3GFIA

Crystal structure of st1710 complexed with its promoter dna
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
143
structure length
143
Chain Sequence
SNENRIQIMSTIAKIYRAMSRELNRRLGELNLSYLDFLVLRATSDGPKTMAYLANRYFVTQSAITASVDKLEEMGLVVRVRDREDRRKILIEITEKGLETFNKGIEIYKKLANEVTGDLSEDEVILVLDKISKILKRIEEISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 146aa long hypothetical transcriptional regulator
publication title ST1710-DNA complex crystal structure reveals the DNA binding mechanism of the MarR family of regulators.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Transcription/dna
total genus 56
structure length 143
sequence length 143
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3gfiA00
3QU6A 1HQCA 3N4MA 2TDXA 1FX7A 4E70A 3ZQ7A 2GAUA 4RS8A 1QZZA 2XAHA 2W25A 2HDCA 4BHCA 2XIGA 1SD7A 2LF7A 2DTRA 2STWA 4WXCA 1DUXC 2V1UA 3KEOA 2HGCA 2ZMEB 3CUQC 4EJOA 3COAC 2QQAA 3M7GA 2E7XA 4A0XA 2OQGA 4EMSA 1XSVA 3DF8A 4KIFA 4HLXA 4ESFA 1RUOA 5L3DA 4BHBA 4EJTA 3P7NA 3WE3A 4U0WA 4KA4A 4JK1X 4M9ZA 2RKHA 4HQEA 3QOPA 2ESHA 2VONA 2LKPA 5DD8A 5CLSA 2QENA 4LB5A 1I1GA 3HTSB 1KA8A 1GHCA 4GXOA 4L5IA 4JQFA 2EV6A 4R79A 4AIJA 4HQMA 4G6QA 5ED4A 3DKWA 4CO8A 1IXSB 1T6SA 4LK1F 3K0LA 3HSFA 2IA2A 1B9NA 3REOA 4MQ9F 2W24A 4I2OA 3FX3A 1I6XA 3E97A 4K2EA 2BV6A 4Z2YA 2KJCA 3I58A 1PDNC 3ZMTA 2ZKZA 2GWRA 4B8XA 1IRFA 3TO9A 2F5FA 5BPIA 4L0ZB 3J80K 3GYHX 5D5UB 1RNLA 1KU2A 2F5EA 3I71A 1U2WA 1SMTA 3E5UA 5FO5A 5HS8A 4BXUA 5CYVA 3J80Z 5D5VB 2XROA 4N9HA 4XSZF 3SFZA 3BJOA 4PGGA 3CUOA 1ZHFA 4HW0A 3IC7A 5AIQA 4O3MA 5H6RA 4CDGA 4NHJA 1IAWA 1XMKA 4U7DA 1F4KA 2M30A 1E2XA 1IN4A 2AS5F 5FB2A 4HBLA 4WF2A 4M6XA 2E7WA 3KZZA 5L3BA 4PCQA 3DPTA 4UNOA 2EFOA 3R4KA 4OU0A 3E6DA 1FYLA 1REPC 2OZ6A 1J59A 3I59A 3ZN0A 1KQ0A 5DDGA 3CTAA 1KU9A 4JBAA 5ICFA 4OIOF 2BE5F 3VEPA 3MZYA 5IT9Z 4OIQF 3I59B 2UZKA 2A3SA 2FBIA 1UHWA 1P4AA 3TDUC 1XB4A 3KLOA 4UVAA 3RJPA 4ZH4F 1FSEA 2Z3YA 1ZRCA 3LAJA 5CVIA 3EQLF 5K5RA 4KYWA 4I01A 2VXZA 4KMFA 5ICCA 3BZ6A 2PMHA 3Q9VA 3NRVA 4HZFA 4U7BA 3HOTA 2O61A 1STZA 4LGWA 2MD5A 2W85A 2L02A 4BQAA 5LEJA 3WTVC 1MGTA 4EV0A 3WTTC 3U1DA 1J2XA 2LNBA 3TGNA 3CO7C 1KU3A 1HW1A 2FQ3A 4XRFA 4XLNF 3K1PA 4EM2A 2V9VA 3ZMUA 3FXRA 1FPQA 3FM5A 1SD6A 4XSXF 2ISZA 3F8NA 1U78A 2VBWA 1ZRFA 2XAQA 1HKSA 3ELKA 5D5XB 3BY6A 3FHZA 1EH6A 1MKMA 1XGNA 4L18B 3K1NA 4N9IA 1R7JA 2Q8KA 5HS9A 3WTUC 3BPVA 3M9AA 2ZJ2A 1CF7A 3HRUA 2V1XA 4HLYA 5LHHA 1FZPB 2RVCA 1BIBA 3DPLC 1JGSA 2VBZA 4RB3C 3BROA 1CF7B 1HW5A 2FXAA 3JAMZ 2MLKA 3G73A 4N0BA 5ICEA 4RB1A 1ZGAA 4BYYA 1B6AA 1BJAA 1VTNC 2O3FA 3EUHA 3F6OA 2H27A 2XAFA 2XV4S 5JR3A 4OIRF 3HRSA 3RDIA 5ILSA 3HSRA 4G94A 2MH2A 1UCRA 2D2WA 2QZ8A 2G9WA 3ZMZA 5DUIA 2VT2A 2DI3A 3BP8A 1ZRDA 1P4WA 1RIOH 4YFNF 2G7HA 3GEZA 2BBYA 1J9IA 4RGXA 2EFWA 4R8HA 2NRAC 2KIMA 5LGTA 5LRRA 3WTXC 3I0TA 2A69F 2PJPA 1P6RA 3FMRA 2K86A 4O6JA 2FBHA 1BIAA 3V7CA 2WV0A 2D1VA 1OYYA 2YX7A 1LDJA 3JW4A 2X0LA 1FYKA 4YFKF 4P9UA 1R58A 1SMYF 3CLOA 1TNTA 3F8FA 3WTZA 5E1ZB 1YO5C 1U3EM 3FWEA 3F22A 3RKWA 1G4DA 4WX9A 4ZYEA 5FLXK 2GIVA 1HXDA 4HOBA 5HDGA 2FEZA 5ILVA 2JPBA 2A6EF 5FLXZ 4WK8F 1OYWA 1R1UA 3LA7A 1IUYA 2CSOA 2MLGA 1TQMA 3K9TA 3EETA 4LMYA 2P5LC 1XN7A 2W57A 2GQQA 1R22A 2RNJA 2NNYA 3KP5A 3I53A 4EM1A 3WU1B 3WG9A 2XHKA 1ON1A 3Q5FA 3GFLA 2K27A 2E1NA 1K6OA 1LNWA 2ELHA 2VOPA 1MDMA 4P55A 4GYGA 1FWZA 1G6NA 1U5TA 3TO7A 2FMYA 4EJUA 3TQNA 3EYYA 2GXGA 1MDMB 3QU3A 1JE8A 3RYRA 1YYVA 4KICA 4MEXF 1U5TB 2FRHA 4ZZLA 1Z6RA 3OV8A 3IRQA 1Q1HA 4G9YA 2XRNA 3ABUA 3PQJA 1TW2A 2JSCA 4EVIA 2DFIA 2HZTA 4BAYA 3GZ6A 4U0VA 1D3YA 1P92A 1TBXA 3T5XA 2CQKA 4IVNA 3MAJA 6PAXA 3IWFA 2ZMEA 1USTA 2R7FA 3N97A 1F1ZA 2FBKA 1FYMA 3GO5A 2BEOA 4G8XA 1HKQA 1F9NA 4HV6A 4M74A 3FM3A 5HLIA 2O0YA 1U6GA 3JTHA 5K5OA 3LA3A 2XKPA 2OQRA 3EYIA 2EV5A 4OINF 2IT0A 3MZHA 4OMZA 2XKOA 3WE2A 2IW5A 3KETA 1MZBA 2Z33A 2VBYA 4ZYGA 4EJWA 2JPCA 1ODDA 4FT8A 2EK5A 2DU9A 4Y17A 1GXQA 1FY7A 1YW9A 3J81K 2OAZA 3K1MA 3GF2A 2DQLA 5ICGA 3P9CA 1O3QA 4ENJA 2Z5UA 3J81Z 3ABTA 1S7AA 4FX4A 1P2FA 4H0EA 1T0FA 2B0LA 1DPUA 1XDUA 1XGSA 1OMIA 3CDHA 5K5QA 4P9FA 5E8IA 3LA2A 1R1VA 2A6HF 2DT5A 2V6CA 3HSEA 3ECHA 2VODA 3LQQA 4EM0B 1ULYA 2FU4A 2VE8A 2LF8A 1TLHB 5H20A 2KIFA 5CVUA 5E18F 1O7FA 3HRTA 3QP6A 3BDDA 2F5CA 1IRGA 4GGGA 2JRTA 4S05A 2FA5A 3TOBA 1R5HA 4AWXB 2IA0A 1A04A 4RGUA 2J5PA 4G7OF 4G7HF 1RZ4A 1R23A 2HQNA 4I02A 4WXDA 3VODA 1CGPA 2L01A 1OKRA 4RAZA 1L3LA 2RV8A 3IRRA 2EV0A 3FMSA 5JFRA 4PZJA 1I5ZA 3H3ZA 2PG4A 1FC3A 2A5YB 2M8EA 1U5TC 1IN6A 3R0AA 2ADUA 3QRFF 4EQQA 2HR3A 3DEUA 3IKVA 3T8TA 2PN6A 4I09A 2ZO4A 3WTYC 1LJ9A 3JSOA 1O3TA 5FFZA 3WU0A 2DAOA 1ZREA 2OD5A 4YIFA 2ZNZA 4ENKA 2IVMA 3L2CA 3R0JA 3R60A 1FLIA 2M5WA 2L54A 2CGPA 1J7KA 2L4MA 1IN8A 1SFUA 5J8FA 2J5OA 2HQRA 4RGSA 1XMAA 4HDUA 2L4AA 3F8MA 2PQ8A 4G6DA 4MQVA 1PP7U 2HTSA 5BS6A 3B02A 2FOKA 3RPQA 1JXSA 2EA4A 5ERIA 3KP6A 4UVCA 1RI7A 3JTGA 4XLPF 3GFMA 4S04A 3RIRA 2RC4A 4I0BA 4A12A 5FFXA 1AWCA 4Q4ZF 3CJNA 1FP1D 3K2ZA 4MTEA 2WC2A 1IZ1A 1FP2A 2CYYA 3HOSA 2K4BA 3KE2A 1T2KA 4GO1A 3P9IA 3HTUA 3F3XA 1KQ8A 1QBJA 3V8LA 1ZAOA 5DV5A 3F21A 1XSDA 1T39A 4MGRA 3ULQB 2XVCA 3O6BB 3V8KA 2HYFA 2DQRA 4Y13A 5KK1A 1YS7A 2IA1A 1IN7A 4Y15A 2HTJA 3KP4A 4RB2C 3E5QA 4CYDA 2IRFG 2HWVA 2EA2A 3SQNA 5E8GA 4G7ZF 4LLGF 4A5MA 2VT3A 1MJAA 4A6DA 2CFXA 4KNYA 2HS5A 2P5KA 5TRDA 3H92A 4QLCU 1ON2A 3HRMA 3DQVC 4XBFA 1EV7A 2M1BA 5JHUA 3C7JA 5F64A 1HSTA 3KLNA 2QBYA 3O2PE 2L3DA 4ASNA 5E17F 3DP7A 1OYIA 2VE9A 3V4GA 3P9KA 2QBYB 5BQTA 4YG2F 1MD0A 1IXRC 2HFHA 4MEYF 4M72A 1LB2A 1YS6A 4ON0A 1EH8A 2KKOA 3GFIA 3TKYA 1V3FA 4KDPA 5DYMA 4A0ZA 3WGHA 2XGXA 1D5VA 3HYIA 2KJBA 3H3UA 1DPRA 1FT9A 1J5YA 2FNAA 4L9TA 2IJLA 5F1RA 3V8JA 5JVTA 2AXLA 1ZH5A 3U9GA 4UV9A 1ZG5A 1LVAA 3GLXA 2YU3A 2KRFA 3DXJF 4RB0A 1BOAA 1O57A 3M8FA 1FBQA 1SD5A 2F5DA 3FF5A 4HX7A 2EFQA 1KYZA 4MNUA 3F6VA 3E6BA 5L3FA 1TQIA 2HKOA 1KGSA 3M1EA 4AIKA 4KIBA 5CVVA 3JSPA 2H94A 1G3YA 2M45A 2P7CB 2Y0MA 3R6SA 4M71A 1ZARA 4ENMA 2STTA 1BN5A 2XAJA 4A0YA 4U0YA 5A2QK 1GVJA 4RAYA 5DEQA 4AD9A 5HDNA 4KIGA 1J75A 1R00A 1D8KA 1YLFA 2M87A 5LEKA 4IRIA 1IW7F 3ML6A 3PQKA 2NS0A 4Q5SF 4EGZA 5DCMA 2VN2A 2FNPA 2VBXA 3GVAA 4M9SA 2WTEA 3KEQA 3S2WA 4L9NA 1ZLJA 5DCMB 1BC8C 2V79A 1QZYA 4AIHA 2P4WA 3LAPA 3ZMDA 5HLGA 1H9GA 3E6MA 2RQPA 3D5LA 5CJ9A 4UHTA 4YFXF 2HKXA 4EJVA 1SFEA 3HUGA 5FD5A 4HF1A 5AONA 3ZPLA 3GW2A 2PMUA 2P8TA 4L9VA 3VFZA 2JT1A 1FSHA 3G3ZA 1O3RA 4EGYA 2DPDA 4IF4A 1YQAA 3IWZA 3AAFA 2P7VB 1E17A 4KT5C 3HIFA 3IL2A 1QQIA 3DFGA 3NQOA 4L5JA 3GX4X 1XDSA 1H0MA 2YR2A 3GZ5A 1ZLKA 4KMUX 2RDPA 3ROUA 4IHSA 4LFUA 1T38A 2GZWA 4FX0A 3L00A 1GXPA 1OPCA 1W7PD 5DUKA 3QAHA 1Y0UA 1BI2A 2ACJA 2XASA 2ZXJA 4IXAA 1NHAA 4HX8A 3LFKA 3I54A 3MFKA 3T1BA 3ECOA 2FF4A 1WSUA 3J7AO 3BJ6A 1Z9CA 3HHGA 4HAMA 4DQ2A 1OR7A 3I5UA 3KCCA 3KP2A 1JHFA 2UXXA 3BOQA 2MA3A 3C3WA 5H6QA 2EWNA 2OA4A 5DD4A 1YG2A 3VB2A 2W84A 4CGZA 2NYXA 4QWQA 1XCVA 1BI0A 4Q48A 2MC3A 2P6SA 1K7AA 3T0YA 2P6TA 5D4RA 5D8LB 1S7OA 4HF0A 1ZYRF 2DPUA 2ZFWA 2DW4A 5K1YA 3I4PA 3MCZA 3VOEA 2HEOA 3WGGA 2ZCWA 2R7DA 1B59A 3L09A 1QGPA 2COMA 4ESJA 1KYWA 2WWYA 3FXQA 3KP3A 5LBQA 4L0YB 2FSWA 4LG0A 3ZMVA 1XCBA 1FBUA 1L0OC 1HSJA 2GA2A 1Z05A 2H6BA 3QPTA 4NB5A 2F2EA 4NQWA 4LG0B 3L7WA 4IHTA 3SZPA 1S3JA 5LGNA 5LRSA 2A68F 1DP7P 3LWFA 2CO5A 2QUFA 5KVRA 1QNTA 4UXNA 2X4HA 2CW0F 1HKTA 2K7LA 3F72A 4BHPA 1UHMA 3TOAA 2DBBA 2OU2A 4U88A 2O8XA 3FXUA 2UXNA 1ZN2A 4LB6B 1H9TA 2UWMA 2PBIA 4I0AA 5D4SA 2RN7A 4TV7A 1R5GA 5J6XA 1X3UA 1W5TA 3ZN1A 3B73A 5BOXA 1S6LA 4P5OA 1FBSA 1U8RA 1RUNA 2MH9A 3GWZA 5EEGA 2G7UA 4IRGA 4ZYDA 1BBYA 1Z6TA 3M8EA 4HA8A 3MQ0A 2O03A 4CICA 3BJAA 3GFJA 3WODF 1F5TA 4GYIA 3W6JB 3EDPA 1BI3A 2VC0A 3C18A 1IXCA 3RPUA 3KZYA 2XUBA 2OZUA 5J8CA 1ONVA 1BM9A 5D5WB 2A07F 1XGOA 4M9XA 2O6GE 4ETSA 4I98B 4LLNA 5D8KB 5FD6A 1HW2A 1B4AA 1XD7A 4ESBA 1G3TA 4L9JA 4M73A 1R36A 2CG4A 4D0PA 4ENNA 1I27A 1WI9A 3D0SA 1SAXA 3IHUA 4PGHA 5EEHA 4P96A 5HLHA 4HYEA 3ZP5A 2CWEA 2DK5A 4CHUA 4HX4A 1YTYA 5IT9K 2HOEA 4HDVA 2FE3A 2VOOA 4CXFA 3E6CC 1O7LA 2YX4A 2QVOA 3QPHA 4R1HA 1IN5A 2P5VA 2EJRA 2EFPA 3WGIA 5FGMA 2QLZA 2Q0OA 2EFNA 1TQPA 2PEXA 2ZNYA 2FMLA 3W6KB 1QPMA 1JHHA 1G3SA 3LSTA 3E3VA 2IPQX 1W7PA 1W5SA 3R61A 4KN4X 1T98A 4MHGA 2DO7A 1W4MA 5BPDA 1IF1A 3KP7A 3WTWC 1WRJA 1Z7UA 4KN7X 1LDKB 3TDZC 1W7PB 2QWWA 2DK8A 4PDKA 4Q47A 3GXOA 5D6FA 4LK0F 1FOKA 1TNSA 1UFMA 3MWMA 4A2UA 1KU7A 4OOIA 1Z91A 4FHTA 3L9FA 2XAGA 4OMYA 3Q9SA 4BH9A 5F6FA 3NEUA 2PFBA 1LEBA 1QO0D 3T8RA 2PI0A 5IT3A 2K02A 3DV8A 5HVQC 3ERED 3LQRA 5LGUA 1FNNA 2NAZA 5E1WA 2ISYA 1WQ2A 1USSA 2Z9OA 4LLLA 1ZG3A 2Z99A 3JAMK 1ZGJA 3BPXA 1BC7C 4LD5A 2ETHA 1PUEE 2QQ9A 4DNCA 1LQ1A 4IJAA 1D8JA 3C1DA 2E1CA 3IKTA 4KUMA 4UV8A 1YFHA 4MTDA 4GCVA 4KFCA 4A5NA 2JTVA 3RKYA 5DCFA 1TTYA 4UVBA 4ZYHA 3RTRA 4A6EA 2GXBA 1LDDA 3FMQA 2D1HA 1DDNA 3SHFA 4CZZA 1EH7A 4M6YA 4ZZDA 3K69A 1PP8F 2MBFA 2Y48A 3CUQA 1G3WA 4WCGA 2H6CA 5L3GA 2HYGD 3CO6C 1YW8A 4OIPF 2YSRA 1YIOA 3V7SA 1P4XA 3E5XA 2R3SA 5HDKA 3CUQB 2ZBKA 5ILUA 3F8BA 3TO6A 3MEXA 4O5VA 5AIPA 3PFIA 5HOOA 4AVPA 1XSXA 1SFXA 5BMZA 1UB9A 2LSOA 2QYOA 2GA1A 1WWXA 4BNCA 2Y75A 2K4JA 1WKMA 2LDUA 5LHGA 2JZYA 1ZG1A 3RI4A 2QM3A 1KQ9A 1B9MA 2NNNA 5TJJA 1J0RA 5LLQA 3F23A 5HS7A 1C0WA 1BI1A 5A2QZ 1S8NA 1B1BA 4IRHA 3I64A 2ESNA 2KIUA 1R1TA 2RGVA 2PLYA 2QQBA 3GUDA 3U2RA 3BWGA 1S29A 3O3KA 3RYPA 3V7RA 3OOPA 3QP5A 4YIIA 2YPRA 4HV5A 1XGMA 4I7HA 4UUVA 5E1XA 1SD4A 2BYVE 4RGRA 1YW7A 5E20A 2IP2A 2Q2EA 5CVJA 5D6EA 4B09A 2D45A 4WWCA 4LJZF 2C6YA 3F8CA 4HF2A 3ISPA 3RKXA 3KFWX 3SZTA 5JI6A 3HHHA 5CVRA 4F7ZA 1Z1DA 2H09A 3SXYA 1HBXG 5L3EA 2V1DA 1K79A 1MJBA 4WXHA 1K78A 1V4RA 1O3SA 2BGCA 5LHIA 4IPAA 1AOYA 2OBPA 2DLLA 2A61A 2VC1A 1LEAA 2EB7A 1K78B 3ZMSA 3FZVA 5L3CA 3WTSC 1I1SA 1MJ9A 1TW3A
chains in the Genus database with same CATH superfamily
2E5ZA 3UR3C 3QU6A 1HQCA 2RQQA 4KITB 3N4MA 2TDXA 1FX7A 2ECCA 2MABA 4E70A 3ZQ7A 2GAUA 4RS8A 1QZZA 3MMYB 2XAHA 2W25A 4XONA 2HDCA 3EUHC 4F52A 2H8WA 2QGUA 4BHCA 4XRMA 3CD6I 1YE9A 2XIGA 1SD7A 3H1CA 1IDYA 4ZTJA 2LF7A 1N78A 2DTRA 2VPRA 2STWA 4BY1J 4WXCA 2W7NA 3HC7A 1DUXC 3BZCA 3KEOA 4ABZA 2F5VA 2HGCA 2ZMEB 2V1UA 2R7SA 5GAHJ 3C2BA 3CUQC 3ZQLA 2HVRA 4EJOA 3FK7A 3D1NI 3COAC 2QQAA 3M7GA 2E7XA 1GV5A 2IGKA 3OYMA 1BR1A 1HC8A 4A0XA 2OQGA 4EMSA 2V7FA 4NDLA 1XSVA 5CKTA 3DF8A 4JOMA 2KQRA 4KIFA 4HLXA 4B48A 1RKWA 4ESFA 1RUOA 1MMSA 1SAUA 3HOYJ 5L3DA 4S0HB 2E19A 2IBDA 4BHBA 4EJTA 3GTMJ 3CQZJ 3P7NA 3IP4B 2EH3A 2BVLA 3WE3A 1B72A 1X1CA 4U0WA 4KA4A 1X19A 4JK1X 4XLAA 3ZQIA 4FISA 4M9ZA 3CCRI 2RKHA 3D5SC 3LNQA 4HQEA 1JTYA 3GZNB 3QOPA 2ESHA 2ID3A 1QVUA 1B72B 2VONA 4E6KG 3LSJA 2LKPA 2CV2A 2HOTA 5DD8A 3HPGA 5CLSA 2KDZA 1X3WB 2QENA 4LB5A 1I1GA 3HTSB 3GTPJ 3A1YA 4E7JA 1KA8A 1DGWY 1N75A 1GHCA 4XN3A 4GXOA 1IO2A 1MMDA 2CRGA 4L5IA 4JQFA 2E1MB 2OC6A 2EV6A 1OCOH 4R79A 3ZOBA 4M3DA 4AIJA 3K4JA 1MBGA 2ICWG 1IJWC 2Q1ZB 4HQMA 4G6QA 3IV5A 4BACA 5ED4A 3DKWA 4CO8A 1IXSB 1T6SA 2XC7A 4FTHA 4LK1F 3K0LA 3HSFA 2IA2A 1ACIA 1B9NA 1J09A 1P7JA 3REOA 4F92B 4MQ9F 3C2HA 2AHQA 3ONQA 3BT9A 2W24A 1VNDA 1O4XA 4XRSA 4I2OA 3FX3A 1SFKA 1I6XA 3E97A 4K2EA 4ZDOA 3JR9A 2BV6A 3S3OA 3IAM2 4Z2YA 2KJCA 1EA3A 1MNEA 4J00A 4HG2A 1Z0XA 4C9YA 3VYUB 3I58A 2QA4I 2JWTA 1MMNA 1PDNC 3F9KA 3RZDJ 1MBJA 2MYSA 4H4KC 3K4NA 3ZMTA 2ZKZA 3OYDA 2GWRA 4RMNA 4B8XA 2VPLA 5EYRA 5K7ZA 5IYDJ 2XGDA 1IRFA 3E7LA 3TO9A 2F5FA 5BPIA 4L0ZB 4BBRJ 3PL8A 3J80K 1DP3A 3OYEA 3GYHX 5D5UB 2OCEA 1YJNI 3VWBA 1RNLA 4X6AJ 4Y7NJ 2HI3A 4IHWA 1KU2A 2F5EA 1OCTC 3CP2A 3I71A 4B43A 3CCUI 1U2WA 1N25A 3CJRB 2L2OA 3GLLA 1SMTA 1V55H 3E5UA 5CQEA 5FO5A 5HS8A 4BXUA 5CYVA 3RSNA 3J80Z 1W0UA 5D5VB 2XROA 2YS9A 3FBNB 4N9HA 4XSZF 3SFZA 2EIJH 3BJOA 4PGGA 4HPQA 2LG4A 5FRNA 1SFOJ 3CUOA 3QPSA 2LH9A 1ZHFA 2OCCH 4HW0A 1HDDC 3VPRA 3CMAI 3IC7A 5AIQA 4Y3OA 3PNVA 