3GFGA

Structure of putative oxidoreductase yvaa from bacillus subtilis in triclinic form
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
350
structure length
340
Chain Sequence
GRRKVDTIKVGILGYGLSGSVFHGPLLDVLDEYQISKIMTSRTEEVKRDFPDAEVVHELEEITNDPAIELVIVTTPSGLHYEHTMACIQAGKHVVMEKPMTATAEEGETLKRAADEKGVLLSVYHNRRWDNDFLTIKKLISEGSLEDINTYQVSYNRYRPEVATGTLYDLGSHIIDQTLHLFGMPKAVTANVMAQRENAETVDYFHLTLDYGKLQAILYGGSIVPANGPRYQIHGKDSSFIKYGIDGQEDALRAGRKPEDDSWGADVPEFYGKLTTIRGSDKKTETIPSVNGSYLTYYRKIAESIREGAALPVTAEEGINVIRIIEAAMESSKEKRTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form.
rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Oxidoreductase
molecule keywords Uncharacterized oxidoreductase yvaA
total genus 109
structure length 340
sequence length 350
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.1.1.371: Scyllo-inositol 2-dehydrogenase (NADP(+)).
pdb deposition date 2009-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3gfgA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gfgA01
2VTEA 2ZKLA 2G82A 3NJ4A 4GH5A 5LC1A 1YB5A 4OM8A 4QQRA 1ISHA 4XDYA 5K6AA 3RWBA 1M67A 1Q1NA 4J9UE 5L4NA 3JTMA 3GA0A 4MVJD 1T1SA 3JCZA 5KJCA 4CLRB 3H9GA 3KLPX 3NUGA 2Y1DA 4FFPA 4IQGA 2WEKA 2Q2WA 3I4CA 1Q0HA 3V1YA 3QVOA 4MJLA 1ENZA 4NZ9A 1WVGA 4CUJA 4FFLA 4WNCA 3F9IA 2W8ZA 4FQ8A 4G5HA 3GUCA 3DZJA 4EUEA 2YV3A 3BMOA 1KC3A 3KSDO 1VKNA 4DUPA 3WGZA 2E48A 4TKMA 3E9NA 4PLYA 1U4OA 5A9SB 3UCFA 4II3A 4Y98A 1LSSA 2UDPA 1IUKA 3P5SA 4RPJA 3NKLA 3FNEA 5KJFA 3AY6A 1GADO 4LVCA 1E3SA 4OKNA 3ZU2A 4CLOB 3I23A 1MC4A 4J1NA 1IZ9A 2Y1OA 3KETA 1TT5B 4J4HA 4MP3A 4JK3A 2HMSA 2O7QA 2W2LA 2PTGA 3I9MA 3ZWXA 2C82A 4PRLA 3BTUA 3IOYA 4KZPA 1DJNA 5JO0A 5G4KB 3NDJA 2HRZA 2Q1WA 3RBZA 4XDZA 3QA9A 4J91A 5IN5A 3RAJA 3VPGA 4BNWA 3HDQA 2VUSA 1EBFA 3QVXA 3AI3A 3K31A 3LC7O 3EC7A 4G2NA 5DULA 3LLSA 1VL6A 4JIGA 4DC0A 5A9RA 2W4QA 1KETA 4I9HA 3BMNB 2O2YA 2VHZA 5L7YA 5TS3A 5COBA 1I5RA 2BLLA 2IYPA 1I30A 1N1EA 4H7PA 4K26A 3DZGA 2Y1EA 3DXFA 4GWGA 4TVBA 3NTOA 3FBTA 5C7IO 5BNTA 1YWGO 1GPJA 1F17A 1WXDA 3QVTA 5EINA 3A9WA 4J9VA 1I3LA 2AEFA 4AJJA 3GOHA 3DR3A 3KBOA 3WWZA 1RM4A 2CVZA 4TRRA 3BMNA 3L6EA 1HDRA 1Q7CA 3PFFA 5DDIP 1A27A 1WDLA 3DWFA 1NAHA 4HY3A 1SEVA 1ADCA 5G0SA 2NU9A 1R4NB 1J5PA 5TT0A 4U6SA 4NJOA 4RVFA 5DF1A 1DBVO 4F3YA 3EHEA 5IZ4A 1CQJA 3RUCA 1P1HA 1F06A 4GWKA 1XYGA 4EUHA 1QYXA 4NFYA 3NGLA 4PLCA 8LDHA 2HUNA 4MVJP 4BNFA 3O26A 3GN1A 3S2GA 1SAYA 3DEYX 2FZWA 2YHIA 3T4XA 4BO0A 1JU9A 3A28A 4MPDA 4OXYA 4LCJA 3L77A 1UP7A 4JP3A 3U0BA 3KEQA 1WMAA 7ADHA 4YRAA 1VPDA 1A7KA 1XKQA 2NVUA 1GUYA 3HN2A 1Z6ZA 3FBGA 1ENYA 2VHWA 4L73A 2NTJA 4EJMA 1BXGA 4AJLA 1N9GB 5TT1A 2P4HX 4BKUA 4Z9XA 1H5QA 1LRKA 3ADPA 4TRNA 4GI2A 4Y6PA 1BXGB 3LQFA 3K8ZA 4CLHA 1BMDA 1KEUA 3K96A 1IULA 4CJXA 4E32A 3WWYA 4J4TA 3GPDG 4KUEA 1YO6A 1LA2A 3O9ZA 3FF4A 4J7XA 3WGQA 2Q1UA 2HK9A 3AJRA 3DTYA 4IM7A 1YE3A 2CZCA 4N7RA 2PKQO 4L9RA 3GEMA 3TN7A 2IE0A 5KJ1A 4BO5A 1E1LA 3KTDA 1YQGA 2IXBA 5AXAA 4TZKA 1O5IA 4PG5A 1X0XA 1ZIDA 3E6AA 2X5OA 4IMRA 1HDOA 4XEHA 1CETA 2V6GA 3E48A 3JD2A 2YHUA 1ARZA 3UXYA 1PU2A 3EYWA 1MG0A 4WCFC 2O4UX 1UXGA 1U7HA 4AJ4A 2GYYA 4IZIA 1LRLA 2VWQA 3H9JA 4YQZA 1N1GA 5JO9A 3C8MA 2FHSA 1E7MA 2VT2A 2CMDA 2R00A 3VTZA 3WG9A 3TF5A 1T2FA 3RU9A 4GX0A 2JHFA 3GLQA 4WK6A 5KNLA 3WMXA 2C5AA 4IDGA 4KDFA 3H65A 3WYBA 1XQ6A 3MJTA 4AJ2A 1HLPA 3MZ0A 2GZ1A 3LT1A 4BNHA 4BS9A 5FWNA 3Q1LA 1C0LA 3KO8A 4HFNA 3RBXA 2JD1A 3C1OA 1EUDA 5JLAA 2HMUA 1VC2A 5JYFA 4OKIA 1LUAA 1YGYA 3ZCXA 1ONOA 4PLFA 4FD3A 3UOGA 3PLRA 1ORRA 3LVFO 4Z3DA 4R41A 1LDYA 4GPD1 4YWJA 2G5CA 3H5RA 4QXMA 4RJTA 1GL3A 3W6UA 3P2OA 2P2SA 1LDBA 1LLDA 4PLGA 1DIAA 4CM4A 1G1AA 2EKLA 2V6BA 3VOSA 2EXXA 3VZPA 4DYVA 2YFQA 4XGIA 3VKUA 1ZJYA 2I6TA 2A4KA 4KUGA 1SNYA 3S2IA 4RF3A 4NU5A 1MC5A 3ZI0A 1OAAA 3UKOA 1GV0A 3WGGA 4CV0A 3ZGYA 2H9IA 4W9NA 1HDZA 3G79A 3FNHA 1ZSVA 4R1UA 1WMBA 3TZKA 2I3GA 1DEHA 1R4MA 5T6BA 1Y8QA 1I3KA 1MGOA 1ZO8A 3JQBA 3ZHBA 3EK2A 5KVVA 5K9ZA 2WD7A 5THQA 3SX2A 4D3FA 2D2IA 1KY5A 3RJ5A 1F12A 4YJHB 4L4XA 3DHNA 5BSFA 3UH1A 1N8KA 1U2DA 1R16A 4OL9A 2PGLA 2RH4A 4GKVA 1NBOA 5JDCC 1NTOA 1DXYA 5HS6A 1R4MB 1BW9A 1C1XB 3W8EA 3VC7A 3CKYA 4FIZA 4MKXA 4HNGA 4IY1A 1HDYA 1A7AA 2RHCA 1GU7A 1BG6A 2DPHA 1PGNA 5T64A 2FSVA 1NR1A 3DL2A 3JQCA 5DN9A 1E5LA 3U49A 1HXHA 1BTOA 2AMFA 1PTJA 2B36A 3PEFA 4JNKA 4RF4A 1X14A 3ZWNA 3PWSA 3WFJA 1XA0A 2X1HA 3SVTA 2FR1A 5EESA 2GZ3A 1RKXA 1LDNA 2ZYAA 1PS9A 1Z74A 4BNMA 1A5ZA 4NG5A 3N58A 1FJHA 1EZ4A 1ZKMA 1WZIA 4BKQA 3LSYA 2EP7A 5JC8A 1GPDG 5T8KC 2GN6A 1PS0A 1GD1O 3HQ4O 4NBWA 4YJGB 3VZQA 1MFZA 4GKBA 2OL4A 3IP1A 3D4NA 2IYOA 2XXBA 5HM8A 4PVCA 3UICA 2H5LA 2HK7A 4XIYA 4CV2A 4YCAA 4AJ1A 5C7LO 4FN4A 2RHRA 2WJPA 3K5PA 1H94A 4W4TA 1HYEA 3Q2KA 2IXAA 1KOLA 1PL6A 3B70A 1K3TA 3GEDA 3JQ7B 4ALLA 1QYVA 1AE1A 1XIVA 1O9BA 4WCDA 5G4LA 3PJDA 3C1TA 2ILTA 3JQFC 1NFFA 5BT9A 4OOEA 4OMUA 1Y9AA 4W7HA 5CPFA 3HNPA 5EL0A 2JCVA 3GFGA 5CEEA 2NQTA 2FWMX 1V0JA 1M6WA 4RVUA 1EVZA 2CUKA 4MVJH 5EERA 1BW9B 3EZLA 1W0CA 4S1VA 1RYDA 2YYYA 3RUFA 4MOWA 4GMFA 3S2EA 5DCUA 5JYEA 1XSEA 3OMLA 5DOZA 3IDSA 1VSVA 4XRRA 1PZEA 2ZYGA 3VPXA 5B12A 3VH2A 2B37A 3DFZA 1L7EA 1HLDA 3AWDA 1E92A 