA 4LSSL 2PWDA 2VSDA 3LQAL 5EUOE 4NNXA 5IHWA 3SDDC 4NPKA 3P4MA 5JR1H 4GXUN 4MB1A 3E9UA 2WM0A 5DVPA 4F15B 5C0FA 1AGEA 2DLGA 4OD3H 1JMZA 3BWUC 5EF1A 4ODTL 1OY3B 1EK3A 3HFFA 4S11A 5DK0B 4YNYB 4G83A 3MV8D 1J5CA 2HRGA 5D7IB 3II3A 4EBQL 2FO1A 4ZS6C 4GEJA 1FO0B 3JZ7A 2VZOA 3WJLC 3S37L 1WFIA 3VFUB 1IM9A 1SVZA 3CFKB 3GO1H 4XNAA 1NAKH 2Y07L 4J6RL 5AD0A 5EWIL 3HG1B 3JTTB 2GBTA 2PXYB 2W91A 1U58B 3UH8A 3A3YB 1EO8H 4L4VB 1L3NA 1F97A 3MCLL 5TQ0H 1KV3A 5J1AA 2QBWA 3RVXC 3VI4A 4PJEA 2X4QA 2JI1A 12E8L 4DVBB 3ZYJA 4LPYA 2NY0C 1CLYH 2KLTA 4FXLA 4N0FB 3LPGA 4PJBA 4ENED 2Z1PA 3BEWB 3N06B 2PCYA 3ZKXC 4F2FA 2VJXA 5F70A 4MMXB 2XVLA 5FO7B 1GYAA 1NPUA 4Z23A 5JHLH 2OP4L 1IAIH 3D2TA 3SE6A 2G3MA 4Z3GA 3OLEA 4DO4A 2BCKA 3ARGA 1NEZG 2P5WE 4TTDD 1FZKA 4QHUB 1JPFA 3FO0L 1SHWA 2B4CH 2HVKA 4BQCA 3SO3C 1TJGL 5I15L 3ARBA 1VEPA 1IM3D 1AIFB 2UX6A 5IHUL 3ALXA 1UZ8A 3GMNB 3ZKMD 4WUUB 3PXLA 1RZIB 2QSVA 5DA4A 1D3CA 2HVJA 3T6VA 5FYLH 3V5KA 3DBXA 4UNIA 1FNEB 1NEUA 3MRQA 2WZPA 4ELKA 3FCSB 4L1SA 2PPEA 3AQXA 2I5YH 1I8MA 4N2EA 5J1AB 3BAYA 4LRNL 1KB9K 1VA9A 4HUWB 4YSRA 4MD4A 4L4VA 4O4YH 4TSBH 4LOVA 5BV7B 3LKQA 3BVDB 4NN7B 1NGYA 1BP3B 4EMZA 1RY7B 5KANI 32C2B 4GAJH 1X4XA 3MFGB 4X5QA 1MH5B 1AE6H 3O3BA 4TL5A 2EDMA 7TAAA 5DSCA 5AUMB 4XCFL 4ABVA 4P5TA 4L9LB 5B8CB 1YEEH 4ORGA 4M29A 1EWHA 1AD0B 4LQFH 4YSDA 2AERT 2JWYA 4K7PY 3EJTA 4NQVB 1BAGA 3D48R 3LTVA 5I8CA 3VXQA 1N5YL 3CTTA 3EBHA 4M4RA 5CWSB 1A7PL 3PL6C 5J11C 3CD4A 2QPEB 4WHDA 2NX5A 3SY6A 2FZ3A 1KJ2A 2WLLB 3ROOB 4G6AC 4MD0B 4WWPA 3GXPA 3L1OH 4NT6A 4IRSD 3GRWA 1W6WA 4U1LA 4XVTH 5E8PB 2ZUQB 1FAKT 4ZFZB 1IARB 5BV7C 2I9LA 2KDYA 2PCXA 4L05A 2WD0A 4IBQA 4KKQA 2CGRL 1X5JA 4NJAH 5EC1B 4OV6F 4W9JC 3F8UB 4N6RB 3AUVA 5DHVA 1FYTA 5LXVA 4JY6A 3HZYB 3AU1A 3FQ1A 2PO6B 5FUOH 1YSOA 4JO3H 4Z1PA 2DW5A 5TDOB 2X12A 2H8PB 1GYUA 2AEWA 4ZMVA 2M26A 2IDUA 4PI2A 2CDGB 2WQXA 4XPHH 1KEML 1M9SA 3L3DA 4R7XA 4OF6A 4N9GB 2EIMB 3KL0A 2ZX8A 3JUZA 5KJRL 5LN4A 3CZEA 5LAPA 2RIKA 4PP2A 4ODSL 5H37H 5LHDA 4XPFL 2XC8A 2VUKA 3MRCB 3RYMA 4G9FE 3UO8B 4Z3JA 4XE0A 4QXGH 1OSZA 3FT0A 3LVEA 1IQDB 4WK0B 1IAOA 1XGYL 3WG7B 3R4RA 1MRFH 1TG8A 4PJCA 5HGHA 4ETQA 1T21B 2IAMC 1KB5H 3VD5A 4R7NA 4UT9H 4U6HA 4YHKH 3UYPB 1F4HA 1L7IL 1DLFL 5ITBL 4CW1A 5CBAA 4Y4KC 3QPXH 4CILA 1G7HB 4LOEA 3U82B 1UFUA 2ZOOA 5DRWB 2VAJA 3RGVC 4CC4A 1WO2A 1P4IH 5F2FA 4GRMA 3HAEB 1N4XL 1AY1L 2D2CC 3MYZA 3QZWA 5ESQA 3ESVF 3ZDXB 4YSSA 3WO4C 3PHOA 5ICYB 4BDVA 2YWYA 2HMIC 5DMJB 1GAFL 3QQNA 2N0KA 1WFUA 3O6FC 5AVXB 1JZHA 1WVZA 2A7BA 2BCKB 3L08A 3RNKB 2E6QA 4IDLA 4U3HA 4HQQL 3V5DA 4X8GA 3X1BA 3WLBA 4AEEA 4NHUA 5LCVH 4F15C 1E8XA 4MYPA 4QTFA 5DUBB 3TX4A 2J1YA 3DUUA 1HKLH 4AKQA 3GMOB 3TN0B 4K73A 3I6KA 2FUTA 2E76C 2VZ1A 3KCPA 4YZFE 1IC5H 2I7OA 4WV1A 4ZMOA 2NNAA 5LWYL 3KG5A 3WEOA 1DTUA 2VWEE 3TPUA 4DFIA 3FTGA 4PJ8C 5I74C 3O2VL 2N01B 4FFWD 2JXMB 3RZCA 4H8QA 2PWHA 1AXIB 2V37A 1AD9A 4R8WL 4FNQA 5C92A 4JO4L 5I23A 4AJVA 4YSPA 4HKJA 4KZDH 5IBUB 4JFPB 1BWWA 3GD1C 4HAGA 3VX0A 3CHPA 4H1LB 1U8CA 5I1EH 5EO9A 5J57B 3MRRB 3H3BC 4U1HA 4Z3HA 4KRPC 3MLSH 3IF1B 3MNVA 4A55A 4B53A 2OTUB 4GXUM 4KJYA 4QHMA 3DX7B 5BXFB 1CGWA 4NAJA 1COBA 3ZO9A 3WLWC 1XCQA 5ISZD 1INDH 4B27A 3CFJA 1CL7L 1G6RH 3HEIB 4YC2B 5BQ7A 4BRJA 1JZ6A 1OQXA 4W9GC 1SBSH 4XXDA 2YQ3A 1B0GB 2XWXA 3MR9B 3TXAA 4KTEH 2LT9A 5KBNC 3HMXH 4HT1H 3FTVA 3SYOA 1OCWH 3V2AR 2VAAB 1U8JB 4PCSA 4YGVB 4XODA 1OGTA 4P5RA 1P5UC 1X9RA 2PTTB 3QPQD 4DN4L 5BVPH 4XCEB 4DK5A 4LB8A 4YFLI 3EOAA 1E9QA 2WBJA 4JO8A 4JHAL 4JFEE 3REWA 1UB5B 2FQEA 2WVVA 3RTLA 3PHAA 2CMRH 2YUVA 3R7RA 4DF9A 3IDXL 4PV1C 3ZTNH 4ANWA 3HN8A 4OIFA 4ZAKC 1XGPB 2NRDA 1URLA 4W68A 