4O3MA 3HKZN 5H6RA 4CDGA 3GTJJ 2MC4A 2BOLA 4NHJA 3DEEA 1IAWA 1KZHA 3HB9A 1M1EB 1XMKA 4BEHB 1OCZH 3HL2A 4U7DA 1F4KA 1JUPA 2FD5A 2M30A 1E2XA 1RR8C 1IN4A 2AS5F 1G8XA 5FB2A 4HBLA 4WF2A 3OYGA 1MNMC 5FKOA 2X1CA 1GLNA 2IS2A 2W82A 2IAIA 4M6XA 3L1PA 3DCFA 1XS9A 2E7WA 3KZZA 3TBIA 4QIWN 5L3BA 4YIRX 4PCQA 4IOCF 1K4TA 2E2JJ 4A3CJ 2LLKA 3DPTA 4UNOA 2EFOA 5J40A 3R4KA 4OU0A 2X85A 3E6DA 1FYLA 4L5EA 2KZGA 1REPC 2NXNB 2OZ6A 3HDDA 1J59A 2XAUA 5FROA 2KRHA 2A6TA 2WY8Q 3I59A 3QPLA 4QSHA 3ZN0A 4XIDA 5TISC 4CCOA 1KQ0A 5DDGA 3CTAA 3FKIJ 1KU9A 2QSFX 4JBAA 5ICFA 4IQJA 4U87A 5M3FJ 4OIOF 5M5YJ 2M8GX 2BE5F 2JRMA 2R7QA 3VEPA 1JKRC 2V4JC 3MZYA 2HVQA 4OIQF 5IT9Z 3I59B 1V5FA 2V9PA 2ZMEC 2UZKA 3H3VK 2A3SA 2FBIA 1UHWA 1P4AA 2PMZN 2BW3A 4ZYAA 3FDYA 3CDIA 3HKZA 1XB4A 3KLOA 3TDUC 3W6VA 4UVAA 3RJPA 4ZH4F 1FSEA 5B5EC 2Z3YA 1ZRCA 4A3MJ 3LAJA 1WJ5A 5CVIA 3K4CA 3EQLF 5K5RA 4KYWA 4I01A 2VXZA 2BW3B 3MKZA 4BDZA 4KMFA 1TWGJ 3BZ6A 5ICCA 2BY0A 3OYBA 2PMHA 3Q9VA 3W2AA 3NRVA 2AO9A 4HZFA 4U7BA 2LD5A 2EZHA 3HOTA 2O61A 2IS6A 1STZA 4LGWA 2MD5A 4XLFA 2W85A 2L02A 1MBKA 1Z3YA 4C30A 4BQAA 1ETVA 1OCCH 1U8BA 2X51A 5LEJA 3WTVC 4XICA 2BHYA 1MGTA 4QTRA 4EV0A 2PJRA 2EIKH 3WTTC 3U1DA 1J2XA 1IUFA 1SVLA 2LNBA 3TGNA 4IOAF 1K61A 3CO7C 2R7UA 3K4MA 1UELB 1IG7A 4I76A 1ITYA 3I56I 1KU3A 2NOGA 1HW1A 4BKXA 2FQ3A 2JA6J 1GVDA 4B44A 3AFHA 2AQFA 2PJRB 3MZ8A 4XRFA 4BQNA 4XLNF 5F0CA 3PJRA 5FKMA 3K1PA 4EM2A 5J1YA 2E1MC 2V9VA 3LSPA 3ZMUA 3FXRA 1FPQA 2PMZA 3FM5A 5EF6A 1SD6A 4RM2A 4XSXF 2ISZA 3F8NA 1VQLI 3CCLI 4CSWA 1U78A 2VBWA 1ZRFA 1GDTA 2XAQA 1HKSA 3ELKA 3CESA 5D5XB 3BY6A 1TWCJ 4BY7J 3VDXA 4BL0B 3FHZA 1EH6A 1MKMA 1XGNA 1T0FC 2DOFA 1TT0A 3GTQJ 1G59A 2CU7A 4L18B 1N77A 3K1NA 4N9IA 1YIJI 3Q0VA 1R7JA 4CCKA 2Q8KA 5HS9A 5F1JA 3WTUC 3BPVA 1LE8A 1P9QC 4PSWA 3M9AA 1WJFA 3L2WA 2ZJ2A 1YOVB 1CF7A 3HRUA 2V1XA 4HLYA 3FXOA 2JK3A 5LHHA 5J4VA 1FZPB 2RVCA 1BIBA 1LE8B 3BR0A 2Z2SB 3DPLC 3W2WA 3OR1C 3HOXJ 3CLQA 1JGSA 2VBZA 4RB3C 2K9SA 2VASA 3BROA 2HQAA 1VQPI 1CF7B 1HW5A 2FXAA 5IYBJ 3JAMZ 2MLKA 3G73A 3CCSI 4N0BA 5ICEA 1WPKA 4EATA 4RB1A 1ZGAA 2DMUA 4RLQA 5FJ8J 5KCMA 2LYCA 3W2VA 1D0ZA 4A3LJ 4Y52J 3ABMH 4BYYA 1S7EA 2ZJPF 1B6AA 2H1LA 1BJAA 3GBGA 1VTNC 2DOEA 2O3FA 3EUHA 4B3AA 3H36A 2M7BA 4RLFA 1QHHD 3S14J 3F6OA 2H27A 2K9MA 3BR3A 3LL7A 2XAFA 2XV4S 5JR3A 3BR2A 4OIRF 2B9SA 3CCJI 3HRSA 2DJIA 3RDIA 3ZCOA 5ILSA 3HSRA 4G94A 1YHQI 2MH2A 1U9OA 1ETWA 1UCRA 2D2WA 3H5AA 2QZ8A 2G9WA 3G1MA 3BZKA 3ZMZA 5DUIA 2VT2A 3PNYA 5E3OA 3GTGJ 2DI3A 3JRCA 3BP8A 3QOEA 2EBIA 1P4WA 2ELKA 1RIOH 1ZRDA 5EDNA 1FTTA 3BCBA 3DTEA 3PIOF 5J4YA 3SDBA 1JKPC 4YFNF 2G7HA 3GEZA 4DIQA 2BBYA 4DOZA 1J9IA 4B4CA 4RGXA 1EF4A 2EFWA 4BXFA 2CQNA 4R8HA 2NRAC 2KIMA 2LRDA 5LRRA 5LGTA 3WTXC 3I0TA 2DDAA 4DZJA 2KISA 2A69F 1SVMA 4IHVA 2PJPA 1P6RA 2GIZA 3FMRA 2K86A 4O6JA 4FQGA 1AKHB 2HPIA 2FBHA 1BIAA 2JUCA 2MSYA 3V7CA 2R92J 3EPZA 2WV0A 3B6CA 2DMTA 2D1VA 1OYYA 2YX7A 1LDJA 3JW4A 3AL0C 2X0LA 1FYKA 3OYLA 4YFKF 2DA4A 2WAFA 5J1RA 3K7AJ 4P9UA 1R58A 1SMYF 5IP6A 3K4KA 3CLOA 4XQFA 1TNTA 3KYLA 3L2UA 4II2A 1YRNA 3BR1A 3G4SI 3F8FA 3WTZA 3QQAA 4UY8I 5E1ZB 1YO5C 2Z1DA 3CDLA 1U3EM 3FWEA 3BTIA 4BQQA 3F22A 3RKWA 3OIOA 1G4DA 1PUFA 4WX9A 3ZQFA 2VKDA 1YRNB 4ZYEA 4LITA 5FLXK 4YEJA 5LD2C 2GIVA 1HXDA 3PUBA 3BTCA 4HOBA 5HDGA 5J3LA 4A3IJ 1PUFB 4AYBA 2FEZA 2DYRH 2NS8A 4I99C 5ILVA 2JPBA 2A6EF 1T56A 2Y30A 1Z77A 4FETA 5FLXZ 4WK8F 3RKQA 1OYWA 1R1UA 3LA7A 1IUYA 2CSOA 2GOXB 2MLGA 1TQMA 3K9TA 3EETA 4LMYA 5B1BH 2P5LC 1XMXA 1A35A 1ERDA 1XN7A 2YU9J 2W57A 2W4SA 2GQQA 1R22A 1VQMI 1LUJB 2M4KA 3P5JA 2RNJA 3PSFA 4E4HA 2BY1A 2NNYA 3OYCA 1WFXA 3CCYA 3KP5A 4E7SA 1X4OA 1QHGA 3I53A 4EM1A 4JX6A 2WB1N 3WU1B 3WG9A 2IGOA 2XHKA 2ZJRF 1ON1A 2IGNA 3Q5FA 3GFLA 2K27A 2E1NA 3TW7A 1K6OA 1LNWA 1FEXA 2VQCA 3OS1A 1VQOI 4A93J 1WH5A 1A6IA 3HUGB 4A3KJ 2ELHA 1GV2A 2VOPA 5F27A 3PIPF 1MDMA 4P55A 4GYGA 2R7XA 1FWZA 1G6NA 1D5YA 4GFBA 3DTIA 1R4MB 1U5TA 3TO7A 4PFPA 2FMYA 5EZGA 3VSKA 4EJUA 1MH4A 3TQNA 1E3OC 1ETOA 3EYYA 2ZSHB 2GXGA 1MDMB 2DA5A 2VJ5A 3QU3A 1JGGA 3OMYA 1I39A 1JE8A 2QF7A 4YRVA 3RYRA 1YYVA 4KICA 2VQHA 4MLOA 4MEXF 1U5TB 2FRHA 4ZZLA 1Z6RA 3OV8A 3IRQA 5E3MA 2BXZA 2X6XA 3OYKA 4M3EA 1AHDP 1Q1HA 4G9YA 2XRNA 3ABUA 3PQJA 2L7KA 1TW2A 2JSCA 2XPUA 5K7FA 4EVIA 3K6GA 1ENHA 3ZXSA 1HF0A 1LVKA 2DFIA 2HZTA 3GMEA 5F0FA 4BAYA 2FX0A 3GZ6A 4U0VA 2LBFA 1D3YA 1P92A 4PJLA 1TBXA 3T5XA 2WB1A 4J01A 1Z67A 1R71A 2CQKA 2DYSH 4IVNA 4IO9F 3MAJA 6PAXA 3IWFA 2ZMEA 1USTA 2CW8A 3H9QA 2R7FA 2LBFB 3N97A 1F1ZA 3OYFA 2FBKA 1FYMA 3GO5A 1YX3A 2BEOA 4NNJA 3Q3SA 4G8XA 2CFOA 2NS7A 3WG7H 4C3HJ 1HKQA 3PM1A 4PUSA 1F9NA 4HV6A 4M74A 4DYCA 3IUOA 3A03A 3FM3A 5HLIA 1NK2P 4FE4A 1RETA 1U6GA 2O0YA 3LMMA 1BA5A 3JTHA 5K5OA 1K6YA 3VSLA 3AG1H 2JSPA 3LA3A 2XKPA 3HPHA 2OQRA 4M6VA 3WHCA 3EYIA 2EV5A 2X6WA 4D1QA 2X1EA 2DN0A 3A01A 4OINF 2CQXA 2IT0A 3G2BA 3MZHA 4OMZA 4E7HA 2XKOA 3WE2A 2IW5A 2DCEA 3KETA 1MZBA 1FIAA 3J7ZI 2Z33A 3OOUA 2VBYA 3A01B 2KFDA 4ZYGA 4EJWA 2JPCA 1ETQA 4A3DJ 1ODDA 4FT8A 2EK5A 3CC2I 4GRIA 3BLYA 2DU9A 2WV1A 4Y17A 5K7HA 1GXQA 4D9JA 2X1DA 1R4NB 1FY7A 1YW9A 1Y8QB 3J81K 3S3NA 2OAZA 3K1MA 3GF2A 2LREA 4YELA 2DQLA 3LFUA 5ICGA 3HOUJ 3P9CA 4G12A 1LFPA 2DTZA 1O3QA 4RAGA 2JA7J 4ENJA 1TWAJ 4NUBA 4MFDA 3HXLA 3IH2A 2COBA 2IXSA 2Z5UA 4KISA 3J81Z 3A02A 3ABTA 3CMEI 1S7AA 3K70D 3DWLE 2XPWA 4FX4A 2MW8A 1P2FA 1RPWA 3HG9A 3LSMA 1T0FA 2B0LA 4H0EA 1DPUA 1XDUA 2I5UA 2QEXI 3BC8A 4KT6A 1JJ6C 4FE7A 1XGSA 5CPRB 1OMIA 2WAQN 5IY5H 3CDHA 2R7RA 1QU3A 4HNTA 1BR2A 1ETKA 2Y0SN 5K5QA 3S1QJ 4XOPA 4P9FA 5C4JJ 5E8IA 3LA2A 1XX5A 1R1VA 3MKWB 2A6HF 4OAYA 2DT5A 2V6CA 2BY3A 1BJZA 3HSEA 3ECHA 2VXDA 4PJJA 2VODA 2X9DA 4CZCA 3LQQA 4XMYA 1ULYA 2FU4A 3CP8A 2HZDA 2VE8A 3EUKL 4EM0B 2LF8A 3ZRGA 1TLHB 3S1NJ 3CC4I 5H20A 2KIFA 2DA3A 3JCUC 5CVUA 3ERMA 5E18F 1MMGA 1O7FA 3HRTA 1JJ8C 3QP6A 2M3AA 3BDDA 2XB5A 2F5CA 1IRGA 1X2MA 2DMNA 4GGGA 2JRTA 4S05A 2FA5A 3TOBA 1R5HA 1MH3A 1NG6A 2IA0A 4AWXB 1A04A 2K85A 4RGUA 2J5PA 1HLVA 4A3FJ 3CZ6A 4G7OF 4G7HF 1RZ4A 3JRBA 1MSEC 1R23A 2HQNA 4I02A 4WXDA 4F93B 3VODA 1CGPA 3OYNA 2L01A 2R0QC 1W1WE 1OKRA 2OF7A 2CQ7A 5FRMA 2R7VA 4RAZA 1L3LA 2RV8A 3FXLA 4ZDPA 3IRRA 2EV0A 3BTLA 2WAQA 4BEHA 3S17J 3ABKH 5DS9A 3FMSA 3DBLB 4B1RA 5JFRA 4PZJA 1I5ZA 2Y0SA 4DZPA 3H3ZA 2W00A 4A69C 2PG4A 2I8DA 2LMDA 3ESWB 1FC3A 2A5YB 5E79C 2ZXWH 5GAGJ 2M8EA 1U5TC 4HNUA 3OS2A 1IN6A 3R0AA 2ADUA 3QRFF 1B8IA 4EQQA 2HR3A 3BQZA 1S5LC 3DEUA 1T08B 1D1BA 2IS1A 2CUZA 3IKVA 3T8TA 4DYRA 2PN6A 4RAFA 5KAIC 4CCJA 4IEJA 1B8IB 2R7WA 4I09A 1FIPA 4XOTA 4IKFA 2ZO4A 3WTYC 1LJ9A 2L9NA 1ZR4A 1W36D 3JSOA 1O3TA 5FFZA 5FKNA 3WU0A 2DAOA 1ZREA 4BU2A 2OD5A 2MD0A 4PJMA 3GTKJ 4AM3A 2L0KA 2XDVA 4YIFA 2VI6A 2ZNZA 1WJDA 2M9HA 3TP0A 3TL4X 4ENKA 2IVMA 2LC2A 3L2CA 1U9NA 3R0JA 3R60A 1FLIA 2QKLB 2M5WA 2L54A 2CGPA 3A4CA 1J7KA 2L4MA 2ELJA 2NVQJ 1IN8A 1SFUA 2Y2ZA 3AL0B 5J8FA 2J5OA 2HQRA 2E36A 4RGSA 5HLTA 3SFIA 1XMAA 5E3NA 3BG7A 4HDUA 2L4AA 3F8MA 4JX4A 4RA2A 2PQ8A 2V1NA 4G6DA 4MQVA 1PP7U 2KRCA 3ASOH 3CCMI 1D0YA 2HTSA 2JVHA 2G0EA 4RM3A 4CCLA 5BS6A 2E34A 3B02A 4ZDLA 2CUJA 4ANJA 2FOKA 2R5YA 3Q0UA 3RPQA 2OTLI 1JXSA 5JLXA 4DBRA 2EA4A 3J7YJ 5ERIA 4D5CA 3KP6A 2HXOA 4UVCA 1RI7A 3JTGA 1XTAA 4XLPF 3GFMA 2R5YB 4S04A 3H5NA 3RIRA 1FMVA 2RC4A 4I0BA 4FASD 4A12A 4CH7A 1SC7A 5FFXA 3OSGA 1AWCA 1MBHA 1JTXA 3CJNA 4Q4ZF 1FP1D 4X1EA 3H9JA 3K2ZA 4MTEA 2WC2A 1IZ1A 1FP2A 2CYYA 1TP4A 4XRSG 3HOSA 1D0XA 2K4BA 3KE2A 1T2KA 4GO1A 4C3JJ 3S3MA 3P9IA 3HTUA 3LSKA 1IRXA 1NK3P 3B6AA 3F3XA 1SANA 1FJLA 1QBJA 3V8LA 1OCPA 1ZAOA 3DTKA 4DBQA 1KQ8A 5DV5A 2HOAA 3F21A 1XSDA 3CMYA 1T39A 5H2FC 4MGRA 3ULQB 1UMQA 1OCRH 2XVCA 2RAEA 3O6BB 1UAAA 3RQIA 2V9KA 3V8KA 2HYFA 1WJBA 2DQRA 4V2GA 1OISA 4Y13A 5KK1A 1Z21A 1YS7A 2IA1A 1IN7A 4Y15A 1HA8A 5EGOA 2NVTJ 2HTJA 3KP4A 4RB2C 4F55A 3E5QA 2KIQA 4CCMA 2HPMA 4CYDA 2IRFG 2HWVA 3PFYA 2EA2A 3ZGKA 2L9VA 3SQNA 4JYKA 5E8GA 3NWSA 4IX7A 4G7ZF 4LLGF 4A5MA 2K9LA 2VT3A 3OL3A 3S32A 1MJAA 4A6DA 5EEAA 5EGOB 3G1OA 4CYCA 3LSIA 2CFXA 3QYBA 4KNYA 2HS5A 2P5KA 5TRDA 3H92A 4QLCU 1ON2A 3HRMA 3TW6A 3DQVC 4XBFA 4Y33A 4BDYA 1EV7A 2M1BA 5JHUA 1HOMA 3C7JA 5F64A 1HSTA 3KLNA 4CYCB 2QBYA 1TT5B 2V26A 3O2PE 3JRAA 2L3DA 3MKYB 3JRDA 4ASNA 5E17F 1APLC 2RNGA 2XPVA 3DP7A 1CQTA 1TZLA 1WH7A 1OYIA 1OFCX 2HU9A 2WA0A 2LY9A 2VE9A 3AKZA 3M8JA 3V4GA 2EZLA 2HQ5A 3P9KA 2QBYB 5BQTA 3ZQHA 4YG2F 2JVGA 4XKBA 1MD0A 1IXRC 2HFHA 1XC5A 2N8GA 4MEYF 2L7MP 4XN0A 1JT0A 4M72A 2R7OA 2JA8J 1LB2A 3HZJA 1YS6A 1X1DA 2XGCA 4ON0A 2M2EA 3S93A 3SEQA 5JLWA 2CW7A 1EH8A 2KKOA 3M1CA 3GFIA 3TKYA 1V3FA 5E3LA 4A3JJ 4KDPA 5DYMA 4A0ZA 5DTDA 2EZKA 3I4NJ 3WGHA 3QYEA 2XGXA 1G2HA 2BXYA 4N4NB 1D5VA 3HYIA 3OL4A 4P1WA 2KJBA 2TCTA 3H3UA 2BZTA 1DPRA 1BR4A 1TWHJ 2LVSA 4M3GA 4BE2A 3KX2A 5JVGF 3OR2C 1NG7A 3G1LA 1E3HA 1FT9A 1J5YA 2FNAA 4L9TA 2IJLA 5F1RA 3V8JA 4OWRB 5JVTA 2E71A 2JMWA 2O5RA 2ME6A 1RC9A 1NTCA 2DA7A 4W97A 5TGTA 2AXLA 5M3MJ 1ZH5A 2H8RA 2LOOA 1X4PA 3U9GA 2BY2A 4UV9A 4E7LA 1BL0A 1ZG5A 1LVAA 3IH4A 1FOYA 3GLXA 3H35A 2YU3A 2KRFA 1A6QA 3L2VA 3DXJF 4RB0A 1BOAA 1H89C 1O57A 3M8FA 1FBQA 1D1AA 3TEDA 1EJ9A 2LFBA 1SD5A 5HODA 1AKHA 4A3GJ 2F5DA 3FF5A 4HX7A 1IV6A 2EFQA 1KYZA 4MNUA 1RESA 1I6HJ 1WCMJ 2EIMH 1UZCA 5IOYA 3F6VA 3E6BA 3HJEA 2V6EA 4E7IA 2GM4A 5EZHA 3I3LA 5L3FA 2ECBA 1ZR2A 1TQIA 2HKOA 1KGSA 3M1EA 4AIKA 3K4LA 3KEYA 4KIBA 1JUSA 5CVVA 1A31A 3JSPA 2H94A 2XGEA 2DT7B 4ZTFA 1G3YA 2M45A 1BOBA 1LKXA 2Y0MA 5F0HA 2P7CB 3R6SA 4M71A 1ZARA 2VLAA 2A05A 4ENMA 4BJ5C 2STTA 1BN5A 2XAJA 4A0YA 4U0YA 1R5ID 5A2QK 3LSRA 1GVJA 2AXTC 4RAYA 5DEQA 4AD9A 5HDNA 4W1UA 2NVXJ 4BS9A 4KIGA 1J75A 2FJ1A 1R00A 4LIUA 1D8KA 3OYJA 3IH3A 9ANTA 1JKQC 4PK4A 1YLFA 2M87A 2P0WA 5LEKA 3RPUD 4IRIA 2M34A 1IW7F 2FOWA 5FLMJ 1UHSA 3ML6A 3PQKA 2NS0A 4Q5SF 4BJ6C 4EGZA 3KIOA 2QQ8A 5DCMA 3DKYA 1Z3XA 2VN2A 3QWLA 2Y69H 1MBEA 1AA7A 1T33A 2AQEA 2FNPA 4BJTA 2VBXA 3GVAA 3UNGC 4BE1A 3M3YJ 3K2AA 4M9SA 2WTEA 3KEQA 3BR5A 2DT6A 4HSTA 3S2WA 3H0DA 2X6OA 4L9NA 1ZLJA 1FTZA 5DCMB 1DGRM 1OJLA 3MKLA 1BC8C 2V79A 1P7IA 1QZYA 2NVUB 4AIHA 1GT0C 2VUMJ 2P4WA 2E35A 1TWFJ 3LAPA 2LKXA 3ZMDA 5J47A 5HLGA 1AU7A 1H9GA 3E6MA 2RQPA 3D5LA 5CJ9A 2UUZA 3MN2A 2HKXA 1EKEA 3DU5A 4UHTA 4YFXF 4EJVA 2VJIA 3DLAA 4I6ZA 1SFEA 3HUGA 4V2FA 5FD5A 4HF1A 1POGA 5AONA 3ZPLA 2TRTA 4V19K 2DA2A 3CCVI 3GW2A 5LFAA 2PMUA 5DM7F 2P8TA 3FKJA 2OTJI 4L9VA 1FOXA 3VFZA 2JT1A 1VQ8I 1FSHA 3G3ZA 1O3RA 4EGYA 2DPDA 2UV1A 4IF4A 1YQAA 3M4OJ 2VKHA 3IWZA 3AAFA 1X1BA 2Y31A 4HSRA 2P7VB 2ZSIB 1E17A 1WI3A 4KT5C 3HIFA 1ORKA 3IL2A 1QQIA 3CJQB 1VI0A 3DFGA 3NQOA 4L5JA 4UUSA 3GX4X 3TMOA 1XDSA 1H0MA 2Q2EB 1DQUA 2YR2A 3GZ5A 1ZLKA 4KMUX 2RDPA 3ROUA 3OSFA 4LFUA 4IHSA 2O8KA 1T38A 2R7ZJ 3PSIA 4UUSB 2GZWA 3FXJA 3L00A 4FX0A 3CCEI 5C4XJ 2Z16A 1GXPA 1OPCA 3W3CA 1A36A 1W7PD 1E3PA 1PVEA 5DUKA 3M07A 5B66C 3QAHA 1Y0UA 2OV7A 1BI2A 3S8PA 5M5XJ 1UG2A 2ACJA 1A5JA 2XASA 2ZXJA 4IXAA 1NHAA 4HX8A 3LFKA 3I54A 4PJNA 3MFKA 1LFUP 2LK2A 2GBYA 3ECOA 3T1BA 2VIXA 4PSXA 2FF4A 1WSUA 2XF7A 2PX9A 1W0TA 3S2DJ 1VQ7I 1JUMA 3J7AO 1Q1VA 4XL9A 3BJ6A 1Z9CA 1FMWA 3HHGA 5FKKA 5EJCA 4HAMA 4DQ2A 1RRJA 2K9QA 4NC8A 1OR7A 2KHMA 3I5UA 1K4SA 3KCCA 3KP2A 3K70C 1JHFA 2UXXA 4UB6C 3BOQA 1S72I 1X3ZB 2MA3A 3C3WA 3BR6A 5H6QA 2EWNA 2OA4A 2CS3A 2WADA 1QA6A 3U1KA 2CUEA 3S16J 3QODA 5DD4A 1Y56A 1YG2A 1ZK8A 3VB2A 1E0EA 1Y0NA 3O8HA 3MVPA 3O8GA 1LFBA 2X48A 3GTOJ 3OIPA 2E60A 3Q0WA 2W84A 1F36A 4CGZA 3PUFA 3SZGA 2NYXA 4QWQA 2JA5J 1XCVA 1BI0A 2QSHX 4Q48A 3VYRB 2GLOA 2VKEA 2F6CA 3WU2C 1HCRA 2MC3A 5KAFC 2VKVA 3F0CA 3ZR8X 2P6SA 2XF5A 5EG0A 4A3BJ 1K7AA 1BW6A 3MD2A 3H9GA 2P6TA 3T0YA 5D4RA 2R5ZA 5D8LB 1S7OA 4HF0A 1ZYRF 3RZOJ 2DPUA 1JT6A 2KT0A 5EG0B 4UB8C 1RKTA 4C3IJ 2CQQA 2DA1A 2ZFWA 2DW4A 5K1YA 3I4PA 3MCZA 1WJAA 2R5ZB 1MMAA 3VOEA 2HEOA 4XLCA 1JKOC 3BTJA 1IGNA 3WGGA 2QCOA 2ZCWA 2R7DA 1B59A 1ETXA 2QKMB 