1GDHA 3LF1A 1K89A 4BUCA 4YDRA 5CDSA 3G49A 2JD0A 2A35A 3JQGA 4U7WA 4BMNA 4CLOA 4PLTA 2CDAA 3PZBA 3ST7A 5CDTA 4CL8A 2Z1NA 4CV3A 1QLHA 1Y8RA 3ZV4A 1LBEA 1I33A 5ES3A 3HDJA 2I3AA 1MA0A 3Q9UA 2VWPA 4RDIA 1NQ5A 3X2FA 4O6VA 1XU9A 5ER9A 1GY8A 3MJVA 5KVCA 3QW2A 1J6UA 1DLIA 3PIIA 4BNJA 4GBJA 3R0IA 5EIOA 1KVTA 3DBVO 3F4BA 4ZN6A 5ITWA 3WSWA 2Y93A 3E9MA 3OJEA 4CQLA 1YJQA 1P31A 4BGEA 3ASVA 4XCVA 1XR3A 2GF2A 1I2BA 3IS3A 4FBGA 5LDGA 4PG8A 3A06A 1I3NA 5H81A 1WDKA 2XOXA 4OYRA 2OO5A 2YHIB 5IZCA 1GZ4A 3DAGA 1LQTA 3C3XA 4X54A 1QYCA 4FDAA 1D7OA 3TL3A 4NJMA 3GDOA 1Z75A 1WPQA 1VL8A 5IXYA 5DT9A 3AOEC 3MOIA 1SB9A 5HA5A 1QYWA 3GNQA 3Q6IA 2VRBA 4WLUA 3SJUA 3DOCA 4XQEA 4NQZA 5IDXA 1VI2A 1R0KA 4OSOA 2G76A 2R00C 5JDIC 5TLSA 4YJGA 3QWBA 3WJ7A 2Q50A 3WJAA 1D1SA 1X13A 3S8MA 4NK5A 3M2PA 1ZNQO 3AY3A 4J16A 3WTCA 1ZJZA 2I67A 5BSGA 3H6KA 4K6FA 3VZRA 4YT8A 2Q4BA 4LMPA 5BSHA 1HDGO 2QRKA 4XJSA 3SJ7A 3HJAA 3I5MA 4J3FA 3CIFA 1NFRA 4CM5A 3C24A 2PGJA 2AG5A 4ND2A 1NFQA 1K2WA 4B7XA 4KWHA 5F1KA 1LQUA 1B8UA 4BO1A 3BTOA 2RCYA 3ANLA 3NV9A 3B1JA 3D0OA 1YOVB 1DHRA 1QYDA 4B4OA 4UEJA 5TJ9A 2EF1A 3F1LA 3FCOA 4EITA 4E5YA 4XB1A 4I5GA 3U4HA 1PEDA 3V1UA 4CL3A 3O38A 4CM4B 5G4KA 4PLVA 2PD4A 3WIDA 3EGOA 4HKTA 1DFHA 1BGVA 1V3VA 2W98A 4WKGA 1R15A 4W99A 3SC6A 4BKOA 3BTSA 3AUTA 2VCYA 2EGHA 4WPGA 3TWOA 5JBIA 4MDHA 1FDVA 3HDYA 4LVUA 4R5MA 3CTMA 3H8VA 1WP4A 5COAA 3V2GA 4YPOA 1JTVA 4MIOA 4RF5A 1RM0A 1JKJA 2HLPA 3DFUA 4IBOA 4WEQA 1DB3A 2R2GA 5IG2A 2X5KO 2Q45A 4PLZA 3PJGA 2X0RA 2PGDA 2E82A 2Y1GA 1DHTA 1ZXLA 3O8QB 5ICMA 2W2LD 1BXZA 3MCVA 4FCCA 2OFPA 1QR6A 2Y66A 3W4KA 4E5KA 1O0SA 1MG5A 4ESOA 3GVXA 3B6ZA 3FPCA 3G3EA 4P38A 4CMKA 1K6XA 4KQXA 2X8LA 4IDAA 4MINA 3I9JA 5CHEA 3I3OA 1VRWA 4Y67A 2PH3A 3OJ0A 4QECA 4U6QA 1CIVA 2GR9A 1ONNA 2JD2A 3U9LA 4TZTA 4K28A 3RD5A 4J7CA 1EQUA 3QQPA 1NNUA 3ROQA 1KEWA 1LSOA 5L45A 4CM6A 3RSHA 3TDKA 2ZTVA 2QZZA 2AG8A 1C1DA 1HE3A 1A71A 2WDZA 3I4FA 2JFGA 3QY9A 4UVIA 2C2XA 1PQUA 2VNSA 3R3SA 3CZRA 1KVRA 4BO7A 5C37A 4R54A 1VJ1A 3CINA 3PPIA 3T7CA 1F8FA 3PWKA 3R6DA 4DRYA 3GRKA 1NQAO 3U62A 5JYAA 1JN0A 4YA6A 5TSDA 1O8CA 3HHPA 3ZW8A 4YYZA 1GQ2A 2QX7A 3V2UA 2QYSA 4UREA 1JWBB 2YUTA 1X1TA 4KOAA 1S6YA 4QO8A 2LDXA 1HZJA 2NLOA 3UN1A 4B3HA 4KMSA 1MP0A 2D8AA 2EHDA 4TVOA 3ZW9A 3RCBA 5JAZA 1U8FO 4RPGA 3OSUA 3F46A 3JYLA 4PCVA 3KYCB 2CDBA 3B20A 3DC2A 1U28A 3RUDA 1DSSG 1FDTA 3PTZA 3EVNA 1V3UA 2HRBA 3ZU4A 1P77A 4IINA 5I7EA 5TJHA 1PJSA 5L7TA 3F4LA 4CMIA 3DOOA 3TOXA 5JAQA 4DLLA 3ZDFA 4ZQFA 4BO2A 2VOEA 3I9LA 2BGMA 1EE9A 2X0JA 2HAEA 3GT0A 4DWVA 1ML3A 3FR8A 1W73A 1PJBA 1I8TA 5KCZA 4D0RA 4O63O 3H3FA 5I9MA 4BNKA 1FF9A 3E82A 3GDFA 3GMSA 4CMBA 1P45A 1PX0A 4FGSA 4R3WA 1Z7EA 5EQDA 2PA3A 2ET6A 3ICPA 1R6DA 3WICA 4BNIA 4Z0HO 1LEHA 1ADGA 4I1IA 4O5OA 4ALKA 6LDHA 2O3TA 5B1YA 2X58A 3L6DA 3S1LA 1HSZA 1KIFA 1MXFA 3IUPA 3AUUA 5B37A 3NDRA 4AFNA 4CMEC 1SPXA 4QT0A 3WGYA 3K9QO 4DA9A 1ULSA 1AXGA 3PXXA 1HYHA 1F14A 4CPDA 1B15A 2Q46A 4PVDA 4B4WA 1M66A 1NWCA 3L07A 1JA9A 3JQDA 4HXYA 4PZCA 4BNVA 1BDMA 3JD4A 2C5EA 1DC6A 2X86A 1VLLA 3ZU3A 1PL8A 2FMUA 2B4QA 3UCEA 2X6TA 3ZHXA 5AVOA 6ADHA 3RUHA 1GYRA 4AJPA 1DFGA 4RPHA 3V8BA 1CYDA 1HL3A 4JX8A 3ULKA 1V35A 4TRJA 4Q3AA 1M6HA 2AE2A 4NH4A 1SEPA 3D4OA 5HBRA 1VSUA 1CDOA 3DB2A 2BFOA 3GFBA 5DBIA 4BMSA 5L4SA 2PFGA 2Y0DA 3H4VA 5IF3A 3RC9A 4BNUA 5CP8A 4LK3A 1NYTA 2HQ1A 3GZ4A 3BHIA 5I8ZA 3AFMA 1P33A 4EUFA 1JDJA 4AG3A 5A04A 3KYDB 4OQYA 2AEMA 4PZDA 3EY4A 5IN4A 3GG2A 3DAPA 3VVBA 2P9CA 2BGKA 3H3JA 3VAZA 3AOEA 5DZSA 2HMTA 3PQFA 3FR7A 2D59A 2EKPA 2O3QA 1RYEA 1J0XO 2QHXA 4IJWA 3DTTA 4UVDA 3K6JA 3AM4A 4XJTA 4MIEA 1WW8A 3S2FA 2VYVD 3RQSA 3ROKA 4PIVA 3ROMA 2EW8A 1GQQA 2PD3A 4HX5A 3GAZA 4L76A 1EDOA 2DPGA 4NHEA 2PWZA 3EMKA 2O3RA 2O3SA 4PRKA 3RIHA 2RIRA 1Q2XA 1TB4A 4CR7A 4E12A 5F21A 1KVQA 1NHWA 3OM9A 1Y5MA 3H2ZA 3WB9A 3I1JA 4FGWA 3STHA 4ND4A 1LLQA 1YL5A 3DZFA 2DBQA 4Y6SA 4AJOA 1ISJA 3VTFA 1YQDA 5CEFA 1HT0A 1U3VA 3ZWWA 1OC4A 2WYVA 3JQEA 4TQGA 4C7KA 5CG1A 4OXNA 1P1JA 1E3IA 3ONEA 4CMCA 5J9GA 1DRVA 1B3RA 1SO8A 5A9SA 4RQUA 3OQ6A 1SCUA 4E5NA 2PK3A 1GUFA 2J3KA 2JHGA 2O2SA 3BMOB 4Q3CA 1IY8A 1P74A 4R3NA 1BHSA 3GHYA 3DZHA 5JYDA 3OIFA 3ITDA 2CVQA 2GASA 2PZJA 1P1IA 1ZBQA 1ISFA 3IIEA 2OHXA 1P3DA 4YTEA 5FI5A 4YJHA 4BL5A 4QFCA 4WLOA 4BHTA 3AW9A 3GN2A 4JCOA 5LCXA 1UXJA 3JSAA 3MJ4A 3LDHA 3JYQA 4U5QA 1KY4A 4AICA 3B1KA 3TZ6A 1YOVA 4XA8A 2X0NA 1NX6A 2IDZA 2DLDA 4AVYA 3OIDA 2CNBA 3BMCB 4TMFA 1QRRA 4GMGA 4OO3A 4CODB 4DYDA 1UAGA 4KP7A 4XYGA 4GAEA 2OOSA 3CMMA 3RJ9A 3KSZO 5KJ6A 3HB4X 2Y68A 1PGOA 3FTPA 2ZTUA 1R0LA 3L9XA 4E6PA 5JMWA 1LJ8A 4OQZA 1I36A 4MKZA 4K9DA 4M1QA 2DUWA 3F1KA 1GZ6A 1ZK0A 1H9BA 3PHJA 2ZCUA 4R9SA 2NWQA 4RLSA 5DCYA 2J3IA 3Q9NA 2X0IA 1NQTA 3ADOA 1DIGA 5F3RA 3V2HA 4AJKA 5L40A 2P4QA 1DFIA 2WE8A 1GV1A 3ZNNA 2VHVA 3PWZA 4FS3A 4CMEA 1P44A 1XWFA 1LX6A 3UGKA 3LC1O 1Q7GA 3DHYA 2NACA 3JQBC 1C1XA 2RAFA 2I99A 2UUPA 3S55A 2Q1SA 3I52A 1HDCA 3GEGA 1DIRA 4ZVVA 4NR0A 2X23A 1KERA 5FYDA 3H9EO 2IZ0A 3RFVA 1R0SA 2PNFA 4PG4A 3JV7A 3A4VA 4ZHSA 1PR3A 4JBIA 3SXPA 4ZRNA 5THKA 4HP8A 3RVDA 2AW5A 3ICCA 1NPYA 5L3ZA 5IFLA 4IIVA 2ZCVA 1HTBA 5FI3A 1JQBA 3W8FA 3AU9A 4Q3EA 1U8XX 1EVJA 4DIFA 3NX4A 1E1KA 4OXKA 