2B59B 4WNJA 4WHYG 2EE2A 3TZVD 4M7LL 4NHCH 4A7UA 1S7XB 2Z7ZA 2BIMA 4K94C 2GC7C 4O51B 5DRZB 2CCVA 3MUGB 4PJ9A 1IZKA 3GTNA 4JB9H 1Z9PA 5AQ0A 1JNHA 1C8PA 3WNIA 4G7VH 2H6UA 5GSRB 3GXFA 4JFOB 1N3NB 1ZV9A 2GK2A 2VUYA 2VLRB 1JZIA 3PHQA 4DQAA 2R2BA 5FW8A 5KSAB 4HOXA 1ACCA 2QLYA 4TUJA 1LD9A 5DZOA 3MQIA 2ED7A 4GSRA 3SCMB 1A4AA 1BVNP 1GHFL 2E7HA 2JCWA 3TOPA 3MYJA 4W1TA 5AENA 3BGMA 5D7HA 5EEUA 1SEQH 3RUGA 4BFOA 4JFHD 1NBQA 2ZOUA 3KEHA 5C7XL 4RVBA 4PLOB 2ED6A 4PYHA 3PNRB 3GHBL 4HK3N 1F58H 4IEFB 2H6OA 3WDHA 3DRQA 4NSKA 1M2VA 1TCRA 1I8LA 1JVKA 2EH7L 2G9HB 5F7EH 3K8MA 1KJVB 2FQFA 2WXGA 4GG6E 3SZKC 3KXFE 2VDOL 3TH4T 2CBQA 5GGSA 4D0CA 1MJ8H 5T5FH 3WL9A 3SE9H 2GUYA 5ID1B 4LCIH 4IU2A 3PREA 1CYXA 3EJQA 4CUCA 4PJ5B 3MV9A 2Y2TA 4B9CA 4JPWH 3D1MC 3BWAB 2R0LL 3UP6A 1XCQB 4BH7A 2BIOA 2FIKA 4QRPB 3RAJH 4ZJ9A 4JVWA 5EBWB 3TIDB 1RIUL 5JXAL 5CP3H 4XCFH 1NEPA 3RDTC 3QQ9D 3S96B 4DSYA 3L5WB 5E5RB 4P2QE 4U6YB 4G59C 5BVJA 3IFLH 2VABA 3CFDB 4U0RB 1T1ZA 1NZRA 4HWZB 3ATDA 4HUMB 1KC5L 1JNNL 1JK8B 3DMMC 3C5XA 1QBBA 3WIHA 3T6WA 4HHAA 1OE1A 4G42B 2Z91A 3KMDA 5F9OH 1DVFB 4LARL 3ZT6A 3CU7A 1DSYA 1UA7A 4KO9A 1GGCH 4XPGL 3UBFA 2ICWA 4YHOH 5I9QB 4EN3D 8FABB 2A9AA 1RXLA 2FBJH 3DIFB 1A6VL 2VDNB 4K9JA 4XMUA 2MCPL 4EO5A 1XTLA 2NLJA 3HS8A 4WO4C 2Y7SA 3Q2NA 5KUKA 3VNZA 4DP5X 1I1YB 3TCTA 2EAEA 1JD9A 1PQZB 3DX1A 3HRPA 2VRAA 4DTGH 4Y1AD 3OQ3B 1V8HA 1J1OH 3DJTA 5J6SA 1G7LA 3KPPA 5AAWA 5DFAA 5C9JA 2CR3A 3VXMB 1Y1DA 1OAQH 2HFEA 4BGLA 1A64A 2QQKH 1L9SA 5I1DB 1FA4A 1G9NL 3CIQA 4ERSL 1A6ZA 1JTTA 3ENEA 1BEYL 1TJIL 2IWGA 3ASOB 3FU9A 4Q6YA 3U46A 4F8PA 5JHLL 1CE1L 1U3ZA 2BC4B 3C6LA 1FSKC 4N5UA 2BJML 1J8HB 1I9JH 1MLBA 3E38A 4FMKA 2AK1L 1H3VA 1QR1B 1FGNL 3I9PA 5GRJL 3RUGF 1CD0A 4E41D 5LGJB 2AP2A 4AQOA 5DJYA 4KKPA 4Y2OA 4HUUB 3SQBB 3HBPA 3DJSA 3MNWB 4OGAD 3QZWB 5E70A 1UA6H 5FUZL 1SXNA 3S6CA 3D9AL 2XQYK 4JFDD 1H5BC 4H2CA 5IIEB 4U1IB 4Z7OB 3PYCA 1HNGA 5E4EB 2EDJA 4QPEA 1QSEB 5K59F 2OMTB 2J1WA 1KPRB 4LRNH 2YN3A 2ZF8A 3CIAA 4OFKA 3KLHD 1RUAL 3IVKB 3O3AB 2Z31A 3VGGA 4M93B 1BVZA 5CD3A 3A4DA 5KVGL 4E41B 2QT6A 2VMEA 1MAJA 4E2OA 1RSYA 4OF5A 5JHAA 3WTTA 2AF2A 2B14A 4LSUH 5C2UB 5DJ0B 1QBMH 4LSQL 4Y2DA 4ZZKA 4ZFFA 2ZX9A 3OWRA 5B7EA 4H8PA 5EN3A 3WNOA 3D0AA 1S6NA 2OSYA 1OW0C 2J5LB 3QRGH 4OQTL 1PIGA 1RK1B 2EYRB 3NCJL 3RILA 2OJEB 4JG1L 4ZFGH 4G82A 4L18A 3MV7D 4GG8B 5TDOA 1DSFL 2A73B 4GG6F 3QRBA 2ED9A 3AG3B 5FYJU 3MN8A 4X8JB 1JPGA 2G2RA 5CR1A 4JMNA 4NNPL 4YEEA 2ALWA 1A8ZA 2Q8AL 1GY2A 2YO3A 2ENSA 2VMCA 3UAJC 1R3HA 4L8CA 3Q8FA 2QADD 5TK4A 1NANH 1UM4L 5AAPA 3TBCA 1W16A 4WO4B 1CYWA 1U2HA 2XG5A 2Y1ZA 2PF6A 3NPSB 5D7JD 5D2NA 4CNIA 1T4KA 2YC1A 2ZJSH 5F1IA 3OAZH 1OAKL 4XP1H 3U9WA 4UZSA 2X1XR 2LTQC 3VSVA 3FQWA 3WSQH 2GKIA 3LH8A 1JGDB 2ZYIA 5F3BB 4L3FA 2BSEA 1H3WM 4PWJA 4PGEA 1GKEA 1V54B 2BO0A 2QPUA 4EIGB 2O5YL 3BKYH 3D4GA 3GDBA 4G3YL 1YNTB 1KXVC 1T1YA 3QCUL 3QA3B 1DJWA 4MJ5A 1N0LA 4OZGE 4TMPA 4U0RC 4JVUA 1KT2B 1NLBH 3GKWL 4ZMPA 3GSXA 3KYOA 4FZ8L 4MCYA 4ZMWA 3TN0D 3OPUA 1MWAL 4JRYA 4ZW6A 1OM3L 1UB6B 2IQ9L 5CLTA 4B9FA 4OFDA 3LJ3A 2O6FA 1UWEH 5C8JA 1ADQH 4YHLH 1KLGB 2A9ML 3L7FA 4TTDC 2DMCA 4XNUH 3HMXL 4JRXA 3U4KA 3O2WH 4FE9A 3WKPA 1ZTXE 1Z9NA 1W80A 1WFOA 3KH3A 4OLVL 3VI3E 3Q6FB 1SMOA 1CYGA 1JWUA 3KPNA 3UPAA 4QY8B 5BRZB 4FXGC 3ES6A 2X0UA 1EEYB 1MFAH 5K69A 3IKKA 2OR8A 1NANI 4B41A 1JXGA 5I6XC 2ICEC 5JOPD 4P2OA 3UGUA 2ESVD 3L9BA 4AV5A 3IRCA 1NBYB 3OAWA 3UBHA 2ZKHL 3OAYK 3FRPA 1MCCA 4NN7C 5FC9A 3CX5J 5D7LB 3MXVH 1Q0XL 3LN5B 2DEXX 1HEJC 4KBPA 1LJMA 2D2OA 3VFSA 3IS1X 4FQXD 3RUGB 4H5SB 4NPYB 3RB7A 3B9KC 3DX2A 3WJMB 1Q9KA 1WA1X 3L4CA 2VDLL 3BE1L 5ALCH 5FYJE 5IW1B 