3L09A 3GTLJ 1QGPA 1PJRA 1UG0A 2Y9YA 2COMA 3NAUA 4ESJA 1KYWA 4Z6YA 2WWYA 3FXQA 3KP3A 5LBQA 4PJ0C 3I55I 4L0YB 2FSWA 4LG0A 3PO3J 3ZMVA 2GXAA 4E7ZA 5GPCA 2R93J 1XCBA 2W48A 1FBUA 3D5RC 2DJNA 2LTPA 1L0OC 5GAEJ 1R9TJ 1HSJA 1DU6A 2JJ7A 2GA2A 1Z05A 2H6BA 3QPTA 1VQ4I 5GPAA 4NB5A 2K5CA 2F2EA 4NQWA 4LG0B 3L7WA 4IHTA 2FQ4A 3SZPA 3HEFA 2E5NA 4C2MJ 1S3JA 5LGNA 3A2KA 5LRSA 2A68F 1DP7P 4BBSJ 3LWFA 2CO5A 1MBFA 3DBRB 2OJED 2X6YA 4NQWB 2QUFA 5KVRA 1QNTA 1T95A 4UXNA 1Y8RB 4DYQA 2X4HA 2CW0F 1HKTA 2K7LA 3F72A 4JP0A 1JI8A 4BHPA 1UHMA 3U21A 3TOAA 2DBBA 2OU2A 4U88A 2O8XA 2B7EA 3FXUA 1XPXA 2UXNA 1ZN2A 4LB6B 1H9TA 1WZ2A 2UWMA 1W36C 2PBIA 4I0AA 3OYHA 4NBQA 3ZQGA 5D4SA 2RN7A 2MFZA 4TV7A 4UUTA 1R5GA 1OLTA 5J6XA 1X3UA 1W5TA 3ZN1A 3B73A 2EZIA 5BOXA 1S6LA 2CH0A 4P5OA 1FBSA 4E7KA 1U8RA 1RUNA 3AG2H 2MH9A 3GWZA 1KONA 5EEGA 2G7UA 4IRGA 3RQ4A 4ZYDA 2MG4A 1BBYA 2ZB9A 1Z6TA 1GUUA 5GP9A 3M8EA 2XF6A 4CCNA 4HA8A 3MQ0A 3UKGA 2R7TA 2DFFA 2O03A 2VQLA 3A0BC 4G6TB 3EUAA 4CICA 2KPMA 3JRHA 2P81A 2HVSA 3BJAA 3NWTA 3GFJA 3WODF 1F5TA 1Y1VJ 4GYIA 3W6JB 2R4GA 3EDPA 1BI3A 1VF9A 1V5GA 1MW7A 2VC0A 3C18A 3FHNA 1IXCA 4LIVA 4NC6A 3RPUA 1F43A 1IV8A 4JX5A 3KZYA 2DMPA 2WBMA 2XUBA 2OZUA 5J8CA 5B1AH 4XORA 1ONVA 1VQ5I 1BM9A 5D5WB 2ZC2A 2A07F 5GADJ 1XGOA 4M9XA 3N05A 5C44J 2O6GE 4ETSA 4I98B 4AU7A 3KPHA 2L9RA 4HNVA 4LLNA 1D1CA 5D8KB 5FD6A 2YUSA 4CA0A 3S2HJ 1HW2A 3X2QH 2DFHA 1B4AA 3H5RA 2QSGX 2EQRA 1XD7A 1ZKGA 3KZIC 4ESBA 2MGQA 1G3TA 3NARA 3ZQQA 4L9JA 4M73A 1R36A 1WVRA 1X1PA 2CG4A 4D0PA 4ENNA 4GDFA 1I27A 1WI9A 3D0SA 4XKWA 2L5QA 3G6EI 2A5WA 4QPQA 2H1KA 4HRIA 1ZELA 1SAXA 3IHUA 5J1UA 2CJJA 4PGHA 1DU0A 5FLVA 5EEHA 4P96A 5HLHA 4HYEA 2HXIA 3ZP5A 5C3EJ 4X0GA 2HOSA 2CWEA 2DK5A 3CCQI 4CHUA 3DPUA 4HX4A 1YTYA 4BE0A 2VJ4A 2EILH 1OR7C 2ZXIA 5IT9K 3AG4H 4IL6C 1ZQ3P 2HOEA 2JA2A 4HDVA 1ETYA 2FE3A 2VOOA 4CXFA 1IRZA 4ITVA 3CJTB 3E6CC 1O7LA 2YX4A 2QVOA 2DFEA 2L7FP 3QPHA 4R1HA 4XLHA 2XB0X 3DU6A 5GTHC 3BG6A 1IN5A 2P5VA 3SJMA 2EJRA 1WJCA 2EFPA 3WGIA 5FGMA 2QLZA 2L7ZA 3IAS2 2Q0OA 3K4BA 4HEA2 5IYCJ 2K3FA 2EFNA 1TQPA 2PEXA 1R49A 2ZNYA 2FMLA 4M3BA 3W6KB 3VYSB 4BGDA 5IP7J 1QPMA 1JHHA 1G3SA 3LSTA 4MO7A 3E3VA 2E2HJ 1TC3C 2IPQX 1W7PA 1W5SA 3R61A 4KN4X 4DW6A 1T98A 4MHGA 2DO7A 1W4MA 5BPDA 3HOWJ 2KZVA 1IF1A 3KP7A 3WTWC 4XKVA 1WRJA 1Z7UA 4KN7X 3OIQA 1LDKB 2JQ7A 2KLOA 3TDZC 4A3EJ 1WJEA 1YJWI 1W7PB 2QWWA 1I3AA 2DK8A 2LR8A 3C2GA 3FK6A 3TP3A 4PDKA 1TL8A 4Q47A 2HDDA 3GXOA 1YX5A 1SVOA 4D5FA 4N4OB 5D6FA 4LK0F 1FOKA 2K9NA 2NVYJ 4OAZA 1ZTRA 1TNSA 4AC0A 1UFMA 3MWMA 4A2UA 5JHFA 3JREA 4IZZA 4OOIA 1KU7A 4CUGA 2F4IA 2XSJC 4J19A 4II3A 3CF2A 1Z91A 4FHTA 2Y9ZA 3L9FA 2XAGA 1QVTA 4OMYA 4Y4RA 3Q9SA 3E0JB 3DEWA 1IC8A 4BH9A 5F6FA 3NEUA 2K40A 2PFBA 1LEBA 1QO0D 2F48A 3T8RA 2CUFA 3K10A 3BQYA 2PI0A 5IT3A 2K02A 3H0GJ 1X2NA 5HNHA 3DV8A 2IS4A 5HVQC 4IHYA 3AG3H 3DKXA 1X1AA 3ERED 2EPFA 3LQRA 5LGUA 1FNNA 2VL8A 2BHZA 3SEZA 2NAZA 3FBIB 1QRYA 1NH3A 5E1WA 1V54H 3WHBA 5IP9J 1VQKI 2ISYA 2KMUA 2WAEA 2HNHA 5F04A 3OY9A 1WQ2A 2KP6A 4XNFA 2B63J 3HM5A 2EINH 3FXKA 5KNLA 1USSA 2Z9OA 1I3QJ 4LLLA 4B3XA 2BVMA 3S1MJ 1ZG3A 2Z99A 3ABLH 1R6RA 3JAMK 1ZGJA 2HYJA 3BPXA 5F08A 1PYVA 1BC7C 2L9SA 4LD5A 1X58A 1VQ6I 1V5EA 2CV1A 2O9LA 2ETHA 3DBHB 1PUEE 3HGGA 2QQ9A 4DNCA 1LQ1A 4IJAA 1UJ8A 3HOVJ 1D8JA 3C1DA 2E2IJ 2I10A 4D7MA 2E1CA 3JRIA 4XLEA 4KUMA 2FUG2 4UV8A 3IKTA 1YFHA 2ZFUA 3GCMA 1YI2I 4MTDA 2ID6A 4GCVA 4KFCA 4A5NA 2JTVA 3RKYA 5DCFA 1TTYA 4UVBA 4MIMA 3S15J 4MFEA 4ZYHA 4EEFG 3RTRA 4A6EA 2M0CA 2GXBA 1LDDA 3FMQA 2D1HA 1DDNA 4M3FA 3SHFA 4CZZA 3L2QA 1EH7A 2E1OA 4M6YA 2DDBA 4XM3A 4ZZDA 1W5CC 3KYDB 2WY7Q 3K69A 2DXIA 1PP8F 2MBFA 3BG5A 3BG9A 5KHDA 2DA6A 3OS0A 2Y48A 3CUQA 1G3WA 4WCGA 2H6CA 3PNTA 5FKLA 5L3GA 1MNDA 2HYGD 4BUPA 3CO6C 2HDWA 4XR6A 1YW8A 4F3QA 4OIPF 2YSRA 4IHXA 2KDOA 1YIOA 3V7SA 3RCOA 5B3SH 1P4XA 3E5XA 2R3SA 4RBOA 5HDKA 2M7AA 3G71I 3CUQB 3S1RJ 3VYTB 4ZJZA 4NC7A 2ZBKA 3FISA 5ILUA 4F91B 2ZXHA 3F8BA 1WHUA 1H88C 3TO6A 3MEXA 3HGYA 4O5VA 1YJ9I 5AIPA 3PFIA 5HOOA 2F4OB 4AVPA 1XSXA 4LOCA 4AYBN 1SFXA 4DGWB 4LG3A 5BMZA 1UB9A 1VFCA 3DLLF 2LSOA 2QYOA 2GA1A 3I9V2 1WWXA 4BNCA 5HNFA 2Y75A 3SYTA 1K83J 1WKMA 2K4JA 2LDUA 2LY2A 4KJZA 5LHGA 2ME0A 2JZYA 1ZG1A 3RI4A 2QM3A 2IEKA 1KQ9A 1B9MA 1IDZA 2NNNA 4AUXA 4AIDA 2JUGA 5TJJA 2D5VA 2ZJQF 1J0RA 3BCAA 3HBLA 5LLQA 1VZ0A 1LPQA 3F23A 5HS7A 1C0WA 1VQ9I 1VQNI 1BI1A 2DOAA 5A2QZ 1S8NA 1YITI 1B1BA 4IRHA 3I64A 5GTIC 2ESNA 2KIUA 4C2UA 1R1TA 2RGVA 1HDPA 2NOJB 1FOWA 2PLYA 3QYFA 2QQBA 3GUDA 3U2RA 4FCYA 2GOMA 3BWGA 2XRLA 2O7OA 1S29A 3O3KA 3FXMA 1MIJA 1QZEA 3RYPA 3ZQCA 3V7RA 4BXXJ 3OOPA 1T8IA 3QP5A 4C2TA 3PO2J 2IGMA 3ASNH 2CV0A 2M0MA 1QPIA 3CC7I 4YIIA 2YPRA 2VQGA 1WGXA 2JN6A 1Z7LA 4HV5A 4IQ4A 1Y1WJ 3JRGA 1XGMA 4I7HA 4B47A 4UUVA 3OYIA 5BNGA 5E1XA 3SDGA 3JRFA 3E1SA 2OUMA 2VB6A 5CQGA 2VJJA 2DMQA 1SD4A 2BYVE 3LSGA 4RGRA 1OQYA 1ZGWA 2OPTA 1YW7A 5E20A 2IP2A 2Q2EA 5CVJA 1MSFC 3CMMA 5D6EA 4QPOA 1XG1A 4B09A 4RDUA 4XK4A 2LY1A 2DODA 3A0HC 5IPAA 2D45A 3LOCA 3LSHA 4BQOA 3CF5F 1Y6IA 4WWCA 4LJZF 2C6YA 3F8CA 4HF2A 3BG3A 4PFOA 5IOZA 4ZC3A 4D7NA 2RREA 3ISPA 3RKXA 3KFWX 3SZTA 5JI6A 2F4MB 3OYAA 3HHHA 2W1OA 1I50J 5CVRA 4F7ZA 5DM6F 2M4GA 1Z1DA 1SEUA 2XSDC 3V42A 2H09A 3SXYA 3J7AY 1HBXG 3FIWA 1Y39A 5L3EA 2LP0A 2V1DA 1RR7A 1K79A 1MJBA 1U0JA 4WXHA 1K78A 1V4RA 2KL4A 3OWTA 1O3SA 1S9HA 2BGCA 5LHIA 4IPAA 4AVZA 1AOYA 2OBPA 3KYCB 1BW5A 3HOZJ 2CMPA 2LKSA 3L2RA 2DLLA 2A61A 2VC1A 1LEAA 2EB7A 1K78B 3ZMSA 4XKCA 2K3PA 3FZVA 5M5WJ 1H8AC 5L3CA 3WTSC 3I4MJ 1I1SA 4DJAA 1MJ9A 1TW3A
chains in the Genus database with same CATH topology
3QU6A 1HQCA 3N4MA 2TDXA 1FX7A 4E70A 3ZQ7A 2GAUA 4RS8A 1QZZA 2XAHA 2W25A 2HDCA 4BHCA 2XIGA 1SD7A 2LF7A 2DTRA 2STWA 4WXCA 1DUXC 2V1UA 3KEOA 2HGCA 2ZMEB 3CUQC 4EJOA 3COAC 2QQAA 3M7GA 2E7XA 4A0XA 2OQGA 4EMSA 1XSVA 3DF8A 4KIFA 4HLXA 4ESFA 1RUOA 5L3DA 4BHBA 4EJTA 3P7NA 3WE3A 4U0WA 4KA4A 4JK1X 4M9ZA 2RKHA 4HQEA 3QOPA 2ESHA 2VONA 2LKPA 5DD8A 5CLSA 2QENA 4LB5A 1I1GA 3HTSB 1KA8A 1GHCA 4GXOA 4L5IA 4JQFA 2EV6A 4R79A 4AIJA 4HQMA 4G6QA 5ED4A 3DKWA 4CO8A 1IXSB 1T6SA 4LK1F 3K0LA 3HSFA 2IA2A 1B9NA 3REOA 4MQ9F 2W24A 4I2OA 3FX3A 1I6XA 3E97A 4K2EA 2BV6A 4Z2YA 2KJCA 3I58A 1PDNC 3ZMTA 2ZKZA 2GWRA 4B8XA 1IRFA 3TO9A 2F5FA 5BPIA 4L0ZB 3J80K 3GYHX 5D5UB 1RNLA 1KU2A 2F5EA 3I71A 1U2WA 1SMTA 3E5UA 5FO5A 5HS8A 4BXUA 5CYVA 3J80Z 5D5VB 2XROA 4N9HA 4XSZF 3SFZA 3BJOA 4PGGA 3CUOA 1ZHFA 4HW0A 3IC7A 5AIQA 4O3MA 5H6RA 4CDGA 4NHJA 1IAWA 1XMKA 4U7DA 1F4KA 2M30A 1E2XA 1IN4A 2AS5F 5FB2A 4HBLA 4WF2A 4M6XA 2E7WA 3KZZA 5L3BA 4PCQA 3DPTA 4UNOA 2EFOA 3R4KA 4OU0A 3E6DA 1FYLA 1REPC 2OZ6A 1J59A 3I59A 3ZN0A 1KQ0A 5DDGA 3CTAA 1KU9A 4JBAA 5ICFA 4OIOF 2BE5F 3VEPA 3MZYA 5IT9Z 4OIQF 3I59B 2UZKA 2A3SA 2FBIA 1UHWA 1P4AA 3TDUC 1XB4A 3KLOA 4UVAA 3RJPA 4ZH4F 1FSEA 2Z3YA 1ZRCA 3LAJA 5CVIA 3EQLF 5K5RA 4KYWA 4I01A 2VXZA 4KMFA 5ICCA 3BZ6A 2PMHA 3Q9VA 3NRVA 4HZFA 4U7BA 3HOTA 2O61A 1STZA 4LGWA 2MD5A 2W85A 2L02A 4BQAA 5LEJA 3WTVC 1MGTA 4EV0A 3WTTC 3U1DA 1J2XA 2LNBA 3TGNA 3CO7C 1KU3A 1HW1A 2FQ3A 4XRFA 4XLNF 3K1PA 4EM2A 2V9VA 3ZMUA 3FXRA 1FPQA 3FM5A 1SD6A 4XSXF 2ISZA 3F8NA 1U78A 2VBWA 1ZRFA 2XAQA 1HKSA 3ELKA 5D5XB 3BY6A 3FHZA 1EH6A 1MKMA 1XGNA 4L18B 3K1NA 4N9IA 1R7JA 2Q8KA 5HS9A 3WTUC 3BPVA 3M9AA 2ZJ2A 1CF7A 3HRUA 2V1XA 4HLYA 5LHHA 1FZPB 2RVCA 1BIBA 3DPLC 1JGSA 2VBZA 4RB3C 3BROA 1CF7B 1HW5A 2FXAA 3JAMZ 2MLKA 3G73A 4N0BA 5ICEA 4RB1A 1ZGAA 4BYYA 1B6AA 1BJAA 1VTNC 2O3FA 3EUHA 3F6OA 2H27A 2XAFA 2XV4S 5JR3A 4OIRF 3HRSA 3RDIA 5ILSA 3HSRA 4G94A 2MH2A 1UCRA 2D2WA 2QZ8A 2G9WA 3ZMZA 5DUIA 2VT2A 2DI3A 3BP8A 1ZRDA 1P4WA 1RIOH 4YFNF 2G7HA 3GEZA 2BBYA 1J9IA 4RGXA 2EFWA 4R8HA 2NRAC 2KIMA 5LGTA 5LRRA 3WTXC 3I0TA 2A69F 2PJPA 1P6RA 3FMRA 2K86A 4O6JA 2FBHA 1BIAA 3V7CA 2WV0A 2D1VA 1OYYA 2YX7A 1LDJA 3JW4A 2X0LA 1FYKA 4YFKF 4P9UA 1R58A 1SMYF 3CLOA 1TNTA 3F8FA 3WTZA 5E1ZB 1YO5C 1U3EM 3FWEA 3F22A 3RKWA 1G4DA 4WX9A 4ZYEA 5FLXK 2GIVA 1HXDA 4HOBA 5HDGA 2FEZA 5ILVA 2JPBA 2A6EF 5FLXZ 4WK8F 1OYWA 1R1UA 3LA7A 1IUYA 2CSOA 2MLGA 1TQMA 3K9TA 3EETA 4LMYA 2P5LC 1XN7A 2W57A 2GQQA 1R22A 2RNJA 2NNYA 3KP5A 3I53A 4EM1A 3WU1B 3WG9A 2XHKA 1ON1A 3Q5FA 3GFLA 2K27A 2E1NA 1K6OA 1LNWA 2ELHA 2VOPA 1MDMA 4P55A 4GYGA 1FWZA 1G6NA 1U5TA 3TO7A 2FMYA 4EJUA 3TQNA 3EYYA 2GXGA 1MDMB 3QU3A 1JE8A 3RYRA 1YYVA 4KICA 4MEXF 1U5TB 2FRHA 4ZZLA 1Z6RA 3OV8A 3IRQA 1Q1HA 4G9YA 2XRNA 3ABUA 3PQJA 1TW2A 2JSCA 4EVIA 2DFIA 2HZTA 4BAYA 3GZ6A 4U0VA 1D3YA 1P92A 1TBXA 3T5XA 2CQKA 4IVNA 3MAJA 6PAXA 3IWFA 2ZMEA 1USTA 2R7FA 3N97A 1F1ZA 2FBKA 1FYMA 3GO5A 2BEOA 4G8XA 1HKQA 1F9NA 4HV6A 4M74A 3FM3A 5HLIA 2O0YA 1U6GA 3JTHA 5K5OA 3LA3A 2XKPA 2OQRA 3EYIA 2EV5A 4OINF 2IT0A 3MZHA 4OMZA 2XKOA 3WE2A 2IW5A 3KETA 1MZBA 2Z33A 2VBYA 4ZYGA 4EJWA 2JPCA 1ODDA 4FT8A 2EK5A 2DU9A 4Y17A 1GXQA 1FY7A 1YW9A 3J81K 2OAZA 3K1MA 3GF2A 2DQLA 5ICGA 3P9CA 1O3QA 4ENJA 2Z5UA 3J81Z 3ABTA 1S7AA 4FX4A 1P2FA 4H0EA 1T0FA 2B0LA 1DPUA 1XDUA 1XGSA 1OMIA 3CDHA 5K5QA 4P9FA 5E8IA 3LA2A 1R1VA 2A6HF 2DT5A 2V6CA 3HSEA 3ECHA 2VODA 3LQQA 4EM0B 1ULYA 2FU4A 2VE8A 2LF8A 1TLHB 5H20A 2KIFA 5CVUA 5E18F 1O7FA 3HRTA 3QP6A 3BDDA 2F5CA 1IRGA 4GGGA 2JRTA 4S05A 2FA5A 3TOBA 1R5HA 4AWXB 2IA0A 1A04A 4RGUA 2J5PA 4G7OF 4G7HF 1RZ4A 1R23A 2HQNA 4I02A 4WXDA 3VODA 1CGPA 2L01A 1OKRA 4RAZA 1L3LA 2RV8A 3IRRA 2EV0A 3FMSA 5JFRA 4PZJA 1I5ZA 3H3ZA 2PG4A 1FC3A 2A5YB 2M8EA 1U5TC 1IN6A 3R0AA 2ADUA 3QRFF 4EQQA 2HR3A 3DEUA 3IKVA 3T8TA 2PN6A 4I09A 2ZO4A 3WTYC 1LJ9A 3JSOA 1O3TA 5FFZA 3WU0A 2DAOA 1ZREA 2OD5A 4YIFA 2ZNZA 4ENKA 2IVMA 3L2CA 3R0JA 3R60A 1FLIA 2M5WA 2L54A 2CGPA 1J7KA 2L4MA 1IN8A 1SFUA 5J8FA 2J5OA 2HQRA 4RGSA 1XMAA 4HDUA 2L4AA 3F8MA 2PQ8A 4G6DA 4MQVA 1PP7U 2HTSA 5BS6A 3B02A 2FOKA 3RPQA 1JXSA 2EA4A 5ERIA 3KP6A 4UVCA 1RI7A 3JTGA 4XLPF 3GFMA 4S04A 3RIRA 2RC4A 4I0BA 4A12A 5FFXA 1AWCA 4Q4ZF 3CJNA 1FP1D 3K2ZA 4MTEA 2WC2A 1IZ1A 1FP2A 2CYYA 3HOSA 2K4BA 3KE2A 1T2KA 4GO1A 3P9IA 3HTUA 3F3XA 1KQ8A 1QBJA 3V8LA 1ZAOA 5DV5A 3F21A 1XSDA 1T39A 4MGRA 3ULQB 2XVCA 3O6BB 3V8KA 2HYFA 2DQRA 4Y13A 5KK1A 1YS7A 2IA1A 1IN7A 4Y15A 2HTJA 3KP4A 4RB2C 3E5QA 4CYDA 2IRFG 2HWVA 2EA2A 3SQNA 5E8GA 4G7ZF 4LLGF 4A5MA 2VT3A 1MJAA 4A6DA 2CFXA 4KNYA 2HS5A 2P5KA 5TRDA 3H92A 4QLCU 1ON2A 3HRMA 3DQVC 4XBFA 1EV7A 2M1BA 5JHUA 3C7JA 5F64A 1HSTA 3KLNA 2QBYA 3O2PE 2L3DA 4ASNA 5E17F 3DP7A 1OYIA 2VE9A 3V4GA 3P9KA 2QBYB 5BQTA 4YG2F 1MD0A 1IXRC 2HFHA 4MEYF 4M72A 1LB2A 1YS6A 4ON0A 1EH8A 2KKOA 3GFIA 3TKYA 1V3FA 4KDPA 5DYMA 4A0ZA 3WGHA 2XGXA 1D5VA 3HYIA 2KJBA 3H3UA 1DPRA 1FT9A 1J5YA 2FNAA 4L9TA 2IJLA 5F1RA 3V8JA 5JVTA 2AXLA 1ZH5A 3U9GA 4UV9A 1ZG5A 1LVAA 3GLXA 2YU3A 2KRFA 3DXJF 4RB0A 1BOAA 1O57A 3M8FA 1FBQA 1SD5A 2F5DA 3FF5A 4HX7A 2EFQA 1KYZA 4MNUA 3F6VA 3E6BA 5L3FA 1TQIA 2HKOA 1KGSA 3M1EA 4AIKA 4KIBA 5CVVA 3JSPA 2H94A 1G3YA 2M45A 2P7CB 2Y0MA 3R6SA 4M71A 1ZARA 4ENMA 2STTA 1BN5A 2XAJA 4A0YA 4U0YA 5A2QK 1GVJA 4RAYA 5DEQA 4AD9A 5HDNA 4KIGA 1J75A 1R00A 1D8KA 1YLFA 2M87A 5LEKA 4IRIA 1IW7F 3ML6A 3PQKA 2NS0A 4Q5SF 4EGZA 5DCMA 2VN2A 2FNPA 2VBXA 3GVAA 4M9SA 2WTEA 3KEQA 3S2WA 4L9NA 1ZLJA 5DCMB 1BC8C 2V79A 1QZYA 4AIHA 2P4WA 3LAPA 3ZMDA 5HLGA 1H9GA 3E6MA 2RQPA 3D5LA 5CJ9A 4UHTA 4YFXF 2HKXA 4EJVA 1SFEA 3HUGA 5FD5A 4HF1A 5AONA 3ZPLA 3GW2A 2PMUA 2P8TA 4L9VA 3VFZA 2JT1A 1FSHA 3G3ZA 1O3RA 4EGYA 2DPDA 4IF4A 1YQAA 3IWZA 3AAFA 2P7VB 1E17A 4KT5C 3HIFA 3IL2A 1QQIA 3DFGA 3NQOA 4L5JA 3GX4X 1XDSA 1H0MA 2YR2A 3GZ5A 1ZLKA 4KMUX 2RDPA 3ROUA 4IHSA 4LFUA 1T38A 2GZWA 4FX0A 3L00A 1GXPA 1OPCA 1W7PD 5DUKA 3QAHA 1Y0UA 1BI2A 2ACJA 2XASA 2ZXJA 4IXAA 1NHAA 4HX8A 3LFKA 3I54A 3MFKA 3T1BA 3ECOA 2FF4A 1WSUA 3J7AO 3BJ6A 1Z9CA 3HHGA 4HAMA 4DQ2A 1OR7A 3I5UA 3KCCA 3KP2A 1JHFA 2UXXA 3BOQA 2MA3A 3C3WA 5H6QA 2EWNA 2OA4A 5DD4A 1YG2A 3VB2A 2W84A 4CGZA 2NYXA 4QWQA 1XCVA 1BI0A 4Q48A 2MC3A 2P6SA 1K7AA 