3GFIA

Crystal structure of st1710 complexed with its promoter dna
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
143
structure length
143
Chain Sequence
SNENRIQIMSTIAKIYRAMSRELNRRLGELNLSYLDFLVLRATSDGPKTMAYLANRYFVTQSAITASVDKLEEMGLVVRVRDREDRRKILIEITEKGLETFNKGIEIYKKLANEVTGDLSEDEVILVLDKISKILKRIEEISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ST1710-DNA complex crystal structure reveals the DNA binding mechanism of the MarR family of regulators.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Transcription/dna
molecule keywords 146aa long hypothetical transcriptional regulator
total genus 56
structure length 143
sequence length 143
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3gfiA00
1RIOH 2HQNA 2GQQA 4KA4A 3QP6A 3P7NA 1HW5A 1BC8C 1MZBA 4RS8A 3JTGA 2O61A 1FYLA 1O57A 2HYGD 3IRRA 3CUOA 1S3JA 2R3SA 2K02A 2EB7A 4M9ZA 1ZN2A 2JT1A 5LLQA 4LGWA 2Q0OA 2R7FA 1OKRA 4B8XA 3LWFA 4LMYA 1YW9A 1R23A 1O3TA 1I6XA 1TW2A 2F5CA 2CO5A 1YO5C 5HOOA 2PMUA 3BPVA 2LF8A 1XN7A 3U2RA 3I53A 3FM5A 1W4MA 4MTDA 4Z2YA 2GZWA 2NNNA 4IPAA 4RB1A 3IKTA 2XAHA 3ZQ7A 5ICFA 5BS6A 3K1NA 2O8XA 1FP2A 1QZYA 5E1XA 1P92A 4YG2F 3N97A 1FY7A 3O2PE 1XMKA 1BI2A 1MKMA 2EFWA 3BOQA 1R36A 4G6QA 4ESJA 2DFIA 1OYWA 4OMZA 3U1DA 2FMYA 2AS5F 5E8GA 1ON2A 3GLXA 4XRFA 4OMYA 3R4KA 4P9FA 1IN4A 3TDZC 1PUEE 4HA8A 5ILVA 3KP3A 5DUKA 4CXFA 2XHKA 3DXJF 2OQRA 3LA3A 2G7UA 2WC2A 2OBPA 3ERED 5LRSA 1HSJA 1YTYA 1STZA 4MNUA 1IUYA 2A61A 2D1HA 2Q8KA 2EA2A 3TDUC 4P5OA 2EFPA 1SFUA 1BI3A 5K1YA 2QVOA 1MJ9A 5BPDA 2BE5F 3HOTA 1LEBA 2QWWA 2VE9A 1YS6A 4BH9A 2CWEA 2UZKA 1O3QA 3FHZA 3M8EA 5DDGA 4ENMA 1B59A 3DEUA 2KIFA 2NNYA 3MAJA 5HLHA 3ZN0A 5JVTA 4ASNA 1BN5A 3AAFA 4AIJA 2OQGA 2HR3A 3LA2A 1W5TA 3QOPA 1IXSB 4GGGA 4RGXA 3GX4X 4MEXF 2V79A 1ZREA 3J7AO 2ETHA 3LA7A 2DQLA 1XDUA 1IRFA 4KMUX 3BJAA 4I09A 4FX4A 4QLCU 2PEXA 2HGCA 4M72A 2IJLA 4EJVA 3WTZA 4OIQF 2UXXA 1HKQA 3TGNA 3ML6A 1U3EM 4EJTA 2ZBKA 2JZYA 5DV5A 1MDMB 4GXOA 3WE2A 4R8HA 1ODDA 1LVAA 2IPQX 3L09A 3GZ6A 4MGRA 3CTAA 1XGMA 2JSCA 2KJBA 3HIFA 4MTEA 2ZFWA 1P2FA 2DBBA 2P5LC 5LGNA 4UNOA 3GW2A 2FE3A 3KP4A 2Z5UA 2DI3A 2XASA 5IT9Z 2W24A 5FFZA 4M6XA 3I59A 3R0AA 6PAXA 1IXRC 2QQ9A 4OIOF 3F23A 1KA8A 2OZUA 2W84A 5DCMA 3R0JA 3W6JB 4A5NA 1T6SA 5J8FA 5DUIA 2QBYB 3WGIA 1R00A 2V1XA 4IHTA 1D5VA 4ENNA 1IRGA 1SD7A 2CW0F 3DKWA 4OOIA 1K79A 5JR3A 3GWZA 4ZYHA 2KRFA 4EJUA 2H6BA 4LG0B 4UHTA 2NRAC 2P5KA 1PP8F 1UCRA 4EVIA 2G7HA 3I5UA 1K7AA 2VBWA 5CJ9A 3IRQA 1Z05A 1FPQA 3F6VA 3L00A 1WRJA 1LEAA 1T2KA 2FBHA 3ABUA 3KFWX 4EV0A 3DQVC 2IA2A 3KLNA 1AOYA 4S04A 4YFNF 1T0FA 3WTTC 2HKXA 1R5GA 4M9XA 4EMSA 3V8JA 3SXYA 4MQ9F 4AD9A 2MH9A 4OIRF 2M1BA 1L0OC 5L3EA 2M30A 2QUFA 5LEJA 3GFMA 3F21A 3LAJA 4RGRA 2OU2A 2HTJA 4ZYGA 1LB2A 3V7SA 2ZCWA 3IWFA 3N4MA 1YS7A 4E70A 4UUVA 5LBQA 1R22A 4WWCA 1QO0D 5JFRA 4GCVA 2PJPA 3H92A 2G9WA 3RI4A 2HYFA 2YX7A 5TJJA 3J81K 3IC7A 2RV8A 5LHIA 1TNTA 3NRVA 2Z33A 4HAMA 1G3YA 1XSXA 3HYIA 3J81Z 2PN6A 4HQMA 3T0YA 2HWVA 2COMA 3TOAA 1UHWA 5IT3A 1ZHFA 1R7JA 4G7HF 1ZRCA 1FOKA 5H6RA 4N0BA 1RUNA 4HDUA 1Z6RA 4WF2A 1D3YA 3QU3A 4HLYA 3CO6C 2QENA 4CZZA 4RGUA 1EH6A 5H20A 1TQPA 1DUXC 3M7GA 3ZMUA 3BP8A 2EJRA 2A5YB 1ZLJA 3I58A 2GXBA 4WK8F 2O03A 3U9GA 1H0MA 1U78A 1A04A 1IAWA 1K78A 3GYHX 4GO1A 4EGZA 2DO7A 3WU0A 1SMYF 1J2XA 4FHTA 3D5LA 2H6CA 3GVAA 1HKSA 4XLPF 2VODA 4KNYA 3KETA 1YW8A 2HKOA 1BOAA 1FBUA 1T39A 4QWQA 2ELHA 3ABTA 1R1UA 5L3BA 1O7FA 2JRTA 5DD4A 4AVPA 2QQBA 3E5QA 1QPMA 3EYIA 2MC3A 3VODA 1FYKA 1GHCA 2LNBA 3LSTA 3JTHA 1G6NA 4BYYA 3DP7A 4UVCA 1I5ZA 2STWA 3CUQC 2HOEA 3V8LA 2WWYA 5FLXZ 3JW4A 5FGMA 4IRIA 3TO7A 4KMFA 2DK8A 1O3RA 5ICCA 1JGSA 2RNJA 1JHFA 2KIUA 3PQJA 5ED4A 2V6CA 4MEYF 4Q4ZF 1BI1A 2ISYA 1C0WA 3EYYA 3E5UA 4PDKA 4N9HA 3MFKA 1USSA 3MCZA 3EQLF 2FA5A 2L4MA 3K1PA 3BJ6A 1EV7A 5D5UB 1BM9A 2GXGA 3ECOA 1U2WA 3SQNA 2PLYA 1KU2A 5AIQA 4YIIA 2EFNA 2ZJ2A 2M87A 4LK0F 3T8TA 2V1DA 2FF4A 5F6FA 1KQ9A 2KJCA 1L3LA 4U7BA 4U7DA 1HXDA 2DQRA 1OYYA 3KLOA 1W7PA 2L3DA 3FM3A 1REPC 2FRHA 3FMQA 1IN6A 4A2UA 3H3ZA 1MJAA 3V7RA 1UB9A 5DEQA 3BZ6A 1CF7B 1WQ2A 1FZPB 1TBXA 5HS7A 4RB3C 3VB2A 1KU3A 1SFEA 4EJOA 4UVBA 1HQCA 3R60A 4LFUA 1OMIA 1R1VA 1FSHA 2EFOA 4KUMA 2XAQA 4L5IA 4LD5A 1OPCA 4PZJA 1USTA 3NEUA 1E17A 2IA1A 1TQIA 2GIVA 1YG2A 2HTSA 2VN2A 1ZAOA 3F8NA 2E7WA 2OAZA 4AWXB 3ELKA 1B9MA 4LJZF 1F1ZA 4MHGA 4HYEA 1XD7A 3GO5A 2XRNA 2ESHA 4Q47A 1EH7A 4CO8A 3WGGA 2H09A 5A2QK 4ENJA 1FYMA 2H94A 3JSPA 5J8CA 4U0VA 3EETA 2P7CB 2FBIA 2M8EA 5HDKA 4L0ZB 3MEXA 1T98A 2K86A 1J0RA 3RPUA 3SFZA 3FF5A 3C18A 2RVCA 3QP5A 4UV8A 3LFKA 3F8MA 2YU3A 3M9AA 5D5XB 5F64A 4IRGA 3ZPLA 4IJAA 1FSEA 3ECHA 3ZMTA 5HDGA 1SAXA 2K4BA 2Q2EA 5D5WB 4KN4X 4KIFA 2EWNA 4HV5A 4BHBA 5F1RA 1CGPA 1XGOA 2E1CA 4BNCA 3E5XA 1ZH5A 4EJWA 5KVRA 5E1WA 4AIKA 1S8NA 1BJAA 3K9TA 1ZGAA 2VT2A 4LB6B 3ZMVA 2NS0A 1TQMA 3KEQA 1YLFA 1GXPA 5L3DA 3RJPA 4ETSA 2QQAA 4HQEA 2ZNYA 2O6GE 2VOPA 2QBYA 1I27A 