1IT9H 2YZ1A 3GSUB 3IMSA 4UILH 2V9RA 5BMFH 1UB6A 3APMA 3GINA 2FX7H 3SDCC 3A47A 1JV5A 5KSAA 1IM3B 1OGSA 2R7EA 3LZQA 2XTJD 4Z7WA 4YFDB 5FDYA 3QEGL 5LWYH 1Z0MA 4H13C 4RAHA 3WIFA 2N0MA 3WKYA 4PRBA 4YFLF 3QNXB 3H0TB 2NQCA 1NLDH 2ICCA 4FA6A 3DI2B 2ZCKH 3WS3B 3ZKNC 5I1IH 4LKXA 3D06A 2FK9A 2RQEA 3KPSA 4HUXB 3S4SG 4OFVA 2AK4D 3VUAA 4NZTH 3GEWB 2V9QA 1MF2L 4AMKL 5PAZA 5MENB 1DVZA 3DURA 3IDMA 3ILEA 4NO5A 5DI8B 3M07A 2DYPD 5E1GA 1MRCH 4JO3L 5AW1B 1RPUA 1H3UA 4JHZA 5HHME 5KSBA 4QLRA 2JKSA 5HHXL 2F5AL 4E9SA 3KZ8A 2JELH 2XVKA 2JELL 5I1LA 3JQOB 4GSDL 3W39A 2R8SH 3F01A 1DSWA 2OMUB 4C57C 2LLLA 1N6QL 2CQVA 2WOBA 4BFNA 3G5XB 4H2AA 5BZXA 1NPJA 1I3VA 3OHXB 3FTZA 3THMH 4UMSA 3AY4C 3CFIC 4QHLB 3MRPB 2OI9B 5BS0A 2P5EA 4I18A 4Y16D 5JIKA 5FA4B 3FFDB 2IEPA 4M5ZL 2ZP8A 1CF8H 1J12A 3VW3H 1MZZA 2X4UB 3MRKB 4DKFL 3LAFA 3NIFE 3ZKSD 4WI8A 4PW9A 4MKTA 3UZQB 4ZOCA 5CFHA 5EO9B 1KTJA 5EUKA 4A04A 3LZRA 2APSA 4FNTA 4FXKC 5CS7A 4K8RH 2BNRE 4JPIB 3GSRB 2XU9A 3TVMD 1QFWH 1BVLB 4W6WB 4LHUD 3UIYA 5IJKC 4Y4KD 1IL1B 2RACA 4JHWL 3ZTJH 4NQSA 2A6DB 2BCMA 4NSKB 4QGTA 3ARDA 3DUHA 4GNKB 5TF0A 4DTGL 4QRUB 5I16B 1WAPA 2EIKB 5DLLA 4YBQD 5H94B 2VDRL 4FQJL 1A4KA 1RZGB 3EHBD 4Y2DC 1ZJBA 2J8HA 4PRNB 4Z95L 5J3HD 1NDMB 4G9DA 3UMTA 3L5IA 5GHWL 3VQ1C 4XZ4A 3QNXA 4BZ1A 3HI1B 1AZNA 5I1HH 2F61A 4AENA 4WEMB 2DQTL 4P3DB 1CJYA 2P24A 1J0JA 4PIRF 5GISL 4X4XA 1I8KA 3VCLB 1BQLH 2APVA 3NSDA 4KVCH 3SE8H 5H37G 3JV5A 4OIIL 2DD8H 3MXWL 3NGBB 4NKDB 3HLKA 4YUEL 2EVJA 2X6UA 3TEYA 4JY6B 2Z35B 1HI6A 4EAEA 5I2IA 4ZMTA 4UQ3A 4KH2A 5ACMA 4HXAL 1MRDL 1I3UA 2VN3A 3RDTA 2MQ3A 5EEVA 5I5MA 3EFFA 1VJSA 2WINB 3PJSB 1E8WA 1UURA 4YS4A 4L0YA 4NC2B 3QYNA 3DBSA 3GJEA 3AY4A 4JRXE 1TFHA 4OCSL 1M6UA 3EJPA 2Z93A 2DWTA 5DD0L 5CGTA 5BRZD 5ABDE 5F7WC 2YD6A 2QLVB 3I75B 1I9IH 1AD0A 3SGEI 3NJFA 1ZK9A 3ASWA 2V5MA 2P24B 4HJUA 4IEFA 3K80A 1EFXD 2FLBT 3CFJB 1E5YA 3KE0A 4ZQTA 4UQBA 4BINA 5DEFB 3O2DH 2G2NA 2Y1YA 4URKA 3ZYZA 1HILB 4MJ6B 1MFMA 1EXUB 2H0JA 1N64H 2V17L 4G7YL 2HWZL 4HLZG 4UNVA 3UG5A 3GM8A 2YAQA 4LARH 1GJUA 3HJEA 4HUWA 3AADB 3WIHL 3T2NL 2IPUG 1HQRA 3RFZB 5JYMA 4FOMA 1CBVL 5BVPL 3U7YH 5GSVB 3D6GA 3QWRD 1OAXH 4OJFH 1M4KA 3ZRFC 2X40A 2Z92B 1BGXL 3BKCH 4YIQA 4IRJD 1EFQA 3CVCA 3GSRA 5CJQL 1T0MB 4CADA 2GAZA 2IAMB 4ZDHA 1QZNA 1ZSDA 4MB5A 3OXSB 3JWOC 1XD1A 5CIPA 5I1JH 1A8JH 1C7SA 3QIBB 1OAQL 4MQXD 5D2NB 4D94A 3BO8B 1FZKB 4QHUA 3UC0H 4OLUL 2NTFA 1I85C 1NDTA 2NDFA 5BQDA 5I66A 1MCJA 4YAQA 3OAYH 3DXAA 2PABA 1KJ2B 2I85A 5CEZH 2VDRB 4BEIA 2A4CA 3DROB 4UTCA 4NYLB 4AGQA 2VLKE 2MOGA 1ITBB 3PHSA 2DBLL 1C16B 1FFPB 2MJWA 1HSBA 1MHCB 4YHMH 4BQ9A 2L7QA 4PJGE 5F7AA 2X4QB 2BP0A 4DVBA 4N8PA 3RWJB 1YRKA 1HYSC 3M1OA 2G4GA 3OKLA 4N1CA 4XOBA 4FJYA 4L0PB 3NJKA 4U0QB 4UYQA 3W0WD 3RL1A 5BV7H 3ESMA 5EEZA 2ISDA 1MAML 2FSDA 3RTQB 3RKDD 1GC1H 3W0WB 5F8RC 1E3FA 2L7JA 2F54D 2H47C 5LGHH 1H19A 1AZUA 1PZCA 3UAEA 4LRIC 5L7XL 2NYKA 3U6RA 1J87A 4OQTA 2HLAB 4OLXL 4Y1AB 2ARJB 2WSKA 3JT2A 4K9EL 1VFMA 5DTFB 5A3IC 3PAUA 2Q3AA 3MRRA 1RZ8B 1JFHA 2BIIA 1FVEA 1E4WL 2N1KA 4XPAH 1A02N 2X4NB 1P1ZA 4FCHA 2P8MB 3V4VB 4NZRL 4JGNA 4PM1A 3BIAX 4UI2A 4G7VL 1A65A 4I8DA 4LEXL 4CJ0A 3L3JB 2XY2A 4ELDA 2LGNA 2JV6A 4MBRA 4ZO8A 3GBLA 5FFOA 5I1AB 1FI8C 4S1DC 2F54E 2FLRT 5JW5B 1VZIA 2D3VA 2X1OA 1EZVY 3FQRA 4JDVA 5CKGA 1NMBL 2A83B 1DCEA 4UOQA 2NY3C 1H15A 3F7YB 1DCLA 3MJWA 3A6BL 1JNLH 2F58L 2VABB 3KJ6H 1B0GA 3MR9A 2JLLA 1NCCL 5LUMA 3NCJH 4L2LA 4MQ7B 1N7ML 4Y4FA 3T6XA 2VXVL 2WOYA 3TFKC 1S7UA 3HI5H 4PJFB 4WSKA 2VH5H 5E95B 3VFMA 3RA7H 2F7IA 2DTMH 5E8EA 1TMQA 1U93B 5IV2A 3VDCA 3L4YA 4ATWA 1D6VH 1TQTA 2X2UA 4UBDC 3TBBA 2HPOA 4NGHH 5DRXA 1YDPB 