3T0YA 2P6TA 5D4RA 5D8LB 1S7OA 4HF0A 1ZYRF 2DPUA 2ZFWA 2DW4A 5K1YA 3I4PA 3MCZA 3VOEA 2HEOA 3WGGA 2ZCWA 2R7DA 1B59A 3L09A 1QGPA 2COMA 4ESJA 1KYWA 2WWYA 3FXQA 3KP3A 5LBQA 4L0YB 2FSWA 4LG0A 3ZMVA 1XCBA 1FBUA 1L0OC 1HSJA 2GA2A 1Z05A 2H6BA 3QPTA 4NB5A 2F2EA 4NQWA 4LG0B 3L7WA 4IHTA 3SZPA 1S3JA 5LGNA 5LRSA 2A68F 1DP7P 3LWFA 2CO5A 2QUFA 5KVRA 1QNTA 4UXNA 2X4HA 2CW0F 1HKTA 2K7LA 3F72A 4BHPA 1UHMA 3TOAA 2DBBA 2OU2A 4U88A 2O8XA 3FXUA 2UXNA 1ZN2A 4LB6B 1H9TA 2UWMA 2PBIA 4I0AA 5D4SA 2RN7A 4TV7A 1R5GA 5J6XA 1X3UA 1W5TA 3ZN1A 3B73A 5BOXA 1S6LA 4P5OA 1FBSA 1U8RA 1RUNA 2MH9A 3GWZA 5EEGA 2G7UA 4IRGA 4ZYDA 1BBYA 1Z6TA 3M8EA 4HA8A 3MQ0A 2O03A 4CICA 3BJAA 3GFJA 3WODF 1F5TA 4GYIA 3W6JB 3EDPA 1BI3A 2VC0A 3C18A 1IXCA 3RPUA 3KZYA 2XUBA 2OZUA 5J8CA 1ONVA 1BM9A 5D5WB 2A07F 1XGOA 4M9XA 2O6GE 4ETSA 4I98B 4LLNA 5D8KB 5FD6A 1HW2A 1B4AA 1XD7A 4ESBA 1G3TA 4L9JA 4M73A 1R36A 2CG4A 4D0PA 4ENNA 1I27A 1WI9A 3D0SA 1SAXA 3IHUA 4PGHA 5EEHA 4P96A 5HLHA 4HYEA 3ZP5A 2CWEA 2DK5A 4CHUA 4HX4A 1YTYA 5IT9K 2HOEA 4HDVA 2FE3A 2VOOA 4CXFA 3E6CC 1O7LA 2YX4A 2QVOA 3QPHA 4R1HA 1IN5A 2P5VA 2EJRA 2EFPA 3WGIA 5FGMA 2QLZA 2Q0OA 2EFNA 1TQPA 2PEXA 2ZNYA 2FMLA 3W6KB 1QPMA 1JHHA 1G3SA 3LSTA 3E3VA 2IPQX 1W7PA 1W5SA 3R61A 4KN4X 1T98A 4MHGA 2DO7A 1W4MA 5BPDA 1IF1A 3KP7A 3WTWC 1WRJA 1Z7UA 4KN7X 1LDKB 3TDZC 1W7PB 2QWWA 2DK8A 4PDKA 4Q47A 3GXOA 5D6FA 4LK0F 1FOKA 1TNSA 1UFMA 3MWMA 4A2UA 1KU7A 4OOIA 1Z91A 4FHTA 3L9FA 2XAGA 4OMYA 3Q9SA 4BH9A 5F6FA 3NEUA 2PFBA 1LEBA 1QO0D 3T8RA 2PI0A 5IT3A 2K02A 3DV8A 5HVQC 3ERED 3LQRA 5LGUA 1FNNA 2NAZA 5E1WA 2ISYA 1WQ2A 1USSA 2Z9OA 4LLLA 1ZG3A 2Z99A 3JAMK 1ZGJA 3BPXA 1BC7C 4LD5A 2ETHA 1PUEE 2QQ9A 4DNCA 1LQ1A 4IJAA 1D8JA 3C1DA 2E1CA 3IKTA 4KUMA 4UV8A 1YFHA 4MTDA 4GCVA 4KFCA 4A5NA 2JTVA 3RKYA 5DCFA 1TTYA 4UVBA 4ZYHA 3RTRA 4A6EA 2GXBA 1LDDA 3FMQA 2D1HA 1DDNA 3SHFA 4CZZA 1EH7A 4M6YA 4ZZDA 3K69A 1PP8F 2MBFA 2Y48A 3CUQA 1G3WA 4WCGA 2H6CA 5L3GA 2HYGD 3CO6C 1YW8A 4OIPF 2YSRA 1YIOA 3V7SA 1P4XA 3E5XA 2R3SA 5HDKA 3CUQB 2ZBKA 5ILUA 3F8BA 3TO6A 3MEXA 4O5VA 5AIPA 3PFIA 5HOOA 4AVPA 1XSXA 1SFXA 5BMZA 1UB9A 2LSOA 2QYOA 2GA1A 1WWXA 4BNCA 2Y75A 2K4JA 1WKMA 2LDUA 5LHGA 2JZYA 1ZG1A 3RI4A 2QM3A 1KQ9A 1B9MA 2NNNA 5TJJA 1J0RA 5LLQA 3F23A 5HS7A 1C0WA 1BI1A 5A2QZ 1S8NA 1B1BA 4IRHA 3I64A 2ESNA 2KIUA 1R1TA 2RGVA 2PLYA 2QQBA 3GUDA 3U2RA 3BWGA 1S29A 3O3KA 3RYPA 3V7RA 3OOPA 3QP5A 4YIIA 2YPRA 4HV5A 1XGMA 4I7HA 4UUVA 5E1XA 1SD4A 2BYVE 4RGRA 1YW7A 5E20A 2IP2A 2Q2EA 5CVJA 5D6EA 4B09A 2D45A 4WWCA 4LJZF 2C6YA 3F8CA 4HF2A 3ISPA 3RKXA 3KFWX 3SZTA 5JI6A 3HHHA 5CVRA 4F7ZA 1Z1DA 2H09A 3SXYA 1HBXG 5L3EA 2V1DA 1K79A 1MJBA 4WXHA 1K78A 1V4RA 1O3SA 2BGCA 5LHIA 4IPAA 1AOYA 2OBPA 2DLLA 2A61A 2VC1A 1LEAA 2EB7A 1K78B 3ZMSA 3FZVA 5L3CA 3WTSC 1I1SA 1MJ9A 1TW3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QU6 A;  1HQC A;  3N4M A;  2TDX A;  1FX7 A;  4E70 A;  3ZQ7 A;  2GAU A;  4RS8 A;  1QZZ A;  2XAH A;  2W25 A;  2HDC A;  4BHC A;  2XIG A;  1SD7 A;  2LF7 A;  2DTR A;  2STW A;  4WXC A;  1DUX C;  2V1U A;  3KEO A;  2HGC A;  2ZME B;  3CUQ C;  4EJO A;  3COA C;  2QQA A;  3M7G A;  2E7X A;  4A0X A;  2OQG A;  4EMS A;  1XSV A;  3DF8 A;  4KIF A;  4HLX A;  4ESF A;  1RUO A;  5L3D A;  4BHB A;  4EJT A;  3P7N A;  3WE3 A;  4U0W A;  4KA4 A;  4JK1 X;  4M9Z A;  2RKH A;  4HQE A;  3QOP A;  2ESH A;  2VON A;  2LKP A;  5DD8 A;  5CLS A;  2QEN A;  4LB5 A;  1I1G A;  3HTS B;  1KA8 A;  1GHC A;  4GXO A;  4L5I A;  4JQF A;  2EV6 A;  4R79 A;  4AIJ A;  4HQM A;  4G6Q A;  5ED4 A;  3DKW A;  4CO8 A;  1IXS B;  1T6S A;  4LK1 F;  3K0L A;  3HSF A;  2IA2 A;  1B9N A;  3REO A;  4MQ9 F;  2W24 A;  4I2O A;  3FX3 A;  1I6X A;  3E97 A;  4K2E A;  2BV6 A;  4Z2Y A;  2KJC A;  3I58 A;  1PDN C;  3ZMT A;  2ZKZ A;  2GWR A;  4B8X A;  1IRF A;  3TO9 A;  2F5F A;  5BPI A;  4L0Z B;  3J80 K;  3GYH X;  5D5U B;  1RNL A;  1KU2 A;  2F5E A;  3I71 A;  1U2W A;  1SMT A;  3E5U A;  5FO5 A;  5HS8 A;  4BXU A;  5CYV A;  3J80 Z;  5D5V B;  2XRO A;  4N9H A;  4XSZ F;  3SFZ A;  3BJO A;  4PGG A;  3CUO A;  1ZHF A;  4HW0 A;  3IC7 A;  5AIQ A;  4O3M A;  5H6R A;  4CDG A;  4NHJ A;  1IAW A;  1XMK A;  4U7D A;  1F4K A;  2M30 A;  1E2X A;  1IN4 A;  2AS5 F;  5FB2 A;  4HBL A;  4WF2 A;  4M6X A;  2E7W A;  3KZZ A;  5L3B A;  4PCQ A;  3DPT A;  4UNO A;  2EFO A;  3R4K A;  4OU0 A;  3E6D A;  1FYL A;  1REP C;  2OZ6 A;  1J59 A;  3I59 A;  3ZN0 A;  1KQ0 A;  5DDG A;  3CTA A;  1KU9 A;  4JBA A;  5ICF A;  4OIO F;  2BE5 F;  3VEP A;  3MZY A;  5IT9 Z;  4OIQ F;  3I59 B;  2UZK A;  2A3S A;  2FBI A;  1UHW A;  1P4A A;  3TDU C;  1XB4 A;  3KLO A;  4UVA A;  3RJP A;  4ZH4 F;  1FSE A;  2Z3Y A;  1ZRC A;  3LAJ A;  5CVI A;  3EQL F;  5K5R A;  4KYW A;  4I01 A;  2VXZ A;  4KMF A;  5ICC A;  3BZ6 A;  2PMH A;  3Q9V A;  3NRV A;  4HZF A;  4U7B A;  3HOT A;  2O61 A;  1STZ A;  4LGW A;  2MD5 A;  2W85 A;  2L02 A;  4BQA A;  5LEJ A;  3WTV C;  1MGT A;  4EV0 A;  3WTT C;  3U1D A;  1J2X A;  2LNB A;  3TGN A;  3CO7 C;  1KU3 A;  1HW1 A;  2FQ3 A;  4XRF A;  4XLN F;  3K1P A;  4EM2 A;  2V9V A;  3ZMU A;  3FXR A;  1FPQ A;  3FM5 A;  1SD6 A;  4XSX F;  2ISZ A;  3F8N A;  1U78 A;  2VBW A;  1ZRF A;  2XAQ A;  1HKS A;  3ELK A;  5D5X B;  3BY6 A;  3FHZ A;  1EH6 A;  1MKM A;  1XGN A;  4L18 B;  3K1N A;  4N9I A;  1R7J A;  2Q8K A;  5HS9 A;  3WTU C;  3BPV A;  3M9A A;  2ZJ2 A;  1CF7 A;  3HRU A;  2V1X A;  4HLY A;  5LHH A;  1FZP B;  2RVC A;  1BIB A;  3DPL C;  1JGS A;  2VBZ A;  4RB3 C;  3BRO A;  1CF7 B;  1HW5 A;  2FXA A;  3JAM Z;  2MLK A;  3G73 A;  4N0B A;  5ICE A;  4RB1 A;  1ZGA A;  4BYY A;  1B6A A;  1BJA A;  1VTN C;  2O3F A;  3EUH A;  3F6O A;  2H27 A;  2XAF A;  2XV4 S;  5JR3 A;  4OIR F;  3HRS A;  3RDI A;  5ILS A;  3HSR A;  4G94 A;  2MH2 A;  1UCR A;  2D2W A;  2QZ8 A;  2G9W A;  3ZMZ A;  5DUI A;  2VT2 A;  2DI3 A;  3BP8 A;  1ZRD A;  1P4W A;  1RIO H;  4YFN F;  2G7H A;  3GEZ A;  2BBY A;  1J9I A;  4RGX A;  2EFW A;  4R8H A;  2NRA C;  2KIM A;  5LGT A;  5LRR A;  3WTX C;  3I0T A;  2A69 F;  2PJP A;  1P6R A;  3FMR A;  2K86 A;  4O6J A;  2FBH A;  1BIA A;  3V7C A;  2WV0 A;  2D1V A;  1OYY A;  2YX7 A;  1LDJ A;  3JW4 A;  2X0L A;  1FYK A;  4YFK F;  4P9U A;  1R58 A;  1SMY F;  3CLO A;  1TNT A;  3F8F A;  3WTZ A;  5E1Z B;  1YO5 C;  1U3E M;  3FWE A;  3F22 A;  3RKW A;  1G4D A;  4WX9 A;  4ZYE A;  5FLX K;  2GIV A;  1HXD A;  4HOB A;  5HDG A;  2FEZ A;  5ILV A;  2JPB A;  2A6E F;  5FLX Z;  4WK8 F;  1OYW A;  1R1U A;  3LA7 A;  1IUY A;  2CSO A;  2MLG A;  1TQM A;  3K9T A;  3EET A;  4LMY A;  2P5L C;  1XN7 A;  2W57 A;  2GQQ A;  1R22 A;  2RNJ A;  2NNY A;  3KP5 A;  3I53 A;  4EM1 A;  3WU1 B;  3WG9 A;  2XHK A;  1ON1 A;  3Q5F A;  3GFL A;  2K27 A;  2E1N A;  1K6O A;  1LNW A;  2ELH A;  2VOP A;  1MDM A;  4P55 A;  4GYG A;  1FWZ A;  1G6N A;  1U5T A;  3TO7 A;  2FMY A;  4EJU A;  3TQN A;  3EYY A;  2GXG A;  1MDM B;  3QU3 A;  1JE8 A;  3RYR A;  1YYV A;  4KIC A;  4MEX F;  1U5T B;  2FRH A;  4ZZL A;  1Z6R A;  3OV8 A;  3IRQ A;  1Q1H A;  4G9Y A;  2XRN A;  3ABU A;  3PQJ A;  1TW2 A;  2JSC A;  4EVI A;  2DFI A;  2HZT A;  4BAY A;  3GZ6 A;  4U0V A;  1D3Y A;  1P92 A;  1TBX A;  3T5X A;  2CQK A;  4IVN A;  3MAJ A;  6PAX A;  3IWF A;  2ZME A;  1UST A;  2R7F A;  3N97 A;  1F1Z A;  2FBK A;  1FYM A;  3GO5 A;  2BEO A;  4G8X A;  1HKQ A;  1F9N A;  4HV6 A;  4M74 A;  3FM3 A;  5HLI A;  2O0Y A;  1U6G A;  3JTH A;  5K5O A;  3LA3 A;  2XKP A;  2OQR A;  3EYI A;  2EV5 A;  4OIN F;  2IT0 A;  3MZH A;  4OMZ A;  2XKO A;  3WE2 A;  2IW5 A;  3KET A;  1MZB A;  2Z33 A;  2VBY A;  4ZYG A;  4EJW A;  2JPC A;  1ODD A;  4FT8 A;  2EK5 A;  2DU9 A;  4Y17 A;  1GXQ A;  1FY7 A;  1YW9 A;  3J81 K;  2OAZ A;  3K1M A;  3GF2 A;  2DQL A;  5ICG A;  3P9C A;  1O3Q A;  4ENJ A;  2Z5U A;  3J81 Z;  3ABT A;  1S7A A;  4FX4 A;  1P2F A;  4H0E A;  1T0F A;  2B0L A;  1DPU A;  1XDU A;  1XGS A;  1OMI A;  3CDH A;  5K5Q A;  4P9F A;  5E8I A;  3LA2 A;  1R1V A;  2A6H F;  2DT5 A;  2V6C A;  3HSE A;  3ECH A;  2VOD A;  3LQQ A;  4EM0 B;  1ULY A;  2FU4 A;  2VE8 A;  2LF8 A;  1TLH B;  5H20 A;  2KIF A;  5CVU A;  5E18 F;  1O7F A;  3HRT A;  3QP6 A;  3BDD A;  2F5C A;  1IRG A;  4GGG A;  2JRT A;  4S05 A;  2FA5 A;  3TOB A;  1R5H A;  4AWX B;  2IA0 A;  1A04 A;  4RGU A;  2J5P A;  4G7O F;  4G7H F;  1RZ4 A;  1R23 A;  2HQN A;  4I02 A;  4WXD A;  3VOD A;  1CGP A;  2L01 A;  1OKR A;  4RAZ A;  1L3L A;  2RV8 A;  3IRR A;  2EV0 A;  3FMS A;  5JFR A;  4PZJ A;  1I5Z A;  3H3Z A;  2PG4 A;  1FC3 A;  2A5Y B;  2M8E A;  1U5T C;  1IN6 A;  3R0A A;  2ADU A;  3QRF F;  4EQQ A;  2HR3 A;  3DEU A;  3IKV A;  3T8T A;  2PN6 A;  4I09 A;  2ZO4 A;  3WTY C;  1LJ9 A;  3JSO A;  1O3T A;  5FFZ A;  3WU0 A;  2DAO A;  1ZRE A;  2OD5 A;  4YIF A;  2ZNZ A;  4ENK A;  2IVM A;  3L2C A;  3R0J A;  3R60 A;  1FLI A;  2M5W A;  2L54 A;  2CGP A;  1J7K A;  2L4M A;  1IN8 A;  1SFU A;  5J8F A;  2J5O A;  2HQR A;  4RGS A;  1XMA A;  4HDU A;  2L4A A;  3F8M A;  2PQ8 A;  4G6D A;  4MQV A;  1PP7 U;  2HTS A;  5BS6 A;  3B02 A;  2FOK A;  3RPQ A;  1JXS A;  2EA4 A;  5ERI A;  3KP6 A;  4UVC A;  1RI7 A;  3JTG A;  4XLP F;  3GFM A;  4S04 A;  3RIR A;  2RC4 A;  4I0B A;  4A12 A;  5FFX A;  1AWC A;  4Q4Z F;  3CJN A;  1FP1 D;  3K2Z A;  4MTE A;  2WC2 A;  1IZ1 A;  1FP2 A;  2CYY A;  3HOS A;  2K4B A;  3KE2 A;  1T2K A;  4GO1 A;  3P9I A;  3HTU A;  3F3X A;  1KQ8 A;  1QBJ A;  3V8L A;  1ZAO A;  5DV5 A;  3F21 A;  1XSD A;  1T39 A;  4MGR A;  3ULQ B;  2XVC A;  3O6B B;  3V8K A;  2HYF A;  2DQR A;  4Y13 A;  5KK1 A;  1YS7 A;  2IA1 A;  1IN7 A;  4Y15 A;  2HTJ A;  3KP4 A;  4RB2 C;  3E5Q A;  4CYD A;  2IRF G;  2HWV A;  2EA2 A;  3SQN A;  5E8G A;  4G7Z F;  4LLG F;  4A5M A;  2VT3 A;  1MJA A;  4A6D A;  2CFX A;  4KNY A;  2HS5 A;  2P5K A;  5TRD A;  3H92 A;  4QLC U;  1ON2 A;  3HRM A;  3DQV C;  4XBF A;  1EV7 A;  2M1B A;  5JHU A;  3C7J A;  5F64 A;  1HST A;  3KLN A;  2QBY A;  3O2P E;  2L3D A;  4ASN A;  5E17 F;  3DP7 A;  1OYI A;  2VE9 A;  3V4G A;  3P9K A;  2QBY B;  5BQT A;  4YG2 F;  1MD0 A;  1IXR C;  2HFH A;  4MEY F;  4M72 A;  1LB2 A;  1YS6 A;  4ON0 A;  1EH8 A;  2KKO A;  3GFI A;  3TKY A;  1V3F A;  4KDP A;  5DYM A;  4A0Z A;  3WGH A;  2XGX A;  1D5V A;  3HYI A;  2KJB A;  3H3U A;  1DPR A;  1FT9 A;  1J5Y A;  2FNA A;  4L9T A;  2IJL A;  5F1R A;  3V8J A;  5JVT A;  2AXL A;  1ZH5 A;  3U9G A;  4UV9 A;  1ZG5 A;  1LVA A;  3GLX A;  2YU3 A;  2KRF A;  3DXJ F;  4RB0 A;  1BOA A;  1O57 A;  3M8F A;  1FBQ A;  1SD5 A;  2F5D A;  3FF5 A;  4HX7 A;  2EFQ A;  1KYZ A;  4MNU A;  3F6V A;  3E6B A;  5L3F A;  1TQI A;  2HKO A;  1KGS A;  3M1E A;  4AIK A;  4KIB A;  5CVV A;  3JSP A;  2H94 A;  1G3Y A;  2M45 A;  2P7C B;  2Y0M A;  3R6S A;  4M71 A;  1ZAR A;  4ENM A;  2STT A;  1BN5 A;  2XAJ A;  4A0Y A;  4U0Y A;  5A2Q K;  1GVJ A;  4RAY A;  5DEQ A;  4AD9 A;  5HDN A;  4KIG A;  1J75 A;  1R00 A;  1D8K A;  1YLF A;  2M87 A;  5LEK A;  4IRI A;  1IW7 F;  3ML6 A;  3PQK A;  2NS0 A;  4Q5S F;  4EGZ A;  5DCM A;  2VN2 A;  2FNP A;  2VBX A;  3GVA A;  4M9S A;  2WTE A;  3KEQ A;  3S2W A;  4L9N A;  1ZLJ A;  5DCM B;  1BC8 C;  2V79 A;  1QZY A;  4AIH A;  2P4W A;  3LAP A;  3ZMD A;  5HLG A;  1H9G A;  3E6M A;  2RQP A;  3D5L A;  5CJ9 A;  4UHT A;  4YFX F;  2HKX A;  4EJV A;  1SFE A;  3HUG A;  5FD5 A;  4HF1 A;  5AON A;  3ZPL A;  3GW2 A;  2PMU A;  2P8T A;  4L9V A;  3VFZ A;  2JT1 A;  1FSH A;  3G3Z A;  1O3R A;  4EGY A;  2DPD A;  4IF4 A;  1YQA A;  3IWZ A;  3AAF A;  2P7V B;  1E17 A;  4KT5 C;  3HIF A;  3IL2 A;  1QQI A;  3DFG A;  3NQO A;  4L5J A;  3GX4 X;  1XDS A;  1H0M A;  2YR2 A;  3GZ5 A;  1ZLK A;  4KMU X;  2RDP A;  3ROU A;  4IHS A;  4LFU A;  1T38 A;  2GZW A;  4FX0 A;  3L00 A;  1GXP A;  1OPC A;  1W7P D;  5DUK A;  3QAH A;  1Y0U A;  1BI2 A;  2ACJ A;  2XAS A;  2ZXJ A;  4IXA A;  1NHA A;  4HX8 A;  3LFK A;  3I54 A;  3MFK A;  