2IEDA 4WLVA 3GPIA 1DRWA 2IRWA 1H6BA 2C07A 3M6IA 4M49A 4NK4A 1I32A 3KYDA 4BGIA 1SBYA 5I7FA 2X9VA 4UAGA 1LDEA 1SMKA 3LYLA 3D3WA 3F3SA 2Y05A 1U9JA 3PJFA 3EDMA 4BV8A 3UFXA 4EI2A 1UUFA 1UXHA 3I9OA 4DPLA 3ON5A 3TNLA 4WASA 4WLFA 2VWHA 5F1PA 3TL2A 4DBVO 3LT4A 3I9NA 2AEJA 2HJSA 5H83A 5IDWA 4XR4A 3LF2A 5COQA 1T4DA 2P9EA 1RM3A 2B5VA 3MEQA 4B3IA 4JJGA 4ZICA 1DC4A 4E0BA 2Q2VA 3PZRA 1AXEA 2YW9A 3CH6A 4FFNA 1LLCA 1W4ZA 1EUZA 5TC4A 4U0JA 1DOHA 2NQ8A 3LC2O 1ID1A 1I10A 4ILKA 4EW6A 4EBFA 3UVEA 4P22A 4LSWA 1IZ0A 3QVSA 1E3JA 3TZCA 3KB6A 1BSVA 2Q22A 2X4GA 3LU1A 3SLGA 3OA2A 4UULA 4J2HA 2YZ7A 3OQBA 3VH3A 3QWFA 1ZFNA 1ZZEA 4RVGA 4YT4A 1KBZA 1C1DB 2Z95A 4DPKA 2OP1A 4LCEA 3DBRB 3PHGA 3EUWA 1UZNA 1H6DA 3F6YA 1ZW1A 2CSUA 2ZK7A 4FJ2A 5AQ1A 3A1NA 2QYTA 1V9LA 1GAEO 1PL7A 3FHLA 3UHAA 3QHAA 2EKQA 4XR9A 3WTBA 2AA3A 4HBGA 4CLEA 4UVGA 4Y9DA 4Z0PA 3U09A 3RBVA 1TT5A 3FNFA 4ZQEA 1EMDA 4IGFA 5KTKA 3WLEA 1KYQA 1DLJA 1PQPA 2B4TO 1OI7A 2UUOA 5KVQA 2EG9A 3PDUA 3C7AA 5A03A 2F00A 2WM3A 2EJWA 4Q3DA 1MB4A 1SC6A 3JQ7A 2CDCA 4WGGA 4BNLA 4R51A 2EERA 1QMGA 2ZTMA 3ZWVA 1NVGA 2BD0A 3GDGA 1UZLA 2PKRA 2BRUA 3QV1A 4L4SA 2AHRA 2J6IA 2H1SA 1K6JA 3IAHA 2CF6A 1Y5RA 2CF5A 1Y9EA 2FP4A 4J1TA 4WECA 4BVAA 4D46A 4Y8VA 4BO3A 1Z73A 3GRPA 3RC2A 2QZ9A 4YAJA 2ZJ0A 1EBUA 5BQFA 4EEZA 1NVMB 1HRDA 1P1KA 1X0VA 3KXDA 4ALJA 1Y8RB 2PR2A 1NHGA 4QX6A 4MVJI 3NDIA 3BMQB 1AUPA 2GUGA 3TRIA 2W2KB 1D8AA 2PZKA 2Y1CA 3JYNA 1J4AA 4DXHA 1YBMA 2XAAA 1PJ2A 4YQYA 1NQOA 4WEOA 3D3EA 2QRLA 4ALNA 2FPPA 1KEVA 3SBOA 2ZATA 3ZWAA 3NRCA 1M2WA 3RFTA 5MDHA 4XGNA 2GD1O 4XX0A 4NBUA 3AFNA 4FPXA 2RH8A 3M2TA 3TOZA 3GGGA 4CM9D 3GHHA 5CFZA 4XZ3A 3OICA 3HSKA 2G1UA 1R4NA 3QP9A 4XKJA 3WIEA 1HF3A 1EVIA 3GAFA 2YQ4A 3ZWOA 2DTXA 4CM9A 1E7SA 3RROA 3W8DA 4RVDA 3HADA 1BVRA 4AJNA 1LSJA 3WBBA 1HSOA 4C4OA 2YDXA 2NU7A 2ZB7A 4RVHA 3WDSA 3D5QA 3ZHZA 4MVJE 2DTDA 3U5TA 1Y8QB 1ZSYA 4I9NA 5G2OA 4A0SA 5A1TA 2D5AA 3G17A 1Z45A 1SOVA 2B83A 2WD7B 1T4BA 4E3ZA 1WWKA 2ZB4A 5HS4A 4YJDA 3WMWA 2IZZA 4L4RA 2BI8A 4C7JA 1DIHA 1T1RA 1E7QA 1PQWA 4RZHA 1E3LA 2QRJA 4MO2A 3WFIA 4MVJG 4ZD6A 3TPCA 2JJYA 4N5LA 3L0DA 3AUSA 2C0CA 4G65A 4XIJA 4B4UA 1KVUA 2TMDA 3HFSA 4D3DA 3E03A 1C14A 3AY7A 4JBGA 4A2CA 3AI1A 5JW6A 1EK6A 5GZ1A 3IP3A 2DTEA 2ZQZA 4YT2A 1VM6A 4URFA 2X22A 2I5PO 1A4IA 3TZQA 4YAGA 4IIUA 2O4CA 1H93A 4O59O 2G0TA 4E13A 4IUYA 4YJFB 2VYVA 3ETGA 1XQ1A 1YB1A 5JXWA 3VDRA 2BFMA 5DBFA 4KQWA 2GDZA 2VRCA 4BO9A 4JP2A 4ZGWA 4NI5A 4FOSA 4XGKA 3PGJA 2NU6A 2NTVA 4O0LA 5TQVA 3ZU5A 2FN7A 3KYBA 4FFOA 1PJ3A 4OH1A 1B8VA 5L7WA 5DP1A 3DMTC 1Z7BA 4A7PA 3ENNA 3VDQA 4KUHA 3IC5A 3BMCA 3GK3A 4GX1A 5ILGA 4BMVA 1E3EA 4PGFA 3WGHA 3GUYA 3MJCA 4M87A 4EJ0A 4DREA 9LDBA 4G81A 4ZA2A 5M6DA 3D4PA 4IXTA 1K5HA 2Q1TA 3P2YA 1GZ3A 5HTOA 1XDWA 3D5TA 4YACA 1PZFA 4J4BA 2Z5LA 2C20A 3FI9A 2CFCA 5L4LA 4E21A 1BVUA 4PFJA 4R1TA 1MV8A 5JCXA 4JQCA 3RC7A 1ADBA 3JD1A 3SEFA 4DQVA 5TF4A 5C5IA 5TNXA 4DVJA 2GGSA 4PZEA 1XG5A 3PYXA 4RQTA 1E6UA 3ZV3A 3WGIA 4UUPA 1B3BA 2O23A 3IL2A 2OP0A 4RL6A 3K30A 3U4DA 3E5MA 4YRDA 3QJ5A 1ISIA 2YQ5A 3OEWA 4K1LA 2NADA 3GH3A 3C85A 2FPIA 3WBFA 3ZH2A 4EZBA 2P91A 3NTRA 1E5QA 4ZRMA 3IUSA 3KSUA 4J6FA 3SLKA 4ALMA 1K0UA 1LSUA 1ZEJA 3JYOA 4IPTA 3GQVA 1X7HA 3JYPA 4RPKA 3TZHA 5GY7A 3W4JA 1YB4A 2D4AA 1ZSNA 4JBHA 2OGUA 4YRBA 1H0KA 4ND5A 1WAMA 4A26A 2Y0EA 1JWAB 1V3TA 4R68A 3JQ9C 4DLBA 4D0SA 2AQIA 2PY6A 5EJ2A 1T2EA 3OEYA 2WWRA 2DFDA 3IKTA 4I5FA 2UYYA 2YV2A 3INGA 1D4FA 1QLJA 4ND3A 4NJMB 1O94A 3KZVA 3D3WB 1GYQA 1IHYA 4A73A 4N18A 3PIDA 4NNJA 4BIIA 2B5WA 3HZZA 4DPMA 4E4YA 4KDEA 3RUAA 1T2DA 2GSDA 2E4AA 2VYNA 2GZ2A 2P5UA 2VZ0A 4CMIB 5T8KA 3WQSB 3GVPA 4NPCA 4XQ9A 4RVSA 4HV4A 2HCTA 4AJHA 1PR9A 4PN3A 4JXKA 2C2YA 5I8WA 1ZVMA 4ZJUA 3GC6A 5JAIA 1DO8A 3WS7A 4UVEA 1PWXA 2EW2A 2CY0A 1DC3A 2E6UX 3DAFA 2YDYA 4GVXA 1N7GA 5CPBA 1LDGA 4BV9A 4YAIA 3R3JA 1TI7A 3H9UA 2X9GA 3JQ6A 2FPGA 2C7VA 4HWKA 2JL1A 1YONA 3QWIA 1Y7TA 1V8BA 3NT4A 3WOHA 4JROA 5IDQA 4CMJA 4BQRA 3WNQA 3JQGB 4UUNA 2HMWA 4IXWA 4W7IA 1O6ZA 4L75A 1NXQA 3PHIA 4TKLA 2Q49A 1UAYA 3JQFA 3QE3A 3WQRA 4CR6A 4NBVA 3MOGA 3VKVA 1CF2O 1U3UA 4XYEA 5A3VA 4OGWA 3NT2A 4ZQBA 4OOFA 1M76A 3KYCA 3RUEA 1BRMA 1U4SA 2FR8A 2D0IA 4M8SA 2UVDA 3EAGA 1TLTA 1DAPA 3CPSA 1H2BA 1UDCA 4TSKA 4QO7A 2ZTLA 3PRJA 1G0OA 3QIVA 4NDNE 4ONEA 1T25A 1UXIA 4WOJA 1E6WA 8ADHA 4N5MA 3ZN2A 4RLHA 5AXDA 2W2KA 4F45A 4E2XA 2CVOA 1ADFA 4OSPA 4ZQGA 1F0YA 3D1LA 4NBRA 1EFKA 2J5KA 3AOGA 3VZSA 4IMPA 1C0KA 4IS3A 4F6CA 4BNZA 3I9KA 1WNTA 1HEUA 2J5QA 1MX3A 1YBAA 3MWEB 4BB5A 4MP8A 2Q2QA 3GVIA 1P1RA 3MWDB 5B4TA 1VL0A 4NU6A 1Q0LA 5FF9A 1CRWG 3BZUA 1DPGA 5U1PA 3ZNOA 5K0ZA 3HB5X 3TJRA 1R12A 4YXFA 5AXCA 1A9YA 2DQ4A 1A9ZA 4CQMD 3O4RA 4LRSB 5C7OO 1DDOA 1IL0A 2ZYDA 4QUKA 3PHLA 4U0KA 2BGLA 1RM5A 1UP4A 3MJSA 3ZNPA 1VJTA 1BWSA 3O8QA 3ZWBA 3WR5A 1W8DA 5JDCA 4DIBA 4XRGA 4MP6A 3F47A 4QSMA 3WYEA 5J23A 1DIBA 3TQHA 4IQ8A 3W6ZA 2QG4A 1LC3A 1HZZA 5TX7A 1PZGA 4E5MA 4LN1A 4E31A 3VH4A 5F5LA 2Q4EA 4I5DA 2JCXA 1L7DA 2YV1A 4WE3A 1E7WA 3AI2A 4YVFA 5ER6A 3CMCO 2BF7A 4U8GA 4QEDA 4Q3NA 1ZK4A 3WGTA 3SC4A 2OZPA 1GYPA 4N54A 3HE3A 1B7GO 4NMHA 4R1SA 2VTDA 3KLMX 3LT2A 2HKIA 1HE4A 3F5SA 5FEUA 2YY7A 5A06A 3VPFA 1U1IA 3LZ6A 2OORA 3RKUA 