3ARED 1KXHA 2EDEA 4W4NA 1JAEA 4IJ3B 2LOEA 4APQB 4EUPA 1J0IA 1DBMH 4M3HA 3W39B 4CBZA 4EIBA 5I1LB 1L0QA 2GTZB 1KJVA 3JTTA 5EU3B 2VRKA 2F8OA 1R9FA 2HFGH 3ZTDC 4DH2A 5F93C 4L1LA 2D9CA 4KKLC 4OF8A 5HI3D 3WTWA 3Q44A 4ZFZA 1UHVA 3LRSA 1FO0L 3S88H 2VDQB 3H3KA 3BGMB 4PTUA 1LK3L 3DTUB 5EO0A 4ZDHB 3WFHB 1PVHA 5ANMB 3QJOA 4XC1L 1I8LC 1NAMB 2NNXA 4OT1H 2QVMA 2QSTA 5IG7A 3N9GL 1ZTXH 4GPVA 1DVUA 2H4EA 1P5UB 4N8CL 5F88B 4R4FL 15C8L 2EEXA 3ECQA 4NDMB 5GJSL 1ASQA 1FDLH 4L0ZA 4QWWC 3CBRA 4YDZA 4YDKL 3MI6A 2Y07H 5LB1A 3WN5B 1EFXB 4APXB 5CN3A 1FC1A 4P9HH 4XWGL 3HZKB 1KIPB 5F3BA 3ULSB 3FSVA 1LILA 1Q8MA 3N44F 4J8RB 2ADFL 2BDNH 4P46B 2OI9C 5DVOA 1SY6H 5KVGH 3QYCA 4R0LB 1A4KB 3FPYA 3FUJA 1JGVL 4GFXA 4C4BA 1JZ7A 4QRPA 1MUJB 4FKEA 5C08E 1F11B 3DECA 1BAWA 2X87A 4R26H 1ECZA 3K71B 1MJJA 1FNEA 1S7RB 1WITA 1X5XA 1RJZA 3MV9E 4K5LA 2YRPA 1ZS8A 2QVIA 3D69A 2ZUTA 4F7TB 5IEKB 2BJMH 2PCFA 1SN2A 1CTNA 1F4WH 1I4FB 1BXAA 1ZA6B 5A2LH 3MRGA 5DVMA 2NSXA 4U6VL 4K4KA 5EOQH 4N0YH 3U4AA 3B5HA 3V4LA 1HVXA 1GIGL 1WRFA 4OLYL 4CC0A 4XNYH 1ZGLB 1KYOK 1IFRA 5AZ2L 1R33A 4OGXL 1U30A 3J27A 3P3SA 4J8RA 2NR6C 1QMUA 3O6LL 4P2RE 3FT9A 5KYWB 3JZYA 1C7TA 5EU7E 4FFVC 5I8CB 2JI2A 1DO6A 4BSJA 2VDPH 2AJXL 3BYTA 1KB5A 5F6HJ 4FD0A 1OSEA 1EZSA 1T3FA 1WEJL 5AKVA 1W8NA 3JV4A 3BQUC 1G7LB 2OSXA 3KPPB 3FW6A 4JFFE 1OQOA 2CIKA 2D7MA 2IOIA 2MCAA 4AKOA 2A1WL 3QISA 1JGDA 4JZNA 3VFUA 3R1GH 2RMNA 5BO1L 3ZDWA 4P2RD 1TXKA 5BO1H 1X9LA 4LSVH 4V1DE 2WANA 5AYTA 1KBGL 3T4AB 4GSDH 3FN3A 3JWOH 3NUKA 2K4AA 5TH2B 3Q5YA 3UADA 3W11D 3PLYA 3ME0A 3FCSA 2P8PA 1VENA 2P7TB 5B3SB 4UU9A 2HKHH 3HG5A 5E6IC 4BZ1L 1TR7A 4G71B 1QLEL 1MKFA 1XXFC 3QEQD 4XVJH 1WCQA 1DBBH 1W0VB 3VXSD 4NBZB 4XBPA 3BFWA 4DW2L 1XZ0B 1CICA 4LPUA 2HX7A 3KJ4C 4X9YA 3S8WA 1Q72H 1INQB 1RUPH 2H7WA 2NQDA 4OU3A 4V1DD 3TA3C 2BX5A 3L1EA 4Y5XC 1A4BA 2EDWA 4DQOH 4HDIA 4F7MB 4ELMA 1JPST 1XR8A 5HYJD 2FLMA 4NQQA 1G43A 1ZXQA 3LZOA 4OAWB 3DX6B 3LPOA 1XGZA 3O3BB 1WIUA 5E00B 1KJMA 4QHMB 5EPMA 2R9HC 5DMKB 4B9ZA 4F91B 2P4AB 4M1DH 3C6EA 3MTRA 3K7UA 4FJ6A 2QHRL 2PN5A 1BPVA 3L5JA 4RFNC 3IMBA 1IAKB 3QEQB 2FD6H 1TF4A 4B3EA 1Q9OB 1JGUL 3CXHK 3FT3A 3Q3GA 1JN6B 2BHZA 2H5UA 1FL3A 1X44A 3GXTA 3GLDA 4HWBH 1QATA 2A77L 5M7QA 3C5ZB 5KSBB 3FU7A 4GRWE 4QXVA 1DVTA 5FXCH 3MXVL 5JZ7C 2IBBA 4KJWC 4PLNC 3C75A 4ES9A 4Q89A 4ZX4A 3O4LE 5C0JA 3WJLA 2L8AA 1JZGA 4I3RH 3JTSB 1E67A 5I1HL 4FQXC 3TNMA 2I5YL 4YHML 2FB4L 1F3JA 2I07A 2X1PA 1AGEB 4HJJL 1KTLA 4AH2A 4PSRA 2XQBH 1NSNL 3O4LB 4Z3FA 1XIWC 2FECI 1PEZA 5E56A 4XHQA 4OV5B 3UYRL 2VXQH 3MRLA 4Q56A 2BIPA 5GS0D 2V3FA 4OFYA 4JVPA 4ZO6A 5GRUL 2XN9A 1ET5A 2XTJC 4X5PA 2EADA 2VIRA 2QMJA 2QFPA 5BZWB 4PMFA 2VLKA 3LQZB 1NMAL 4IRZH 5D7LD 1OWWA 3X11B 3DOSA 1L7IH 3FYIB 3P77B 3HMXA 4NXSA 4X4YB 4R83A 5LNDA 1SUHA 4JM2B 2AK4B 4JO1H 4FFWC 2ODIA 1KWGA 2DQ6A 1VSCA 4NQED 4TSCL 3L17A 5C3IA 4NI6A 3NFNB 4OM1L 4AL8H 3MUY1 4ACTA 5TF1H 3ATEA 3CLEL 2NX5B 4WUUD 3HAEA 4PJXE 5AAWC 4DERA 2ADGA 5IJCC 1AHWC 2FCBA 5DRWA 5B1JA 4PJHB 3UP1A 1CI3M 4OIAA 3FS9A 3I02B 1DVFA 4HOZA 43C9B 1GOHA 4YIQB 5D5MF 5BRZA 5KVGE 5DRNB 5EORL 3U4BH 5IVOA 5KJ4A 1R34A 5EBMB 1QSFB 2YJLA 2JIXB 4HXBH 1R47A 4HZ1A 2C34A 1I85A 1UFGA 1SOKA 2HT3C 4NJAL 3PDDA 4M6ML 3EFOA 2KZKA 4N6QA 2ZX7A 4FQLL 2E9IA 4ZPTA 3NJVA 3ROLB 1YUKB 1J05B 2K6YA 4N5ED 1CLVA 1SHMA 2GJJA 4R3SB 1QTPA 2R23A 4FQ2H 4RGOL 4YE4L 4OZHE 2Q76A 2GSMB 2V9UA 5M94B 4FQPA 1ZLWH 2J1XA 1D5IH 3NCYS 4QT5A 3MV8E 4BSVB 5L4MA 2HAZA 2UWEB 1AG6A 1UB5A 1ADWA 2WVVB 4JBSA 2E6JA 3CFCH 3F00A 1P4UA 5EH1A 4LHUB 4JY5H 4ZUVA 2MEJB 2Y0SA 1I3RA 3ZU8A 2R2CA 4ALAL 1IC1A 1FGVL 2J88H 3UPCA 1AMXA 2OCCB 1JWMB 2CIIA 2WJ5A 