3T1B A;  3ECO A;  2FF4 A;  1WSU A;  3J7A O;  3BJ6 A;  1Z9C A;  3HHG A;  4HAM A;  4DQ2 A;  1OR7 A;  3I5U A;  3KCC A;  3KP2 A;  1JHF A;  2UXX A;  3BOQ A;  2MA3 A;  3C3W A;  5H6Q A;  2EWN A;  2OA4 A;  5DD4 A;  1YG2 A;  3VB2 A;  2W84 A;  4CGZ A;  2NYX A;  4QWQ A;  1XCV A;  1BI0 A;  4Q48 A;  2MC3 A;  2P6S A;  1K7A A;  3T0Y A;  2P6T A;  5D4R A;  5D8L B;  1S7O A;  4HF0 A;  1ZYR F;  2DPU A;  2ZFW A;  2DW4 A;  5K1Y A;  3I4P A;  3MCZ A;  3VOE A;  2HEO A;  3WGG A;  2ZCW A;  2R7D A;  1B59 A;  3L09 A;  1QGP A;  2COM A;  4ESJ A;  1KYW A;  2WWY A;  3FXQ A;  3KP3 A;  5LBQ A;  4L0Y B;  2FSW A;  4LG0 A;  3ZMV A;  1XCB A;  1FBU A;  1L0O C;  1HSJ A;  2GA2 A;  1Z05 A;  2H6B A;  3QPT A;  4NB5 A;  2F2E A;  4NQW A;  4LG0 B;  3L7W A;  4IHT A;  3SZP A;  1S3J A;  5LGN A;  5LRS A;  2A68 F;  1DP7 P;  3LWF A;  2CO5 A;  2QUF A;  5KVR A;  1QNT A;  4UXN A;  2X4H A;  2CW0 F;  1HKT A;  2K7L A;  3F72 A;  4BHP A;  1UHM A;  3TOA A;  2DBB A;  2OU2 A;  4U88 A;  2O8X A;  3FXU A;  2UXN A;  1ZN2 A;  4LB6 B;  1H9T A;  2UWM A;  2PBI A;  4I0A A;  5D4S A;  2RN7 A;  4TV7 A;  1R5G A;  5J6X A;  1X3U A;  1W5T A;  3ZN1 A;  3B73 A;  5BOX A;  1S6L A;  4P5O A;  1FBS A;  1U8R A;  1RUN A;  2MH9 A;  3GWZ A;  5EEG A;  2G7U A;  4IRG A;  4ZYD A;  1BBY A;  1Z6T A;  3M8E A;  4HA8 A;  3MQ0 A;  2O03 A;  4CIC A;  3BJA A;  3GFJ A;  3WOD F;  1F5T A;  4GYI A;  3W6J B;  3EDP A;  1BI3 A;  2VC0 A;  3C18 A;  1IXC A;  3RPU A;  3KZY A;  2XUB A;  2OZU A;  5J8C A;  1ONV A;  1BM9 A;  5D5W B;  2A07 F;  1XGO A;  4M9X A;  2O6G E;  4ETS A;  4I98 B;  4LLN A;  5D8K B;  5FD6 A;  1HW2 A;  1B4A A;  1XD7 A;  4ESB A;  1G3T A;  4L9J A;  4M73 A;  1R36 A;  2CG4 A;  4D0P A;  4ENN A;  1I27 A;  1WI9 A;  3D0S A;  1SAX A;  3IHU A;  4PGH A;  5EEH A;  4P96 A;  5HLH A;  4HYE A;  3ZP5 A;  2CWE A;  2DK5 A;  4CHU A;  4HX4 A;  1YTY A;  5IT9 K;  2HOE A;  4HDV A;  2FE3 A;  2VOO A;  4CXF A;  3E6C C;  1O7L A;  2YX4 A;  2QVO A;  3QPH A;  4R1H A;  1IN5 A;  2P5V A;  2EJR A;  2EFP A;  3WGI A;  5FGM A;  2QLZ A;  2Q0O A;  2EFN A;  1TQP A;  2PEX A;  2ZNY A;  2FML A;  3W6K B;  1QPM A;  1JHH A;  1G3S A;  3LST A;  3E3V A;  2IPQ X;  1W7P A;  1W5S A;  3R61 A;  4KN4 X;  1T98 A;  4MHG A;  2DO7 A;  1W4M A;  5BPD A;  1IF1 A;  3KP7 A;  3WTW C;  1WRJ A;  1Z7U A;  4KN7 X;  1LDK B;  3TDZ C;  1W7P B;  2QWW A;  2DK8 A;  4PDK A;  4Q47 A;  3GXO A;  5D6F A;  4LK0 F;  1FOK A;  1TNS A;  1UFM A;  3MWM A;  4A2U A;  1KU7 A;  4OOI A;  1Z91 A;  4FHT A;  3L9F A;  2XAG A;  4OMY A;  3Q9S A;  4BH9 A;  5F6F A;  3NEU A;  2PFB A;  1LEB A;  1QO0 D;  3T8R A;  2PI0 A;  5IT3 A;  2K02 A;  3DV8 A;  5HVQ C;  3ERE D;  3LQR A;  5LGU A;  1FNN A;  2NAZ A;  5E1W A;  2ISY A;  1WQ2 A;  1USS A;  2Z9O A;  4LLL A;  1ZG3 A;  2Z99 A;  3JAM K;  1ZGJ A;  3BPX A;  1BC7 C;  4LD5 A;  2ETH A;  1PUE E;  2QQ9 A;  4DNC A;  1LQ1 A;  4IJA A;  1D8J A;  3C1D A;  2E1C A;  3IKT A;  4KUM A;  4UV8 A;  1YFH A;  4MTD A;  4GCV A;  4KFC A;  4A5N A;  2JTV A;  3RKY A;  5DCF A;  1TTY A;  4UVB A;  4ZYH A;  3RTR A;  4A6E A;  2GXB A;  1LDD A;  3FMQ A;  2D1H A;  1DDN A;  3SHF A;  4CZZ A;  1EH7 A;  4M6Y A;  4ZZD A;  3K69 A;  1PP8 F;  2MBF A;  2Y48 A;  3CUQ A;  1G3W A;  4WCG A;  2H6C A;  5L3G A;  2HYG D;  3CO6 C;  1YW8 A;  4OIP F;  2YSR A;  1YIO A;  3V7S A;  1P4X A;  3E5X A;  2R3S A;  5HDK A;  3CUQ B;  2ZBK A;  5ILU A;  3F8B A;  3TO6 A;  3MEX A;  4O5V A;  5AIP A;  3PFI A;  5HOO A;  4AVP A;  1XSX A;  1SFX A;  5BMZ A;  1UB9 A;  2LSO A;  2QYO A;  2GA1 A;  1WWX A;  4BNC A;  2Y75 A;  2K4J A;  1WKM A;  2LDU A;  5LHG A;  2JZY A;  1ZG1 A;  3RI4 A;  2QM3 A;  1KQ9 A;  1B9M A;  2NNN A;  5TJJ A;  1J0R A;  5LLQ A;  3F23 A;  5HS7 A;  1C0W A;  1BI1 A;  5A2Q Z;  1S8N A;  1B1B A;  4IRH A;  3I64 A;  2ESN A;  2KIU A;  1R1T A;  2RGV A;  2PLY A;  2QQB A;  3GUD A;  3U2R A;  3BWG A;  1S29 A;  3O3K A;  3RYP A;  3V7R A;  3OOP A;  3QP5 A;  4YII A;  2YPR A;  4HV5 A;  1XGM A;  4I7H A;  4UUV A;  5E1X A;  1SD4 A;  2BYV E;  4RGR A;  1YW7 A;  5E20 A;  2IP2 A;  2Q2E A;  5CVJ A;  5D6E A;  4B09 A;  2D45 A;  4WWC A;  4LJZ F;  2C6Y A;  3F8C A;  4HF2 A;  3ISP A;  3RKX A;  3KFW X;  3SZT A;  5JI6 A;  3HHH A;  5CVR A;  4F7Z A;  1Z1D A;  2H09 A;  3SXY A;  1HBX G;  5L3E A;  2V1D A;  1K79 A;  1MJB A;  4WXH A;  1K78 A;  1V4R A;  1O3S A;  2BGC A;  5LHI A;  4IPA A;  1AOY A;  2OBP A;  2DLL A;  2A61 A;  2VC1 A;  1LEA A;  2EB7 A;  1K78 B;  3ZMS A;  3FZV A;  5L3C A;  3WTS C;  1I1S A;  1MJ9 A;  1TW3 A; 
#chains in the Genus database with same CATH topology
 2E5Z A;  3UR3 C;  3QU6 A;  1HQC A;  2RQQ A;  4KIT B;  3N4M A;  2TDX A;  1FX7 A;  2ECC A;  2MAB A;  4E70 A;  3ZQ7 A;  2GAU A;  4RS8 A;  1QZZ A;  3MMY B;  2XAH A;  2W25 A;  4XON A;  2HDC A;  3EUH C;  4F52 A;  2H8W A;  2QGU A;  4BHC A;  4XRM A;  3CD6 I;  1YE9 A;  2XIG A;  1SD7 A;  3H1C A;  1IDY A;  4ZTJ A;  2LF7 A;  1N78 A;  2DTR A;  2VPR A;  2STW A;  4BY1 J;  4WXC A;  2W7N A;  3HC7 A;  1DUX C;  3BZC A;  3KEO A;  4ABZ A;  2F5V A;  2HGC A;  2ZME B;  2V1U A;  2R7S A;  5GAH J;  3C2B A;  3CUQ C;  3ZQL A;  2HVR A;  4EJO A;  3FK7 A;  3D1N I;  3COA C;  2QQA A;  3M7G A;  2E7X A;  1GV5 A;  2IGK A;  3OYM A;  1BR1 A;  1HC8 A;  4A0X A;  2OQG A;  4EMS A;  2V7F A;  4NDL A;  1XSV A;  5CKT A;  3DF8 A;  4JOM A;  2KQR A;  4KIF A;  4HLX A;  4B48 A;  1RKW A;  4ESF A;  1RUO A;  1MMS A;  1SAU A;  3HOY J;  5L3D A;  4S0H B;  2E19 A;  2IBD A;  4BHB A;  4EJT A;  3GTM J;  3CQZ J;  3P7N A;  3IP4 B;  2EH3 A;  2BVL A;  3WE3 A;  1B72 A;  1X1C A;  4U0W A;  4KA4 A;  1X19 A;  4JK1 X;  4XLA A;  3ZQI A;  4FIS A;  4M9Z A;  3CCR I;  2RKH A;  3D5S C;  3LNQ A;  4HQE A;  1JTY A;  3GZN B;  3QOP A;  2ESH A;  2ID3 A;  1QVU A;  1B72 B;  2VON A;  4E6K G;  3LSJ A;  2LKP A;  2CV2 A;  2HOT A;  5DD8 A;  3HPG A;  5CLS A;  2KDZ A;  1X3W B;  2QEN A;  4LB5 A;  1I1G A;  3HTS B;  3GTP J;  3A1Y A;  4E7J A;  1KA8 A;  1DGW Y;  1N75 A;  1GHC A;  4XN3 A;  4GXO A;  1IO2 A;  1MMD A;  2CRG A;  4L5I A;  4JQF A;  2E1M B;  2OC6 A;  2EV6 A;  1OCO H;  4R79 A;  3ZOB A;  4M3D A;  4AIJ A;  3K4J A;  1MBG A;  2ICW G;  1IJW C;  2Q1Z B;  4HQM A;  4G6Q A;  3IV5 A;  4BAC A;  5ED4 A;  3DKW A;  4CO8 A;  1IXS B;  1T6S A;  2XC7 A;  4FTH A;  4LK1 F;  3K0L A;  3HSF A;  2IA2 A;  1ACI A;  1B9N A;  1J09 A;  1P7J A;  3REO A;  4F92 B;  4MQ9 F;  3C2H A;  2AHQ A;  3ONQ A;  3BT9 A;  2W24 A;  1VND A;  1O4X A;  4XRS A;  4I2O A;  3FX3 A;  1SFK A;  1I6X A;  3E97 A;  4K2E A;  4ZDO A;  3JR9 A;  2BV6 A;  3S3O A;  3IAM 2;  4Z2Y A;  2KJC A;  1EA3 A;  1MNE A;  4J00 A;  4HG2 A;  1Z0X A;  4C9Y A;  3VYU B;  3I58 A;  2QA4 I;  2JWT A;  1MMN A;  1PDN C;  3F9K A;  3RZD J;  1MBJ A;  2MYS A;  4H4K C;  3K4N A;  3ZMT A;  2ZKZ A;  3OYD A;  2GWR A;  4RMN A;  4B8X A;  2VPL A;  5EYR A;  5K7Z A;  5IYD J;  2XGD A;  1IRF A;  3E7L A;  3TO9 A;  2F5F A;  5BPI A;  4L0Z B;  4BBR J;  3PL8 A;  3J80 K;  1DP3 A;  3OYE A;  3GYH X;  5D5U B;  2OCE A;  1YJN I;  3VWB A;  1RNL A;  4X6A J;  4Y7N J;  2HI3 A;  4IHW A;  1KU2 A;  2F5E A;  1OCT C;  3CP2 A;  3I71 A;  4B43 A;  3CCU I;  1U2W A;  1N25 A;  3CJR B;  2L2O A;  3GLL A;  1SMT A;  1V55 H;  3E5U A;  5CQE A;  5FO5 A;  5HS8 A;  4BXU A;  5CYV A;  3RSN A;  3J80 Z;  1W0U A;  5D5V B;  2XRO A;  2YS9 A;  3FBN B;  4N9H A;  4XSZ F;  3SFZ A;  2EIJ H;  3BJO A;  4PGG A;  4HPQ A;  2LG4 A;  5FRN A;  1SFO J;  3CUO A;  3QPS A;  2LH9 A;  1ZHF A;  2OCC H;  4HW0 A;  1HDD C;  3VPR A;  3CMA I;  3IC7 A;  5AIQ A;  4Y3O A;  3PNV A;  4O3M A;  3HKZ N;  5H6R A;  4CDG A;  3GTJ J;  2MC4 A;  2BOL A;  4NHJ A;  3DEE A;  1IAW A;  1KZH A;  3HB9 A;  1M1E B;  1XMK A;  4BEH B;  1OCZ H;  3HL2 A;  4U7D A;  1F4K A;  1JUP A;  2FD5 A;  2M30 A;  1E2X A;  1RR8 C;  1IN4 A;  2AS5 F;  1G8X A;  5FB2 A;  4HBL A;  4WF2 A;  3OYG A;  1MNM C;  5FKO A;  2X1C A;  1GLN A;  2IS2 A;  2W82 A;  2IAI A;  4M6X A;  3L1P A;  3DCF A;  1XS9 A;  2E7W A;  3KZZ A;  3TBI A;  4QIW N;  5L3B A;  4YIR X;  4PCQ A;  4IOC F;  1K4T A;  2E2J J;  4A3C J;  2LLK A;  3DPT A;  4UNO A;  2EFO A;  5J40 A;  3R4K A;  4OU0 A;  2X85 A;  3E6D A;  1FYL A;  4L5E A;  2KZG A;  1REP C;  2NXN B;  2OZ6 A;  3HDD A;  1J59 A;  2XAU A;  5FRO A;  2KRH A;  2A6T A;  2WY8 Q;  3I59 A;  3QPL A;  4QSH A;  3ZN0 A;  4XID A;  5TIS C;  4CCO A;  1KQ0 A;  5DDG A;  3CTA A;  3FKI J;  1KU9 A;  2QSF X;  4JBA A;  5ICF A;  4IQJ A;  4U87 A;  5M3F J;  4OIO F;  5M5Y J;  2M8G X;  2BE5 F;  2JRM A;  2R7Q A;  3VEP A;  1JKR C;  2V4J C;  3MZY A;  2HVQ A;  4OIQ F;  5IT9 Z;  3I59 B;  1V5F A;  2V9P A;  2ZME C;  2UZK A;  3H3V K;  2A3S A;  2FBI A;  1UHW A;  1P4A A;  2PMZ N;  2BW3 A;  4ZYA A;  3FDY A;  3CDI A;  3HKZ A;  1XB4 A;  3KLO A;  3TDU C;  3W6V A;  4UVA A;  3RJP A;  4ZH4 F;  1FSE A;  5B5E C;  2Z3Y A;  1ZRC A;  4A3M J;  3LAJ A;  1WJ5 A;  5CVI A;  3K4C A;  3EQL F;  5K5R A;  4KYW A;  4I01 A;  2VXZ A;  2BW3 B;  3MKZ A;  4BDZ A;  4KMF A;  1TWG J;  3BZ6 A;  5ICC A;  2BY0 A;  3OYB A;  2PMH A;  3Q9V A;  3W2A A;  3NRV A;  2AO9 A;  4HZF A;  4U7B A;  2LD5 A;  2EZH A;  3HOT A;  2O61 A;  2IS6 A;  1STZ A;  4LGW A;  2MD5 A;  4XLF A;  2W85 A;  2L02 A;  1MBK A;  1Z3Y A;  4C30 A;  4BQA A;  1ETV A;  1OCC H;  1U8B A;  2X51 A;  5LEJ A;  3WTV C;  4XIC A;  2BHY A;  1MGT A;  4QTR A;  4EV0 A;  2PJR A;  2EIK H;  3WTT C;  3U1D A;  1J2X A;  1IUF A;  1SVL A;  2LNB A;  3TGN A;  4IOA F;  1K61 A;  3CO7 C;  2R7U A;  3K4M A;  1UEL B;  1IG7 A;  4I76 A;  1ITY A;  3I56 I;  1KU3 A;  2NOG A;  1HW1 A;  4BKX A;  2FQ3 A;  2JA6 J;  1GVD A;  4B44 A;  3AFH A;  2AQF A;  2PJR B;  3MZ8 A;  4XRF A;  4BQN A;  4XLN F;  5F0C A;  3PJR A;  5FKM A;  3K1P A;  4EM2 A;  5J1Y A;  2E1M C;  2V9V A;  3LSP A;  3ZMU A;  3FXR A;  1FPQ A;  2PMZ A;  3FM5 A;  5EF6 A;  1SD6 A;  4RM2 A;  4XSX F;  2ISZ A;  3F8N A;  1VQL I;  3CCL I;  4CSW A;  1U78 A;  2VBW A;  1ZRF A;  1GDT A;  2XAQ A;  1HKS A;  3ELK A;  3CES A;  5D5X B;  3BY6 A;  1TWC J;  4BY7 J;  3VDX A;  4BL0 B;  3FHZ A;  1EH6 A;  1MKM A;  1XGN A;  1T0F C;  2DOF A;  1TT0 A;  3GTQ J;  1G59 A;  2CU7 A;  4L18 B;  1N77 A;  3K1N A;  4N9I A;  1YIJ I;  3Q0V A;  1R7J A;  4CCK A;  2Q8K A;  5HS9 A;  5F1J A;  3WTU C;  3BPV A;  1LE8 A;  1P9Q C;  4PSW A;  3M9A A;  1WJF A;  3L2W A;  2ZJ2 A;  1YOV B;  1CF7 A;  3HRU A;  2V1X A;  4HLY A;  3FXO A;  2JK3 A;  5LHH A;  5J4V A;  1FZP B;  2RVC A;  1BIB A;  1LE8 B;  3BR0 A;  2Z2S B;  3DPL C;  3W2W A;  3OR1 C;  3HOX J;  3CLQ A;  1JGS A;  2VBZ A;  4RB3 C;  2K9S A;  2VAS A;  3BRO A;  2HQA A;  1VQP I;  1CF7 B;  1HW5 A;  2FXA A;  5IYB J;  3JAM Z;  2MLK A;  3G73 A;  3CCS I;  4N0B A;  5ICE A;  1WPK A;  4EAT A;  4RB1 A;  1ZGA A;  2DMU A;  4RLQ A;  5FJ8 J;  5KCM A;  2LYC A;  3W2V A;  1D0Z A;  4A3L J;  4Y52 J;  3ABM H;  4BYY A;  1S7E A;  2ZJP F;  1B6A A;  2H1L A;  1BJA A;  3GBG A;  1VTN C;  2DOE A;  2O3F A;  3EUH A;  4B3A A;  3H36 A;  2M7B A;  4RLF A;  1QHH D;  3S14 J;  3F6O A;  2H27 A;  2K9M A;  3BR3 A;  3LL7 A;  2XAF A;  2XV4 S;  5JR3 A;  3BR2 A;  4OIR F;  2B9S A;  3CCJ I;  3HRS A;  2DJI A;  3RDI A;  3ZCO A;  5ILS A;  3HSR A;  4G94 A;  1YHQ I;  2MH2 A;  1U9O A;  1ETW A;  1UCR A;  2D2W A;  3H5A A;  2QZ8 A;  2G9W A;  3G1M A;  3BZK A;  3ZMZ A;  5DUI A;  2VT2 A;  3PNY A;  5E3O A;  3GTG J;  2DI3 A;  3JRC A;  3BP8 A;  3QOE A;  2EBI A;  1P4W A;  2ELK A;  1RIO H;  1ZRD A;  5EDN A;  1FTT A;  3BCB A;  3DTE A;  3PIO F;  5J4Y A;  3SDB A;  1JKP C;  4YFN F;  2G7H A;  3GEZ A;  4DIQ A;  2BBY A;  4DOZ A;  1J9I A;  4B4C A;  4RGX A;  1EF4 A;  2EFW A;  4BXF A;  2CQN A;  4R8H A;  2NRA C;  2KIM A;  2LRD A;  5LRR A;  5LGT A;  3WTX C;  3I0T A;  2DDA A;  4DZJ A;  2KIS A;  2A69 F;  1SVM A;  4IHV A;  2PJP A;  1P6R A;  2GIZ A;  3FMR A;  