2FZEA 1H6CA 4IS2A 2NUAA 2WTBA 1MUUA 2ZQYA 4EDFA 3WX0A 4I8XA 5CDGA 2B0JA 2BH9A 3JQ8A 4JGBA 3KM0A 3UCXA 1Y6JA 3BIOA 2DT5A 1RPNA 3GNSA 2JAPA 3ORFA 3PGXA 2VYND 1Q0QA 1O95A 4LSMA 3CZMA 5BR7A 1KC1A 3A14A 4I9UA 5TGDA 4YBZA 1QG6A 1X1EA 5JCJA 5DCWA 5L95A 1LI4A 4XYBA 4CLXA 1OC2A 1RJWA 1T26A 1FDWA 4M86A 1ZUD1 3K73O 4LISA 1C0IA 4CUKA 4CLRA 4BNXA 1B26A 3ONDA 2WSBA 1PJCA 3NYWA 4GQAA 4ZQHA 2DUUA 4PLPA 1IB6A 2F1KA 4TROA 3EW7A 1JW9B 4Z6KA 3TFOA 4YR9A 4J2OA 4IQ0A 2OXIA 2BMAA 2XPCA 4BNTA 4CM8B 3CEAA 4L0QA 4WCFA 4JJFA 4XD2A 1HE2A 1AGNA 1GQYA 1H9AA 3GY0A 4HFMA 4D41A 5L9AA 2A92A 1YQXA 1PZHA 3FPLA 4I5EA 4Q9NA 3AUAA 1WDMA 3FNGA 2WD8A 1YDEA 2I9PA 1WLYA 3G1TA 1LDMA 2D5CA 5ENVA 5KOIA 4GLOA 1T2CA 4B79A 3N7UA 1PS8A 4BNGA 4GGPA 3ROPA 1G6KA 5ADHA 4MVJF 1DJQA 1LC0A 3RASA 4INAA 3DBLB 5IDYA 1PGPA 2RBEA 2FOIA 4PLHA 1U2GA 1X7DA 4P4LA 1YDWA 3JQ8B 5F5NA 4FFMA 1U5AA 4J1SA 2HO5A 2W90A 1C0PA 1JAXA 3LLVA 1ZH8A 1NAIA 2J8ZA 2Y0CA 3K2BA 5A5FA 3U4IA 4HADA 1OZAA 1LU9A 1NP3A 3R1IA 4DMLA 4K6CA 3V5NA 5ITVA 1XHLA 2B35A 4IJUA 4DTIA 1E77A 2FSSA 4D44A 3JQ9A 2PV7A 4DLAA 1ZXBA 1YS4A 3INRA 1AHIA 3KRTA 3BMQA 1N7HA 4GGOA 3L6OO 3RI3A 1VE9A 1YRLA 1TVEA 4BOYA 3JQAB 3DHEA 4WLEA 4OJNA 1YVEI 4Y6RA 1E3WA 3DBRA 3BAZA 4E5PA 3OETA 2VRCD 3HDHA 3B1FA 2B69A 1I2ZA 1CJCA 2GN8A 2OMEA 3CXRA 5JY1A 1ENOA 3ZNQA 1RWBA 1E1MA 2DAPA 2EJVA 1K6IA 1T2AA 4R4JA 2DKNA 4J1QA 1CERA 3GG9A 4NFHA 2Z1MA 3ZWMA 1QSGA 3PP8A 1IHXA 2YFHA 3I6IA 4FJ1A 1B8PA 3Q11A 4CV1A 4DIOA 2HK8A 4CR8A 5KWEA 3IKVA 3E5RA 4RV9A 3OFSA 3WNVA 2GLXA 2H6EA 3MTGA 3GVHA 1N5DA 3L4BA 4IJVA 4NBTA 4DQUA 4UEOA 4XYLA 2P9GA 2B4RO 2A94A 4IDDA 5KKCA 3ETEA 2NSDA 2YJZA 5ENDA 1B14A 1ISGA 4BKRA 5JDIA 2XF8A 3H2SA 5I7VA 4BNNA 4MKRA 5B4VA 2AXQA 5TIIA 3PLNA 5A02A 5LDHA 1L1FA 3RC1A 3PI7A 5K6AC 4D79A 2O3UA 4RORA 1CEQA 3OBBA 1QKIA 5G0VA 2NTNA 3EVTA 3ANMA 1TA4A 4IDFA 3GZNA 4XB2A 4Q39A 5A3JA 1NPTO 4FR5A 4LGVA 4XYMA 3PK0A 3AK4A 3HWRA 3QWHA 2Q99A 2HSDA 5IZCC 1UJMA 3NEPX 1OOEA 2V6MA 4MVJM 2VNAA 3DBHB 3O03A 1NR7A 2AQKA 3CUKA 2AQ8A 3ONFA 4WJZA 4D3SA 3AM5A 1GTMA 5L53A 2JFFA 3I6QA 4IGEA 4FSHA 4GX5A 3HUDA 2DU8A 4P4NA 5EQFA 5I9NA 5GZ6A 3C7DB 4WUVA 4ALIA 2EP5A 1GCOA 1PJLA 3KV3O 1BXKA 1YJ8A 3RFXA 4HUJA 5CAEA 4B8WA 2PZLA 1YXMA 5I9LA 1MFPA 3QVWA 1UR5A 2AE1A 2BI7A 2X9NA 3OHSX 3BXXA 5JFOA 3DDNA 2NV6A 3LT0A 1FMCA 3JD3A 3G0OA 3GR6A 3HN7A 5CG2A 3OIGA 1IOLA 4D7AA 5B4UA 2BKAA 4DC1A 2C29D 5JSFA 1H6AA 4IDBA 1PGQA 2Y1FA 3K2EA 3RUIA 3NT5A 1YKFA 1LTHR 3QRWA 4WLNA 2JCYA 1JVBA 1QV7A 5JPIA 4YAKA 4H16A 4F46A 2D3TA 3I83A 4IZHA 5GZ3A 5IAAA 1CQIA 3PDJA 3V1TC 5I7SA 4CM7A 4GL4A 1TEHA 4TRMA 3D7LA 3EZYA 5F1OA 2Q3EA 4M89A 1NM5A 4GX2A 4LMRA 3U4CA 1LLUA 3VH1A 2HJRA 4Z9FA 4AJIA 2WMDA 2BHLA 3BTVA 2I66A 1ENPA 1PSDA 1Z82A 2VT3A 4RZIA 3UF0A 3E18A 2VN8A 5G0WA 1NWHA 4L8VA 4R9RA 1PGJA 4R5HA 3OP4A 3D64A 4GSKA 4CMAA 4B8ZA 1MXHA 3G1UA 5C3MA 3DOJA 3GVCA 3IJRA 1U3WA 3NJ8A 4BKPA 1EE2A 2GCGA 4WOKA 3H7AA 1XLTA 3PQDA 2IODA 4UUMA 3ANNA 2PH5A 5A05A 4KTTE 2IZ1A 4IJKA 3GMDA 2NU8A 3COSA 5DBGA 4CM8A 3Q0EA 2P68A 3DO5A 1O89A 1N9GA 2TMGA 2EGGA 3CE6A 3DZIA 4ID9A 5U9CA 2E49A 1DC5A 1XGKA 1PJ4A 4UUOA 3OJFA 2JKVA 3T7EA 1W6UA 5KKAA 3UAGA 2AQHA 4Z3KA 4JLWA 5T67A 3UUWA 1XELA 5T57A 3DZBA 5ILOA 3IQDB 1AN9A 1I01A 3WSVA 2WYUA 1QXSA 2C7GA 3FTNA 3OJOA 1TT7A 1U7TA 3INTA 1I2CA 4J7UA 4FB5A 5JCJD 2HMVA 3E1KA 3MJEA 2PZMA 3ZZNA 4L74A 3PYLA 3NAQA 1U5CA 4DL9A 5CEJA 2IEBA 2J3JA 2EWMA 5JY6A 4UEKA 2WYWA 2J5RA 2O3JA 3M1LA 4RDHA 3RU7A 1EK5A 1V6AA 5CDUA 1WZEA 2NNLD 4DQXA 3GZNB 4XQGA 1YBVA 1P0CA 3E8XA 5BSEA 4R01A 3KHUA 4YAEA 1CWUA 2P5YA 3ENKA 5MGBA 1A72A 3GGOA 1SOWA 2DC1A 1X15A 3AM3A 3QSGA 3OF2A 2I65A 3T4EA 4NFSA 3L9WA 3C7CB 5A5EA 3KUXA 1JLLA 2DFVA 2GNAA 2FY8A 1YH3A 3DZKA 1EEHA 2ZJ1A 4PG7A 2DVMA 4D43A 1ONPA 2NVBA 4BQPA 2C54A 4QTZA 4J43A 4BO4A 5DP2A 4ROSA 3FWZA 4J0EA 4W9NC 3PHHA 4RF2A 4GLLA 4ITUA 3ITKA 2DBRA 2QIOA 4ZU3A 2PKQP 1NPDA 1R37A 2GN9A 1D3AA 5HWSA 1KVSA 3PJEA 1E6EA 2VOJA 4AL4A 4CQLB 5DNAA 4YEDA 4YB8A 4JN6B 3OQ1A 4LW8A 3VPHA 1GR0A 3ZV5A 1ISMA 2VZ9A 4E2WA 4FW8A 5EMHA 5IJZA 5IXSA 5T73A 4RGBA 1DRUA 3RKRA 5A4DA 1OMOA 4E2YA 4R16A 1A4UA 4BGUA 4CQMA 2DM6A 1J49A 2H63A 4E30A 3MTJA 1GFSA 3HFGA 5T5QA 4J49A 4FFRA 1JKFA 2V7PA 1E0DA 2DBZA 5EN4A 1UP6A 1VJ0A 5HRUA 4JJIA 5JE8A 2PD6A 3JD0A 4A5OA 3OJLA 1N92A 2J3HA 1ZMOA 5G0UA 2VWGA 1BDBA 3BYZA 1X7GA 5JAMA 1U3TA 1UDAA 1D1TA 5KVSA 4CMGA 4H3VA 2NVUB 3IJPA 3PFWO 4N5NA 1FXSA 3AU8A 3C1AA 2BFPA 4BO6A 4EJ6A 1GEEA 4J0FA 3M1AA 3JQAD 4UVHA 3DMYA 1P9LA 3CSDA 5DOVA 4CM3A 4E33A 1GEGA 2VUTA 1HETA 4E2ZA 4B3JA 5GMOA 2V65A 4P4GA 1IPFA 1QP8A 3ZWPA 3JQAA 5AXBA 3ZHYA 1GCUA 4NIMA 4WNIA 3GF4A 4XWYA 5AOVA 1ZK1A 1ZK3A 1LRJA 1Y81A 1HKUA 1UDBA 1Q7BA 2DBVO 2LDBA 2HU2A 2ZB3A 1NASA 1R66A 2Y67A 1MLDA 1N2SA 2VHYA 3VPSA 1B0AA 4A03A 2GN4A 3ZWYA 2PLAA 7MDHA 1KS9A 5BNFA 4A10A 4WCFB 3QLJA 2GRAA 2BELA 4BB6A 2JAHA 2X7HA 2O48X 2X5JO 1ZMTA 1UH5A 3OECA 1LXCA 2UAGA 4RO0A 1F8GA 1KEPA 4MVJA 2CD9A 2VZ8A 4O1MA 4H15A 4OHUA 5KJEA 4GVLA 1M75A 1S7CA 3WLFA 5CDYA 2VQ3A 4FC6A 1E3WB 1B16A 1EDZA 5A9TA 2HDHA 2GO1A 4D45A 4FJ0A 4CMHA 9LDTA 2A9FA 2QQ5A 4B4VA 5H82A 1OBFO 4DGSA 3DBHA 1PJTA 4TWRA 3HG7A 3KVOA 3FN4A 1EUCA 1XU7A 4YT5A 1P1FA 1G0NA 