4I0BA 3GFJA 1RZ4A 5FO5A 2XIGA 1Z6TA 4ZYEA 4R1HA 1ZARA 3FX3A 1JE8A 3EDPA 3PFIA 4LK1F 3PQKA 4NB5A 2O3FA 3HTSB 1PDNC 1J9IA 5CVIA 2BYVE 2P6SA 2CGPA 4PGGA 1DP7P 5BPIA 1XSVA 4IRHA 5CVRA 2VC0A 2CQKA 2YR2A 2VONA 1SMTA 3K0LA 4KT5C 3QU6A 3SHFA 4L9TA 3B73A 3RYPA 1JHHA 4Q5SF 2FNAA 4O5VA 5HVQC 1W7PB 1G3TA 3KP5A 2FU4A 3Q9VA 4HOBA 3KP7A 2ADUA 2QLZA 1PP7U 5D4SA 4ZZLA 1FT9A 4ZZDA 1W5SA 1K78B 3ULQB 3TQNA 3SZTA 1FLIA 4G94A 1XCBA 5IT9K 2HFHA 4L18B 4WX9A 3S2WA 1SFXA 1FX7A 3GUDA 4HLXA 3C7JA 1T38A 5ICGA 1TTYA 2IW5A 1ULYA 2A69F 1J59A 1ON1A 1D8KA 3TO6A 2DPDA 4DNCA 3WTWC 3RDIA 1KQ0A 1I1SA 1G3SA 1S7OA 1KYWA 4XSZF 3G73A 3E97A 3F8BA 2GWRA 1S29A 2CG4A 3K1MA 3WTXC 3HOSA 1LDJA 1LDDA 3FXQA 2DW4A 5TRDA 1HKTA 1Z91A 4IVNA 4L9VA 4LLGF 4PGHA 3DV8A 3MZHA 1E2XA 3NQOA 3IWZA 2VBZA 2ZMEA 3P9IA 2FMLA 2VOOA 5E1ZB 3LQRA 1O7LA 3P9KA 1XSDA 3MQ0A 1MGTA 3RIRA 4A6EA 4M74A 1V4RA 5JI6A 4KN7X 3RYRA 4M71A 3T1BA 4I0AA 2QYOA 2L02A 3T8RA 3DPTA 5E17F 4XBFA 5L3CA 5AIPA 4L5JA 5DYMA 1IF1A 3KCCA 3IHUA 1MJBA 1XGNA 1BBYA 4WXHA 5D6FA 4A0YA 1B4AA 4AIHA 2ESNA 4ESBA 4HX8A 1RNLA 3I4PA 1P4XA 5CVJA 3V4GA 4WXCA 1YFHA 3E6CC 1DPRA 3EUHA 3QRFF 5ILSA 5CYVA 4A6DA 1S7AA 2GA2A 5LHGA 4M73A 3HRSA 1X3UA 3KZZA 2WTEA 1XMAA 2VE8A 2E1NA 4F7ZA 2BBYA 1HBXG 3REOA 4OIPF 1U5TC 2K4JA 3CLOA 5BOXA 3BPXA 3FZVA 4P96A 4I7HA 1LQ1A 1WWXA 4FT8A 3T5XA 2RN7A 5FD6A 3L7WA 3BY6A 3ZP5A 4U88A 2F5DA 3QAHA 1HW2A 2VBXA 3QPHA 2V9VA 4WXDA 5EEGA 2CFXA 5DCFA 5HDNA 1TLHB 2FSWA 1Y0UA 3BROA 2P6TA 3FXRA 2KIMA 4DQ2A 5D5VB 3WTVC 2E7XA 4A0XA 1F5TA 4KFCA 3ZMSA 2A07F 4A5MA 2OD5A 4EQQA 4ESFA 5HS8A 4JBAA 1KGSA 1SD4A 4EM1A 1R1TA 2M5WA 4ENKA 2ZKZA 3K69A 4GYIA 5D8LB 3OV8A 4HW0A 4ZH4F 3COAC 2PMHA 1BIAA 2D1VA 2P5VA 4JK1X 1R5HA 3ROUA 3BJOA 2MA3A 4G9YA 3W6KB 2UWMA 2IRFG 4I01A 3V8KA 4Y15A 4HF0A 3CUQA 4N9IA 2NYXA 2L54A 2HQRA 1YW7A 2C6YA 2X4HA 2GAUA 1ZG5A 1KYZA 4U0YA 1BIBA 2FNPA 4G7OF 4L0YB 1ZYRF 4HBLA 5ICEA 4R79A 3FMSA 3O6BB 5HLIA 4I2OA 5KK1A 4IF4A 2BEOA 1Z7UA 3ZMDA 4IXAA 3KEOA 3GZ5A 2DU9A 2QM3A 1WI9A 3QPTA 4WCGA 2P8TA 5HLGA 1K6OA 4BHPA 3E6DA 1U8RA 1ZRDA 4HF1A 3RPQA 1B9NA 3VOEA 2IA0A 3HTUA 4ZYDA 3I71A 3E6MA 3HRUA 1ZLKA 2XKOA 2P7VB 1J75A 2YSRA 5BMZA 3ZMZA 1HW1A 1U5TA 4M6YA 4BHCA 2J5OA 4CGZA 3LAPA 1VTNC 5FD5A 1QBJA 1IXCA 4PCQA 3DFGA 4NQWA 4RB2C 4K2EA 2F5EA 4HDVA 3KZYA 2LKPA 3MZYA 2A3SA 2JTVA 3HRMA 2NAZA 1G3WA 2DAOA 5K5RA 2PG4A 4D0PA 2MD5A 3CUQB 3HSRA 2EK5A 3R6SA 2DPUA 2YPRA 4RAZA 1RUOA 2F5FA 2V1UA 3O3KA 2HZTA 2B0LA 3GF2A 1F4KA 4KYWA 2JPCA 4EM2A 2D45A 4KIBA 5LGTA 3ZN1A 4YFXF 4CYDA 4HV6A 2PI0A 4G7ZF 1QQIA 1XDSA 2L4AA 3I64A 5LGUA 2W25A 4UV9A 4EGYA 2STTA 2W57A 2P4WA 2EV5A 4HX4A 3GEZA 2XVCA 5FB2A 3C1DA 2PFBA 4RAYA 1XCVA 5D8KB 2ZXJA 4RGSA 3F22A 1YIOA 1MDMA 4UXNA 2EV6A 2EA4A 2CSOA 4Y17A 4JQFA 3RTRA 2XAJA 2RC4A 4Q48A 4CDGA 1B6AA 3GFLA 2DK5A 5L3GA 1S6LA 2Z9OA 1IN8A 3TO9A 2VXZA 1DPUA 4CICA 3VEPA 1U5TB 3L2CA 3BWGA 1KU9A 5DD8A 2VC1A 1IZ1A 4OINF 2IT0A 1OYIA 2VBYA 3WTYC 3M8FA 2KKOA 2K27A 2Z99A 3WE3A 3LQQA 1P4WA 1DDNA 1HSTA 1LJ9A 1H9GA 1UHMA 3SZPA 1ZRFA 2MLKA 4G6DA 1BI0A 4LB5A 4LLNA 3BDDA 4A0ZA 4LG0A 3WGHA 1QZZA 1R58A 1QGPA 2Z3YA 1BC7C 4HX7A 1FNNA 3HSEA 5J6XA 3CO7C 2XUBA 2O0YA 5FFXA 3F3XA 3C3WA 2RQPA 1CF7A 3R61A 2GA1A 5LEKA 1GVJA 1H9TA 4I98B 5EEHA 1FBSA 2IP2A 1W7PD 1NHAA 2OZ6A 1TW3A 4M9SA 2QZ8A 1I1GA 3RKWA 1WKMA 4BAYA 1U6GA 1IW7F 1ZG3A 3FWEA 2M45A 2BGCA 4A12A 3WU1B 1MD0A 4S05A 5L3FA 3P9CA 3J80Z 2HS5A 1FP1D 3DF8A 4O6JA 3I0TA 4I02A 4Y13A 1XGSA 2DT5A 1V3FA 2XAGA 3CDHA 3WTUC 3I54A 5FLXK 2FBKA 3HRTA 2MLGA 2H27A 2IVMA 1AWCA 2OA4A 3M1EA 2MBFA 2RGVA 1YQAA 3GFIA 2LDUA 1D8JA 3FMRA 3GXOA 4FX0A 2FOKA 2XROA 3VFZA 2JPBA 5CVUA 5E18F 2ZNZA 1XB4A 3OOPA 2A6EF 3MWMA 5CVVA 1WSUA 5JHUA 2BV6A 4G8XA 3J80K 1JXSA 4IHSA 1LDKB 4LLLA 2AXLA 4KIGA 3V7CA 3Q5FA 4KDPA 5ERIA 5ILUA 3RKXA 4CHUA 2UXNA 3H3UA 1F9NA 4UVAA 5A2QZ 2XV4S 5D4RA 2Y0MA 1ZGJA 4OU0A 1ONVA 2FXAA 4KICA 5D6EA 2A6HF 2CYYA 5H6QA 4TV7A 2TDXA 2EFQA 2W85A 1P6RA 2HEOA 2XAFA 3IL2A 2FEZA 4EM0B 1G4DA 1ZG1A 2K7LA 3HSFA 1KQ8A 1UFMA 4ON0A 1IN5A 3HUGA 4L9NA 5HS9A 1FC3A 2FQ3A 2HDCA 4O3MA 3TOBA 5K5QA 1QNTA 2MH2A 2PQ8A 2ACJA 1Q1HA 2ZO4A 2D2WA 5K5OA 5CLSA 2ZMEB 1O3SA 1FWZA 5LRRA 1Z9CA 4MQVA 5E8IA 4YFKF 1IN7A 3HHGA 3FXUA 1TNSA 3DPLC 3ISPA 1GXQA 2A68F 1FBQA 5E20A 4P55A 2ISZA 3JSOA 2WV0A 3B02A 4H0EA 1SD6A 4BQAA 3F8FA 2LF7A 4RB0A 2Y75A 2EV0A 4XSXF 2RDPA 4NHJA 2L01A 3F8CA 3KE2A 2X0LA 3JAMK 2XKPA 2VT3A 4XLNF 1LNWA 1OR7A 1YYVA 4U0WA 4P9UA 3WTSC 4L9JA 2RKHA 2XGXA 1J5YA 5BQTA 1B1BA 1P4AA 3CJNA 3D0SA 3HHHA 2YX4A 3WODF 2F2EA 3KP6A 3IKVA 4YIFA 2Y48A 3RKYA 4HZFA 3TKYA 5LHHA 3K2ZA 2R7DA 2J5PA 3E3VA 4BXUA 4B09A 3Q9SA 4HF2A 1RI7A 1EH8A 1Z1DA 3F72A 1SD5A 1KU7A 3L9FA 2DLLA 3KP2A 1J7KA 3I59B 2PBIA 3E6BA 3F6OA 3G3ZA 2LSOA 4GYGA 5DCMB 2DTRA 3JAMZ 5AONA 3WG9A
chains in the Genus database with same CATH superfamily