2K86 A;  4O6J A;  4FQG A;  1AKH B;  2HPI A;  2FBH A;  1BIA A;  2JUC A;  2MSY A;  3V7C A;  2R92 J;  3EPZ A;  2WV0 A;  3B6C A;  2DMT A;  2D1V A;  1OYY A;  2YX7 A;  1LDJ A;  3JW4 A;  3AL0 C;  2X0L A;  1FYK A;  3OYL A;  4YFK F;  2DA4 A;  2WAF A;  5J1R A;  3K7A J;  4P9U A;  1R58 A;  1SMY F;  5IP6 A;  3K4K A;  3CLO A;  4XQF A;  1TNT A;  3KYL A;  3L2U A;  4II2 A;  1YRN A;  3BR1 A;  3G4S I;  3F8F A;  3WTZ A;  3QQA A;  4UY8 I;  5E1Z B;  1YO5 C;  2Z1D A;  3CDL A;  1U3E M;  3FWE A;  3BTI A;  4BQQ A;  3F22 A;  3RKW A;  3OIO A;  1G4D A;  1PUF A;  4WX9 A;  3ZQF A;  2VKD A;  1YRN B;  4ZYE A;  4LIT A;  5FLX K;  4YEJ A;  5LD2 C;  2GIV A;  1HXD A;  3PUB A;  3BTC A;  4HOB A;  5HDG A;  5J3L A;  4A3I J;  1PUF B;  4AYB A;  2FEZ A;  2DYR H;  2NS8 A;  4I99 C;  5ILV A;  2JPB A;  2A6E F;  1T56 A;  2Y30 A;  1Z77 A;  4FET A;  5FLX Z;  4WK8 F;  3RKQ A;  1OYW A;  1R1U A;  3LA7 A;  1IUY A;  2CSO A;  2GOX B;  2MLG A;  1TQM A;  3K9T A;  3EET A;  4LMY A;  5B1B H;  2P5L C;  1XMX A;  1A35 A;  1ERD A;  1XN7 A;  2YU9 J;  2W57 A;  2W4S A;  2GQQ A;  1R22 A;  1VQM I;  1LUJ B;  2M4K A;  3P5J A;  2RNJ A;  3PSF A;  4E4H A;  2BY1 A;  2NNY A;  3OYC A;  1WFX A;  3CCY A;  3KP5 A;  4E7S A;  1X4O A;  1QHG A;  3I53 A;  4EM1 A;  4JX6 A;  2WB1 N;  3WU1 B;  3WG9 A;  2IGO A;  2XHK A;  2ZJR F;  1ON1 A;  2IGN A;  3Q5F A;  3GFL A;  2K27 A;  2E1N A;  3TW7 A;  1K6O A;  1LNW A;  1FEX A;  2VQC A;  3OS1 A;  1VQO I;  4A93 J;  1WH5 A;  1A6I A;  3HUG B;  4A3K J;  2ELH A;  1GV2 A;  2VOP A;  5F27 A;  3PIP F;  1MDM A;  4P55 A;  4GYG A;  2R7X A;  1FWZ A;  1G6N A;  1D5Y A;  4GFB A;  3DTI A;  1R4M B;  1U5T A;  3TO7 A;  4PFP A;  2FMY A;  5EZG A;  3VSK A;  4EJU A;  1MH4 A;  3TQN A;  1E3O C;  1ETO A;  3EYY A;  2ZSH B;  2GXG A;  1MDM B;  2DA5 A;  2VJ5 A;  3QU3 A;  1JGG A;  3OMY A;  1I39 A;  1JE8 A;  2QF7 A;  4YRV A;  3RYR A;  1YYV A;  4KIC A;  2VQH A;  4MLO A;  4MEX F;  1U5T B;  2FRH A;  4ZZL A;  1Z6R A;  3OV8 A;  3IRQ A;  5E3M A;  2BXZ A;  2X6X A;  3OYK A;  4M3E A;  1AHD P;  1Q1H A;  4G9Y A;  2XRN A;  3ABU A;  3PQJ A;  2L7K A;  1TW2 A;  2JSC A;  2XPU A;  5K7F A;  4EVI A;  3K6G A;  1ENH A;  3ZXS A;  1HF0 A;  1LVK A;  2DFI A;  2HZT A;  3GME A;  5F0F A;  4BAY A;  2FX0 A;  3GZ6 A;  4U0V A;  2LBF A;  1D3Y A;  1P92 A;  4PJL A;  1TBX A;  3T5X A;  2WB1 A;  4J01 A;  1Z67 A;  1R71 A;  2CQK A;  2DYS H;  4IVN A;  4IO9 F;  3MAJ A;  6PAX A;  3IWF A;  2ZME A;  1UST A;  2CW8 A;  3H9Q A;  2R7F A;  2LBF B;  3N97 A;  1F1Z A;  3OYF A;  2FBK A;  1FYM A;  3GO5 A;  1YX3 A;  2BEO A;  4NNJ A;  3Q3S A;  4G8X A;  2CFO A;  2NS7 A;  3WG7 H;  4C3H J;  1HKQ A;  3PM1 A;  4PUS A;  1F9N A;  4HV6 A;  4M74 A;  4DYC A;  3IUO A;  3A03 A;  3FM3 A;  5HLI A;  1NK2 P;  4FE4 A;  1RET A;  1U6G A;  2O0Y A;  3LMM A;  1BA5 A;  3JTH A;  5K5O A;  1K6Y A;  3VSL A;  3AG1 H;  2JSP A;  3LA3 A;  2XKP A;  3HPH A;  2OQR A;  4M6V A;  3WHC A;  3EYI A;  2EV5 A;  2X6W A;  4D1Q A;  2X1E A;  2DN0 A;  3A01 A;  4OIN F;  2CQX A;  2IT0 A;  3G2B A;  3MZH A;  4OMZ A;  4E7H A;  2XKO A;  3WE2 A;  2IW5 A;  2DCE A;  3KET A;  1MZB A;  1FIA A;  3J7Z I;  2Z33 A;  3OOU A;  2VBY A;  3A01 B;  2KFD A;  4ZYG A;  4EJW A;  2JPC A;  1ETQ A;  4A3D J;  1ODD A;  4FT8 A;  2EK5 A;  3CC2 I;  4GRI A;  3BLY A;  2DU9 A;  2WV1 A;  4Y17 A;  5K7H A;  1GXQ A;  4D9J A;  2X1D A;  1R4N B;  1FY7 A;  1YW9 A;  1Y8Q B;  3J81 K;  3S3N A;  2OAZ A;  3K1M A;  3GF2 A;  2LRE A;  4YEL A;  2DQL A;  3LFU A;  5ICG A;  3HOU J;  3P9C A;  4G12 A;  1LFP A;  2DTZ A;  1O3Q A;  4RAG A;  2JA7 J;  4ENJ A;  1TWA J;  4NUB A;  4MFD A;  3HXL A;  3IH2 A;  2COB A;  2IXS A;  2Z5U A;  4KIS A;  3J81 Z;  3A02 A;  3ABT A;  3CME I;  1S7A A;  3K70 D;  3DWL E;  2XPW A;  4FX4 A;  2MW8 A;  1P2F A;  1RPW A;  3HG9 A;  3LSM A;  1T0F A;  2B0L A;  4H0E A;  1DPU A;  1XDU A;  2I5U A;  2QEX I;  3BC8 A;  4KT6 A;  1JJ6 C;  4FE7 A;  1XGS A;  5CPR B;  1OMI A;  2WAQ N;  5IY5 H;  3CDH A;  2R7R A;  1QU3 A;  4HNT A;  1BR2 A;  1ETK A;  2Y0S N;  5K5Q A;  3S1Q J;  4XOP A;  4P9F A;  5C4J J;  5E8I A;  3LA2 A;  1XX5 A;  1R1V A;  3MKW B;  2A6H F;  4OAY A;  2DT5 A;  2V6C A;  2BY3 A;  1BJZ A;  3HSE A;  3ECH A;  2VXD A;  4PJJ A;  2VOD A;  2X9D A;  4CZC A;  3LQQ A;  4XMY A;  1ULY A;  2FU4 A;  3CP8 A;  2HZD A;  2VE8 A;  3EUK L;  4EM0 B;  2LF8 A;  3ZRG A;  1TLH B;  3S1N J;  3CC4 I;  5H20 A;  2KIF A;  2DA3 A;  3JCU C;  5CVU A;  3ERM A;  5E18 F;  1MMG A;  1O7F A;  3HRT A;  1JJ8 C;  3QP6 A;  2M3A A;  3BDD A;  2XB5 A;  2F5C A;  1IRG A;  1X2M A;  2DMN A;  4GGG A;  2JRT A;  4S05 A;  2FA5 A;  3TOB A;  1R5H A;  1MH3 A;  1NG6 A;  2IA0 A;  4AWX B;  1A04 A;  2K85 A;  4RGU A;  2J5P A;  1HLV A;  4A3F J;  3CZ6 A;  4G7O F;  4G7H F;  1RZ4 A;  3JRB A;  1MSE C;  1R23 A;  2HQN A;  4I02 A;  4WXD A;  4F93 B;  3VOD A;  1CGP A;  3OYN A;  2L01 A;  2R0Q C;  1W1W E;  1OKR A;  2OF7 A;  2CQ7 A;  5FRM A;  2R7V A;  4RAZ A;  1L3L A;  2RV8 A;  3FXL A;  4ZDP A;  3IRR A;  2EV0 A;  3BTL A;  2WAQ A;  4BEH A;  3S17 J;  3ABK H;  5DS9 A;  3FMS A;  3DBL B;  4B1R A;  5JFR A;  4PZJ A;  1I5Z A;  2Y0S A;  4DZP A;  3H3Z A;  2W00 A;  4A69 C;  2PG4 A;  2I8D A;  2LMD A;  3ESW B;  1FC3 A;  2A5Y B;  5E79 C;  2ZXW H;  5GAG J;  2M8E A;  1U5T C;  4HNU A;  3OS2 A;  1IN6 A;  3R0A A;  2ADU A;  3QRF F;  1B8I A;  4EQQ A;  2HR3 A;  3BQZ A;  1S5L C;  3DEU A;  1T08 B;  1D1B A;  2IS1 A;  2CUZ A;  3IKV A;  3T8T A;  4DYR A;  2PN6 A;  4RAF A;  5KAI C;  4CCJ A;  4IEJ A;  1B8I B;  2R7W A;  4I09 A;  1FIP A;  4XOT A;  4IKF A;  2ZO4 A;  3WTY C;  1LJ9 A;  2L9N A;  1ZR4 A;  1W36 D;  3JSO A;  1O3T A;  5FFZ A;  5FKN A;  3WU0 A;  2DAO A;  1ZRE A;  4BU2 A;  2OD5 A;  2MD0 A;  4PJM A;  3GTK J;  4AM3 A;  2L0K A;  2XDV A;  4YIF A;  2VI6 A;  2ZNZ A;  1WJD A;  2M9H A;  3TP0 A;  3TL4 X;  4ENK A;  2IVM A;  2LC2 A;  3L2C A;  1U9N A;  3R0J A;  3R60 A;  1FLI A;  2QKL B;  2M5W A;  2L54 A;  2CGP A;  3A4C A;  1J7K A;  2L4M A;  2ELJ A;  2NVQ J;  1IN8 A;  1SFU A;  2Y2Z A;  3AL0 B;  5J8F A;  2J5O A;  2HQR A;  2E36 A;  4RGS A;  5HLT A;  3SFI A;  1XMA A;  5E3N A;  3BG7 A;  4HDU A;  2L4A A;  3F8M A;  4JX4 A;  4RA2 A;  2PQ8 A;  2V1N A;  4G6D A;  4MQV A;  1PP7 U;  2KRC A;  3ASO H;  3CCM I;  1D0Y A;  2HTS A;  2JVH A;  2G0E A;  4RM3 A;  4CCL A;  5BS6 A;  2E34 A;  3B02 A;  4ZDL A;  2CUJ A;  4ANJ A;  2FOK A;  2R5Y A;  3Q0U A;  3RPQ A;  2OTL I;  1JXS A;  5JLX A;  4DBR A;  2EA4 A;  3J7Y J;  5ERI A;  4D5C A;  3KP6 A;  2HXO A;  4UVC A;  1RI7 A;  3JTG A;  1XTA A;  4XLP F;  3GFM A;  2R5Y B;  4S04 A;  3H5N A;  3RIR A;  1FMV A;  2RC4 A;  4I0B A;  4FAS D;  4A12 A;  4CH7 A;  1SC7 A;  5FFX A;  3OSG A;  1AWC A;  1MBH A;  1JTX A;  3CJN A;  4Q4Z F;  1FP1 D;  4X1E A;  3H9J A;  3K2Z A;  4MTE A;  2WC2 A;  1IZ1 A;  1FP2 A;  2CYY A;  1TP4 A;  4XRS G;  3HOS A;  1D0X A;  2K4B A;  3KE2 A;  1T2K A;  4GO1 A;  4C3J J;  3S3M A;  3P9I A;  3HTU A;  3LSK A;  1IRX A;  1NK3 P;  3B6A A;  3F3X A;  1SAN A;  1FJL A;  1QBJ A;  3V8L A;  1OCP A;  1ZAO A;  3DTK A;  4DBQ A;  1KQ8 A;  5DV5 A;  2HOA A;  3F21 A;  1XSD A;  3CMY A;  1T39 A;  5H2F C;  4MGR A;  3ULQ B;  1UMQ A;  1OCR H;  2XVC A;  2RAE A;  3O6B B;  1UAA A;  3RQI A;  2V9K A;  3V8K A;  2HYF A;  1WJB A;  2DQR A;  4V2G A;  1OIS A;  4Y13 A;  5KK1 A;  1Z21 A;  1YS7 A;  2IA1 A;  1IN7 A;  4Y15 A;  1HA8 A;  5EGO A;  2NVT J;  2HTJ A;  3KP4 A;  4RB2 C;  4F55 A;  3E5Q A;  2KIQ A;  4CCM A;  2HPM A;  4CYD A;  2IRF G;  2HWV A;  3PFY A;  2EA2 A;  3ZGK A;  2L9V A;  3SQN A;  4JYK A;  5E8G A;  3NWS A;  4IX7 A;  4G7Z F;  4LLG F;  4A5M A;  2K9L A;  2VT3 A;  3OL3 A;  3S32 A;  1MJA A;  4A6D A;  5EEA A;  5EGO B;  3G1O A;  4CYC A;  3LSI A;  2CFX A;  3QYB A;  4KNY A;  2HS5 A;  2P5K A;  5TRD A;  3H92 A;  4QLC U;  1ON2 A;  3HRM A;  3TW6 A;  3DQV C;  4XBF A;  4Y33 A;  4BDY A;  1EV7 A;  2M1B A;  5JHU A;  1HOM A;  3C7J A;  5F64 A;  1HST A;  3KLN A;  4CYC B;  2QBY A;  1TT5 B;  2V26 A;  3O2P E;  3JRA A;  2L3D A;  3MKY B;  3JRD A;  4ASN A;  5E17 F;  1APL C;  2RNG A;  2XPV A;  3DP7 A;  1CQT A;  1TZL A;  1WH7 A;  1OYI A;  1OFC X;  2HU9 A;  2WA0 A;  2LY9 A;  2VE9 A;  3AKZ A;  3M8J A;  3V4G A;  2EZL A;  2HQ5 A;  3P9K A;  2QBY B;  5BQT A;  3ZQH A;  4YG2 F;  2JVG A;  4XKB A;  1MD0 A;  1IXR C;  2HFH A;  1XC5 A;  2N8G A;  4MEY F;  2L7M P;  4XN0 A;  1JT0 A;  4M72 A;  2R7O A;  2JA8 J;  1LB2 A;  3HZJ A;  1YS6 A;  1X1D A;  2XGC A;  4ON0 A;  2M2E A;  3S93 A;  3SEQ A;  5JLW A;  2CW7 A;  1EH8 A;  2KKO A;  3M1C A;  3GFI A;  3TKY A;  1V3F A;  5E3L A;  4A3J J;  4KDP A;  5DYM A;  4A0Z A;  5DTD A;  2EZK A;  3I4N J;  3WGH A;  3QYE A;  2XGX A;  1G2H A;  2BXY A;  4N4N B;  1D5V A;  3HYI A;  3OL4 A;  4P1W A;  2KJB A;  2TCT A;  3H3U A;  2BZT A;  1DPR A;  1BR4 A;  1TWH J;  2LVS A;  4M3G A;  4BE2 A;  3KX2 A;  5JVG F;  3OR2 C;  1NG7 A;  3G1L A;  1E3H A;  1FT9 A;  1J5Y A;  2FNA A;  4L9T A;  2IJL A;  5F1R A;  3V8J A;  4OWR B;  5JVT A;  2E71 A;  2JMW A;  2O5R A;  2ME6 A;  1RC9 A;  1NTC A;  2DA7 A;  4W97 A;  5TGT A;  2AXL A;  5M3M J;  1ZH5 A;  2H8R A;  2LOO A;  1X4P A;  3U9G A;  2BY2 A;  4UV9 A;  4E7L A;  1BL0 A;  1ZG5 A;  1LVA A;  3IH4 A;  1FOY A;  3GLX A;  3H35 A;  2YU3 A;  2KRF A;  1A6Q A;  3L2V A;  3DXJ F;  4RB0 A;  1BOA A;  1H89 C;  1O57 A;  3M8F A;  1FBQ A;  1D1A A;  3TED A;  1EJ9 A;  2LFB A;  1SD5 A;  5HOD A;  1AKH A;  4A3G J;  2F5D A;  3FF5 A;  4HX7 A;  1IV6 A;  2EFQ A;  1KYZ A;  4MNU A;  1RES A;  1I6H J;  1WCM J;  2EIM H;  1UZC A;  5IOY A;  3F6V A;  3E6B A;  3HJE A;  2V6E A;  4E7I A;  2GM4 A;  5EZH A;  3I3L A;  5L3F A;  2ECB A;  1ZR2 A;  1TQI A;  2HKO A;  1KGS A;  3M1E A;  4AIK A;  3K4L A;  3KEY A;  4KIB A;  1JUS A;  5CVV A;  1A31 A;  3JSP A;  2H94 A;  2XGE A;  2DT7 B;  4ZTF A;  1G3Y A;  2M45 A;  1BOB A;  1LKX A;  2Y0M A;  5F0H A;  2P7C B;  3R6S A;  4M71 A;  1ZAR A;  2VLA A;  2A05 A;  4ENM A;  4BJ5 C;  2STT A;  1BN5 A;  2XAJ A;  4A0Y A;  4U0Y A;  1R5I D;  5A2Q K;  3LSR A;  1GVJ A;  2AXT C;  4RAY A;  5DEQ A;  4AD9 A;  5HDN A;  4W1U A;  2NVX J;  4BS9 A;  4KIG A;  1J75 A;  2FJ1 A;  1R00 A;  4LIU A;  1D8K A;  3OYJ A;  3IH3 A;  9ANT A;  1JKQ C;  4PK4 A;  1YLF A;  2M87 A;  2P0W A;  5LEK A;  3RPU D;  4IRI A;  2M34 A;  1IW7 F;  2FOW A;  5FLM J;  1UHS A;  3ML6 A;  3PQK A;  2NS0 A;  4Q5S F;  4BJ6 C;  4EGZ A;  3KIO A;  2QQ8 A;  5DCM A;  3DKY A;  1Z3X A;  2VN2 A;  3QWL A;  2Y69 H;  1MBE A;  1AA7 A;  1T33 A;  2AQE A;  2FNP A;  4BJT A;  2VBX A;  3GVA A;  3UNG C;  4BE1 A;  3M3Y J;  3K2A A;  4M9S A;  2WTE A;  3KEQ A;  3BR5 A;  2DT6 A;  4HST A;  3S2W A;  3H0D A;  2X6O A;  4L9N A;  1ZLJ A;  1FTZ A;  5DCM B;  1DGR M;  1OJL A;  3MKL A;  1BC8 C;  2V79 A;  1P7I A;  1QZY A;  2NVU B;  4AIH A;  1GT0 C;  2VUM J;  2P4W A;  2E35 A;  1TWF J;  3LAP A;  2LKX A;  3ZMD A;  5J47 A;  5HLG A;  1AU7 A;  1H9G A;  3E6M A;  2RQP A;  3D5L A;  5CJ9 A;  2UUZ A;  3MN2 A;  2HKX A;  1EKE A;  3DU5 A;  4UHT A;  4YFX F;  4EJV A;  2VJI A;  3DLA A;  4I6Z A;  1SFE A;  3HUG A;  4V2F A;  5FD5 A;  4HF1 A;  1POG A;  5AON A;  3ZPL A;  2TRT A;  4V19 K;  2DA2 A;  3CCV I;  3GW2 A;  5LFA A;  2PMU A;  5DM7 F;  2P8T A;  3FKJ A;  2OTJ I;  4L9V A;  1FOX A;  3VFZ A;  2JT1 A;  1VQ8 I;  1FSH A;  3G3Z A;  1O3R A;  4EGY A;  2DPD A;  2UV1 A;  4IF4 A;  1YQA A;  3M4O J;  2VKH A;  3IWZ A;  3AAF A;  1X1B A;  2Y31 A;  4HSR A;  2P7V B;  2ZSI B;  1E17 A;  1WI3 A;  4KT5 C;  3HIF A;  1ORK A;  3IL2 A;  1QQI A;  3CJQ B;  1VI0 A;  3DFG A;  3NQO A;  4L5J A;  4UUS A;  3GX4 X;  3TMO A;  1XDS A;  1H0M A;  2Q2E B;  1DQU A;  2YR2 A;  3GZ5 A;  1ZLK A;  4KMU X;  2RDP A;  3ROU A;  3OSF A;  4LFU A;  4IHS A;  2O8K A;  1T38 A;  2R7Z J;  3PSI A;  4UUS B;  2GZW A;  3FXJ A;  3L00 