5FFFA 2POQX 5KIAA 1AHHA 3FWNA 3PVZA 4ND1A 4D42A 5BNIA 4BO8A 4CLDA 1YL7A 1Y1PA 2C59A 2NM0A 1EVYA 2O7SA 1SZJG 3BA1A 4II2A 1NVTA 4DMMA 3OH8A 1HWYA 2GERA 4R1NA 4A27A 4QFDA 4HFRA 5JMPA 1FDUA 2EEZA 4BNYA 1B2LA 1IYZA 2VHXA 1HYGA 1OFGA 1IE3A 4S3MA 3H5AA 2XXJA 1TXGA 1ZCJA 3GNTA 1XEAA 2O50A 2ZB8A 5ICSA 2D1YA 1E1NA 3H9QA 1VKOA 5JS6A 4IDEA 5L51A 3X2EA 3WGOA 1I0ZA 1ULUA 4M54A 2BFAA 2SCUA 3IMFA 4CUZA 3K92A 5JC1A 4W82A 3BHMA 4OAQA 3Q2IA 4B7CA 3P7MA 4EEXA 2NVWA 3PYMA 3TSCA 4P8RA 3VHRA 4HNHA 4KTVE 4AJEA 4XQCA 3W4IA 3QWAA 1QORA 4FOOA 3Q3CA 2ZIZA 2Y99A 4RPLA 4CM1A 1ZK2A 3WXBA 4DBZA 5U4QA 2WE7A 4RCVA 2OUIA 3FRJA 3NTQA 3H5NA 1HE5A 4F6LA 5AYVA 4EYEA 3OA0A 1E7YA 3N74A 1ZEMA 1PWZA 3GGPA 5TRTA 3DMTA 1IPEA 2OBNA 4I08A 4B7UA 4BGVA 1LNQA 3ETDA 2V6FA 3FD8A 3DQPA 4LRTB 4OIMA 5EPOA 4Z0TA 4KWIA 1UZMA 4FC7A 1YL6A 1FK8A 1QV6A 1H2HA 3KOUA 4R69A 4PLWA 3ZV6A 4IDCA 1JVSA 4M55A 5JNLA 2FR0A 3U3XA 4Z9YA 1T24A 2QW8A 3DBLA 3ABIA 1I24A 1UXKA 3WQQA 4Q3BA 1EFLA 1JKIA 1EQ2A 2EV9A 1HDXA 2R6JA 3PQEA 3ZWCA 2G17A 2OBYA 4GSLA 3LK7A 4CQMB 2E37A 3NGXA 4EGFA 4J90A 1PIWA 1C3VA 2I76A 3ASUA 2JFHA 4W6ZA 1JAYA 1DAOA 3L4BC 3VVCA 2GPTA 3UW3A 1XCBA 4YJFA 3WYCA 2UV8A 2EIHA 3L4SO 3F5QA 1PJQA 4MIYA 2FRDA 3BHJA 1FDSA 5G0TA 3W1VA 1E7RA 1SB8A 1GUZA 4PG6A 1P0FA 3E9QA 3DONA 4HFJA 3FSRA 3P19A 3KEOA 3TFQA 2VUUA 1I3MA
chains in the Genus database with same CATH superfamily
1ZXXA 2QSYA 2R6ZA 3G5TA 1E2NA 1WTCA 3OE4A 4JP5A 2APJA 1EWQA 1Q1NA 3FZEA 4BIMA 3EVEA 4QDUA 1ZH2A 3U3RA 3ZGXA 3PD1A 1EINA 1T1SA 1Y37A 2E5FA 5KJCA 1WB5A 4MGZR 1D7AA 2OK8A 1V1JA 4PC3A 5B1EA 2Q2WA 2XAUA 4PBSA 3T3NA 4G07A 3BDIA 3OT5A 4KFSA 1Z07A 2VDJA 2DY1A 3RTEA 2XLCA 4MJLA 1IHDA 1QS0A 2YMLA 3DHWC 3MTBA 4NZ9A 4DCOA 4FFLA 2QQGA 3ASZA 2W8ZA 3Q8WA 4ZI7B 2CBGA 1UMDA 2YWRA 3O1JC 4Y9SA 3DZJA 4G0PA 3S6JA 2NIPA 4B9AA 2YV3A 4KQCA 1X1CA 2B1QA 1VKNA 1K7EB 3EPAB 5IVIA 3C4VA 3WGZA 4LHYA 1L5LA 4TKMA 2D6FA 3E9NA 3VA7A 2CXSA 4HDSA 2BMEA 3EOZA 4M9RA 4X92A 4ARAA 5EJAA 1YIOA 4NMMA 1LSSA 4Y2XA 3P5SA 4RPJA 1AC5A 3N76A 4X7MA 3NKLA 2GA8A 3FNEA 4HEA1 3RF7A 1S7GA 3K6RA 4RSHA 2J7PD 4X41A 2X8WA 3REQB 4NZOA 3SVZA 3MOSA 3TSWA 3V1LA 2RAPA 3W9SA 3A9UA 4K6MA 5DYNA 2KJQA 5C7YA 4QWMA 2CGEA 3F8SA 3VU9A 3WKCA 1Y1QA 1PLJA 1TT5B 3QEMA 4BDTA 2WJJA 4JK3A 4B7AA 2O7QA 4ZO9A 5IBRA 1L7OA 3LXXA 4KGXA 2C82A 4JL5A 1T5BA 5CVCA 2OHHA 3O3MB 4GPIB 2AK2A 5EIFA 4G5FA 5J40A 3W34A 4XDZA 2O5EA 2XQJA 5IN5A 2F48A 3IKLA 4ZK2A 4MV4A 5ESXA 2IA5A 4TL8A 1IEQA 4OBBA 3ZJVA 3VAAA 2VUSA 4G1CA 1EBFA 2QVCA 3AI3A 5BW5A 1GAWA 1NDQA 4NAHA 4K9NA 3JZMA 4DIDA 2JI7A 2VR1A 3O75A 5A9RA 1SZCA 1KETA 5J2TA 4AP6A 5I7OA 4X00A 5TS3A 5COBA 2P6PA 2XIJA 3HO1A 3DLCA 1P17A 1I30A 4L8WB 3EG9A 4G5QA 2Y1EA 5JSYA 2C4VA 1CZRA 1UMBB 2XWPA 3DXFA 2RGNC 4GWGA 4ZZ2A 4B84A 3NTOA 2IXGA 3FBTA 4RHYA 4UU7A 1NF3A 5CYOA 3BQMB 1WZCA 3BDAA 1BMQA 2ZUVA 5EINA 1H2XA 5HIJA 3HC7A 2DH5A 2AEFA 4DSNA 3GOHA 1C3LA 3JPYA 3RT7A 1EGQA 3HYSA 3O1HB 2Z8YA 5DLEA 1HDRA 2P9QA 1Z8DA 1O7JA 1SEVA 3PB3A 5DYYA 1VMDA 1IAVA 1A1SA 2JKYA 2QVZX 1R4NB 4IIGA 4LGMA 2R8RA 4R8VA 4U6SA 3ONWA 3FZQA 3IO3A 3HCFA 4RIGA 1DBVO 4F3YA 3H13A 3N1UA 3ZE6A 4B6RA 5K01A 5KNDA 2VPTA 2FWRA 3RUCA 4JBWA 4LDZA 5LA6B 3JATB 4GWKA 2ZVQX 3IIKA 4M7RA 4RSMA 1DKOA 4PLCA 5JQGA 3ZJXA 3NGLA 2VTBA 1A9PA 4ENUA 3R3WA 4TKVA 3VDMA 1O8BA 2YN2A 2Q21A 4BPRA 5ESRA 1OI4A 1F2VA 5FOVA 5JNVA 2I4OA 5B4UA 4PS0A 4JI4B 3UMRA 5L3SB 7GPBA 3L77A 1DBWA 1UP7A 3LQ1A 3KEQA 3QVJA 4JP3A 1LS6A 1WMAA 3G6WA 4TYQA 1NYQA 2NVUA 4XQ0A 4DQLA 2O5CA 3HN2A 3MUNA 1C8KA 3Q88A 2XBUA 1YDFA 2VHWA 3U61B 2NTJA 4A91A 1EX7A 3DVAB 4EJMA 5EHXA 4IVPA 4AJLA 3RVKA 2P4HX 2PLNA 2RGCA 2XNDD 1E8DA 3KP1A 4HCJA 4REQB 4G56A 4TRNA 3CN9A 1SXJA 2GFQA 4PTLA 4Y6PA 5F51A 3RS2A 1ZOLA 4XWYA 3I04M 2CD7A 1IZZA 4N8EA 3DZ6B 1KEUA 3K96A 4OP3A 2WTXA 4KAXA 4Q01A 4TN1A 5EKDA 4AW9A 1AOXA 4U9HS 4ZQIA 2JGJA 4E32A 3DDCA 1SUCA 4QGFA 3GUZA 4J7XA 1QFXA 2BTOA 2Q1UA 4G4GA 1NLMA 5JCZA 4MA0A 1GAJA 1I5OA 1YE3A 5IM4F 4K0KB 1DP4A 3E9YA 4O33A 4L9RA 1DUSA 1O4WA 1Z08A 3QK7A 4BO5A 4IOMA 3OZEA 5IP5A 2P78A 2PUCA 1FTQA 1ZRHA 2YJ4A 4DCSA 1ZGHA 2QNBA 2BRUC 4B87A 1X0XA 5CCEA 4RCZA 1FFEA 3OZ7A 2ZUSA 2VXBA 1NVWQ 2YY6A 3WI7A 1T2VA 3IALA 1OASA 3T1TA 5A4IS 3MMXA 4RK4A 1IDOA 3RVLA 3WIUA 1M6VB 5GIOE 2V6GA 3EZFA 2IEIA 5KTMA 1EFVA 2QDXA 1ARZA 2EX0A 2I3ZA 3UXYA 1GPKA 3EYWA 1MG0A 2B94A 2JVIA 1SKMA 3KXKA 5BRJA 4TUYF 5D3ZA 1UXGA 2FLKA 2BV3A 3CUWA 5JADA 5DCLA 3FUUA 1JSZA 1LRLA 3NM5A 5JAUA 3NQ41 2VWQA 2LR0A 2OB2A 3VV2A 4X1IA 4E08A 4KMOA 1N9KA 3GEPA 3OM0A 5C1DA 2IBMA 2QWXA 4RTRA 2EZTA 3CO0S 1E63A 2CMDA 3OUZA 4CCAA 1T2FA 4KXNA 2FPLA 2QY6A 4JOCA 3T1HB 2RGWA 4DWOA 3WMXA 1H8HA 2C5AA 2ZU0C 4AJ2A 3MJTA 1II8B 1HLPA 2OWEA 2R4TA 2QGZA 5DTRA 1YZTA 4KFRA 3FFBA 1ZKDA 3UENA 1ZGGA 3Q1LA 1C0LA 4IL5A 4NMXB 1ORHA 3C1OA 5EOVA 5JLAA 3V4SA 2HMUA 4LPKA 2X0DA 4KLRA 4WY5A 1LUAA 4I1UA 4ZPJA 3SXUA 4DA0A 3S2UA 2FR8C 2FPPB 1KO8A 4UZEA 4TM7A 4BB9A 4LVNA 2QPAA 2K2WA 4AX8A 5J2UF 1C3OB 1A2OA 1U80A 4PF1A 4GPD1 4ZYWA 2W2QA 1IY0A 1YA4A 3EF1A 2YXEA 1SG9A 3QXCA 5KREA 5LD2C 4E70A 5FD8A 1ZA2A 4Z9AA 3SHOA 3H4IA 2QTCA 4RZQA 4KVGA 1Q3HA 1XZLA 5T4FA 4MWSA 1DIAA 1O08A 4PPQA 2PX8A 4CM4A 1XVVA 3M6MD 1S8OA 2QORA 