5IQ9B 1BQLL 2GT9A 5I76B 1CWVA 1I31A 3U7WL 4DHLA 4K3DL 3I85A 5AZEL 1U91B 3ARBC 5FKPA 4JJOA 4C58B 3S9DB 2UZIL 4PJBE 2M2DA 3RBGA 3VA2C 1GAFH 3RVUC 4B7IA 1NOFA 3LIZA 4QJ5B 1AGCA 2OJ1A 2W60B 3B7RL 1CLCA 1AKJD 3RWGB 2CM5A 2YPLB 3IJEB 3UBXI 4Q6IB 3X12B 4M7JL 2P5WA 2WLNA 2NYYC 1SBSL 3A23A 4I3SH 4PHZA 3P3RA 1UQSA 2CHWA 3UBGA 3JWNE 5E03A 1LP9F 1WK0A 4A6YH 1H9VA 4X7TB 4ZSOB 2ICEA 1P7QB 2AGJL 4H25B 4U3CA 4HUNB 2Y36H 4QDGA 25C8H 5HVWA 1KGXA 2GW5A 4ESKA 3UCRA 5D5ME 2HJLA 3CC5B 3JYCA 5ESQB 5D1XE 3II1A 1R5VA 1VFAA 5CD5D 1CE1H 2WWOA 4PRPA 5MEQA 2H1XA 3ZO0A 3UPRB 1UJ3A 4ENZA 4KFZC 4ODBD 2P1YA 1O0VA 3DX8A 4KMTH 5FWRA 1NBZB 1RMFL 5ECJE 1J0YA 1OALA 1RZIA 5DQDL 3EBGA 1KJ2L 3BW9B 4PJIF 1BVLA 2KMWA 4UM8A 3QQ3B 2FATL 4GQZA 1IQWL 2O6CA 3QQ4B 3NOIA 1XV8A 3BEVB 1E4JA 3ESUF 1UH4A 5DHVH 3O9WB 2BNUB 4JM4L 3RNQB 4FS0A 3QEUB 3RI5K 4O2FA 5IOKA 2BH0A 4HJSA 4NOBA 3QFJA 3GZOA 1WEJH 1DBML 3ZQXA 4IOSA 4X6DF 4N2OA 1C5DB 4CSSA 2YQGA 1OD9A 4OSUH 1Z9MA 4A7GA 5IMOB 5K9OB 5CINL 3ZY7A 1ZLWK 1IGJB 2EUXA 4R3SA 3BKMH 4IK7A 3VG0H 3LKOA 1ZRUA 1U91A 2CJ3A 2D3JA 2VCOA 4NAQA 1LK3H 5FKPB 1D7FA 3PP4L 3SDYH 1G87A 2G9HA 1SN5A 3EJYC 4R7DB 5D5MB 4Y5VB 4PLJC 3BUDA 1J11A 3MLYL 3L3HB 3H9SE 3PDGA 1UOVA 1U2CA 4PJAE 4IOIA 4TRPL 3ARGD 5J0BA 4YSUA 4X4KA 1ANUA 2IQAA 5GJSH 2PYFB 1NC4D 1W8OA 2P49B 3GNML 1OXYA 3W2DL 1QP1A 3Q5TA 4P5MA 4KQ0A 1P9MA 5AWNH 4M8VA 4MA8H 3UTQA 2ADGB 5EIIG 3VH8G 3E8UL 3WHXB 2Y5TA 1R24B 4QO1A 3WFBL 4X6FA 2VL4A 3U1SL 1H0DB 3IJ7A 3UJIH 2XWDA 2AQQA 3EF7A 4QEGA 3WXVH 2Y7NA 1PLCA 5D9SA 4XRCB 2E59A 4JHUA 4K7FB 2WLMA 4LAQH 4WWKC 1C5DA 4UMGA 4Q9BA 3D39B 1EHXA 1ZIBA 4DEPC 2QVTA 1U8MB 3V9EA 1T2XA 2AVFA 2FWUA 1TUPA 1Q1JL 2YUZA 4OZGA 3DPDA 3O9WC 5DD3L 3TH3T 2XIBA 1IM9D 5E6RB 1TJIH 1F3RB 3HN5A 1P6FA 2NY5C 4GUCA 1HJCA 2ZKMX 5TE4L 1IKFL 2VLLA 1XF4B 3GBMH 1EX0A 3EO1B 3FTXA 4HYTB 4NT6B 3LNFA 4AT6B 4O5LH 4WUUA 1QPPA 4CVUA 3C8KA 1ZS8B 4OV5A 2DBLH 5FHBH 4FFYH 1OGAA 3M6DA 2CKNA 2AJYL 4NRYA 5LG1A 1CFSB 3OZ9H 1NCWH 1T83A 1S9XA 3EYUL 2OTWA 1XGUA 3CZKA 2IH1B 2WYIA 5EF0A 3ES6B 1M2VB 1N7MH 1T5WB 1MAKA 3WY2A 4JM2C 1RUMH 2P26A 4Y5YC 5E1IA 3TCXA 3TFKD 5D7JA 4PREA 2DY2A 5G5DB 2ESVA 3CUPB 4RCAA 1SXSA 1A6AA 3MYJB 5GRUH 3STBA 2G4EA 1SLXA 2BSRB 2D03L 1EJOL 1L7TH 4NQCA 2YMOA 2ZG2A 4YFEA 2WQAA 2WVTA 3V7MA 3VXMD 4NZRH 4MMYB 4C83A 3KS0J 2W9DH 1K8IA 5SX4I 3VXRB 1J8RA 3QS2A 4LVEA 4G6FD 3DYMA 4TNVF 4QR7A 5I6KA 3CAFA 3I02A 2H8PA 4WENB 1BD2E 3OM3B 4K5MA 1NFAA 4A7SA 5DRZA 1WFMA 1J18A 2N56A 3CQQA 4PJ7A 2C1OB 3FN0H 4H44C 2AV7B 4FN0A 3KYMA 1YQVH 4L8DB 3H2QA 4U1GC 4WRLA 1JTPA 1DSFH 1YMHB 4OCNC 3VXME 5EZLB 5FM5M 4G6JH 4UIKH 3SY0A 1WDAA 5TFSL 3QCVL 3AS2A 2P28B 1KYOJ 4V1DA 1WD8A 1T2QH 1OEZW 4TOYH 3VSTA 4EI6A 5GS0H 3Q3GB 5L8KB 3AABA 5FOBB 1FDLL 2G3ZA 5GIRB 3NDZE 1IC7H 2W65A 4TPRL 1AXTH 1K4CA 3EYOB 4OCYH 1CDJA 4QOKA 5J8OA 1FLRL 5D2NC 4WLCA 5JYLA 4I0PB 4DO6A 1SRDA 1SXBA 5DJCB 1JDDA 1DDHA 1SY6L 4TSAL 1L3WA 4FAAB 4P46D 4HMEA 3S88L 3MLPA 4PB9L 2HLEB 2OTUA 3NIDB 3CJJA 1RZKL 4BFGA 2F7PA 3ABZA 2NUPB 4WDIB 2CBPA 2WIMA 3QSKB 2KBGA 1VADB 4LQ1A 3DBXB 4C56D 2A9NH 1BW8A 1GZPA 1NCNA 2XX1A 4FG0A 5IP4A 3I9AA 3O0RH 1UATA 4ODVH 5INDA 4C56B 4FG6D 2AABH 4Y4HA 3S3SA 3BI9X 2XQBL 1HL8A 4GIPD 3QUXC 3LB6D 4OZIE 2X3AA 4EXPX 3C12A 1QRKA 2VDKL 4FYTA 4FYRA 4HH9B 2X9WA 2RFXA 4FTVD 2GCYA 4GG6B 2FBOJ 2ADFH 2BDNL 3EJSA 2CPUA 3RTQA 5J12B 1ZXKA 1CGUA 4EI5A 3VFTA 3BH4A 2ICEB 3BMVA 1U8HA 2XZCH 3VRLE 3QZWG 4HSCX 4Q7DA 3VFOB 4DP0X 4AQAA 2G5UA 1NOLA 3O8XA 2QSCH 4Q6IA 5AG9A 1I1AA 3QWOB 3RHWF 2FO8A 2VIRB 1B0RB 1QFUH 4A7TA 2AVGA 3BWZA 5IMMB 4GUPB 4BM7A 2DWDA 4Q74A 3O6KH 3C9NB 1S78C 4GAYB 4NPJA 1HEZA 1QLEH 