A;  4FX0 A;  3CCE I;  5C4X J;  2Z16 A;  1GXP A;  1OPC A;  3W3C A;  1A36 A;  1W7P D;  1E3P A;  1PVE A;  5DUK A;  3M07 A;  5B66 C;  3QAH A;  1Y0U A;  2OV7 A;  1BI2 A;  3S8P A;  5M5X J;  1UG2 A;  2ACJ A;  1A5J A;  2XAS A;  2ZXJ A;  4IXA A;  1NHA A;  4HX8 A;  3LFK A;  3I54 A;  4PJN A;  3MFK A;  1LFU P;  2LK2 A;  2GBY A;  3ECO A;  3T1B A;  2VIX A;  4PSX A;  2FF4 A;  1WSU A;  2XF7 A;  2PX9 A;  1W0T A;  3S2D J;  1VQ7 I;  1JUM A;  3J7A O;  1Q1V A;  4XL9 A;  3BJ6 A;  1Z9C A;  1FMW A;  3HHG A;  5FKK A;  5EJC A;  4HAM A;  4DQ2 A;  1RRJ A;  2K9Q A;  4NC8 A;  1OR7 A;  2KHM A;  3I5U A;  1K4S A;  3KCC A;  3KP2 A;  3K70 C;  1JHF A;  2UXX A;  4UB6 C;  3BOQ A;  1S72 I;  1X3Z B;  2MA3 A;  3C3W A;  3BR6 A;  5H6Q A;  2EWN A;  2OA4 A;  2CS3 A;  2WAD A;  1QA6 A;  3U1K A;  2CUE A;  3S16 J;  3QOD A;  5DD4 A;  1Y56 A;  1YG2 A;  1ZK8 A;  3VB2 A;  1E0E A;  1Y0N A;  3O8H A;  3MVP A;  3O8G A;  1LFB A;  2X48 A;  3GTO J;  3OIP A;  2E60 A;  3Q0W A;  2W84 A;  1F36 A;  4CGZ A;  3PUF A;  3SZG A;  2NYX A;  4QWQ A;  2JA5 J;  1XCV A;  1BI0 A;  2QSH X;  4Q48 A;  3VYR B;  2GLO A;  2VKE A;  2F6C A;  3WU2 C;  1HCR A;  2MC3 A;  5KAF C;  2VKV A;  3F0C A;  3ZR8 X;  2P6S A;  2XF5 A;  5EG0 A;  4A3B J;  1K7A A;  1BW6 A;  3MD2 A;  3H9G A;  2P6T A;  3T0Y A;  5D4R A;  2R5Z A;  5D8L B;  1S7O A;  4HF0 A;  1ZYR F;  3RZO J;  2DPU A;  1JT6 A;  2KT0 A;  5EG0 B;  4UB8 C;  1RKT A;  4C3I J;  2CQQ A;  2DA1 A;  2ZFW A;  2DW4 A;  5K1Y A;  3I4P A;  3MCZ A;  1WJA A;  2R5Z B;  1MMA A;  3VOE A;  2HEO A;  4XLC A;  1JKO C;  3BTJ A;  1IGN A;  3WGG A;  2QCO A;  2ZCW A;  2R7D A;  1B59 A;  1ETX A;  2QKM B;  3L09 A;  3GTL J;  1QGP A;  1PJR A;  1UG0 A;  2Y9Y A;  2COM A;  3NAU A;  4ESJ A;  1KYW A;  4Z6Y A;  2WWY A;  3FXQ A;  3KP3 A;  5LBQ A;  4PJ0 C;  3I55 I;  4L0Y B;  2FSW A;  4LG0 A;  3PO3 J;  3ZMV A;  2GXA A;  4E7Z A;  5GPC A;  2R93 J;  1XCB A;  2W48 A;  1FBU A;  3D5R C;  2DJN A;  2LTP A;  1L0O C;  5GAE J;  1R9T J;  1HSJ A;  1DU6 A;  2JJ7 A;  2GA2 A;  1Z05 A;  2H6B A;  3QPT A;  1VQ4 I;  5GPA A;  4NB5 A;  2K5C A;  2F2E A;  4NQW A;  4LG0 B;  3L7W A;  4IHT A;  2FQ4 A;  3SZP A;  3HEF A;  2E5N A;  4C2M J;  1S3J A;  5LGN A;  3A2K A;  5LRS A;  2A68 F;  1DP7 P;  4BBS J;  3LWF A;  2CO5 A;  1MBF A;  3DBR B;  2OJE D;  2X6Y A;  4NQW B;  2QUF A;  5KVR A;  1QNT A;  1T95 A;  4UXN A;  1Y8R B;  4DYQ A;  2X4H A;  2CW0 F;  1HKT A;  2K7L A;  3F72 A;  4JP0 A;  1JI8 A;  4BHP A;  1UHM A;  3U21 A;  3TOA A;  2DBB A;  2OU2 A;  4U88 A;  2O8X A;  2B7E A;  3FXU A;  1XPX A;  2UXN A;  1ZN2 A;  4LB6 B;  1H9T A;  1WZ2 A;  2UWM A;  1W36 C;  2PBI A;  4I0A A;  3OYH A;  4NBQ A;  3ZQG A;  5D4S A;  2RN7 A;  2MFZ A;  4TV7 A;  4UUT A;  1R5G A;  1OLT A;  5J6X A;  1X3U A;  1W5T A;  3ZN1 A;  3B73 A;  2EZI A;  5BOX A;  1S6L A;  2CH0 A;  4P5O A;  1FBS A;  4E7K A;  1U8R A;  1RUN A;  3AG2 H;  2MH9 A;  3GWZ A;  1KON A;  5EEG A;  2G7U A;  4IRG A;  3RQ4 A;  4ZYD A;  2MG4 A;  1BBY A;  2ZB9 A;  1Z6T A;  1GUU A;  5GP9 A;  3M8E A;  2XF6 A;  4CCN A;  4HA8 A;  3MQ0 A;  3UKG A;  2R7T A;  2DFF A;  2O03 A;  2VQL A;  3A0B C;  4G6T B;  3EUA A;  4CIC A;  2KPM A;  3JRH A;  2P81 A;  2HVS A;  3BJA A;  3NWT A;  3GFJ A;  3WOD F;  1F5T A;  1Y1V J;  4GYI A;  3W6J B;  2R4G A;  3EDP A;  1BI3 A;  1VF9 A;  1V5G A;  1MW7 A;  2VC0 A;  3C18 A;  3FHN A;  1IXC A;  4LIV A;  4NC6 A;  3RPU A;  1F43 A;  1IV8 A;  4JX5 A;  3KZY A;  2DMP A;  2WBM A;  2XUB A;  2OZU A;  5J8C A;  5B1A H;  4XOR A;  1ONV A;  1VQ5 I;  1BM9 A;  5D5W B;  2ZC2 A;  2A07 F;  5GAD J;  1XGO A;  4M9X A;  3N05 A;  5C44 J;  2O6G E;  4ETS A;  4I98 B;  4AU7 A;  3KPH A;  2L9R A;  4HNV A;  4LLN A;  1D1C A;  5D8K B;  5FD6 A;  2YUS A;  4CA0 A;  3S2H J;  1HW2 A;  3X2Q H;  2DFH A;  1B4A A;  3H5R A;  2QSG X;  2EQR A;  1XD7 A;  1ZKG A;  3KZI C;  4ESB A;  2MGQ A;  1G3T A;  3NAR A;  3ZQQ A;  4L9J A;  4M73 A;  1R36 A;  1WVR A;  1X1P A;  2CG4 A;  4D0P A;  4ENN A;  4GDF A;  1I27 A;  1WI9 A;  3D0S A;  4XKW A;  2L5Q A;  3G6E I;  2A5W A;  4QPQ A;  2H1K A;  4HRI A;  1ZEL A;  1SAX A;  3IHU A;  5J1U A;  2CJJ A;  4PGH A;  1DU0 A;  5FLV A;  5EEH A;  4P96 A;  5HLH A;  4HYE A;  2HXI A;  3ZP5 A;  5C3E J;  4X0G A;  2HOS A;  2CWE A;  2DK5 A;  3CCQ I;  4CHU A;  3DPU A;  4HX4 A;  1YTY A;  4BE0 A;  2VJ4 A;  2EIL H;  1OR7 C;  2ZXI A;  5IT9 K;  3AG4 H;  4IL6 C;  1ZQ3 P;  2HOE A;  2JA2 A;  4HDV A;  1ETY A;  2FE3 A;  2VOO A;  4CXF A;  1IRZ A;  4ITV A;  3CJT B;  3E6C C;  1O7L A;  2YX4 A;  2QVO A;  2DFE A;  2L7F P;  3QPH A;  4R1H A;  4XLH A;  2XB0 X;  3DU6 A;  5GTH C;  3BG6 A;  1IN5 A;  2P5V A;  3SJM A;  2EJR A;  1WJC A;  2EFP A;  3WGI A;  5FGM A;  2QLZ A;  2L7Z A;  3IAS 2;  2Q0O A;  3K4B A;  4HEA 2;  5IYC J;  2K3F A;  2EFN A;  1TQP A;  2PEX A;  1R49 A;  2ZNY A;  2FML A;  4M3B A;  3W6K B;  3VYS B;  4BGD A;  5IP7 J;  1QPM A;  1JHH A;  1G3S A;  3LST A;  4MO7 A;  3E3V A;  2E2H J;  1TC3 C;  2IPQ X;  1W7P A;  1W5S A;  3R61 A;  4KN4 X;  4DW6 A;  1T98 A;  4MHG A;  2DO7 A;  1W4M A;  5BPD A;  3HOW J;  2KZV A;  1IF1 A;  3KP7 A;  3WTW C;  4XKV A;  1WRJ A;  1Z7U A;  4KN7 X;  3OIQ A;  1LDK B;  2JQ7 A;  2KLO A;  3TDZ C;  4A3E J;  1WJE A;  1YJW I;  1W7P B;  2QWW A;  1I3A A;  2DK8 A;  2LR8 A;  3C2G A;  3FK6 A;  3TP3 A;  4PDK A;  1TL8 A;  4Q47 A;  2HDD A;  3GXO A;  1YX5 A;  1SVO A;  4D5F A;  4N4O B;  5D6F A;  4LK0 F;  1FOK A;  2K9N A;  2NVY J;  4OAZ A;  1ZTR A;  1TNS A;  4AC0 A;  1UFM A;  3MWM A;  4A2U A;  5JHF A;  3JRE A;  4IZZ A;  4OOI A;  1KU7 A;  4CUG A;  2F4I A;  2XSJ C;  4J19 A;  4II3 A;  3CF2 A;  1Z91 A;  4FHT A;  2Y9Z A;  3L9F A;  2XAG A;  1QVT A;  4OMY A;  4Y4R A;  3Q9S A;  3E0J B;  3DEW A;  1IC8 A;  4BH9 A;  5F6F A;  3NEU A;  2K40 A;  2PFB A;  1LEB A;  1QO0 D;  2F48 A;  3T8R A;  2CUF A;  3K10 A;  3BQY A;  2PI0 A;  5IT3 A;  2K02 A;  3H0G J;  1X2N A;  5HNH A;  3DV8 A;  2IS4 A;  5HVQ C;  4IHY A;  3AG3 H;  3DKX A;  1X1A A;  3ERE D;  2EPF A;  3LQR A;  5LGU A;  1FNN A;  2VL8 A;  2BHZ A;  3SEZ A;  2NAZ A;  3FBI B;  1QRY A;  1NH3 A;  5E1W A;  1V54 H;  3WHB A;  5IP9 J;  1VQK I;  2ISY A;  2KMU A;  2WAE A;  2HNH A;  5F04 A;  3OY9 A;  1WQ2 A;  2KP6 A;  4XNF A;  2B63 J;  3HM5 A;  2EIN H;  3FXK A;  5KNL A;  1USS A;  2Z9O A;  1I3Q J;  4LLL A;  4B3X A;  2BVM A;  3S1M J;  1ZG3 A;  2Z99 A;  3ABL H;  1R6R A;  3JAM K;  1ZGJ A;  2HYJ A;  3BPX A;  5F08 A;  1PYV A;  1BC7 C;  2L9S A;  4LD5 A;  1X58 A;  1VQ6 I;  1V5E A;  2CV1 A;  2O9L A;  2ETH A;  3DBH B;  1PUE E;  3HGG A;  2QQ9 A;  4DNC A;  1LQ1 A;  4IJA A;  1UJ8 A;  3HOV J;  1D8J A;  3C1D A;  2E2I J;  2I10 A;  4D7M A;  2E1C A;  3JRI A;  4XLE A;  4KUM A;  2FUG 2;  4UV8 A;  3IKT A;  1YFH A;  2ZFU A;  3GCM A;  1YI2 I;  4MTD A;  2ID6 A;  4GCV A;  4KFC A;  4A5N A;  2JTV A;  3RKY A;  5DCF A;  1TTY A;  4UVB A;  4MIM A;  3S15 J;  4MFE A;  4ZYH A;  4EEF G;  3RTR A;  4A6E A;  2M0C A;  2GXB A;  1LDD A;  3FMQ A;  2D1H A;  1DDN A;  4M3F A;  3SHF A;  4CZZ A;  3L2Q A;  1EH7 A;  2E1O A;  4M6Y A;  2DDB A;  4XM3 A;  4ZZD A;  1W5C C;  3KYD B;  2WY7 Q;  3K69 A;  2DXI A;  1PP8 F;  2MBF A;  3BG5 A;  3BG9 A;  5KHD A;  2DA6 A;  3OS0 A;  2Y48 A;  3CUQ A;  1G3W A;  4WCG A;  2H6C A;  3PNT A;  5FKL A;  5L3G A;  1MND A;  2HYG D;  4BUP A;  3CO6 C;  2HDW A;  4XR6 A;  1YW8 A;  4F3Q A;  4OIP F;  2YSR A;  4IHX A;  2KDO A;  1YIO A;  3V7S A;  3RCO A;  5B3S H;  1P4X A;  3E5X A;  2R3S A;  4RBO A;  5HDK A;  2M7A A;  3G71 I;  3CUQ B;  3S1R J;  3VYT B;  4ZJZ A;  4NC7 A;  2ZBK A;  3FIS A;  5ILU A;  4F91 B;  2ZXH A;  3F8B A;  1WHU A;  1H88 C;  3TO6 A;  3MEX A;  3HGY A;  4O5V A;  1YJ9 I;  5AIP A;  3PFI A;  5HOO A;  2F4O B;  4AVP A;  1XSX A;  4LOC A;  4AYB N;  1SFX A;  4DGW B;  4LG3 A;  5BMZ A;  1UB9 A;  1VFC A;  3DLL F;  2LSO A;  2QYO A;  2GA1 A;  3I9V 2;  1WWX A;  4BNC A;  5HNF A;  2Y75 A;  3SYT A;  1K83 J;  1WKM A;  2K4J A;  2LDU A;  2LY2 A;  4KJZ A;  5LHG A;  2ME0 A;  2JZY A;  1ZG1 A;  3RI4 A;  2QM3 A;  2IEK A;  1KQ9 A;  1B9M A;  1IDZ A;  2NNN A;  4AUX A;  4AID A;  2JUG A;  5TJJ A;  2D5V A;  2ZJQ F;  1J0R A;  3BCA A;  3HBL A;  5LLQ A;  1VZ0 A;  1LPQ A;  3F23 A;  5HS7 A;  1C0W A;  1VQ9 I;  1VQN I;  1BI1 A;  2DOA A;  5A2Q Z;  1S8N A;  1YIT I;  1B1B A;  4IRH A;  3I64 A;  5GTI C;  2ESN A;  2KIU A;  4C2U A;  1R1T A;  2RGV A;  1HDP A;  2NOJ B;  1FOW A;  2PLY A;  3QYF A;  2QQB A;  3GUD A;  3U2R A;  4FCY A;  2GOM A;  3BWG A;  2XRL A;  2O7O A;  1S29 A;  3O3K A;  3FXM A;  1MIJ A;  1QZE A;  3RYP A;  3ZQC A;  3V7R A;  4BXX J;  3OOP A;  1T8I A;  3QP5 A;  4C2T A;  3PO2 J;  2IGM A;  3ASN H;  2CV0 A;  2M0M A;  1QPI A;  3CC7 I;  4YII A;  2YPR A;  2VQG A;  1WGX A;  2JN6 A;  1Z7L A;  4HV5 A;  4IQ4 A;  1Y1W J;  3JRG A;  1XGM A;  4I7H A;  4B47 A;  4UUV A;  3OYI A;  5BNG A;  5E1X A;  3SDG A;  3JRF A;  3E1S A;  2OUM A;  2VB6 A;  5CQG A;  2VJJ A;  2DMQ A;  1SD4 A;  2BYV E;  3LSG A;  4RGR A;  1OQY A;  1ZGW A;  2OPT A;  1YW7 A;  5E20 A;  2IP2 A;  2Q2E A;  5CVJ A;  1MSF C;  3CMM A;  5D6E A;  4QPO A;  1XG1 A;  4B09 A;  4RDU A;  4XK4 A;  2LY1 A;  2DOD A;  3A0H C;  5IPA A;  2D45 A;  3LOC A;  3LSH A;  4BQO A;  3CF5 F;  1Y6I A;  4WWC A;  4LJZ F;  2C6Y A;  3F8C A;  4HF2 A;  3BG3 A;  4PFO A;  5IOZ A;  4ZC3 A;  4D7N A;  2RRE A;  3ISP A;  3RKX A;  3KFW X;  3SZT A;  5JI6 A;  2F4M B;  3OYA A;  3HHH A;  2W1O A;  1I50 J;  5CVR A;  4F7Z A;  5DM6 F;  2M4G A;  1Z1D A;  1SEU A;  2XSD C;  3V42 A;  2H09 A;  3SXY A;  3J7A Y;  1HBX G;  3FIW A;  1Y39 A;  5L3E A;  2LP0 A;  2V1D A;  1RR7 A;  1K79 A;  1MJB A;  1U0J A;  4WXH A;  1K78 A;  1V4R A;  2KL4 A;  3OWT A;  1O3S A;  1S9H A;  2BGC A;  5LHI A;  4IPA A;  4AVZ A;  1AOY A;  2OBP A;  3KYC B;  1BW5 A;  3HOZ J;  2CMP A;  2LKS A;  3L2R A;  2DLL A;  2A61 A;  2VC1 A;  1LEA A;  2EB7 A;  1K78 B;  3ZMS A;  4XKC A;  2K3P A;  3FZV A;  5M5W J;  1H8A C;  5L3C A;  3WTS C;  3I4M J;  1I1S A;  4DJA A;  1MJ9 A;  1TW3 A; 
#chains in the Genus database with same CATH homology