3EQ2A 2YFQA 4QRHA 1DAEA 5F7ZA 4F2WA 1XA3A 1XLUA 1U3FA 1ZJYA 2I6TA 2GJKA 2A4KA 1TJYA 4KUGA 2OLKA 1USIA 5EJEA 4CT4B 2ZSHA 1MC5A 2HMAA 3ZE1B 2H0RA 4HGNA 4BAGA 1UT5A 3AF6A 5JEEA 5C18A 1HQDA 1TC2A 2PWBA 1KZ4A 1HDZA 3P32A 1LPPA 2JFOA 3PDHA 3FNHA 4RE6A 4F72A 8ATCA 2GJSA 2J6CA 2WRZA 4TLBA 4ZI7A 2WUEA 1Z0DA 1MGOA 3V7WA 5KVVA 3FFWA 2XF2A 1QRAA 7ABPA 5K6RA 2FW7A 4MNTA 4O02B 3SX2A 1D04A 1UF9A 4D3FA 2ZU6A 5I01A 2CMHA 1M83A 1ZU5A 2ZAOA 3FGOA 2DX7A 2UZ1B 4OMDA 1N75A 3LO8A 4OM7A 2VDUE 3BF8A 4OL9A 3CLSC 1COZA 3C15C 3N8NA 2W42A 2A86A 1NBOA 4S0XA 1DXYA 5IBCA 2REQA 3UMCA 2Z56A 2DUNA 2AFRA 1MO5A 3PUJA 1R4MB 5ALIA 3F98A 2R8XA 3FRIA 1Z7GA 4LTNA 2VSXA 1JHOA 5I45A 3H3XA 3OZRA 2CFRA 3FJYA 4O4HA 4Q4AB 4BCDA 1UMCA 2RHCA 3A9VA 3PQ2A 1BG6A 2C03A 4RADA 1XMXA 2QAIA 4KNVA 1EHIA 2FSVA 3Q7IA 4ZC1A 3DKVA 3JQCA 4ML3A 5D6OA 1XKXA 5DN9A 4A8JA 1FFCA 5LLDA 4PGAA 1WQ1R 1XOIA 3IEUA 3TE6A 1ODTC 4WXMA 3PEFA 2ETXA 1QV9A 2PX2A 4G89A 1OXUA 1X14A 1RXCA 3HA7A 2ZS9A 3T54A 3T1YB 2PZFA 5EESA 1CUAA 1RKXA 1LDNA 4M9SA 1TU0A 5B2EA 3O0DA 2WB4A 3G0IA 2MINA 2GB4A 2ISQA 4I2VA 2O8DA 3N58A 1EZ4A 3ZU6A 4H7FA 1IBCA 3LSYA 2QTFA 4ZV4A 1HFKA 4MI6A 3IESA 2GN6A 4MUBA 1GD1O 5G1OA 2RHWA 2X5XA 3VZQA 2GBFA 1MFZA 4GKBA 2OL4A 3QXGA 1EFAA 3GAMA 4JVNA 3WHKA 1W2HA 1Y7PA 2XXBA 4PVCA 4RKQA 4CV2A 4UDNA 4PYQA 3D6UA 4FN4A 4I81A 3RVNA 4GZ5A 3DFKA 4QLBA 1XROA 2FP4B 2WHRA 3AIOA 4U7FA 2QVGA 5AUNB 4BZWA 2O8DB 3O73A 1IN5A 2G72A 4EVIA 3H1FA 3C98A 1W2WB 2ZKIA 5D8DA 2BF4A 2VLIA 3B70A 4XH9B 1YR8A 3FUCA 3ZX5A 2YN0A 4O3FA 3BJIC 1GR1A 4HSEA 1KEEB 4Q0MA 3K16A 2ZS8A 4RHUA 5E8RA 3TX6A 3F7NA 4K9PA 3IE0A 1XIVA 1XRQA 1O9BA 4ZWNA 5CIYA 1UODA 3VO8A 1XT6A 4H60A 3C6XA 2IV2X 4TTPA 3V4VB 2D1FA 4NENA 4C0LA 3DZ3B 2PQMA 5BT9A 4R8SA 3K9NA 4MARA 4OMUA 5CPFA 3DW3X 5ALFA 4DDHA 5CEEA 4DF3A 1V0JA 1M6WA 1A69A 2VDVE 4PPFA 2CUKA 3RVSA 5EERA 1KI3A 2BEVA 3OUUA 3T06B 1K5GA 1XU4A 2AN5A 2Q3MA 3DVQX 3HO8A 1RYDA 2YYYA 4MSUA 4KN5A 3SDSA 2V98A 3MMZA 3ZXUB 4JI0B 2WG2A 3FLBA 4XD7D 4B80A 5DIFA 3RFFA 4XRRA 1PZEA 4J76A 4U2GA 2C2GA 2Y6VA 3GUHA 4UE6A 1L7EA 4M0PA 4RKFA 1HLDA 4JCCA 2HQRA 3KD3A 2A7QA 2IHBA 1G8HA 1UK9A 4M1WA 4YDRA 3BMXA 4IDHA 2QAGC 2A35A 1KHHA 2ZYHA 4ZK6A 1WPGA 3K4PA 2BH2A 2CFIA 4BJ3A 4ESHA 1UQRA 1G38A 3EX7C 1QCYA 4IEFB 4RUKA 721PA 3PZBA 2GPBA 3BK2A 4HAUA 3NUQA 4ERXA 1WW3A 1QLHA 4XASA 4YLGA 4OB6A 5I4IA 1LBEA 3P9NA 3HDJA 2I3AA 1MA0A 4X63A 2Q41A 3IPYA 3ZTYA 2A3NA 1Z56C 3D6HA 4RVOA 3COWA 1YFJA 1N6PA 5ER9A 1XU9A 1XTKA 3BB4A 1PVDA 2BM0A 2O7NA 3MJVA 4MRNA 2J9FA 1DLIA 1CS0B 3R40A 3S2YA 5A5DA 3M33A 2HCRA 2H2FA 2NUBA 4KXLA 2HPAA 3KZKA 3F4BA 5PGMA 4ZKDA 1QS0B 1YZHA 2B1JA 2YMPA 3QVKA 1W6RA 5A4KA 4JXXA 1JDUA 3EEYA 1RHMA 3GMIA 3OC6A 3WSWA 1ZN2A 2Y93A 3E9MA 3HVHA 2P0YA 3LY5A 1YJQA 4TPKA 1P31A 1ZP6A 2IHYA 2XB4A 5DNVA 2PPVA 3BCSA 4NDZA 3BCUA 4OP1A 3VNSA 3V4RA 2AZXA 5GONF 1I3NA 3J7AC 1YI1A 1GGFA 4IUDS 3HY3A 2Q62A 5CXQA 5HFNA 1YRAA 3GBSA 3C3XA 4RHCA 1KDPA 1SA0A 2ERYA 4XSHA 3N7AA 1D7OA 4QELA 3SXUB 4NJMA 1GRNA 2CB9A 2E4YA 1I6KA 1QF9A 1WPQA 3COYA 3UEOA 4D9KA 2LRHA 3SM9A 4TWAA 5IXYA 1H4VB 4YHBA 3LPNA 1J2TA 3AOEC 5DT9A 1KK0A 3Q6IA 2F9FA 4TXJA 3AB8A 5CH8A 2VRBA 4URZR 4D9JA 2YYZA 1P8AA 3RSGA 1FW6A 3LGAA 3PUVA 3E27A 4K9LA 1RKQA 3K5WA 2XY4A 1S01A 4OK5A 1F0NA 1TU4A 2NXCA 2CBXA 4HX2A 1YRBA 1NXSA 1YFLA 4RIEA 1GT6A 4V0SA 4Y2HA 3WTCA 5BSGA 4OXIA 4K6FA 4K46A 4LTMA 1SIUA 1VHJA 3HCOA 2PUHA 4A6PA 1OYWA 4EB6B 4WN9A 2QRKA 2XT0A 4V24A 3HJAA 1E99A 5K0BA 1N36B 3IV9A 1N5KA 3C24A 4JOSA 4CM5A 3QI7A 5BV0A 4GYYA 1PFWA 2AG5A 2HUPA 4ND2A 5A5VA 1NFQA 1TLLA 4B7XA 1UBNA 2QM8A 5ALSA 5F1KA 1LQUA 4BE7B 3M70A 5SYNA 2YKGA 3VKGA 2RCYA 2R97A 3EWIA 4BAUA 3NV9A 4QJIA 3B1JA 1X80A 5HK8A 3AVQA 3C6MA 5BYKA 1CYEA 2X0FA 1DHRA 2WIDA 4AWXA 1XTUA 1N5JA 1I2DA 3F1LA 3FCOA 4XDHA 1TKAA 1PEDA 2O2EA 3W2IA 1AK1A 3PE3A 3QE2A 2XYVA 5DX8A 4B2YA 4QXAA 3ZXIA 2PUGA 1LTKA 4J94A 1P6QA 3WAKA 2Z2JA 1TM4E 1JGTA 2ATEA 1DFHA 5H59A 1OX5A 5I3CA 3ESQA 3WIBA 1DV2A 1Z13A 3QW4B 5HOQA 3LFTA 3VUEA 2GEUA 2VH5R 3GRYA 4W99A 3SC6A 3BTSA 4KI7A 2RHOA 5CM9C 1N4DA 3V2IA 2VCYA 1U8EA 4NS1A 5SY4A 1YVUA 2EP8A 3M0EA 3MQ2A 2I1LA 3HDYA 5FKJA 4FYXA 2WHXA 4XJXA 1XWIA 4REQA 4YPOA 3P71T 2GPJA 5COAA 4D92A 3TPFA 2A9RA 1JTVA 3EYAA 5DLDA 2Q5LA 4JEUA 4B2IA 2QPTA 1RM0A 1JKJA 1YJAA 3N0VA 1AK9A 4IBOA 4AUMA 4YHHB 5IG2A 5FBZA 1K8YB 2X0RA 3OFKA 2PGDA 2E82A 2GLUA 1L7VC 1AKNA 2OFXA 2R8OA 3O8QB 4A36A 2EZ8A 2W2LD 4X66B 4TT3A 3MCVA 3RS0A 2Q28A 3W4KA 2FWBA 3YASA 3FKSA 3AINA 1CRLA 3GVXA 3GRFA 4RH3A 2CXHA 5AHXA 1KI8A 2BGRA 5TQ0B 4Z0NA 1KDYA 2QLMA 1Y8ZA 1K6XA 4J1TC 1B23P 4IOJA 3I3OA 3NHAA 3L6BA 3PR3A 1JPUA 1T3ZA 1W4RA 3F3MA 3OJ0A 4MB6A 1RAAA 4BLOA 3LNCA 1QU3A 3X2EA 4G0ZA 1GPUA 1ONNA 2WHPA 3MJFA 1LV7A 4RJIA 2ID9A 3PNQA 3K7EA 4CG0A 4Q1FA 1WETA 2VHQA 4M9UA 4OCZA 4OHMA 4F5ZA 4F2HA 4K28A 1EK1A 2B1IA 3Q40A 4CTMA 3RD5A 4J7CA 5DM1A 3P9XA 3EASA 3QQPA 4J3NA 4YAUA 4O4JB 4Y9UA 2I4IA 4CM6A 2I78A 4ITVA 2XUJA 2PSJA 2QUHA 1QGDA 4XE5A 1C3XA 2H57A 2D74A 1HE3A 1A71A 1T1GA 2WDZA 3I4FA 2JFGA 4WTOA 1ISPA 1PYGA 1QAOA 2W2PA 3KKMA 5JRDS 1HNWB 3BREA 2VNSA 3R3SA 1KJNA 2PX0A 1KVRA 4GPBA 5KMGA 4AS1A 1AV7A 5EWLB 1WDWB 4P3OA 3CINA 5EKXA 3FB1A 3PPIA 1U5BA 5FP0A 3NHWA 