2EZHA 1RIOH 1DP3A 2HQNA 2GQQA 1HA8A 3RCOA 4KA4A 3QP6A 3TMOA 3P7NA 1B72A 1HW5A 1BC8C 1MZBA 3DTKA 1YE9A 4RS8A 1VFCA 2VL8A 3GTJJ 1I50J 1Y56A 3JTGA 2KT0A 5B1AH 3C2BA 2O61A 1FYLA 1O57A 2HYGD 2W7NA 1TT5B 3IRRA 2E1OA 1YRNB 1GDTA 2GBYA 3CUOA 1S3JA 2R3SA 2L9RA 5B1BH 2K02A 1LFPA 1MMNA 2EB7A 3RZOJ 4M9ZA 1ZN2A 4A3EJ 2JT1A 5LLQA 1WJAA 3AG1H 4LGWA 2Q0OA 2R7FA 1OKRA 3LSHA 3LWFA 4B8XA 4LMYA 1YW9A 1R23A 3CMYA 1O3TA 2R7UA 1I6XA 2PJRA 1TW2A 2R7OA 2FUG2 2F5CA 2ICWG 2HPIA 4JX5A 2CO5A 4XOTA 1YO5C 5HOOA 2PMUA 3BPVA 2LF8A 1BW6A 1XN7A 3I53A 3U2RA 4JYKA 2DJIA 1FEXA 3FM5A 1W4MA 4MTDA 4Z2YA 2IXSA 3ZQIA 2GZWA 4UUSB 3H0DA 2NNNA 4W1UA 2NOJB 2NS8A 1V5EA 2Y69H 2ME0A 4E7IA 4IPAA 4RB1A 2WV1A 3IKTA 1BR2A 1SANA 1UJ8A 2OV7A 2G0EA 2X1EA 2XAHA 5ICFA 3ZQ7A 5BS6A 3W3CA 3K1NA 3MD2A 4XOPA 2O8XA 1X3WB 1VQOI 1FP2A 2F4OB 3LSIA 1QZYA 3IUOA 5E1XA 1OFCX 1P92A 4YG2F 3N97A 4XLFA 1K61A 1FY7A 3O2PE 1XMKA 5K7FA 1BI2A 1MKMA 2KMUA 4F52A 3BOQA 2EFWA 1R36A 3PJRA 2GOXB 4G6QA 4CYCA 4ESJA 2DFIA 1OYWA 4OMZA 3U1DA 2FMYA 3K4LA 5J1RA 4YEJA 2AS5F 5E8GA 1O4XA 3DU6A 3GLXA 1ON2A 4XRFA 2LKXA 4OMYA 3DCFA 1OJLA 3R4KA 4P9FA 1WCMJ 1IN4A 1B8IA 3CJRB 1Z0XA 3TDZC 1PUEE 4HA8A 5ILVA 3KP3A 5DUKA 2QF7A 4CXFA 2XHKA 3K4JA 3DXJF 1X1DA 2JA6J 2VJ4A 5E3MA 2CJJA 2OQRA 3LA3A 1WJEA 2VXDA 2FOWA 2G7UA 2DMQA 4NC6A 2WC2A 2OBPA 2X85A 2EH3A 3ERED 4B4CA 5LRSA 2K85A 3GCMA 5JLWA 1D1BA 1HSJA 1YTYA 4Z6YA 4UUTA 1STZA 4MNUA 3HM5A 1IUYA 2A61A 2EILH 4M3DA 2D1HA 2Q8KA 2EA2A 2ECBA 3ZCOA 3TDUC 1OCZH 4P5OA 2EFPA 4CCLA 5F0HA 1SFUA 3F0CA 1BI3A 1A35A 3JRBA 4IOCF 5F1JA 5K1YA 2QVOA 3OY9A 1MJ9A 5BPDA 4E7ZA 2BE5F 3HOTA 2TCTA 3PIOF 1LEBA 3RPUD 2QWWA 3OYMA 2VE9A 1OCOH 2Y31A 4DBRA 4J00A 1YS6A 4BH9A 3PNVA 2CWEA 2UZKA 1O3QA 3FHZA 3M8EA 1QVTA 5DDGA 1FIAA 3ABLH 3FXJA 4ENMA 1MMDA 1B59A 1VI0A 2KIFA 3DEUA 2NNYA 2L7FP 3S32A 3MAJA 5HLHA 3ZN0A 4V2GA 5JVTA 1YJWI 3LSMA 4ASNA 4IOAF 1BN5A 1K6YA 3AAFA 4AIJA 3TW7A 1BL0A 3CC7I 2OQGA 1QZEA 2E2JJ 2HR3A 2GLOA 3LSKA 3NARA 3LA2A 1U8BA 2OTJI 4XRSA 4XKVA 1K4TA 1W5TA 3FKJA 1IXSB 3QOPA 2RREA 2DTZA 2IBDA 2L5QA 4F55A 4GGGA 4RGXA 3GX4X 5GP9A 3FBIB 3K4MA 4MEXF 2HXIA 2V79A 2LREA 5M5YJ 1ZREA 3J7AO 2ETHA 3LA7A 3OYFA 2DQLA 2QSHX 1XDUA 3KIOA 4C2UA 1V55H 1IRFA 4A3BJ 3TBIA 4KMUX 3CCQI 3BJAA 4EEFG 4I09A 2VLAA 4FX4A 4QLCU 2PEXA 2HGCA 4M72A 2IJLA 3MZ8A 4EJVA 3WTZA 4OIQF 1Z7LA 2UXXA 3QYEA 1VQ4I 3BR1A 1HKQA 3TGNA 3ML6A 3ESWB 3GTLJ 1TL8A 1U3EM 4EJTA 2ZBKA 4A3KJ 2DCEA 4IO9F 3K10A 2JZYA 2M7BA 5DV5A 1MDMB 2NS7A 3BTIA 3G4SI 4GXOA 5FKOA 3WE2A 4R8HA 1ODDA 1LVAA 2IPQX 5M5XJ 3L09A 3GZ6A 1SFKA 5C44J 4A3MJ 4MGRA 1OCRH 4C30A 2XSDC 4KJZA 3ZQCA 3M07A 3CTAA 1XGMA 2JSCA 2KJBA 2K3FA 4KISA 3HIFA 4MTEA 2ZFWA 1P2FA 1RETA 2DBBA 2KPMA 3BQYA 5EYRA 2P5LC 2HPMA 5LGNA 4UNOA 1E3HA 2FE3A 3GW2A 3KP4A 3NAUA 2Z5UA 3CCRI 2DI3A 2XASA 1YX3A 5IT9Z 2W24A 5FFZA 4II2A 2DA4A 3I3LA 4M6XA 4E7SA 3I59A 4E7JA 3R0AA 6PAXA 1IXRC 2QQ9A 4OIOF 2XGDA 3PL8A 1RRJA 1TP4A 2BVMA 4BY7J 3F23A 1KA8A 2OZUA 4LOCA 3BG6A 2W84A 5DCMA 3R0JA 3H5AA 4ABZA 1WJBA 2XGCA 4BKXA 1TWFJ 3OYHA 3W6JB 3BG5A 2WBMA 4A5NA 1T6SA 5J8FA 5DUIA 2QBYB 3WGIA 1R00A 4A69C 2V1XA 2E36A 4IHTA 1UMQA 4L5EA 1D5VA 4BEHB 2VQGA 5HNFA 1Y0NA 4ENNA 2MD0A 1IRGA 1SD7A 4MFDA 2CW0F 1YI2I 4IKFA 3DKWA 4OOIA 2V26A 1K79A 2R7WA 4FCYA 2FQ4A 2YUSA 9ANTA 5JR3A 1TWAJ 4N4OB 4C3JJ 3GWZA 4ZYHA 2KRFA 4EJUA 2H6BA 2ME6A 4LG0B 4V2FA 4UHTA 2COBA 1FOXA 1KZHA 2NRAC 4YELA 2P5KA 1PP8F 1ETXA 3OYCA 1LUJB 1UCRA 4EVIA 1D5YA 2XPWA 1T08B 4FTHA 3HOZJ 2G7HA 3BR0A 4ZTJA 2QSFX 3I5UA 4M3EA 1K7AA 2LRDA 3Q0VA 3EUAA 1T0FC 3HJEA 2VBWA 2VQCA 5CJ9A 1WGXA 3Q3SA 4BL0B 1DGWY 3IRQA 4BQOA 3L2UA 2IGNA 2KFDA 1Z05A 5JVGF 1FPQA 3F6VA 3L00A 3VYTB 1WRJA 1LEAA 2M0CA 4QIWN 2FBHA 2XC7A 1T2KA 3ABUA 3CP8A 3KFWX 1WZ2A 4EV0A 3DQVC 3OIQA 2W00A 4C2MJ 2BY2A 2IA2A 3KLNA 1AOYA 2NVUB 4S04A 2K3PA 2I5UA 4I99C 4YFNF 1T0FA 5FLMJ 4ZC3A 3WTTC 2HKXA 2WAFA 1VQ5I 1IV6A 1PUFB 2DA3A 1AHDP 3BCBA 2K9NA 3G2BA 1MH3A 1R5GA 3H35A 3CCEI 2EIMH 4BQNA 2LR8A 2JUCA 2NVXJ 4AYBA 2D5VA 1V54H 4A3GJ 1PJRA 2R7XA 4M9XA 4EMSA 3V8JA 2HDDA 3SXYA 4E4HA 4MQ9F 3S1QJ 2BXYA 4AD9A 2MH9A 1MMAA 2JMWA 4OIRF 2LK2A 2JA2A 3HL2A 2M1BA 1L0OC 5L3EA 1X1AA 5IPAA 2FJ1A 2M30A 3G1OA 4PJMA 1HDDC 2DFFA 2QUFA 4I76A 3S3MA 5LEJA 3PSFA 3K70D 1N75A 1M1EB 2ID3A 3RSNA 3GFMA 5IP6A 2V9PA 1MBJA 1BR1A 3W2WA 3F21A 1UZCA 2JUGA 5IOZA 3ZQFA 3VSLA 3LAJA 1FTTA 2DDAA 4RGRA 1YJ9I 1NK3P 2OU2A 1G59A 2HTJA 4ZYGA 1LB2A 1APLC 3V7SA 1Y8QB 3CP2A 2ZCWA 4XKBA 2LC2A 3IWFA 1AKHB 2X6WA 3N4MA 3CCUI 1YS7A 4E70A 4UUVA 5CPRB 1A6QA 2E1MC 3G1LA 1ENHA 3TP0A 5LBQA 1R22A 4WWCA 1QO0D 5JFRA 4GCVA 3OYGA 2PJPA 2IS4A 3H92A 3BG7A 2G9WA 2JN6A 2HZDA 4C9YA 3RI4A 3A01B 5JHFA 2HYFA 4CCJA 2YX7A 5TJJA 1I39A 3J81K 3IC7A 5B5EC 1OR7C 1P9QC 3ASNH 4KT6A 4QPQA 2RV8A 5LHIA 1TNTA 5F27A 1SEUA 3NRVA 2Z33A 2KRCA 4HAMA 4AUXA 3VSKA 5H2FC 1G3YA 2IS6A 1XSXA 2XPUA 3LOCA 2KZGA 3HYIA 3J81Z 1OISA 1MW7A 2LY9A 2PN6A 4HQMA 3T0YA 5GPAA 2HWVA 2COMA 3CZ6A 3TEDA 3TOAA 4XQFA 1UHWA 5IT3A 1HCRA 1ZHFA 1R7JA 2VIXA 1P7IA 4G7HF 