 3QU6 A;  1HQC A;  3N4M A;  2TDX A;  1FX7 A;  4E70 A;  3ZQ7 A;  2GAU A;  4RS8 A;  1QZZ A;  2XAH A;  2W25 A;  2HDC A;  4BHC A;  2XIG A;  1SD7 A;  2LF7 A;  2DTR A;  2STW A;  4WXC A;  1DUX C;  2V1U A;  3KEO A;  2HGC A;  2ZME B;  3CUQ C;  4EJO A;  3COA C;  2QQA A;  3M7G A;  2E7X A;  4A0X A;  2OQG A;  4EMS A;  1XSV A;  3DF8 A;  4KIF A;  4HLX A;  4ESF A;  1RUO A;  5L3D A;  4BHB A;  4EJT A;  3P7N A;  3WE3 A;  4U0W A;  4KA4 A;  4JK1 X;  4M9Z A;  2RKH A;  4HQE A;  3QOP A;  2ESH A;  2VON A;  2LKP A;  5DD8 A;  5CLS A;  2QEN A;  4LB5 A;  1I1G A;  3HTS B;  1KA8 A;  1GHC A;  4GXO A;  4L5I A;  4JQF A;  2EV6 A;  4R79 A;  4AIJ A;  4HQM A;  4G6Q A;  5ED4 A;  3DKW A;  4CO8 A;  1IXS B;  1T6S A;  4LK1 F;  3K0L A;  3HSF A;  2IA2 A;  1B9N A;  3REO A;  4MQ9 F;  2W24 A;  4I2O A;  3FX3 A;  1I6X A;  3E97 A;  4K2E A;  2BV6 A;  4Z2Y A;  2KJC A;  3I58 A;  1PDN C;  3ZMT A;  2ZKZ A;  2GWR A;  4B8X A;  1IRF A;  3TO9 A;  2F5F A;  5BPI A;  4L0Z B;  3J80 K;  3GYH X;  5D5U B;  1RNL A;  1KU2 A;  2F5E A;  3I71 A;  1U2W A;  1SMT A;  3E5U A;  5FO5 A;  5HS8 A;  4BXU A;  5CYV A;  3J80 Z;  5D5V B;  2XRO A;  4N9H A;  4XSZ F;  3SFZ A;  3BJO A;  4PGG A;  3CUO A;  1ZHF A;  4HW0 A;  3IC7 A;  5AIQ A;  4O3M A;  5H6R A;  4CDG A;  4NHJ A;  1IAW A;  1XMK A;  4U7D A;  1F4K A;  2M30 A;  1E2X A;  1IN4 A;  2AS5 F;  5FB2 A;  4HBL A;  4WF2 A;  4M6X A;  2E7W A;  3KZZ A;  5L3B A;  4PCQ A;  3DPT A;  4UNO A;  2EFO A;  3R4K A;  4OU0 A;  3E6D A;  1FYL A;  1REP C;  2OZ6 A;  1J59 A;  3I59 A;  3ZN0 A;  1KQ0 A;  5DDG A;  3CTA A;  1KU9 A;  4JBA A;  5ICF A;  4OIO F;  2BE5 F;  3VEP A;  3MZY A;  5IT9 Z;  4OIQ F;  3I59 B;  2UZK A;  2A3S A;  2FBI A;  1UHW A;  1P4A A;  3TDU C;  1XB4 A;  3KLO A;  4UVA A;  3RJP A;  4ZH4 F;  1FSE A;  2Z3Y A;  1ZRC A;  3LAJ A;  5CVI A;  3EQL F;  5K5R A;  4KYW A;  4I01 A;  2VXZ A;  4KMF A;  5ICC A;  3BZ6 A;  2PMH A;  3Q9V A;  3NRV A;  4HZF A;  4U7B A;  3HOT A;  2O61 A;  1STZ A;  4LGW A;  2MD5 A;  2W85 A;  2L02 A;  4BQA A;  5LEJ A;  3WTV C;  1MGT A;  4EV0 A;  3WTT C;  3U1D A;  1J2X A;  2LNB A;  3TGN A;  3CO7 C;  1KU3 A;  1HW1 A;  2FQ3 A;  4XRF A;  4XLN F;  3K1P A;  4EM2 A;  2V9V A;  3ZMU A;  3FXR A;  1FPQ A;  3FM5 A;  1SD6 A;  4XSX F;  2ISZ A;  3F8N A;  1U78 A;  2VBW A;  1ZRF A;  2XAQ A;  1HKS A;  3ELK A;  5D5X B;  3BY6 A;  3FHZ A;  1EH6 A;  1MKM A;  1XGN A;  4L18 B;  3K1N A;  4N9I A;  1R7J A;  2Q8K A;  5HS9 A;  3WTU C;  3BPV A;  3M9A A;  2ZJ2 A;  1CF7 A;  3HRU A;  2V1X A;  4HLY A;  5LHH A;  1FZP B;  2RVC A;  1BIB A;  3DPL C;  1JGS A;  2VBZ A;  4RB3 C;  3BRO A;  1CF7 B;  1HW5 A;  2FXA A;  3JAM Z;  2MLK A;  3G73 A;  4N0B A;  5ICE A;  4RB1 A;  1ZGA A;  4BYY A;  1B6A A;  1BJA A;  1VTN C;  2O3F A;  3EUH A;  3F6O A;  2H27 A;  2XAF A;  2XV4 S;  5JR3 A;  4OIR F;  3HRS A;  3RDI A;  5ILS A;  3HSR A;  4G94 A;  2MH2 A;  1UCR A;  2D2W A;  2QZ8 A;  2G9W A;  3ZMZ A;  5DUI A;  2VT2 A;  2DI3 A;  3BP8 A;  1ZRD A;  1P4W A;  1RIO H;  4YFN F;  2G7H A;  3GEZ A;  2BBY A;  1J9I A;  4RGX A;  2EFW A;  4R8H A;  2NRA C;  2KIM A;  5LGT A;  5LRR A;  3WTX C;  3I0T A;  2A69 F;  2PJP A;  1P6R A;  3FMR A;  2K86 A;  4O6J A;  2FBH A;  1BIA A;  3V7C A;  2WV0 A;  2D1V A;  1OYY A;  2YX7 A;  1LDJ A;  3JW4 A;  2X0L A;  1FYK A;  4YFK F;  4P9U A;  1R58 A;  1SMY F;  3CLO A;  1TNT A;  3F8F A;  3WTZ A;  5E1Z B;  1YO5 C;  1U3E M;  3FWE A;  3F22 A;  3RKW A;  1G4D A;  4WX9 A;  4ZYE A;  5FLX K;  2GIV A;  1HXD A;  4HOB A;  5HDG A;  2FEZ A;  5ILV A;  2JPB A;  2A6E F;  5FLX Z;  4WK8 F;  1OYW A;  1R1U A;  3LA7 A;  1IUY A;  2CSO A;  2MLG A;  1TQM A;  3K9T A;  3EET A;  4LMY A;  2P5L C;  1XN7 A;  2W57 A;  2GQQ A;  1R22 A;  2RNJ A;  2NNY A;  3KP5 A;  3I53 A;  4EM1 A;  3WU1 B;  3WG9 A;  2XHK A;  1ON1 A;  3Q5F A;  3GFL A;  2K27 A;  2E1N A;  1K6O A;  1LNW A;  2ELH A;  2VOP A;  1MDM A;  4P55 A;  4GYG A;  1FWZ A;  1G6N A;  1U5T A;  3TO7 A;  2FMY A;  4EJU A;  3TQN A;  3EYY A;  2GXG A;  1MDM B;  3QU3 A;  1JE8 A;  3RYR A;  1YYV A;  4KIC A;  4MEX F;  1U5T B;  2FRH A;  4ZZL A;  1Z6R A;  3OV8 A;  3IRQ A;  1Q1H A;  4G9Y A;  2XRN A;  3ABU A;  3PQJ A;  1TW2 A;  2JSC A;  4EVI A;  2DFI A;  2HZT A;  4BAY A;  3GZ6 A;  4U0V A;  1D3Y A;  1P92 A;  1TBX A;  3T5X A;  2CQK A;  4IVN A;  3MAJ A;  6PAX A;  3IWF A;  2ZME A;  1UST A;  2R7F A;  3N97 A;  1F1Z A;  2FBK A;  1FYM A;  3GO5 A;  2BEO A;  4G8X A;  1HKQ A;  1F9N A;  4HV6 A;  4M74 A;  3FM3 A;  5HLI A;  2O0Y A;  1U6G A;  3JTH A;  5K5O A;  3LA3 A;  2XKP A;  2OQR A;  3EYI A;  2EV5 A;  4OIN F;  2IT0 A;  3MZH A;  4OMZ A;  2XKO A;  3WE2 A;  2IW5 A;  3KET A;  1MZB A;  2Z33 A;  2VBY A;  4ZYG A;  4EJW A;  2JPC A;  1ODD A;  4FT8 A;  2EK5 A;  2DU9 A;  4Y17 A;  1GXQ A;  1FY7 A;  1YW9 A;  3J81 K;  2OAZ A;  3K1M A;  3GF2 A;  2DQL A;  5ICG A;  3P9C A;  1O3Q A;  4ENJ A;  2Z5U A;  3J81 Z;  3ABT A;  1S7A A;  4FX4 A;  1P2F A;  4H0E A;  1T0F A;  2B0L A;  1DPU A;  1XDU A;  1XGS A;  1OMI A;  3CDH A;  5K5Q A;  4P9F A;  5E8I A;  3LA2 A;  1R1V A;  2A6H F;  2DT5 A;  2V6C A;  3HSE A;  3ECH A;  2VOD A;  3LQQ A;  4EM0 B;  1ULY A;  2FU4 A;  2VE8 A;  2LF8 A;  1TLH B;  5H20 A;  2KIF A;  5CVU A;  5E18 F;  1O7F A;  3HRT A;  3QP6 A;  3BDD A;  2F5C A;  1IRG A;  4GGG A;  2JRT A;  4S05 A;  2FA5 A;  3TOB A;  1R5H A;  4AWX B;  2IA0 A;  1A04 A;  4RGU A;  2J5P A;  4G7O F;  4G7H F;  1RZ4 A;  1R23 A;  2HQN A;  4I02 A;  4WXD A;  3VOD A;  1CGP A;  2L01 A;  1OKR A;  4RAZ A;  1L3L A;  2RV8 A;  3IRR A;  2EV0 A;  3FMS A;  5JFR A;  4PZJ A;  1I5Z A;  3H3Z A;  2PG4 A;  1FC3 A;  2A5Y B;  2M8E A;  1U5T C;  1IN6 A;  3R0A A;  2ADU A;  3QRF F;  4EQQ A;  2HR3 A;  3DEU A;  3IKV A;  3T8T A;  2PN6 A;  4I09 A;  2ZO4 A;  3WTY C;  1LJ9 A;  3JSO A;  1O3T A;  5FFZ A;  3WU0 A;  2DAO A;  1ZRE A;  2OD5 A;  4YIF A;  2ZNZ A;  4ENK A;  2IVM A;  3L2C A;  3R0J A;  3R60 A;  1FLI A;  2M5W A;  2L54 A;  2CGP A;  1J7K A;  2L4M A;  1IN8 A;  1SFU A;  5J8F A;  2J5O A;  2HQR A;  4RGS A;  1XMA A;  4HDU A;  2L4A A;  3F8M A;  2PQ8 A;  4G6D A;  4MQV A;  1PP7 U;  2HTS A;  5BS6 A;  3B02 A;  2FOK A;  3RPQ A;  1JXS A;  2EA4 A;  5ERI A;  3KP6 A;  4UVC A;  1RI7 A;  3JTG A;  4XLP F;  3GFM A;  4S04 A;  3RIR A;  2RC4 A;  4I0B A;  4A12 A;  5FFX A;  1AWC A;  4Q4Z F;  3CJN A;  1FP1 D;  3K2Z A;  4MTE A;  2WC2 A;  1IZ1 A;  1FP2 A;  2CYY A;  3HOS A;  2K4B A;  3KE2 A;  1T2K A;  4GO1 A;  3P9I A;  3HTU A;  3F3X A;  1KQ8 A;  1QBJ A;  3V8L A;  1ZAO A;  5DV5 A;  3F21 A;  1XSD A;  1T39 A;  4MGR A;  3ULQ B;  2XVC A;  3O6B B;  3V8K A;  2HYF A;  2DQR A;  4Y13 A;  5KK1 A;  1YS7 A;  2IA1 A;  1IN7 A;  4Y15 A;  2HTJ A;  3KP4 A;  4RB2 C;  3E5Q A;  4CYD A;  2IRF G;  2HWV A;  2EA2 A;  3SQN A;  5E8G A;  4G7Z F;  4LLG F;  4A5M A;  2VT3 A;  1MJA A;  4A6D A;  2CFX A;  4KNY A;  2HS5 A;  2P5K A;  5TRD A;  3H92 A;  4QLC U;  1ON2 A;  3HRM A;  3DQV C;  4XBF A;  1EV7 A;  2M1B A;  5JHU A;  3C7J A;  5F64 A;  1HST A;  3KLN A;  2QBY A;  3O2P E;  2L3D A;  4ASN A;  5E17 F;  3DP7 A;  1OYI A;  2VE9 A;  3V4G A;  3P9K A;  2QBY B;  5BQT A;  4YG2 F;  1MD0 A;  1IXR C;  2HFH A;  4MEY F;  4M72 A;  1LB2 A;  1YS6 A;  4ON0 A;  1EH8 A;  2KKO A;  3GFI A;  3TKY A;  1V3F A;  4KDP A;  5DYM A;  4A0Z A;  3WGH A;  2XGX A;  1D5V A;  3HYI A;  2KJB A;  3H3U A;  1DPR A;  1FT9 A;  1J5Y A;  2FNA A;  4L9T A;  2IJL A;  5F1R A;  3V8J A;  5JVT A;  2AXL A;  1ZH5 A;  3U9G A;  4UV9 A;  1ZG5 A;  1LVA A;  3GLX A;  2YU3 A;  2KRF A;  3DXJ F;  4RB0 A;  1BOA A;  1O57 A;  3M8F A;  1FBQ A;  1SD5 A;  2F5D A;  3FF5 A;  4HX7 A;  2EFQ A;  1KYZ A;  4MNU A;  3F6V A;  3E6B A;  5L3F A;  1TQI A;  2HKO A;  1KGS A;  3M1E A;  4AIK A;  4KIB A;  5CVV A;  3JSP A;  2H94 A;  1G3Y A;  2M45 A;  2P7C B;  2Y0M A;  3R6S A;  4M71 A;  1ZAR A;  4ENM A;  2STT A;  1BN5 A;  2XAJ A;  4A0Y A;  4U0Y A;  5A2Q K;  1GVJ A;  4RAY A;  5DEQ A;  4AD9 A;  5HDN A;  4KIG A;  1J75 A;  1R00 A;  1D8K A;  1YLF A;  2M87 A;  5LEK A;  4IRI A;  1IW7 F;  3ML6 A;  3PQK A;  2NS0 A;  4Q5S F;  4EGZ A;  5DCM A;  2VN2 A;  2FNP A;  2VBX A;  3GVA A;  4M9S A;  2WTE A;  3KEQ A;  3S2W A;  4L9N A;  1ZLJ A;  5DCM B;  1BC8 C;  2V79 A;  1QZY A;  4AIH A;  2P4W A;  3LAP A;  3ZMD A;  5HLG A;  1H9G A;  3E6M A;  2RQP A;  3D5L A;  5CJ9 A;  4UHT A;  4YFX F;  2HKX A;  4EJV A;  1SFE A;  3HUG A;  5FD5 A;  4HF1 A;  5AON A;  3ZPL A;  3GW2 A;  2PMU A;  2P8T A;  4L9V A;  3VFZ A;  2JT1 A;  1FSH A;  3G3Z A;  1O3R A;  4EGY A;  2DPD A;  4IF4 A;  1YQA A;  3IWZ A;  3AAF A;  2P7V B;  1E17 A;  4KT5 C;  3HIF A;  3IL2 A;  1QQI A;  3DFG A;  3NQO A;  4L5J A;  3GX4 X;  1XDS A;  1H0M A;  2YR2 A;  3GZ5 A;  1ZLK A;  4KMU X;  2RDP A;  3ROU A;  4IHS A;  4LFU A;  1T38 A;  2GZW A;  4FX0 A;  3L00 A;  1GXP A;  1OPC A;  1W7P D;  5DUK A;  3QAH A;  1Y0U A;  1BI2 A;  2ACJ A;  2XAS A;  2ZXJ A;  4IXA A;  1NHA A;  4HX8 A;  3LFK A;  3I54 A;  3MFK A;  3T1B A;  3ECO A;  2FF4 A;  1WSU A;  3J7A O;  3BJ6 A;  1Z9C A;  3HHG A;  4HAM A;  4DQ2 A;  1OR7 A;  3I5U A;  3KCC A;  3KP2 A;  1JHF A;  2UXX A;  3BOQ A;  2MA3 A;  3C3W A;  5H6Q A;  2EWN A;  2OA4 A;  5DD4 A;  1YG2 A;  3VB2 A;  2W84 A;  4CGZ A;  2NYX A;  4QWQ A;  1XCV A;  1BI0 A;  4Q48 A;  2MC3 A;  2P6S A;  1K7A A;  3T0Y A;  2P6T A;  5D4R A;  5D8L B;  1S7O A;  4HF0 A;  1ZYR F;  2DPU A;  2ZFW A;  2DW4 A;  5K1Y A;  3I4P A;  3MCZ A;  3VOE A;  2HEO A;  3WGG A;  2ZCW A;  2R7D A;  1B59 A;  3L09 A;  1QGP A;  2COM A;  4ESJ A;  1KYW A;  2WWY A;  3FXQ A;  3KP3 A;  5LBQ A;  4L0Y B;  2FSW A;  4LG0 A;  3ZMV A;  1XCB A;  1FBU A;  1L0O C;  1HSJ A;  2GA2 A;  1Z05 A;  2H6B A;  3QPT A;  4NB5 A;  2F2E A;  4NQW A;  4LG0 B;  3L7W A;  4IHT A;  3SZP A;  1S3J A;  5LGN A;  5LRS A;  2A68 F;  1DP7 P;  3LWF A;  2CO5 A;  2QUF A;  5KVR A;  1QNT A;  4UXN A;  2X4H A;  2CW0 F;  1HKT A;  2K7L A;  3F72 A;  4BHP A;  1UHM A;  3TOA A;  2DBB A;  2OU2 A;  4U88 A;  2O8X A;  3FXU A;  2UXN A;  1ZN2 A;  4LB6 B;  1H9T A;  2UWM A;  2PBI A;  4I0A A;  5D4S A;  2RN7 A;  4TV7 A;  1R5G A;  5J6X A;  1X3U A;  1W5T A;  3ZN1 A;  3B73 A;  5BOX A;  1S6L A;  4P5O A;  1FBS A;  1U8R A;  1RUN A;  2MH9 A;  3GWZ A;  5EEG A;  2G7U A;  4IRG A;  4ZYD A;  1BBY A;  1Z6T A;  3M8E A;  4HA8 A;  3MQ0 A;  2O03 A;  4CIC A;  3BJA A;  3GFJ A;  3WOD F;  1F5T A;  4GYI A;  3W6J B;  3EDP A;  1BI3 A;  2VC0 A;  3C18 A;  1IXC A;  3RPU A;  3KZY A;  2XUB A;  2OZU A;  5J8C A;  1ONV A;  1BM9 A;  5D5W B;  2A07 F;  1XGO A;  4M9X A;  2O6G E;  4ETS A;  4I98 B;  4LLN A;  5D8K B;  5FD6 A;  1HW2 A;  1B4A A;  1XD7 A;  4ESB A;  1G3T A;  4L9J A;  4M73 A;  1R36 A;  2CG4 A;  4D0P A;  4ENN A;  1I27 A;  1WI9 A;  3D0S A;  1SAX A;  3IHU A;  4PGH A;  5EEH A;  4P96 A;  5HLH A;  4HYE A;  3ZP5 A;  2CWE A;  2DK5 A;  4CHU A;  4HX4 A;  1YTY A;  5IT9 K;  2HOE A;  4HDV A;  2FE3 A;  2VOO A;  4CXF A;  3E6C C;  1O7L A;  2YX4 A;  2QVO A;  3QPH A;  4R1H A;  1IN5 A;  2P5V A;  2EJR A;  2EFP A;  3WGI A;  5FGM A;  2QLZ A;  2Q0O A;  2EFN A;  1TQP A;  2PEX A;  2ZNY A;  2FML A;  3W6K B;  1QPM A;  1JHH A;  1G3S A;  3LST A;  3E3V A;  2IPQ X;  1W7P A;  1W5S A;  3R61 A;  4KN4 X;  1T98 A;  4MHG A;  2DO7 A;  1W4M A;  5BPD A;  1IF1 A;  3KP7 A;  3WTW C;  1WRJ A;  1Z7U A;  4KN7 X;  1LDK B;  3TDZ C;  1W7P B;  2QWW A;  2DK8 A;  4PDK A;  4Q47 A;  3GXO A;  5D6F A;  4LK0 F;  1FOK A;  1TNS A;  1UFM A;  3MWM A;  4A2U A;  1KU7 A;  4OOI A;  1Z91 A;  4FHT A;  3L9F A;  2XAG A;  4OMY A;  3Q9S A;  4BH9 A;  5F6F A;  3NEU A;  2PFB A;  1LEB A;  1QO0 D;  3T8R A;  2PI0 A;  5IT3 A;  2K02 A;  3DV8 A;  5HVQ C;  3ERE D;  3LQR A;  5LGU A;  1FNN A;  2NAZ A;  5E1W A;  2ISY A;  1WQ2 A;  1USS A;  2Z9O A;  4LLL A;  1ZG3 A;  2Z99 A;  3JAM K;  1ZGJ A;  3BPX A;  1BC7 C;  4LD5 A;  2ETH A;  1PUE E;  2QQ9 A;  4DNC A;  1LQ1 A;  4IJA A;  1D8J A;  3C1D A;  2E1C A;  3IKT A;  4KUM A;  4UV8 A;  1YFH A;  4MTD A;  4GCV A;  4KFC A;  4A5N A;  2JTV A;  3RKY A;  5DCF A;  1TTY A;  4UVB A;  4ZYH A;  3RTR A;  4A6E A;  2GXB A;  1LDD A;  3FMQ A;  2D1H A;  1DDN A;  3SHF A;  4CZZ A;  1EH7 A;  4M6Y A;  4ZZD A;  3K69 A;  1PP8 F;  2MBF A;  2Y48 A;  3CUQ A;  1G3W A;  4WCG A;  2H6C A;  5L3G A;  2HYG D;  3CO6 C;  1YW8 A;  4OIP F;  2YSR A;  1YIO A;  3V7S A;  1P4X A;  3E5X A;  2R3S A;  5HDK A;  3CUQ B;  2ZBK A;  5ILU A;  3F8B A;  3TO6 A;  3MEX A;  4O5V A;  5AIP A;  3PFI A;  5HOO A;  4AVP A;  1XSX A;  1SFX A;  5BMZ A;  1UB9 A;  2LSO A;  2QYO A;  2GA1 A;  1WWX A;  4BNC A;  2Y75 A;  2K4J A;  1WKM A;  2LDU A;  5LHG A;  2JZY A;  1ZG1 A;  3RI4 A;  2QM3 A;  1KQ9 A;  1B9M A;  2NNN A;  5TJJ A;  1J0R A;  5LLQ A;  3F23 A;  5HS7 A;  1C0W A;  1BI1 A;  5A2Q Z;  1S8N A;  1B1B A;  4IRH A;  3I64 A;  2ESN A;  2KIU A;  1R1T A;  2RGV A;  2PLY A;  2QQB A;  3GUD A;  3U2R A;  3BWG A;  1S29 A;  3O3K A;  3RYP A;  3V7R A;  3OOP A;  3QP5 A;  4YII A;  2YPR A;  4HV5 A;  1XGM A;  4I7H A;  4UUV A;  5E1X A;  1SD4 A;  2BYV E;  4RGR A;  1YW7 A;  5E20 A;  2IP2 A;  2Q2E A;  5CVJ A;  5D6E A;  4B09 A;  2D45 A;  4WWC A;  4LJZ F;  2C6Y A;  3F8C A;  4HF2 A;  3ISP A;  3RKX A;  3KFW X;  3SZT A;  5JI6 A;  3HHH A;  5CVR A;  4F7Z A;  1Z1D A;  2H09 A;  3SXY A;  1HBX G;  5L3E A;  2V1D A;  1K79 A;  1MJB A;  4WXH A;  1K78 A;  1V4R A;  1O3S A;  2BGC A;  5LHI A;  4IPA A;  1AOY A;  2OBP A;  2DLL A;  2A61 A;  2VC1 A;  1LEA A;  2EB7 A;  1K78 B;  3ZMS A;  3FZV A;  5L3C A;  3WTS C;  1I1S A;  1MJ9 A;  1TW3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...