1BQ4A 3LH5A 5A6SB 4ZZ1A 2WAXA 1O8CA 1BN6A 2UZ1A 5A4AA 3O4JA 3GGJA 1XZKA 2V4MA 3OO1A 4V39A 4QU5A 2GNPA 5KTYA 3JTEA 1IC6A 5LZ2A 3UAZA 3K8OE 1FVXA 1PJZA 2LDXA 2R7NA 1VCNA 1YS1X 4JZYA 5LM3A 2XYPA 3KXPA 3C39A 2XDQB 2VNHA 4YASA 4LGYA 3P94A 1K6MA 1U8FO 4RPGA 3VYRB 3ZLTA 2C5LA 2V7XA 5CFRA 3KYCB 4B74A 3JU3A 3N2KB 3I6MA 4U2CA 2YVUA 1VGVA 1XRRA 1TQ2A 3PTZA 4AK9A 4QJ3A 2JJMA 4IFEA 2B8WA 5K3SA 2DY0A 2IYXA 5L7TA 1W88B 2A5JA 2BY4A 2LGJA 1NJ2A 3ZK9A 1YRYE 1MAUA 4DLLA 1L4YA 4ZQFA 1REQB 3FCAA 1S3IA 5HKOA 3I9LA 4YY3B 2HAEA 4ZC8A 3GT0A 2XNJA 4JVMA 5KCZA 5E2AA 3EA0A 3H86A 2OHJA 2QV7A 2GI4A 4CMBA 3GLUA 3A6LA 1ZM7A 2BLNA 1OR8A 1DX6A 4QHSA 5EQDA 4KIUA 1HH4A 2PA3A 4FYKA 4G5OA 3WWYA 2WSSA 4AF8A 1LEHA 4FQ7A 1EU1A 221PA 2NXEA 4OAOA 4DZZA 6LDHA 3WIOA 4KLCA 5EQJB 5PNTA 3JASB 1FX0B 1Y34E 3LDFA 5B1YA 2O2JA 1UMDB 4C29A 1AJEA 4NZZA 4UOQA 1KIFA 3IUPA 4OHBA 3TO5A 2ASVA 5B37A 3UWPA 1QVRA 2GEBA 3WAJA 4OHYA 3FWYA 3WGYA 1QAQA 4DA9A 1JHAA 3IV7A 3N6VA 1G9SA 4OF4A 4QGGA 4C5CA 2O0LA 3RH0A 4TMWA 4FEAA 4L08A 1C50A 3B38A 1LVHA 1F14A 3QOWA 3U0BA 4CPDA 4B4WA 2ZYVX 1Q57A 4PVDA 3SIRA 4E94A 3QEJA 1HDEA 2RC6A 5GV8A 3SBXA 1FZTA 4BNVA 4E14A 2DQYA 2WFAA 1QPGA 3JD4A 1AUQA 3ZJTA 4JJEA 4YMTA 1MX5A 2VBCA 1CQWA 2FMUA 3OLQA 1TKCA 2IU0A 4HXGA 3RANA 2OBLA 3RVMA 3FGZA 2X6TA 4A6DA 4B3CA 5AVOA 3R2JA 5TMBA 1PKEA 2GHTA 1RMTA 4RPHA 1R0BA 1XTSA 1G3QA 1CYDA 1QTRA 1ZD5A 2C2MA 1WCXA 2O0KA 2ZYUX 3K94A 4QUBA 1GPLA 3WRYA 4BQFA 5IKXA 1JFFB 1PUXA 4JX8A 3KL4A 1JDVA 1LFDB 4BQNA 2JATA 4QSHA 1OA1A 2WU3A 3H0WB 3HUEA 1ZWLA 4BZXA 3D4OA 1F51E 1QG0A 4GECA 1CDOA 1JXOA 4KACA 3UMMA 4W8OA 4F4JA 3L6UA 3GD5A 5EPUA 4EHBA 4KG7A 3I5YA 4N3AA 3FG9A 3SF8B 4BNUA 2WABA 5CP8A 3ZE0B 4H7IA 3AFMA 1DUVG 2A0UA 1JDJA 1G3RA 5A04A 1GSIA 1T5TA 3Q2OA 2AEMA 2VXOA 4INOA 2QIPA 1OLUA 3EY4A 3EJWA 5A7GA 5IN4A 4BBAA 2BGKA 1GTJ1 2I2BA 2QGFA 3AOEA 1RSZA 3E4DA 1XJWA 2HMTA 3PQFA 4ZAVA 2QTGA 2D59A 3EVZA 1KZ7B 1MJ5A 1SCJA 1XZQA 2QHXA 2QTNA 1L2TA 4YCSA 4IQ4A 1YA8A 4EUNA 3BCRA 1UBTS 3MS7A 4D4IA 1IRXA 2FE4A 3S2FA 2Q2NA 3CCBA 4NH0A 3NM4A 5JH7B 1JJVA 1G20E 2G04A 3K0AB 5B7NA 6NULA 3TGLA 1OYVA 1W9HA 4JI6B 4PIVA 4NABA 3PJRA 3PFBA 3O1LA 1OZGA 1ZN9A 2QQFA 2PD3A 2OA0A 2FX3A 3TUZC 5FAXA 1JDZA 2IOQA 5ALWA 1UBMS 3EMKA 2D2VA 5DV9A 1L3CA 2O3SA 3A2NA 3H1BA 1KP2A 2XZLA 1OIWA 1XZPA 3O92A 1TB4A 4CR7A 2GCPA 2E5WA 3IXLA 5A7HA 5IU6A 1MHPA 1XZBA 1MZVA 3SJBA 1DPFA 1VLJA 1WPRA 2VNJA 2Z4SA 3FPFA 3WB9A 1RKBA 3H2ZA 4HX9A 3T4PA 4FGWA 1D4ZA 3NC0C 4IFIA 2H1HA 4RZSA 5FWDA 1LLQA 1YL5A 4WD3A 5ALKA 5HQ3A 4AJOA 2VDQB 2PT5A 2WA1A 1U3VA 2CWWA 3II6X 1OC4A 2WYVA 4NCXA 3QUQA 2WJ6A 4O2BF 2B8EA 5CG1A 1XK6A 1E3IA 4CMCA 1E9VA 1QIIA 3DT6A 5A9SA 4ERNA 2W48A 3QJYA 1KWKA 1SCUA 2PK3A 1GUFA 1XNGA 4MQFB 4RH1A 1NBHA 2JHGA 3FVTA 3N6RA 4UNIA 3BMOB 1RAGA 4MGHA 1XQYA 2PUAA 1RKUA 2RJOA 3P0FA 2J3MA 1W1IA 2C8LA 3K72B 2JI6A 3LUPA 1RBQA 4FB4A 1GCGA 2BFWA 3DZHA 3GHYA 4D26A 3L7NA 3ENZA 3QBTA 3H5LA 3BSYA 5KO2A 1L4UA 4QEZA 4ER7A 2GASA 1NSFA 4ZO7A 3NAMA 5ECDA 4JI1B 1ZBQA 2GK3A 3IIEA 1HEYA 4W8GA 1Y89A 3CEMA 5DGXA 5JH7F 2A6PA 3TQCA 4BL5A 3ADCA 3W04A 5CA1A 3ME5A 1V5IA 4WLOA 4C0XA 2BYTA 2AF4C 3THYB 2ODNA 3JYQA 4U5QA 3CKKA 1YC5A 2PMKA 1BHJA 1NSYA 3QKRA 5CNIA 4DNPA 1YOVA 1RS0A 1NW8A 2IDZA 4UEWA 2DLDA 4XWTA 4YK7A 2P30A 3EN0A 4RGQA 1FFXA 1FRQA 4AVYA 1QRRA 1C8LA 5FA5A 4OO3A 2JEZA 3W6PA 3ABQB 4KP7A 5E4YA 3TOSA 2XRZA 3BZWA 2XUGA 4M1MA 4B5LA 3CMMA 5H16A 3ZCSA 5JS8A 4LYGA 1VYTA 4KVFA 3L9XA 1KP9A 3I9V6 2A9PA 4E6PA 4ER5A 5KX5A 4WH0A 1DBQA 3HNRA 4OQZA 1A9RA 1I36A 3HEBA 4NYMQ 5I9TA 3L18A 2LTAA 3UWMA 4K9DA 3H6HA 2WYHA 3FBWA 1T8PA 5D6NA 3R9KA 1GZ6A 1ZK0A 1OXSC 3AUFA 2OCDA 1GO2A 2WA2A 4V0RA 5BO5A 5KAMA 2YXPX 3KQQA 4AWBA 5HZGA 3H4TA 1JZTA 4P7GA 2DWCA 1D2NA 1NU8A 2OGWA 3U7HB 2MOKA 1NQTA 1M2FA 2I91A 3BJZA 1DIGA 5F3RA 4AJKA 5CLQA 2EFHB 4EVSA 8AT1A 4UCFA 5JXGA 3OU2A 1DFIA 1GV1A 1Z25A 5BSWA 5LIPA 2VHVA 2I2DA 4MRPA 2FJUA 2R8BA 1G42A 1K97A 1LX6A 2C99A 1Q7GA 3AQ4A 1DG9A 3ORRA 2QXYA 1BA3A 2JW5A 3CX4A 3LT5A 5JYBA 4YUYA 1C1XA 3FUVA 2Q1SA 1G20A 1SVKA 1ISRA 1V16A 1HDCA 5T3UA 3PC3A 2HRRA 1BJKA 2IEZA 2GEJA 2X23A 4A92A 1ECGA 3H9EO 3LIPA 1H1TA 3VZDA 5AKGA 2Y3IA 2PNFA 5KSWB 5F52A 1XLVA 2OZKA 2VBIA 2ZR0A 3JV7A 3ETCA 2A78A 1WB4A 3PFHA 2IY9A 4JJ6A 5THKA 3SXPA 3P9YA 621PA 4V3CA 2A58A 3ICCA 5JVDB 1NPYA 3D6TB 1GG9A 3THOA 3G5LA 5L3ZA 3VR6D 2B9VA 1BVHA 2RHMA 2FCAA 1P81A 1RLMA 4MRSA 1JQKA 5FI3A 1A88A 3O8RA 1XL1A 2ZJ3A 3HZHA 1SOAA 3IIJA 4QYWA 3DVRX 5HF8A 4BP1A 1AO0A 1OCEA 3MCWA 3BKWA 1E1KA 2MR5A 1F6DA 1Q20A 1IQRA 4LG1A 1TK3A 3OAAA 4D5GA 1DRWA 1CX9B 1F48A 1U2DC 3H84A 3IEMA 2OYRA 3M6IA 4INJA 4M49A 3HZRA 1I32A 4NONA 2P8SA 3DZ2B 1LPSA 3QQ5A 5BORA 3L5OA 3CRNA 5I7FA 4YJ2A 3DV9A 2OFFA 3T3EA 2SKCA 1LDEA 1L5FA 2FNAA 1DWUA 3TK1A 3AR9A 3F3SA 1UT6A 2QZPA 4YMLA 3E9RA 5BNZA 2VTBB 4LX0A 2WWWA 4BV8A 1IBKB 1MQ9A 1F9EA 4G0XA 1P4HA 2RHBA 3UFXA 4EI2A 3I9OA 3D8RA 5FPKA 1HLFA 1NVUQ 4WLFA 3DL4A 1FL9A 3JWEA 3IKJA 4P3XA 1THMA 1XEWX 2L18A 2XKJE 3NKFA 3MG9A 4FHEA 4CHTA 4MDEA 2X42A 4GBED 5IDWA 1JMYA 3LF2A 1AGRA 4KQEA 4L5JA 1XVUA 1RM3A 2KLHA 2P9EA 3M5PA 3MEQA 1PZNA 3MK31 3SQMA 3TIVA 2ZIAA 1DC4A 3TW6A 5B1IA 1QKJA 2XTNA 3PZRA 4KXMA 5H68A 1QH9A 1SHJA 