1ZRCA 1FOKA 5H6RA 3OL4A 3FBNB 2NVQJ 4N0BA 3FXLA 5KAIC 3OYIA 3AKZA 1RUNA 4HRIA 4HDUA 4ZJZA 3UNGC 2KHMA 4CCOA 5FJ8J 1Z6RA 3D5RC 2QSGX 4XLEA 5J40A 3S1MJ 4WF2A 1H8AC 3OYAA 4G6TB 1D3YA 4C3HJ 3QU3A 4HLYA 3CO6C 2QENA 1JKRC 2V1NA 1X19A 4AYBN 4RGUA 4CZZA 5EG0A 4JP0A 2W1OA 1EH6A 3FKIJ 5H20A 1TQPA 5CQEA 1OLTA 1DUXC 3OYKA 3M7GA 3G6EI 1I3AA 3O8HA 1MMSA 3ZMUA 3S2HJ 3BP8A 5J4VA 2EJRA 5IP9J 2A5YB 2LG4A 4NDLA 4UY8I 2LBFB 2X51A 1A5JA 1ZLJA 3I58A 2GXBA 1Y39A 4WK8F 2DFEA 3HB9A 2O03A 4ZTFA 2E71A 2EZLA 2BHYA 3U9GA 3LFUA 2E34A 2CMPA 1XS9A 5M5WJ 1H0MA 1U78A 1S5LC 3RKQA 3KEYA 1RKTA 5FKLA 1A04A 1IAWA 1K78A 3GYHX 4GO1A 2DYRH 4EGZA 5C3EJ 2DO7A 3WU0A 1SMYF 1J2XA 3HC7A 3ONQA 4FHTA 3SDBA 2HI3A 2DJNA 3D5LA 2CQQA 2H6CA 2Y0SA 3GVAA 1BOBA 1HKSA 4XLPF 2VODA 1A36A 2VJJA 2JK3A 4I6ZA 3GTPJ 5F0CA 4KNYA 1ETVA 3KETA 4BDYA 1YW8A 2HKOA 1BOAA 2W48A 1FBUA 1T39A 1D0ZA 3D1NI 4QWQA 2ELHA 3ABTA 1R1UA 5L3BA 2BY1A 1WJCA 1O7FA 2JRTA 5DD4A 2ZSIB 4AVPA 2QQBA 4DW6A 3E5QA 2HQAA 2BY0A 2R5YA 1QPMA 5GAEJ 3EYIA 2XAUA 3S17J 2MC3A 3ZQLA 3VODA 1FYKA 3K2AA 4RLFA 5JLXA 1GHCA 2LNBA 3LSTA 3JTHA 1IC8A 1G6NA 4PFOA 5J4YA 4BYYA 2Y0SN 2Y30A 4A3CJ 3DP7A 4HNTA 4UVCA 1I5ZA 2STWA 4J01A 3CUQC 2HOEA 3V8LA 3I9V2 2WWYA 2R7TA 5FLXZ 2O8KA 3SEZA 4M3GA 2WADA 2F5VA 1ETKA 1VQNI 2BVLA 3JW4A 2VJIA 5FGMA 3TO7A 4IRIA 3Q0UA 2WAEA 4KMFA 4RA2A 2DK8A 1O3RA 5BNGA 5ICCA 1TWGJ 1UG0A 1ERDA 1JGSA 4BUPA 4A3DJ 4BY1J 1FJLA 2RNJA 4EATA 2CW8A 1JHFA 2KIUA 3EUKL 3PQJA 2LP0A 2OC6A 5ED4A 2V6CA 5EGOA 4MEYF 3K4NA 1Q1VA 3IH4A 2ECCA 1H89C 1LPQA 4Q4ZF 1BI1A 2ISYA 3ABKH 1C0WA 4D7NA 1K4SA 3EYYA 3E5UA 3GMEA 3ZQHA 4PDKA 3BTCA 4N9HA 2DOFA 2CV2A 2K9SA 3CQZJ 3S1NJ 3MFKA 5J47A 4YIRX 3O8GA 3OOUA 2A05A 1USSA 3MCZA 3EQLF 1POGA 2FA5A 2L4MA 3K1PA 3BJ6A 1JT0A 1ZR4A 1EV7A 5KHDA 5D5UB 1BM9A 1FMVA 1X1CA 2GXGA 3GTQJ 3ECOA 1U2WA 3SQNA 3PSIA 3K4KA 3E0JB 3VYRB 2PLYA 3CDLA 2OF7A 3RQIA 2E60A 1LKXA 5DTDA 3ZXSA 1KU2A 5AIQA 4YIIA 2EFNA 2ZJ2A 4UB6C 2M87A 4LK0F 2EZKA 3T8TA 4A3IJ 3H5RA 4XIDA 2V1DA 1PVEA 1IJWC 1JKQC 1HLVA 2FF4A 1Y1WJ 1IV8A 1YITI 1VQ6I 5F6FA 1KQ9A 3HEFA 2KJCA 4XR6A 1L3LA 1TWHJ 4F91B 4Y33A 3HOXJ 1WI3A 4PFPA 1UAAA 1JUMA 2FX0A 3QQAA 4FE4A 4CA0A 1I3QJ 1R71A 2QGUA 4LIUA 4U7BA 2R5YB 2BW3B 4U7DA 1Y1VJ 1HXDA 3I55I 2DQRA 1TZLA 1OYYA 3JRGA 3BR6A 3KLOA 1W7PA 2L3DA 2GIZA 2PMZN 3H9JA 2E2IJ 3FM3A 3KYLA 1REPC 2V7FA 3DBHB 2FRHA 4E7HA 1F43A 3FMQA 1IN6A 1IDZA 1UG2A 4A2UA 4XKCA 3H3ZA 1MJAA 1XC5A 4E7KA 3V7RA 1UB9A 5DEQA 3BZ6A 3UKGA 3JRHA 1CF7B 2WA0A 4B44A 3K4BA 1ZKGA 3LSGA 4JX6A 2PJRB 2M4KA 3CC4I 1WQ2A 1FZPB 1A6IA 1UELB 4XL9A 1X1PA 3DKYA 2QCOA 1TBXA 1T95A 5HS7A 3J7YJ 4CYCB 4RB3C 5EEAA 3VB2A 1KU3A 1SFEA 1DU0A 2L9NA 2R4GA 4EJOA 2DA2A 4UVBA 1HQCA 1FOWA 3R60A 3ZR8X 2FD5A 4LFUA 5IP7J 1FOYA 1OMIA 1MNDA 1R1VA 1FSHA 2EFOA 1XMXA 4KUMA 2XAQA 4L5IA 4A3LJ 2L0KA 1LE8A 4AVZA 3WHBA 2DMNA 5FRMA 4LD5A 1OPCA 2KP6A 2WAQN 4HEA2 3S93A 1Z77A 2B7EA 4PZJA 2IS1A 2OPTA 1USTA 2AO9A 3CD6I 3H1CA 5LFAA 1SC7A 3NEUA 2VKDA 1E17A 2DA1A 2IA1A 1TQIA 2GIVA 3H3VK 2MFZA 1YG2A 2HTSA 2VI6A 2VN2A 3B6AA 3H9GA 5LD2C 2P0WA 1ZAOA 3F8NA 3L1PA 2E7WA 1WH7A 2OAZA 3M8JA 4BE1A 1D0YA 3HXLA 3C2HA 3ELKA 4AWXB 1B8IB 1B9MA 4LJZF 1YIJI 2L7MP 1F1ZA 4IEJA 5F08A 4MHGA 2MG4A 2ZMEC 3MMYB 4BBSJ 4HYEA 1X4PA 4NNJA 4QSHA 2F4IA 1XD7A 3GO5A 1R4MB 1DQUA 1XTAA 2XRNA 2ESHA 4RDUA 2E5ZA 4Q47A 2BW3A 1EH7A 4CO8A 3AG3H 3WGGA 2K9QA 2PMZA 1JUPA 2H09A 2DA6A 1SVOA 3OS2A 1WPKA 1WHUA 2MGQA 5A2QK 3CCMI 4ENJA 2M9HA 1FYMA 2Y9YA 3S16J 2XF7A 2H94A 3BR2A 5EF6A 2B9SA 4ZDPA 5CKTA 3JSPA 5J8CA 4U0VA 2AXTC 3EETA 2P7CB 2FBIA 2M8EA 5HDKA 5FROA 4L0ZB 3MEXA 4X0GA 1T98A 2K86A 1J0RA 4HG2A 3RPUA 3SFZA 3HOWJ 3FF5A 3C18A 4XK4A 2Z16A 4A3JJ 3BG3A 4HPQA 2RVCA 3IAM2 2R7SA 2DN0A 4P1WA 1FMWA 4Y52J 4DZJA 2E19A 3QP5A 4UV8A 3LFKA 1T56A 3F8MA 2ID6A 2YU3A 3M9AA 3ZQGA 4NBQA 5D5XB 5F64A 4IRGA 1BW5A 3ZPLA 3QWLA 4IJAA 2HOAA 1VQ9I 1EJ9A 1FSEA 2CUJA 1LVKA 3ECHA 3ZMTA 4PJNA 4Y4RA 2KDZA 4A93J 5HDGA 1SAXA 2K4BA 2Q2EA 5D5WB 4KN4X 3W2VA 4KIFA 2EWNA 1E0EA 3BLYA 4HV5A 2LH9A 4BHBA 5F1RA 2MYSA 1JTYA 1CGPA 2R7QA 1XGOA 2X9DA 2X1CA 2E1CA 2M34A 3SFIA 3IV5A 4B1RA 3HUGB 4BNCA 3E5XA 4ZYAA 4CH7A 1ZH5A 4EJWA 5KVRA 3U21A 5E1WA 1WJFA 1IG7A 4AIKA 1S8NA 3ABMH 1BJAA 2XB5A 2L9SA 1I6HJ 3OR2C 3K9TA 1ZGAA 2VT2A 5M3FJ 1MNMC 4LB6B 3FK6A 3ZMVA 2NS0A 1TQMA 2EIKH 2LY2A 3KZIC 5EZHA 2CS3A 4NQWB 3KEQA 2DMTA 4W97A 1YLFA 2OJED 1GXPA 5L3DA 2RQQA 3RJPA 4ETSA 1ZGWA 2LOOA 2QQAA 4HQEA 2ZNYA 3CCSI 3JRFA 2O6GE 1SVMA 2VOPA 2KISA 2A6TA 4BJTA 1R9TJ 2HQ5A 3S3OA 2QBYA 1I27A 2V9KA 4J19A 5EZGA 5J3LA 4I0BA 3GFJA 1VNDA 4XONA 1R5ID 1X2NA 1RZ4A 4RLQA 2H1KA 5FO5A 2XIGA 1Z6TA 4ZYEA 1RR8C 1E3OC 4R1HA 3OYDA 1ZARA 3OYNA 3BZCA 2W4SA 3FX3A 3KPHA 1OCPA 1N25A 4RAGA 4NC7A 1T33A 2E1MB 2IAIA 1JE8A 2ZFUA 4AIDA 3EDPA 3PFIA 4LK1F 3PQKA 2BY3A 3DEEA 1XX5A 1G8XA 4NB5A 2JA8J 2O3FA 2LYCA 3HTSB 3L2WA 1PDNC 3GBGA 1G2HA 2R5ZA 1J9IA 3IH2A 5CVIA 1DU6A 2BYVE 2P6SA 2CGPA 1RKWA 