3FT4A 4AQ1A 4Z95H 4MCMA 5B3JE 4F80A 1JDCA 1YJDL 3BX7C 1DQJA 1ROCA 4Y7MA 4C4KO 4EDWH 3NVQA 1YMMD 3QDGB 4WJKB 3WDJA 4F8LA 1W72A 1IBDA 2CBMA 1HE8A 4HIPA 2PO6D 4MQTB 1LDPH 1WICA 2ZOLB 4Z18A 5HHVH 4QRBA 5SWSA 3ZUNC 2YD8A 1OAZL 1M7DB 5TJWK 2BP5M 3MRBA 4KTDH 2EDXA 4HCFA 4GBXD 1OSPH 1WS7A 3INOA 4NZ8A 4R6UA 2EO7A 4UILL 2ATKA 2CD0A 1E42A 3T77B 2OMYA 3H7LA 4YX2L 3ZRSA 1HHIA 2NCMA 2ZPKH 5DQJA 3D2UB 4KUZH 5EOCH 4ZTEA 3VYPA 1KWKA 4U1JA 5TDPA 3WTUA 5EB9A 1EXUA 2HTLD 2IOMA 3AM8A 7PCYA 1KMGA 4GW5A 5KYYB 5EU3A 4TKWA 2BP8B 4ZX3A 3GKWH 1JMXA 3V95A 3SQOL 3LZFL 3WNJA 3K6IA 5C0EA 3R18A 4ZXBA 4P59L 4MD4B 5B39A 2B8OT 4WKXA 1M7XA 1QSFA 5I8KH 3SGKA 2YSSA 1CDHA 4UANA 3HUJB 1BM3H 4PTTB 3HB3B 5FOJA 3RL2B 4AQ8C 4G5ZH 3D3VE 1HL4A 2ETWA 1EGJA 4Z7UB 1RZQA 3HRZB 3L5HA 4QOKE 3OMNB 4M5ZH 1LEKA 3IGKA 3NJLA 1AQ8A 4S1SL 1RPQA 2AXWA 4GQQA 2EH8L 1KJ3L 3NZHH 2HUHA 4M61B 3WFCL 3U2SA 3WNMA 1DBAH 1XT5A 4OD1H 3BSHA 3MOAH 3U1PA 2VDKB 1PG7X 3HCVA 3LMJH 3FUKA 3LY6A 4P3CL 1MCBA 5DUPH 4FQIL 4UOW1 5C0CD 2CO4A 4KKLD 3SKUD 1E4KC 4D9QD 5FB8A 2CRMA 3AG2B 5DFWH 5I0ZA 3BZFA 3LZNA 2NZ9C 3PWNB 4E36A 3Q2VA 1O6SB 2O5ZL 2DI7A 1T04A 3U30B 1MFAL 4QOKD 2WUBL 3VD1A 5EZJB 1HWWA 3EYQC 4U33A 3QUMA 4HG4J 2A74A 1KXTB 2AZUA 4D7PA 1E3ZA 3IFPB 1JFQH 1YUHB 2R27A 2Z1KA 3B5TA 1IT9L 4OLWL 1AOHA 3GF8A 4Y5XA 4M3JA 3RWCB 3SPVA 2R23B 3A21A 4IBLT 4OLUH 5KYXB 1NCGA 4PJGA 4XPBH 4PHXA 2BOCA 3CDFA 4LL9A 2GFBB 4Y4FB 5HHPB 2Z64C 4PCKA 1JXDA 3HZMA 4W6XB 1SXAA 1RK0A 4LPWA 5BRPA 2XCMC 4MNGA 1G7QA 5KVFL 1AZRA 3MOBL 3U7AA 4PREB 5L0QB 3VXUD 1DJXA 2YN5A 3EKCA 4JRFA 2DD8L 2WZAA 5EBMA 5BUAA 3GSVB 4F5CE 4WHCA 2ZUXA 4DKTA 3C5ZA 4R2GB 1GGIH 5C0IB 5HYSA 3FQUB 4MD5B 3LKOB 3S2AA 4HIXL 4TSAH 1SDDA 2X0VA 1MRCL 3U2IA 2ROXA 1KCSL 3GTVA 2GK0B 5L7XH 1RV6X 1MG3C 3TTSA 4IBYA 5IJDC 1EMTL 3GMMA 2EUZA 3BH9A 3DVGA 2FO4B 3QPXL 2LU3A 5DCCA 3ZL1A 1BX2A 4IIQA 2EJ1A 2QQLH 3OGCB 1MI5E 4HKZB 4LLWB 2O5XH 1S7UB 1A5FL 4FQ2L 4YE4H 1I9IL 4PJAA 4PJ8B 3NP3A 4QJ3B 1WBXA 5C0AD 3D39A 1J5IA 6PCYA 1GZHC 4RSVA 2TSAA 2VXTL 1HSBB 1MHCA 3MRMB 3QXTA 3QC6X 4WEUD 2XTSA 4NDMA 4XGZB 4KHXH 1CBJA 3JBG7 1CDGA 1J7VR 3DXAB 2EYTA 3DX8B 5LBVA 3OKOB 4GRWF 4TLUA 4NWTL 5EWIH 3TZVC 2LR4A 2R1YB 4MTMA 1KGIA 2VL5A 4ADIA 4ZFQA 3PWPB 5HYSG 2E56A 1CUOA 1E90A 4PWIA 2J20A 4UAOB 4F2MB 4JEGB 1KGJA 2ILLA 5H8DA 2ARJA 3LRSB 3MCLH 4FMVA 3UTPD 1OAXL 5LAXA 3Q9PA 3F7QA 5DD1H 4U6XA 1E7UA 3IDGA 1HTYA 2Q1EA 3GK8H 5E2TH 3CQPA 4PRBB 5DC2A 3SOTA 5CJQH 2NR6A 2W92A 3S37X 4U3SB 3RDJA 2GEEA 2XWBB 3GBDA 2XRAH 5IVXE 4QRFA 3E6FB 5L8LB 1QYGL 3MRMA 4A6YL 4LE8A 2A74B 5DS8B 5AW7B 4ZRGA 1XMEB 4J3SA 4EJ1C 3HNSL 5DDHB 4RFEB 4A2EA 4KK6C 1NINA 4Z7OE 3REVA 5F7HA 4RRPG 3RX5A 4FI8A 3QZPA 5LJYH 4Q9QH 2DQCL 4R4BB 4ZPVB 2Q2EB 2ENQA 5FO8A 4LCWA 4JFVA 2E9GA 1D5BA 1WP6A 2I60L 1T7XA 2XVBA 2P47B 4PJDB 1IC4L 5CXPA 3VWKD 4ZNEE 1IBGL 2ZXAA 4H26B 3IMVA 2GAZB 5FO9A 1IBGH 3VXTB 3M7FB 3B2VH 4QXTA 1KJ2H 4PJCE 2Y1AA 4XMPL 5I8OH 1QRNB 3PWJA 3MFFA 4ONFH 1ASOA 3Q6FA 2XPGB 1MJJB 4UB0H 2IAMD 3ZQ9A 3UBXB 2EDQA 2NXZB 2Q76B 4KJQD 3TJPA 4TVUA 5CFAA 1OCWL 1PZUB 2C4FU 2SEBA 4QD2E 4ZX5A 1PZAA 2PCPA 4NRZA 1V3LA 3QUKA 3K74B 4FXTA 3A0OA 3ARXA 2Y72A 1BSIA 2X5PA 3ARYA 4TVPE 2EC8A 2HRHA 4MA7H 5AOMA 1RK0B 5AVZB 2NY5L 1CPUA 1IU1A 3BP5B 1JI2A 4H8WH 4BSWB 4P4KA 1TZ8A 4H8WL 1KN4L 2RBLA 1EPFA 3RX7A 1Z5LB 1NCHA 4NWUH 4Z7WE 1NMBH 3GMLA 5T3XD 3CPLA 3QQDA 1N9PA 1TQBB 4OI9A 4S0TD 3DETC 3RL1B 5H35A 2W1NA 1UQSB 3S0PA 3UTTA 2FJHB 4P2CG 2WN2A 4QTIH 4V33A 3T3ME 4XOAA 1VCAA 2C7UA 5IMLB 5DMGD 3W2DH 1D5BB 1OOAA 4WI0B 3V0WH 2NZ9D 2NY1D 2XX0A 1F90L 2R2EA 3VM5A 3E8UH 2NW3A 5E2WL 2HRPH 3B3IB 1J1PL 1KFAL 1YNLH 