1ZZGA 4A3SA 2QI9F 4IJQA 4XVHA 1IXZA 5DHTA 5TC4A 1JEAA 1Q21A 2G9NA 5C8VA 2I7XA 2C00A 1ID1A 5CYFA 4HNTA 4FOPA 3UVEA 3DWGA 4P22A 1UWVA 2FLWA 3PPVA 3Q7QA 3R5KA 4D9MA 4RTMA 3HB9A 5FWXA 5LUAA 1Y42X 2AG1A 4D8XA 4YUAA 1QFYA 3EZ9A 2FA9A 3VSDA 5AM2A 5I7RA 3W5BA 1RWQA 4HDAA 2EQ5A 2YWGA 3LU1A 3E05A 3FPGA 4LY9A 4UULA 4HNQA 4IKOA 3WGMA 5EUCA 2H8KA 2YZ7A 4UM5A 4EG3A 2GN0A 4YT4A 1KBZA 1AHNA 1C1DB 2PV0A 2Z95A 3P0IA 1FX0A 4JZKA 5AM1A 4ZVUA 3FVWA 3IOCA 5C1IA 1UZNA 1H6DA 1NXXA 1BEUB 4HDQB 2CSUA 3FOFC 2EIXA 4UXJA 3TSZA 2AFHB 3LHKA 4XFKA 5AQ1A 5AKLA 1OFTA 2R3SA 2C7BA 3FNBA 1KY2A 4KC0A 4OHWA 4ZVNA 1SXPA 2HBQA 1VHTA 1GAEO 1PL7A 1OW3B 1SJ9A 5DX0A 2KHZA 1SRRA 3OWHA 2WM2A 1KKLA 2BFBB 2EKQA 2C4KA 4HBGA 4A6XA 3HEMA 3ZDYB 4Z0PA 4JXZA 1XB2A 5EXDA 1TT5A 1O77A 3N2LA 5F2OA 3L1KA 1KDZA 4BWYA 3CJTA 4WCVA 3B6EA 2QTZA 1JQAA 1DINA 1DLJA 1PQPA 2R4UA 5HGJA 4KRGA 5KVQA 1REQA 5CGQB 5HCUA 3RYIB 3NH6A 1Z06A 4URVR 5LOVF 1SC6A 2QK4A 1LK5A 4L6CA 5K8CA 1U9IA 4R51A 2HQOA 1QH1B 3EXEA 5EJ6A 1I6LA 2HPHA 4NCHA 4OMFG 2OEPA 2I54A 1OH7A 2W22A 3GDGA 4A1FA 2ECKA 4JT2A 1IEWA 4L4SA 1P2SA 2V74B 1Z6XA 2J6IA 1K6JA 2H1SA 4MW1A 3MFQA 1Y5RA 4PO1A 4WECA 4J1TA 2IPXA 3HB7A 2FGJA 3LCVB 1I9CA 2QZ9A 2J3QA 1WOYA 3QG5A 2DUJA 1P1KA 4MUKA 5IJ0B 4ALJA 4QRDA 3K70D 2HT1A 1HT3A 4FYHA 4PTYA 1Y8RB 1C30A 3E5NA 1JJBA 3JY6A 4BY9E 4RGVA 2GBPA 1II9A 2DFLA 4LDRA 4K3VA 2JFBA 1NBMD 1QQ5A 1DEOA 1JI3A 1K63A 4FBMA 3TJZA 3DPIA 3TRFA 3TRIA 2WAYA 1AX9A 3JYNA 2QUJA 2XUOA 1YBMA 4X1OA 1SXJC 1JILA 1PJ2A 4KXQA 1NQOA 5CJ2A 4DXHA 3KDPA 3LS2A 2ZUFA 3A27A 1XL0A 1GGVA 5K0CA 3NBMA 2FPPA 3KOYA 1O4VA 3OEHA 4PEVA 4TQUS 5AJXA 3P0JA 5MDHA 1SD5A 2QE6A 2W43A 3A6GA 3NNNA 4BLTA 5AJVB 2BKLA 4IRMA 4NEGA 3C48A 4Z4QA 1D0SA 3LHDA 3JAKA 4N47A 5LZ4A 2F1JA 5DTQA 3QNWA 1X7ZA 5HEKA 5CCBA 4W1QA 3I04A 1S02A 3BIXA 4BBJA 4Z53A 2OBBA 4S1PA 4BJ5A 3PUWA 3ASYA 4HNUA 4Z7JA 5M34A 4Y18A 5IFKA 1UADA 1T9HA 1XK7A 3WMFA 3UHOA 1J0DA 4W7SA 2R6CA 3WBBA 1HSOA 1JEJA 4X1IB 2YIMA 4S35A 3X1WA 2DG2A 2DTDA 2Q3CA 4L0CA 4ZHQB 2O8FA 1Z6QA 1X8JA 1MOQA 1W35A 1XCPA 2Q6KA 3A4TA 3P4UA 3E1GA 1Z45A 3OE7D 4FYPA 3C6KA 3CRQA 2B83A 3ML1A 1M6YA 3QIAA 3UV3A 3KR2A 4DMKA 2GD6A 2P1RA 3QLVC 3F7OA 4E3ZA 2J4DA 5KQLA 2HGSA 5K3BA 1SBNE 1L5QA 4I50B 4YJDA 4Y2TA 2VQFB 1M2VA 2XGJA 3EGWA 1KSFX 2Q3DA 1E7QA 1H3NA 1YS2X 4RZHA 5TQJA 2QN8A 3RREA 3OG9A 2E4WA 2HWUA 4ZD6A 1CHNA 4N5LA 3L0DA 1I72B 3H5VA 2VDWA 2C0CA 4P4SA 3S5JA 4DG9A 4QBGB 3AXSA 1TK9A 3HFSA 4D3DA 1E3MA 1C14A 1RQRA 1Z6AA 2QMQA 1J2JA 4JBGA 3ZDZB 3ZWQA 2Z3ZA 3TIIA 3RF6A 3TTWA 2G9UA 2ZQZA 4KYIB 3DEAA 4JC8A 4FYYA 4CEJB 1AUXA 1IJFA 4O2RA 1XE3A 4RGYA 1Y5IA 1UM8A 3U48A 5K0GA 4E13A 4B85A 2VYVA 3ETGA 3A6DA 4UKDA 5JNTA 2AW3A 3TXXA 5CVDA 5DBFA 3GJ6A 4KO2S 2VRCA 3CLVA 3D8UA 1OV6A 1VGQA 4JP2A 3T9BA 2XWJI 3V6LA 3DE4X 3NI2A 1AKTA 2NU6A 4B09A 2AFIA 2VFAA 2PWYA 3BK1A 3RBAA 3V46A 1Z2AA 4A16A 5HXAA 1B8VA 2C2ZA 4RXTA 1J42A 4IIXA 4QDOA 3DVAA 1G21A 1DAGA 2JASA 3MS4A 1XRPA 4F9FA 4A8HA 3R3UA 4CQNA 3ZIAA 1V39A 4M1EA 1G5IA 4BE4A 5C1BA 1TCBA 4PYOA 3GUYA 1CR0A 1QUFA 2PEZA 3VU1A 3G9XA 1XZNA 3IEPA 5JS2A 5I47A 1NW9B 2FMXA 2ZWMA 1HG1A 4Y9TA 3IPRA 3O95A 4NWIA 5HK9A 8ABPA 4TQ9A 3IVGA 1IN8A 2VDOB 3AKYA 4LQCA 4ZAFA 4JENA 3H2YA 2JLVA 1AS0A 4MQMA 2WIAA 3T9EA 2WV9A 3IDZA 1U65A 1L9XA 2C3PA 4YACA 1G5PA 2Z5LA 5BYJA 3SXJA 5KTRA 3IBTA 4TYPA 4NE7A 5KNBA 4PFJA 3HKCA 1KOFA 3L43A 4EJ2A 3DOFA 2IUFA 3RC7A 1ADBA 3JD1A 3IP7A 4DQVA 5TF4A 5C5IA 5TNXA 2GGSA 1J1ZA 3GB9A 4MI3A 4OX9Y 2XCRB 3DF7A 1GVHA 1FY2A 4P6VF 4EY7A 4KQKA 1T4CB 3UATA 3ZS9A 4AMZA 1RZRD 1FUYB 4GC5A 1BS1A 2O23A 4UUPA 3IL2A 3EQ8A 2IYVA 3PDWA 2OP0A 2HRCA 2JJ1D 4RL6A 3QPCA 2PRIA 3E5MA 1KZYC 1ISSA 1J06A 4ZO6A 4YRDA 3SYMA 2W2OA 4EYGA 3E53A 2ZRJA 4MVYA 4RS4A 4MUGA 2NADA 2PUEA 2HR1A 3ZH2A 3RSQA 1G4AE 5FO1A 3NTRA 5CB4A 1CZHA 1JUDA 1QAMA 2E55A 3PCTA 2IYUA 4IJ5A 1FYEA 2XZTA 3IUSA 1ZEJA 2O1XA 4ENTA 3GQVA 5CFPA 1NXVA 4FLFA 2R9VA 2A0KA 3LUJA 3C6BA 5BWCA 1RHUA 1ZWKA 2IHTA 1IN6A 2C7OA 1U6IA 1X7HA 3JYPA 3NHKA 4LXYA 4JA2A 4N6NA 3WRWA 1U2ZA 2D4AA 2OVBA 1N0IA 5CLLA 4ND5A 1CULC 4A26A 4M0DA 5HCIA 4TZ0A 1QH8A 3RAPR 3SPXA 4FNMA 1BWRA 4Q19A 1XUOA 2FSVC 4DLBA 2PY6A 4HEA6 4BX9A 1GNSA 3OEYA 1PUIA 2DFDA 2HMYB 4B44A 3JWJA 3BD6A 4I5FA 1XTPA 2YV2A 4HN9A 5FNVB 2QT9A 5ICGA 3M3PA 3OZIA 1MX1A 3LBIA 4G0NA 1IHYA 2EYUA 3LD9A 3EIUA 4PICA 4X6XA 3SBEA 4BIIA 5AIAA 4NAVA 4D4KA 1S0UA 4LRWA 2J9ZB 3EEFA 4RELA 2E4AA 1Z5OA 3TW8B 2DWOA 2VZ0A 5KPDA 3WQSB 1IY9A 1R0WA 1YCFA 3QXHA 2UZAA 2YWXA 3DO6A 2FPSA 4RWEA 5EMLA 4HDMB 1UPXA 2FUG1 1Z12A 2PZ8A 2FFBA 3U2QA 3A7EA 4DV1B 1OX6A 1XMIA 4R0VA 2QE7A 2VQSA 5I9SA 3TAHA 4B6PA 1DS6A 5JAIA 3WS7A 3PC6A 1K9SA 5AVSA 2QI9C 1RI1A 2E6UX 2EDCA 5FPQA 3KCNA 2GAIA 4D0RA 4IEIA 2HJHA 1E1CA 4BV9A 2GF0A 1RRGA 3V55A 2GVZC 2OV1A 1TI7A 1MPTA 3KHSA 3Q3IA 5CYGA 4Y2RA 1QYIA 3QKIA 2DR3A 4FTWA 1V8BA 3EBOA 2ASEA 4D9HA 3PLAE 3FWPA 3I8XA 3HBMA 4CMJA 1NXTA 3AEQB 3BBLA 1RWPA 2Q8QA 1ZGJA 3DMPA 4FUTA 4IXWA 3AR4A 4NSNA 1O6ZA 3EXHC 3OLXA 3VXKA 3L0CA 1TNDA 3NHJA 4L75A 4LWQA 1ILWA 1FVFA 2PANA 4MV8A 5BN4B 1NN5A 1EFCA 1XD8A 1K08A 2RHTA 3NASA 1UAYA 4D57A 5FJJA 1UWLA 4FFVA 1EP9A 1TMYA 4I3HA 4YV7A 3L7OA 2VNKA 1B1AA 3BE8A 4LYAA 5C53B 1JG3A 1WS6A