4PGGA 1DP7P 5BPIA 1XSVA 3S15J 4IRHA 4BXFA 5CVRA 2VC0A 2CQKA 2YR2A 2VONA 1SMTA 3K0LA 1XPXA 4KT5C 3QU6A 3SHFA 4L9TA 1U9OA 3B73A 3FDYA 3RYPA 3J7AY 4XRMA 1JHHA 5FKMA 4BBRJ 2Q2EB 1K83J 4YRVA 4Q5SF 2QKMB 3WU2C 2LFBA 2FNAA 4O5VA 5HVQC 1QRYA 1W7PB 2O9LA 1G3TA 2JVGA 2X6XA 2ZSHB 1S9HA 3KP5A 1ITYA 2FU4A 3Q9VA 4HOBA 3KP7A 2ADUA 2QLZA 1PP7U 5D4SA 4ZZLA 1FT9A 2X48A 3VPRA 4ZZDA 4Y7NJ 2GM4A 1ETYA 3QPSA 1W5SA 3ULQB 3PFYA 1K78B 3TQNA 4F3QA 1LFUP 1PUFA 3SZTA 4B3AA 1FLIA 4G94A 1QHGA 1XCBA 5IT9K 1ETOA 2HFHA 3V42A 4L18B 4WX9A 1IRXA 3GTGJ 3S2WA 3MKYB 4OAZA 1SFXA 1FX7A 2I10A 4DYCA 1EA3A 3GUDA 2QEXI 3HDDA 1ETQA 1JKPC 4HLXA 2K9MA 3E7LA 1W36D 3C7JA 2MC4A 1NG6A 1T38A 1W1WE 5ICGA 5GTHC 1TTYA 2IW5A 1ULYA 1RC9A 3HOVJ 2A69F 3QYFA 4BU2A 1J59A 1ON1A 1D8KA 2KLOA 4C3IJ 2GOMA 3TO6A 4IL6C 2DPDA 3UR3C 1Z67A 4DNCA 3WTWC 3RDIA 2HU9A 2KRHA 1MSEC 1VQMI 4HNUA 4DJAA 1KQ0A 1I1SA 5B66C 2JVHA 1G3SA 2V4JC 3LSJA 5K7HA 1S7OA 1KYWA 2CV0A 4XSZF 3G73A 5HLTA 3MN2A 3BQZA 2JJ7A 4PSWA 3FXMA 3QODA 3E97A 3BT9A 2HVRA 3F8BA 1HC8A 2DOEA 2GWRA 1S29A 2CG4A 3DEWA 3K1MA 3LL7A 3WTXC 2XRLA 1GV2A 3HZJA 3HOSA 4IHVA 4JOMA 2M4GA 4N4NB 1LDJA 1VZ0A 5HODA 2HYJA 1LDDA 2LMDA 2DW4A 3FXQA 5TRDA 1HKTA 1Z91A 3PIPF 4IVNA 2ZXIA 4L9VA 4LLGF 1ORKA 2VB6A 4PGHA 3DV8A 3IH3A 3MZHA 3HKZN 1E2XA 3NQOA 2OTLI 3IWZA 3OSFA 2VBZA 2ZMEA 1JUSA 1YJNI 4BGDA 5C4XJ 2X6OA 5F04A 3P9IA 2FMLA 2NOGA 2F4MB 2VOOA 3BC8A 5E1ZB 3LQRA 1O7LA 3P9KA 2OCCH 2CUZA 4MFEA 3FXOA 1XSDA 3MQ0A 2W82A 1MGTA 3RIRA 4A3FJ 4A6EA 4M74A 1BJZA 2PX9A 1V4RA 3CMEI 2NVTJ 3NWSA 2JQ7A 5JI6A 4KN7X 3RYRA 4M71A 4BJ6C 1OQYA 3T1BA 2QQ8A 4DGWB 4I0AA 5E3OA 2QYOA 2L02A 3H5NA 4PK4A 3T8RA 4CZCA 4BEHA 4KITB 4UB8C 2OUMA 3DPTA 5E17F 5J1UA 4XBFA 5L3CA 5AIPA 1X1BA 4L5JA 1ZQ3P 5DYMA 1IF1A 3KCCA 3AG4H 3IHUA 4X1EA 1MJBA 1XGNA 1BBYA 1IUFA 3IP4B 4WXHA 5D6FA 1TWCJ 4A0YA 1B4AA 2IS2A 3K4CA 3IAS2 4M3BA 2XB0X 4AIHA 4ANJA 2ESNA 2WB1A 4ESBA 2KL4A 4BJ5C 4HX8A 3A0HC 1RNLA 3I4PA 2HNHA 1P4XA 4GDFA 5CVJA 3V4GA 2DMPA 4WXCA 1YFHA 3A1YA 3E6CC 1DPRA 4D1QA 2CQXA 4D5CA 5E3NA 4D7MA 3B6CA 2H1LA 3EUHA 3QRFF 3QYBA 5ILSA 4IZZA 1QU3A 5CYVA 4A6DA 1S7AA 2GA2A 5LHGA 2IGMA 4M73A 3HRSA 1W36C 1X3UA 3KZZA 2KDOA 2LD5A 2CQ7A 4LG3A 2LBFA 2F48A 2WTEA 3OMYA 3HG9A 2VPRA 2H8WA 1XMAA 3G71I 3S14J 2VE8A 1GV5A 1F36A 3CCLI 2E1NA 4F7ZA 2BBYA 4DOZA 1HBXG 2WAQA 3REOA 1BR4A 4OIPF 2ZXHA 1U5TC 1N78A 1ZK8A 1Z3YA 3E1SA 1NH3A 2K4JA 3CLOA 3U1KA 5BOXA 3BPXA 3FZVA 2K5CA 4P96A 4I7HA 1LQ1A 1WWXA 3MKLA 4FT8A 3JR9A 2ZC2A 2Z1DA 3T5XA 1R49A 2EBIA 4M6VA 1D1CA 2RN7A 1GVDA 5FD6A 2L7ZA 3L7WA 4IHWA 3BY6A 1Z21A 3ZP5A 4U88A 2F5DA 3QAHA 4B47A 1HW2A 2MSYA 2VBXA 4FASD 2RAEA 2LTPA 3QPHA 2V9VA 3GLLA 5HNHA 4WXDA 5EEGA 1H88C 3N05A 2CFXA 5DCFA 5HDNA 1TLHB 2FSWA 1Y0UA 2JSPA 3BROA 1X3ZB 4XLCA 2P6TA 3FXRA 1SAUA 2KIMA 3PUBA 3OR1C 4DQ2A 2LVSA 2E7XA 4A0XA 5D5VB 3WTVC 2K40A 4BE0A 1F5TA 2XSJC 4KFCA 3ZMSA 3OS1A 3BR3A 3A2KA 3ZRGA 2A07F 4A5MA 2OD5A 3FHNA 2F6CA 4EQQA 4ESFA 2R5ZB 3L2RA 5HS8A 1AA7A 1KGSA 4JBAA 1SD4A 4EM1A 1GUUA 1R1TA 2M5WA 4ENKA 3DWLE 4UUSA 2ZKZA 3K69A 4GYIA 5D8LB 3K70C 3OV8A 1JJ6C 4HW0A 4ZH4F 3COAC 3SDGA 3CESA 5M3MJ 2PMHA 1BIAA 4HNVA 2D1VA 3Q0WA 2P5VA 2EZIA 1R5HA 4FQGA 4JK1X 3ROUA 3PUFA 3BJOA 3PO3J 2MA3A 4G9YA 3W6KB 2UWMA 2IRFG 4I01A 3V8KA 2E5NA 4Y15A 4HF0A 3CUQA 3DLLF 4N9IA 2NYXA 2L54A 2HQRA 4OWRB 1YW7A 5B3SH 1V5FA 1A31A 2CW7A 3HOUJ 2C6YA 1VQKI 1X58A 3CMMA 1MBGA 2X4HA 2VPLA 2GAUA 2E35A 1ZG5A 1KYZA 4U0YA 3AL0C 3HOYJ 1BIBA 4XLHA 1ZELA 2FNPA 1T8IA 3KYCB 4G7OF 4L0YB 2BHZA 2EIJH 1ZYRF 3A03A 4HBLA 1P7JA 5ICEA 4R79A 4BXXJ 3FMSA 3O6BB 1IDYA 5HLIA 4I2OA 5KK1A 4D5FA 3SJMA 4IF4A 2LY1A 3FK7A 2BEOA 1Z7UA 3ZMDA 1VF9A 3I4NJ 1MBKA 4IXAA 2L7KA 3BR5A 3A0BC 3GZ5A 3KEOA 2MABA 4IHXA 2DU9A 2QM3A 5EDNA 4AM3A 1WI9A 1XG1A 3QPTA 5EG0B 1MBHA 2XDVA 3CF2A 1FTZA 5KAFC 4WCGA 2CV1A 2P8TA 5HLGA 1K6OA 5K7ZA 3BZKA 1N77A 4BHPA 3E6DA 3BTLA 1U8RA 3I4MJ 3H0GJ 1ZRDA 4HF1A 5IYBJ 3RPQA 1B9NA 4GRIA 1OCCH 3VOEA 2IA0A 2NXNB 1ACIA 3HTUA 4ZYDA 1S72I 3I71A 3E6MA 2BOLA 3HRUA 1ZLKA 2XKOA 2P7VB 1J75A 4B43A 1BA5A 2YSRA 3VYSB 5BMZA 3ZMZA 1HW1A 1U5TA 1OCTC 1IRZA 4M6YA 5KNLA 1MNEA 4BHCA 2J5OA 1ZTRA 4CGZA 2CH0A 3LAPA 3CJTB 2KQRA 5FD5A 1VTNC 3FXKA 3SYTA 1QBJA 1IXCA 4PCQA 4IX7A 3DFGA 4NQWA 4RB2C 2JA5J 4K2EA 2F5EA 4II3A 4HDVA 2IEKA 1MH4A 3KZYA 2LKPA 4XICA 3OYLA 3F9KA 2A3SA 3MZYA 3FISA 2B63J 1X4OA 2O5RA 3S3NA 3M3YJ 2JTVA 2DA7A 1QVUA 2DFHA 3HRMA 2NAZA 1G3WA 3GZNB 4X6AJ 2DAOA 2ELJA 5K5RA 2PG4A 4D0PA 3K7AJ 1JKOC 5CQGA 4XN0A 2MD5A 3CUQB 4S0HB 3HSRA 3PM1A 3X2QH 4AC0A 2JA7J 2EK5A 3R6SA 2DPUA 2XF5A 1Z3XA 1YX5A 2YPRA 4RAZA 1RUOA 2ELKA 2F5FA 2HOTA 5FKNA 3O3KA 2HZTA 5IY5H 2V1UA 2B0LA 3HBLA 3GF2A 1F4KA 4KYWA 1YRNA 2UV1A 2Y9ZA 2JPCA 3BCAA 5TGTA 4EM2A 2D45A 4H4KC 2VJ5A 1WJ5A 3G1MA 4KIBA 5LGTA 4QPOA 1VQPI 3ZN1A 4YFXF 3ZQQA 4HV6A 4CYDA 1S7EA 4G7ZF 3LSRA 2PI0A 1JI8A 1QQIA 2QKLB 2VQHA 1XDSA 2L4AA 3I64A 3ERMA 5LGUA 2W25A 4UV9A 2R93J 4EGYA 2XF6A 