2ZG3A 3SYAA 4ZTOH 4IBUA 2YXFA 5KSBE 5FCSH 2QR0B 1U95A 4KTYA 3FBQA 5IQMA 1BVKB 3FT2A 3Q05A 1ICTA 1DEEA 4FF9A 2CRYA 3BLBA 2ZWNA 4BZ2A 5AVVB 3QVAA 5B21A 4I2XB 1YQ2A 1E27B 3OJVC 3GBEA 4G8EA 3V5HB 4WKZA 2Y2YA 2PPDA 4U1NB 4E68A 3BT0A 4G1MB 2OMWA 5IQ7L 4NNYB 2VDMH 5JHLA 2TSBA 4ODSH 3LH2H 3VI3A 3ERXA 3LYRA 2YAHA 3A4FA 1OTTC 3AB0C 3D85B 3L9RB 3POHA 4A7VA 5A7EA 4CJ1A 4IS6B 4F93B 3EDFA 4UTBA 2AJSH 3K6SB 3DGCR 2V7NB 4MMYA 2VSKB 2ZWKA 1LP9E 1JPSL 4OF0A 4OW6A 4Y2LA 1ZVSB 1SNRA 5SWZD 2WP3T 4QHLA 2GJPA 2J8UA 5TE4H 3BN9C 4XPTL 4Q9CA 2GI0A 2V8MA 3N85L 1E9PA 1XEUA 4MAYB 1ACYL 5T5NF 1KENL 5CZVH 2FQGA 1N68A 4K8RD 3BWSA 1Q0EA 4I1NB 1ZKAA 4HIEA 2EDLA 2DQHL 2VZUA 1V3KA 2YK1L 1Y18B 5F6HI 5EEYA 2FH6A 5DWUH 2VW4A 2W0KA 3IVKA 2AITA 3SHSA 4ELKB 5LDUA 4F1SA 3U1SH 3MOAL 2CR6A 2GJZB 3MACH 3NIFB 4XVOA 2ITEA 4QIRA 3ZMRA 3I6SA 2GIYA 2UY7A 1KACB 3AJ7A 1DJIA 4QKTA 3WFHA 2ZOLA 4WNQA 1GH7A 1RK7A 3HA0A 3M88A 4HC1H 3Q1SH 4XMKL 3QR0A 5HJGA 1NKOA 5AW0B 3O4OB 1QWNA 1SN0A 3T0XA 4ANUA 5T33H 4NZUH 4KPHL 4AUYA 1KELL 4YDNA 3X1EA 1DUZA 1JGUH 1MVUB 1ZPLA 1P7QA 4H25A 1GSMA 3FPXA 4JRLA 4NC1C 2HFFB 1NAKL 3MV8A 1T7ZA 2FGZA 2Y7MA 1IGTA 5ESVB 2F1BA 3KAAA 1OPGL 4N90D 3I9GH 4JFEB 4JRYE 4M1CC 3ZZLA 1NIBA 1OPGH 4OFYD 4WO0A 1A6TB 4DGYH 4P4RA 3VXRD 4UT7H 3VFRB 3KYKH 3P9MA 4GS7B 3CNKA 4PWKA 2GY5A 5C07B 4DCQA 1M6OB 1R24A 1V7NH 4J27A 4X4ME 1KTKE 5IV2B 5F9WC 2XNAA 4UU9B 1MCHA 3NCBB 1EAJA 4PG2A 2VUOA 4RAUA 4XBGA 1G7IB 3MLUH 4JL1A 2N4IA 5F7NC 3V0AC 4TPRH 4JFZL 3BPCB 4FTVB 4N90E 5GRJH 4BZ2H 2CG9X 1D5MB 4ZI8A 3E3QE 4BQ8A 1H8OA 1T2QL 4TOYL 2MCMA 2WZ0A 3II2A 4PJXF 4KKAC 5FECA 3C8DA 3FB5A 1MJ7L 1NGWA 4NUJB 3NCEB 4P57B 1CDBA 3MJ6A 4N2MA 3IJSA 3L2MA 4PB9H 4OZIB 4LCYA 3SJVE 3ATFA 2YKLH 1XGQB 3ARSA 3ULUE 5T1KA 5CU5A 3RWFA 1G9ML 1GXEA 1A7QL 4PAZA 4HJEA 1UYWL 2X53A 4O02L 1IAKA 2E7DA 1FO0H 4W9ZA 3V4VH 4OM0L 5E5LA 4DJMA 1IGIH 3SDAD 4LBAA 2XNAB 2F9BT 4BCYA 1DANT 3LNEA 4DP1X 4FQXB 3GGWA 4DCQB 2FR4A 1NCBL 3O11B 4O2CB 5H2BB 4UTAL 4F33B 1XD0A 5EN2A 5T1LD 3SGDI 3ZIYA 5DGRA 4JQIL 2G0LA 3HUJA 4OCWL 4ZUSB 1QNIA 4M8QA 2BNQE 5IEKA 4O9HH 5IM7A 2P3YA 4GP5B 5K9KA 4LK4A 5J5EA 4RMBA 1XX9C 1RK1A 1IKNC 2X2HA 1QLRA 1UGKA 1MVUA 2H9GA 2UZXB 2F68X 2O61B 3K46A 3V79C 4EI6B 1CFNA 1UG9A 5FGCB 1X6NA 1FFOA 1VGEL 4PW3A 3N1MC 4NKIL 5ISZE 1E30A 2CA3A 4JB9L 3BDXA 3IDNA 2D7TH 1SQ2N 1P4BL 3QIBA 2WC7A 2CLVB 2M1KA 3RDTB 1A66A 3EJYD 5IFAH 5EV7A 3CHQA 1B4TA 1QVOA 3CXFA 2DKMA 2OV0A 4OZGB 3DSNA 3L8QA 9CGTA 1RZKH 1QUNA 1GIGH 3O3AA 1QYGH 4GYBA 1MNNA 2XN2A 4ZMAT 5DMIL 2MIZA 3QZOA 3VCLA 5IUSA 4JFED 4Y8AA 5L2KA 3FOLA 1F4WL 4HEMA 1A7OL 1VZGA 2ICES 3APDA 1HN1A 1HCFX 3D34A 3CSGA 2PP8A 1MW1A 2NOYA 3UROR 2E7BA 4GAFB 4JFDA 4ODVL 3ZMNA 1P7HL 2ED8A 1YEGL 2J71A 3ZOAA 2EH7H 4PGBB 5F7EL 3UEZA 1LGVA 4ZUWB 5IQOA 1M7IB 1AGDA 4OGXH 1WAEA 3BUQA 3L95B 5DEFA 1NCDL 4NQUA 2OYKA 3IPEA 4GAJL 1E8ZA 4N8UA 1XO8A 4LPCA 3IBEA 4E41A 3HE7B 3MREB 3U0WH 4UQIM 1DBJL 3MLVL 2A6DA 2W80C 4LSVL 2EYSA 1MG2C 3C6LD 2X09A 2FL5B 3L3IA 4ZD3L 2FNWA 3RB5A 4AYDC 3EYVA 2HX9A 4J3XA 4OUUB 5DYOA 1SPDA 4EI5B 4GBXA 4M56A 3W1ZA 2DF3A 4PY7A 3RPBA 4QCIA 3PG2A 2ZIDA 2QVKA 1JWUB 35C8L 3EO1A 2BP3A 1E6JL 3NFSH 1Q94B 3IFLL 4JFXA 6FABH 1A3ZA 4X6DA 3FAWA 2ZXDA 3PL6A 4P07A 3HVNA 1HHKA 4K2UL 1IEAA 1KF9B 2ZOTA 2YPVL 2XN1A 3HHMA 5C0BA 1AI1L 3O9WA 1U3HC 1T1WA 5C2BH 3WFCH 3BVXA 1TENA 3KXFD 4X6DE 4MQ7A 4MS6A 3JVGA 4UCFA 4JUTA 4MSWB 5ITBH 5F7UA 4LBEA 4BHUI 4OY9A 5E8OA 1E28B 4EZLA 1TQVA 3G6AA 4TTGA 2AKRA 1F1GA 1I53A 1PKQA 2G75B 2R51A 2YXWA 3DV4B 5IF0B 3T0EC 4BFKA 1LO5A 4QRAA 1GC1C 4UF7C 4UQ9A 4ZTOL 4OZIA 1I7RA 3WDIA 1YY8B 2FT8A 4O58H 4R5TA 5IEHA 4QTHB 