2STTA 2W57A 2P4WA 2EV5A 3WG7H 4HX4A 1YHQI 3A01A 3GEZA 2XVCA 5FB2A 3C1DA 2PFBA 3NWTA 3OIOA 4RAYA 1XCVA 4U87A 3W2AA 4DZPA 2YU9J 5D8KB 2ZXJA 4RGSA 3DKXA 3ASOH 2IGOA 3F22A 1YIOA 1MDMA 1NK2P 4UXNA 2EV6A 2EA4A 4IQ4A 2CSOA 2CUEA 4Y17A 4JQFA 3RTRA 1DGRM 2XAJA 4E6KG 2M3AA 2RC4A 4Q48A 1HDPA 5E3LA 1B6AA 4CDGA 3GFLA 2DK5A 5L3GA 4M3FA 1S6LA 2Z9OA 3BG9A 1IN8A 4DYQA 3TO9A 2VXZA 2VKVA 2DDBA 1DPUA 1LFBA 3AFHA 2TRTA 3PO2J 4CICA 4HSRA 3VEPA 5GPCA 1U5TB 2L2OA 2X6YA 2AHQA 3L2CA 3BWGA 1KU9A 1MBFA 1WFXA 5DD8A 2VC1A 1IZ1A 4OINF 2IT0A 5GAHJ 1OYIA 5FLVA 2VBYA 3BTJA 2CRGA 4F93B 3WTYC 3M8FA 2DOAA 1HF0A 2KKOA 3JCUC 2K27A 2Z99A 3WHCA 1RESA 3CLQA 3WE3A 3LQQA 1P4WA 1DDNA 2DT7B 1HSTA 3SZGA 4BACA 1E3PA 1IGNA 2YS9A 1LJ9A 4XM3A 1H9GA 1MMGA 4PJJA 1UHMA 3SZPA 3S8PA 1ZRFA 2V6EA 2MLKA 4G6DA 1BI0A 4LB5A 2CUFA 4LLNA 3BDDA 4A0ZA 4LG0A 3TP3A 3VYUB 4CCMA 3WGHA 3JRCA 1QZZA 1R58A 1JT6A 1QGPA 2Z3YA 3AG2H 4PJ0C 1BC7C 4HX7A 3FIWA 2RNGA 3P5JA 4B3XA 1FNNA 2IGKA 3HSEA 4OAYA 5J6XA 3VDXA 3CO7C 1V5GA 2O7OA 2DODA 2XUBA 2O0YA 3S1RJ 5FFXA 3F3XA 3C3WA 2RQPA 1CF7A 3R61A 3OSGA 2GA1A 2DA5A 2CQNA 5LEKA 2ZJQF 1GVJA 1H9TA 4C2TA 3LNQA 3HGGA 1SVLA 4I98B 4E7LA 5EEHA 1FBSA 2AQEA 4MO7A 3S2DJ 2IP2A 4DIQA 1W7PD 1QA6A 3LSPA 3RQ4A 1NHAA 2OZ6A 4PUSA 5EJCA 3W6VA 3M1CA 1RPWA 1TW3A 2VKEA 1EKEA 1FIPA 4M9SA 3A4CA 3A02A 3HKZA 1AU7A 1B72B 2QZ8A 1I1GA 3RKWA 5FKKA 1WKMA 3ZOBA 2R0QC 4BAYA 2ZXWH 1U6GA 1TC3C 1IW7F 1ZG3A 3FWEA 4BDZA 2M45A 2BGCA 5E79C 1VQ8I 3RZDJ 4A12A 3WU1B 1MD0A 1HOMA 4S05A 5L3FA 3P9CA 3J80Z 2HS5A 1GLNA 4LIVA 1FP1D 3DF8A 4O6JA 3I0TA 1ZR2A 3D5SC 3KX2A 4I02A 4Y13A 3LMMA 1XGSA 2DT5A 1V3FA 2XAGA 3CDHA 4BQQA 5DS9A 3DU5A 3WTUC 2Z2SB 4DBQA 3I54A 5FLXK 2FBKA 3HRTA 2ZJRF 2MLGA 2H27A 2IVMA 2P81A 1AWCA 2OA4A 3QPLA 3M1EA 2MBFA 3H36A 2RGVA 1YQAA 3GFIA 4XKWA 1JJ8C 4XNFA 2LDUA 3DPUA 1D1AA 2R92J 1D8JA 3FMRA 1NG7A 1PYVA 3GXOA 4CUGA 4XN3A 2MW8A 1JTXA 4FX0A 4B48A 2FOKA 1EF4A 3GTOJ 4QTRA 3C2GA 5GTIC 2XROA 1GT0C 3CJQB 2WY8Q 3VFZA 1NTCA 2JPBA 4BS9A 3HGYA 5CVUA 1UHSA 2I8DA 5E18F 2JRMA 2ZNZA 1XB4A 3OOPA 2R7VA 2ZJPF 2A6EF 3MWMA 5CVVA 3OS0A 1WSUA 5JHUA 2Q1ZB 2M8GX 4RBOA 2BV6A 3HPGA 4G8XA 3J80K 1W0UA 2BZTA 4IHSA 1JXSA 1LDKB 1AKHA 4LLLA 5C4JJ 2M0MA 3OIPA 3ZGKA 1U0JA 2AXLA 4KIGA 3V7CA 2VASA 3Q5FA 4KDPA 5ERIA 4XORA 3RKXA 5ILUA 1W0TA 5FRNA 3DBLB 3M4OJ 2LKSA 3CDIA 2XGEA 4XRSG 4CHUA 2UXNA 4PJLA 3MKWB 3H3UA 1F9NA 3PNTA 4UVAA 3OYEA 2K9LA 5A2QZ 1IO2A 2XV4S 2HDWA 4RMNA 3HPHA 5D4RA 3L2VA 1VQLI 2Y0MA 2NVYJ 1D0XA 5J1YA 2N8GA 4FETA 1ZGJA 4OU0A 1ONVA 2FXAA 4PSXA 4KICA 2H8RA 5D6EA 1WVRA 2BXZA 2A6HF 2CYYA 5H6QA 2EPFA 4TV7A 2TDXA 5IOYA 1KONA 3OYBA 3JRDA 2WY7Q 3DLAA 3OL3A 2DMUA 4V19K 2HOSA 2EFQA 2W85A 1P6RA 2EQRA 4FISA 2HEOA 2XAFA 3IL2A 2FEZA 4EM0B 1G4DA 1ZG1A 3KYDB 3OYJA 2HVSA 2K7LA 2A5WA 3HSFA 3J7ZI 1KQ8A 4BE2A 2DYSH 1UFMA 4ON0A 1IN5A 3OWTA 3HUGA 4L9NA 2ZB9A 5HS9A 3TW6A 5DM7F 1FC3A 3AL0B 4MIMA 5GAGJ 2FQ3A 2HDCA 2JWTA 2X1DA 5DM6F 3DTIA 5F0FA 5IYCJ 1WH5A 1X2MA 4O3MA 3CCJI 3TOBA 4NUBA 3SEQA 5K5QA 4F92B 1QNTA 2CFOA 1U9NA 2MH2A 2PQ8A 4Y3OA 3K6GA 4CCKA 2L9VA 2ACJA 2R7ZJ 1Q1HA 1CQTA 2ZO4A 3EUHC 4NC8A 2D2WA 5K5OA 5CLSA 2ZMEB 1O3SA 4XMYA 1FWZA 5LRRA 4RM2A 3CMAI 1Z9CA 3VWBA 4CSWA 4MQVA 3CCYA 5E8IA 4YFKF 3CF5F 1W5CC 1IN7A 3CCVI 2HVQA 3HHGA 2LLKA 2HXOA 2DT6A 5KCMA 1Y8RB 3FXUA 2R7RA 1TNSA 2XPVA 3DPLC 5TISC 3ISPA 1GXQA 2A68F 1FBQA 5E20A 4P55A 4MLOA 1QHHD 2ISZA 3JSOA 1RR7A 2WV0A 1LE8B 3B02A 4H0EA 1SD6A 4BQAA 1ETWA 3F8FA 2CU7A 2LF7A 4RB0A 4IHYA 2M7AA 2Y75A 2EV0A 4XSXF 2RDPA 4NHJA 2L01A 3F8CA 4ZDOA 2Y2ZA 4RM3A 3KE2A 2X0LA 3JAMK 2XKPA 2VQLA 3MKZA 2VT3A 4XLNF 1LNWA 1OR7A 1YYVA 3H9QA 1MBEA 1R6RA 2QA4I 3JRIA 1J09A 4U0WA 4P9UA 1MSFC 3QOEA 1TT0A 3WTSC 2KZVA 4L9JA 2RKHA 3MVPA 1WJDA 2XGXA 2KIQA 4RAFA 1J5YA 2VKHA 1B1BA 3PNYA 1P4AA 2OCEA 3CJNA 3D0SA 5BQTA 3HHHA 4HSTA 5EGOB 2YX4A 3WODF 2F2EA 1YOVB 2DXIA 3KP6A 3GTKJ 4JX4A 3I56I 3IKVA 1QPIA 2EINH 4YIFA 5GADJ 2Y48A 3RKYA 1SFOJ 4HZFA 1MIJA 3TKYA 5LHHA 3K2ZA 4ZDLA 2E2HJ 2AQFA 2R7DA 4GFBA 2J5PA 1JGGA 3E3VA 4BXUA 4B09A 3Q9SA 4HF2A 1RI7A 1EH8A 1Z1DA 3F72A 4IQJA 3DTEA 1SD5A 1KU7A 3L2QA 3L9FA 3JREA 2DLLA 3KP2A 1J7KA 3I59B 3TL4X 2M2EA 4CCNA 2PBIA 3E6BA 3EPZA 4D9JA 3F6OA 3G3ZA 4G12A 2LSOA 3GTMJ 4GYGA 1VQ7I 5IYDJ 2GXAA 4ITVA 2UUZA 4LITA 4FE7A 1R4NB 3DBRB 2DTRA 5DCMB 1Y6IA 4DYRA 3JAMZ 3CC2I 4XLAA 4AU7A 5AONA 2VUMJ 3WG9A 3JRAA 2WB1N
chains in the Genus database with same CATH topology