1OHQA 4G8GD 5CN1A 2H32A 2DQIL 1NH6A 3NEEA 3PDOA 4GRWH 4J3UA 1JOIA 1DQTA 3PIQA 1NUDA 4P2QD 3IJHB 1RZGA 1INEL 1X7QA 2QMKA 4OIBA 4UQDA 4MKMA 1HOEA 4I77H 1UXLA 2QV2A 2WXFA 3J7HA 1TDQA 3OAUL 5F7LB 4G6AD 4K7PH 5CUSH 4F9PC 2BVQB 2OXGB 3T8VA 2ITFA 3MBEB 1P4LA 4AEIH 1G9EA 2WVUA 4NJ9H 4PJAF 3UG3A 1OZUA 3K6DA 5JNYA 4X99A 3FHAA 1JK8A 1PFCA 3QJRB 4IKIA 2GUOA 1HYSD 3T0EB 3NCFB 4F7CB 2OXHA 1LYQA 4FXKA 2IG2L 3ZYIA 3IMUA 4XNZC 2K6WA 5HDBF 3WN6A 2X9XA 1WZKA 4GG8A 2PWGA 5DRXB 5AVRB 2VQ1B 2M83A 3GNMH 3CLFL 1TVBB 4DKEL 1IC4H 3A67L 5ISZB 1MRDH 4Y4FD 4PJIE 3VU2A 2IH3A 1Y07A 2CJUL 3MV9D 4K3EL 4PMEA 5DZNA 1OB1A 1PQZA 1U33A 4U4IA 1UA3A 3NPSC 3THML 4EUPH 2DL2A 3MJ7B 3NQIA 3SKMB 3S5LB 4OJYA 3FSWA 4K15A 5CCJA 3QQ4A 3OKEA 1QA9A 3RWIA 1YEIH 3QHFH 2J72A 3KNBA 3ZHFA 1B0IA 4LHJB 1RL1A 1ZVHA 2L7UA 2XG4B 1Q1JH 4U6XB 2ZSVB 3FT1A 1BHGA 3ARTA 4JDEA 4N2DA 2Y69B 3QUZC 5IB1A 3DPBB 4PJ9D 4TF4A 2C1PA 2Y6SC 3B2UD 2YEQA 1GJWA 2D3NA 2ENYA 3BT2L 4M7KL 3TT1L 1WG3A 4LIQE 3W81A 2OL3B 3B7SA 4HUUA 2IJ0C 2HWZH 5GXBB 1KNOB 5DFVD 2V2WB 4JFFD 3ZDYE 2DH3A 5JPMA 2VQ1A 1ZLDA 3SJVB 4CN6A 3Q0HA 4JO4H 4DOHB 1TZIA 2H6PA 1MCRA 4P0DA 4KZEH 1PJWA 3LH9A 2JJVA 3D25B 1RD6A 3T65A 5IHLB 1AZCA 4HWBA 1XH3A 5D7EA 1WBZA 4KMTL 3BVVA 1CDCA 2GI7A 1VCBC 3MU3A 4RMSA 3UXFA 1O5PA 2FH8A 5DQDH 4QJ4B 3ARGC 4HGWA 5DZPA 4AW7A 3LKSB 4OCRH 4TLKA 5I66B 2DI8A 5DJ6A 1IEHA 3K5SA 2WLYA 3BKML 3P30L 4CGUB 2FZ3B 3ROOA 3HC0A 4X80L 1I7UB 5T5FA 1U8JA 4Q9QL 1CFQA 3WS6C 2R83A 4JM4H 2JLPA 3H6AA 1K3IA 1Q38A 4DGWC 3GSVA 4ZFOL 4HH8A 5ACZA 3WD5H 1ZVYA 4RDBA 3L4VA 3HB3C 3OZLA 1DE4A 2FT7A 5B3JF 5CGBA 1QZ1A 4YSCA 1JF1B 2VITB 3GZPA 5H35B 2X7LB 5E8EB 3SJVA 1WC7B 3QNFA 4OGAC 5DD0H 2CHDA 1MOEA 1O75A 4KOBA 5AKTA 3QWNA 1U8LB 5K33A 3BDBA 3PDOB 4B97A 5B39G 2ITCB 4IIQC 5HI5C 1H3PH 1L9PA 3MUGA 4YSQA 3CHXA 2B2XH 2J4WH 4OZHB 4UB0L 3K6OA 1YVLA 4OJCA 1ESOA 1M6OA 3O2DL 1KT2A 5HHMB 1SMDA 4P4RB 3QIUD 2PKDA 4UINH 4PFEA 4TQHA 4U1MB 1U92A 1T04B 3L3JA 3HE6C 2DDQL 3VU1A 1I1FB 1Q0XH 2OMVB 3FB7B 2W88A 1T66D 3CBKB 2FVNA 1D2PA 4RWYH 1A6PA 1TZGL 5DK2A 4L23A 1JGIA 4Y4HC 3ABGA 3KNBB 1FNFA 3GI8H 3IRPX 1Q9OA 3FT3B 4ODUB 3VFVA 2COVD 3PGFH 2BRQA 5A7BA 3SBQA 3QT2A 2K9FB 2QDVA 2IH3B 3KS0H 2X4OA 1X5FA 1KFAH 2GJZA 2UV3A 3OHXA 1HHGB 1XR8B 2EZ0D 3INUH 2BY3A 2FEJA 5AL0A 2WWKO 1SVBA 1BDYA 3WN5A 3DVIA 2PR4L 3D8MA 4KDTC 4X5XA 3WENA 1JHLH 4ZT1A 4PQXA 1NGXB 5KYNA 1PZ3A 1UJ3B 2NYZA 4R2GC 2XN9B 5KOVC 5I1CH 4U3SA 1A7NL 3P2BA 4IJTA 2CCLA 4PI0A 3LDBB 5IQ7H 2F0CA 2F5BL 3SPCA 2HFFA 5J6HA 4M43H 1AGDB 5FGBC 5CJXA 5DD5L 2V5RA 3ZR5A 5FYJD 3T4AA 2BHFA 1CLZH 4E0RA 4N2LA 3DMMA 1FN4A 1G9NH 2IWFA 2IH9A 3B7TA 4LASH 5KVEH 4IKKA 1ZD6A 3I84A 1KBPA 3G9VA 3MNDA 3VI3F 1VIWA 2Z92A 4Y4KA 1TPXC 3ML8A 1FFQA 4LEOB 3P4MB 3L1GA 4ZQKB 2H9GB 4J4PD 3JV4B 4Z7WB 1IIKA 1LO5B 1IGYA 3M8OL 3TWCL 4BHUA 1GGCL 2VGLM 1JV5B 4XPGH 4NLHA 1A6VH 3IETB 5KYWA 3MNWA 1Y6KR 1G4MA 3ECVA 2J6EL 5EPMB 1L9NA 2NQ3A 2WLLA 3BN9D 4WIQA 1B9ZA 4XNDA 1EEQA 3HLAB 1X5LA 1XF5A 3O6FB 4KKBD 4OAWA 4YQXH 2AJUL 1DL7H 5FS5A 4YQXL 4M4RB 5DUML 1Q9WB 1XGTA 3EO0B 4FNPA 3OC5A 3CFEA 1CGYA 4AE0A 1AR2A 3X3GH 1KEGH 3F12A 4M5YL 5IBLD 5ICYA 5EULV 1DFBH 3BXNA 4V2BA 5CLWA 3OMIB 5F1KC 1T0NA 3AU1B 3HRZC 3QJZA 5J6GB 2C4XA 5FWQA 3UZEC 1AZVA 1HYRC 5DJ8A 1EJFA 1IAIM 3ZN6A 3US9A 4K5PA 4HVBA 3IAQA 2P8PB 4KDVA 4BFBD 2ORBH 3L2NA 4I13B 12E8H 3VSQA 1DQLL 3Q8CA 4NJ9L 4BXVA 5KVEE 3VWJA 4OZHA 1LNUB 2OP4H 4D0BB 1TTGA 1OAUH 2AEOA 4IBZA 3AU0A 2A99A 5FF6A 3RJDA 2X3BA 5AOIA 3TJHC 3SODB 3V9CA 2ADJA 4XNQA 3OTTA 5FO9B 3L45A 1ONQB 2DJUA 3N0AA 2QZQA 2ZUWA 3CLFH 3BUPA 4DKEH 3HI1A 4XNXL 1O7DE 1UJTA 1FVDA 1IGMH 4GXFA 4A66A 5D1ZI