1RIOH 2HQNA 2GQQA 4KA4A 3QP6A 3P7NA 1HW5A 1BC8C 1MZBA 4RS8A 3JTGA 2O61A 1FYLA 1O57A 2HYGD 3IRRA 3CUOA 1S3JA 2R3SA 2K02A 2EB7A 4M9ZA 1ZN2A 2JT1A 5LLQA 4LGWA 2Q0OA 2R7FA 1OKRA 4B8XA 3LWFA 4LMYA 1YW9A 1R23A 1O3TA 1I6XA 1TW2A 2F5CA 2CO5A 1YO5C 5HOOA 2PMUA 3BPVA 2LF8A 1XN7A 3U2RA 3I53A 3FM5A 1W4MA 4MTDA 4Z2YA 2GZWA 2NNNA 4IPAA 4RB1A 3IKTA 2XAHA 3ZQ7A 5ICFA 5BS6A 3K1NA 2O8XA 1FP2A 1QZYA 5E1XA 1P92A 4YG2F 3N97A 1FY7A 3O2PE 1XMKA 1BI2A 1MKMA 2EFWA 3BOQA 1R36A 4G6QA 4ESJA 2DFIA 1OYWA 4OMZA 3U1DA 2FMYA 2AS5F 5E8GA 1ON2A 3GLXA 4XRFA 4OMYA 3R4KA 4P9FA 1IN4A 3TDZC 1PUEE 4HA8A 5ILVA 3KP3A 5DUKA 4CXFA 2XHKA 3DXJF 2OQRA 3LA3A 2G7UA 2WC2A 2OBPA 3ERED 5LRSA 1HSJA 1YTYA 1STZA 4MNUA 1IUYA 2A61A 2D1HA 2Q8KA 2EA2A 3TDUC 4P5OA 2EFPA 1SFUA 1BI3A 5K1YA 2QVOA 1MJ9A 5BPDA 2BE5F 3HOTA 1LEBA 2QWWA 2VE9A 1YS6A 4BH9A 2CWEA 2UZKA 1O3QA 3FHZA 3M8EA 5DDGA 4ENMA 1B59A 3DEUA 2KIFA 2NNYA 3MAJA 5HLHA 3ZN0A 5JVTA 4ASNA 1BN5A 3AAFA 4AIJA 2OQGA 2HR3A 3LA2A 1W5TA 3QOPA 1IXSB 4GGGA 4RGXA 3GX4X 4MEXF 2V79A 1ZREA 3J7AO 2ETHA 3LA7A 2DQLA 1XDUA 1IRFA 4KMUX 3BJAA 4I09A 4FX4A 4QLCU 2PEXA 2HGCA 4M72A 2IJLA 4EJVA 3WTZA 4OIQF 2UXXA 1HKQA 3TGNA 3ML6A 1U3EM 4EJTA 2ZBKA 2JZYA 5DV5A 1MDMB 4GXOA 3WE2A 4R8HA 1ODDA 1LVAA 2IPQX 3L09A 3GZ6A 4MGRA 3CTAA 1XGMA 2JSCA 2KJBA 3HIFA 4MTEA 2ZFWA 1P2FA 2DBBA 2P5LC 5LGNA 4UNOA 3GW2A 2FE3A 3KP4A 2Z5UA 2DI3A 2XASA 5IT9Z 2W24A 5FFZA 4M6XA 3I59A 3R0AA 6PAXA 1IXRC 2QQ9A 4OIOF 3F23A 1KA8A 2OZUA 2W84A 5DCMA 3R0JA 3W6JB 4A5NA 1T6SA 5J8FA 5DUIA 2QBYB 3WGIA 1R00A 2V1XA 4IHTA 1D5VA 4ENNA 1IRGA 1SD7A 2CW0F 3DKWA 4OOIA 1K79A 5JR3A 3GWZA 4ZYHA 2KRFA 4EJUA 2H6BA 4LG0B 4UHTA 2NRAC 2P5KA 1PP8F 1UCRA 4EVIA 2G7HA 3I5UA 1K7AA 2VBWA 5CJ9A 3IRQA 1Z05A 1FPQA 3F6VA 3L00A 1WRJA 1LEAA 1T2KA 2FBHA 3ABUA 3KFWX 4EV0A 3DQVC 2IA2A 3KLNA 1AOYA 4S04A 4YFNF 1T0FA 3WTTC 2HKXA 1R5GA 4M9XA 4EMSA 3V8JA 3SXYA 4MQ9F 4AD9A 2MH9A 4OIRF 2M1BA 1L0OC 5L3EA 2M30A 2QUFA 5LEJA 3GFMA 3F21A 3LAJA 4RGRA 2OU2A 2HTJA 4ZYGA 1LB2A 3V7SA 2ZCWA 3IWFA 3N4MA 1YS7A 4E70A 4UUVA 5LBQA 1R22A 4WWCA 1QO0D 5JFRA 4GCVA 2PJPA 3H92A 2G9WA 3RI4A 2HYFA 2YX7A 5TJJA 3J81K 3IC7A 2RV8A 5LHIA 1TNTA 3NRVA 2Z33A 4HAMA 1G3YA 1XSXA 3HYIA 3J81Z 2PN6A 4HQMA 3T0YA 2HWVA 2COMA 3TOAA 1UHWA 5IT3A 1ZHFA 1R7JA 4G7HF 1ZRCA 1FOKA 5H6RA 4N0BA 1RUNA 4HDUA 1Z6RA 4WF2A 1D3YA 3QU3A 4HLYA 3CO6C 2QENA 4CZZA 4RGUA 1EH6A 5H20A 1TQPA 1DUXC 3M7GA 3ZMUA 3BP8A 2EJRA 2A5YB 1ZLJA 3I58A 2GXBA 4WK8F 2O03A 3U9GA 1H0MA 1U78A 1A04A 1IAWA 1K78A 3GYHX 4GO1A 4EGZA 2DO7A 3WU0A 1SMYF 1J2XA 4FHTA 3D5LA 2H6CA 3GVAA 1HKSA 4XLPF 2VODA 4KNYA 3KETA 1YW8A 2HKOA 1BOAA 1FBUA 1T39A 4QWQA 2ELHA 3ABTA 1R1UA 5L3BA 1O7FA 2JRTA 5DD4A 4AVPA 2QQBA 3E5QA 1QPMA 3EYIA 2MC3A 3VODA 1FYKA 1GHCA 2LNBA 3LSTA 3JTHA 1G6NA 4BYYA 3DP7A 4UVCA 1I5ZA 2STWA 3CUQC 2HOEA 3V8LA 2WWYA 5FLXZ 3JW4A 5FGMA 4IRIA 3TO7A 4KMFA 2DK8A 1O3RA 5ICCA 1JGSA 2RNJA 1JHFA 2KIUA 3PQJA 5ED4A 2V6CA 4MEYF 4Q4ZF 1BI1A 2ISYA 1C0WA 3EYYA 3E5UA 4PDKA 4N9HA 3MFKA 1USSA 3MCZA 3EQLF 2FA5A 2L4MA 3K1PA 3BJ6A 1EV7A 5D5UB 1BM9A 2GXGA 3ECOA 1U2WA 3SQNA 2PLYA 1KU2A 5AIQA 4YIIA 2EFNA 2ZJ2A 2M87A 4LK0F 3T8TA 2V1DA 2FF4A 5F6FA 1KQ9A 2KJCA 1L3LA 4U7BA 4U7DA 1HXDA 2DQRA 1OYYA 3KLOA 1W7PA 2L3DA 3FM3A 1REPC 2FRHA 3FMQA 1IN6A 4A2UA 3H3ZA 1MJAA 3V7RA 1UB9A 5DEQA 3BZ6A 1CF7B 1WQ2A 1FZPB 1TBXA 5HS7A 4RB3C 3VB2A 1KU3A 1SFEA 4EJOA 4UVBA 1HQCA 3R60A 4LFUA 1OMIA 1R1VA 1FSHA 2EFOA 4KUMA 2XAQA 4L5IA 4LD5A 1OPCA 4PZJA 1USTA 3NEUA 1E17A 2IA1A 1TQIA 2GIVA 1YG2A 2HTSA 2VN2A 1ZAOA 3F8NA 2E7WA 2OAZA 4AWXB 3ELKA 1B9MA 4LJZF 1F1ZA 4MHGA 4HYEA 1XD7A 3GO5A 2XRNA 2ESHA 4Q47A 1EH7A 4CO8A 3WGGA 2H09A 5A2QK 4ENJA 1FYMA 2H94A 3JSPA 5J8CA 4U0VA 3EETA 2P7CB 2FBIA 2M8EA 5HDKA 4L0ZB 3MEXA 1T98A 2K86A 1J0RA 3RPUA 3SFZA 3FF5A 3C18A 2RVCA 3QP5A 4UV8A 3LFKA 3F8MA 2YU3A 3M9AA 5D5XB 5F64A 4IRGA 3ZPLA 4IJAA 1FSEA 3ECHA 3ZMTA 5HDGA 1SAXA 2K4BA 2Q2EA 5D5WB 4KN4X 4KIFA 2EWNA 4HV5A 4BHBA 5F1RA 1CGPA 1XGOA 2E1CA 4BNCA 3E5XA 1ZH5A 4EJWA 5KVRA 5E1WA 4AIKA 1S8NA 1BJAA 3K9TA 1ZGAA 2VT2A 4LB6B 3ZMVA 2NS0A 1TQMA 3KEQA 1YLFA 1GXPA 5L3DA 3RJPA 4ETSA 2QQAA 4HQEA 2ZNYA 2O6GE 2VOPA 2QBYA 1I27A 4I0BA 3GFJA 1RZ4A 5FO5A 2XIGA 1Z6TA 4ZYEA 4R1HA 1ZARA 3FX3A 1JE8A 3EDPA 3PFIA 4LK1F 3PQKA 4NB5A 2O3FA 3HTSB 1PDNC 1J9IA 5CVIA 2BYVE 2P6SA 2CGPA 4PGGA 1DP7P 5BPIA 1XSVA 4IRHA 5CVRA 2VC0A 2CQKA 2YR2A 2VONA 1SMTA 3K0LA 4KT5C 3QU6A 3SHFA 4L9TA 3B73A 3RYPA 1JHHA 4Q5SF 2FNAA 4O5VA 5HVQC 1W7PB 1G3TA 3KP5A 2FU4A 3Q9VA 4HOBA 3KP7A 2ADUA 2QLZA 1PP7U 5D4SA 4ZZLA 1FT9A 4ZZDA 1W5SA 1K78B 3ULQB 3TQNA 3SZTA 1FLIA 4G94A 1XCBA 5IT9K 2HFHA 4L18B 4WX9A 3S2WA 1SFXA 1FX7A 3GUDA 4HLXA 3C7JA 1T38A 5ICGA 1TTYA 2IW5A 1ULYA 2A69F 1J59A 1ON1A 1D8KA 3TO6A 2DPDA 4DNCA 3WTWC 3RDIA 1KQ0A 1I1SA 1G3SA 1S7OA 1KYWA 4XSZF 3G73A 3E97A 3F8BA 2GWRA 1S29A 2CG4A 3K1MA 3WTXC 3HOSA 1LDJA 1LDDA 3FXQA 2DW4A 5TRDA 1HKTA 1Z91A 4IVNA 4L9VA 4LLGF 4PGHA 3DV8A 3MZHA 1E2XA 3NQOA 3IWZA 2VBZA 2ZMEA 3P9IA 2FMLA 2VOOA 5E1ZB 3LQRA 1O7LA 3P9KA 1XSDA 3MQ0A 1MGTA 3RIRA 4A6EA 4M74A 1V4RA 5JI6A 4KN7X 3RYRA 4M71A 3T1BA 4I0AA 2QYOA 2L02A 3T8RA 3DPTA 5E17F 4XBFA 5L3CA 5AIPA 4L5JA 5DYMA 1IF1A 3KCCA 3IHUA 1MJBA 1XGNA 1BBYA 4WXHA 5D6FA 4A0YA 1B4AA 4AIHA 2ESNA 4ESBA 4HX8A 1RNLA 3I4PA 1P4XA 5CVJA 3V4GA 4WXCA 1YFHA 3E6CC 1DPRA 3EUHA 3QRFF 5ILSA 5CYVA 4A6DA 1S7AA 2GA2A 5LHGA 4M73A 3HRSA 1X3UA 3KZZA 2WTEA 1XMAA 2VE8A 2E1NA 4F7ZA 2BBYA 1HBXG 3REOA 4OIPF 1U5TC 2K4JA 3CLOA 5BOXA 3BPXA 3FZVA 4P96A 4I7HA 1LQ1A 1WWXA 4FT8A 3T5XA 2RN7A 5FD6A 3L7WA 3BY6A 3ZP5A 4U88A 2F5DA 3QAHA 1HW2A 2VBXA 3QPHA 2V9VA 4WXDA 5EEGA 2CFXA 5DCFA 5HDNA 1TLHB 2FSWA 1Y0UA 3BROA 2P6TA 3FXRA 2KIMA 4DQ2A 5D5VB 3WTVC 2E7XA 4A0XA 1F5TA 4KFCA 3ZMSA 2A07F 4A5MA 2OD5A 4EQQA 4ESFA 5HS8A 4JBAA 1KGSA 1SD4A 4EM1A 1R1TA 2M5WA 4ENKA 2ZKZA 3K69A 4GYIA 5D8LB 3OV8A 4HW0A 4ZH4F 3COAC 2PMHA 1BIAA 2D1VA 2P5VA 4JK1X 1R5HA 3ROUA 3BJOA 2MA3A 4G9YA 3W6KB 2UWMA 2IRFG 4I01A 3V8KA 4Y15A 4HF0A 3CUQA 4N9IA 2NYXA 2L54A 2HQRA 1YW7A 2C6YA 2X4HA 2GAUA 1ZG5A 1KYZA 4U0YA 1BIBA 2FNPA 4G7OF 4L0YB 1ZYRF 4HBLA 5ICEA 4R79A 3FMSA 3O6BB 5HLIA 4I2OA 5KK1A 4IF4A 2BEOA 1Z7UA 3ZMDA 4IXAA 3KEOA 3GZ5A 2DU9A 2QM3A 1WI9A 3QPTA 4WCGA 2P8TA 5HLGA 1K6OA 4BHPA 3E6DA 1U8RA 1ZRDA 4HF1A 3RPQA 1B9NA 3VOEA 2IA0A 3HTUA 4ZYDA 3I71A 3E6MA 3HRUA 1ZLKA 2XKOA 2P7VB 1J75A 2YSRA 5BMZA 3ZMZA 1HW1A 1U5TA 4M6YA 4BHCA 2J5OA 4CGZA 3LAPA 1VTNC 5FD5A 1QBJA 1IXCA 4PCQA 3DFGA 4NQWA 4RB2C 4K2EA 2F5EA 4HDVA 3KZYA 2LKPA 3MZYA 2A3SA 2JTVA 3HRMA 2NAZA 1G3WA 2DAOA 5K5RA 2PG4A 4D0PA 2MD5A 3CUQB 3HSRA 2EK5A 3R6SA 2DPUA 2YPRA 4RAZA 1RUOA 2F5FA 2V1UA 3O3KA 2HZTA 2B0LA 3GF2A 1F4KA 4KYWA 2JPCA 4EM2A 2D45A 4KIBA 5LGTA 3ZN1A 4YFXF 4CYDA 4HV6A 2PI0A 4G7ZF 1QQIA 1XDSA 2L4AA 3I64A 5LGUA 2W25A 4UV9A 4EGYA 2STTA 2W57A 2P4WA 2EV5A 4HX4A 3GEZA 2XVCA 5FB2A 3C1DA 2PFBA 4RAYA 1XCVA 5D8KB 2ZXJA 4RGSA 3F22A 1YIOA 1MDMA 4UXNA 2EV6A 2EA4A 2CSOA 4Y17A 4JQFA 3RTRA 2XAJA 2RC4A 4Q48A 4CDGA 1B6AA 3GFLA 2DK5A 5L3GA 1S6LA 2Z9OA 1IN8A 3TO9A 2VXZA 1DPUA 4CICA 3VEPA 1U5TB 3L2CA 3BWGA 1KU9A 5DD8A 2VC1A 1IZ1A 4OINF 2IT0A 1OYIA 2VBYA 3WTYC 3M8FA 2KKOA 2K27A 2Z99A 3WE3A 3LQQA 1P4WA 1DDNA 1HSTA 1LJ9A 1H9GA 1UHMA 3SZPA 1ZRFA 2MLKA 4G6DA 1BI0A 4LB5A 4LLNA 3BDDA 4A0ZA 4LG0A 3WGHA 1QZZA 1R58A 1QGPA 2Z3YA 1BC7C 4HX7A 1FNNA 3HSEA 5J6XA 3CO7C 2XUBA 2O0YA 5FFXA 3F3XA 3C3WA 2RQPA 1CF7A 3R61A 2GA1A 5LEKA 1GVJA 1H9TA 4I98B 5EEHA 1FBSA 2IP2A 1W7PD 1NHAA 2OZ6A 1TW3A 4M9SA 2QZ8A 1I1GA 3RKWA 1WKMA 4BAYA 1U6GA 1IW7F 1ZG3A 3FWEA 2M45A 2BGCA 4A12A 3WU1B 1MD0A 4S05A 5L3FA 3P9CA 3J80Z 2HS5A 1FP1D 3DF8A 4O6JA 3I0TA 4I02A 4Y13A 1XGSA 2DT5A 1V3FA 2XAGA 3CDHA 3WTUC 3I54A 5FLXK 2FBKA 3HRTA 2MLGA 2H27A 2IVMA 1AWCA 2OA4A 3M1EA 2MBFA 2RGVA 1YQAA 3GFIA 2LDUA 1D8JA 3FMRA 3GXOA 4FX0A 2FOKA 2XROA 3VFZA 2JPBA 5CVUA 5E18F 2ZNZA 1XB4A 3OOPA 2A6EF 3MWMA 5CVVA 1WSUA 5JHUA 2BV6A 4G8XA 3J80K 1JXSA 4IHSA 1LDKB 4LLLA 2AXLA 4KIGA 3V7CA 3Q5FA 4KDPA 5ERIA 5ILUA 3RKXA 4CHUA 2UXNA 3H3UA 1F9NA 4UVAA 5A2QZ 2XV4S 5D4RA 2Y0MA 1ZGJA 4OU0A 1ONVA 2FXAA 4KICA 5D6EA 2A6HF 2CYYA 5H6QA 4TV7A 2TDXA 2EFQA 2W85A 1P6RA 2HEOA 2XAFA 3IL2A 2FEZA 4EM0B 1G4DA 1ZG1A 2K7LA 3HSFA 1KQ8A 1UFMA 4ON0A 1IN5A 3HUGA 4L9NA 5HS9A 1FC3A 2FQ3A 2HDCA 4O3MA 3TOBA 5K5QA 1QNTA 2MH2A 2PQ8A 2ACJA 1Q1HA 2ZO4A 2D2WA 5K5OA 5CLSA 2ZMEB 1O3SA 1FWZA 5LRRA 1Z9CA 4MQVA 5E8IA 4YFKF 1IN7A 3HHGA 3FXUA 1TNSA 3DPLC 3ISPA 1GXQA 2A68F 1FBQA 5E20A 4P55A 2ISZA 3JSOA 2WV0A 3B02A 4H0EA 1SD6A 4BQAA 3F8FA 2LF7A 4RB0A 2Y75A 2EV0A 4XSXF 2RDPA 4NHJA 2L01A 3F8CA 3KE2A 2X0LA 3JAMK 2XKPA 2VT3A 4XLNF 1LNWA 1OR7A 1YYVA 4U0WA 4P9UA 3WTSC 4L9JA 2RKHA 2XGXA 1J5YA 5BQTA 1B1BA 1P4AA 3CJNA 3D0SA 3HHHA 2YX4A 3WODF 2F2EA 3KP6A 3IKVA 4YIFA 2Y48A 3RKYA 4HZFA 3TKYA 5LHHA 3K2ZA 2R7DA 2J5PA 3E3VA 4BXUA 4B09A 3Q9SA 4HF2A 1RI7A 1EH8A 1Z1DA 3F72A 1SD5A 1KU7A 3L9FA 2DLLA 3KP2A 1J7KA 3I59B 2PBIA 3E6BA 3F6OA 3G3ZA 2LSOA 4GYGA 5DCMB 2DTRA 3JAMZ 5AONA 3WG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RIO H;  2HQN A;  2GQQ A;  4KA4 A;  3QP6 A;  3P7N A;  1HW5 A;  1BC8 C;  1MZB A;  4RS8 A;  3JTG A;  2O61 A;  1FYL A;  1O57 A;  2HYG D;  3IRR A;  3CUO A;  1S3J A;  2R3S A;  2K02 A;  2EB7 A;  4M9Z A;  1ZN2 A;  2JT1 A;  5LLQ A;  4LGW A;  2Q0O A;  2R7F A;  1OKR A;  4B8X A;  3LWF A;  4LMY A;  1YW9 A;  1R23 A;  1O3T A;  1I6X A;  1TW2 A;  2F5C A;  2CO5 A;  1YO5 C;  5HOO A;  2PMU A;  3BPV A;  2LF8 A;  1XN7 A;  3U2R A;  3I53 A;  3FM5 A;  1W4M A;  4MTD A;  4Z2Y A;  2GZW A;  2NNN A;  4IPA A;  4RB1 A;  3IKT A;  2XAH A;  3ZQ7 A;  5ICF A;  5BS6 A;  3K1N A;  2O8X A;  1FP2 A;  1QZY A;  5E1X A;  1P92 A;  4YG2 F;  3N97 A;  1FY7 A;  3O2P E;  1XMK A;  1BI2 A;  1MKM A;  2EFW A;  3BOQ A;  1R36 A;  4G6Q A;  4ESJ A;  2DFI A;  1OYW A;  4OMZ A;  3U1D A;  2FMY A;  2AS5 F;  5E8G A;  1ON2 A;  3GLX A;  4XRF A;  4OMY A;  3R4K A;  4P9F A;  1IN4 A;  3TDZ C;  1PUE E;  4HA8 A;  5ILV A;  3KP3 A;  5DUK A;  4CXF A;  2XHK A;  3DXJ F;  2OQR A;  3LA3 A;  2G7U A;  2WC2 A;  2OBP A;  3ERE D;  5LRS A;  1HSJ A;  1YTY A;  1STZ A;  4MNU A;  1IUY A;  2A61 A;  2D1H A;  2Q8K A;  2EA2 A;  3TDU C;  4P5O A;  2EFP A;  1SFU A;  1BI3 A;  5K1Y A;  2QVO A;  1MJ9 A;  5BPD A;  2BE5 F;  3HOT A;  1LEB A;  2QWW A;  2VE9 A;  1YS6 A;  4BH9 A;  2CWE A;  2UZK A;  1O3Q A;  3FHZ A;  3M8E A;  5DDG A;  4ENM A;  1B59 A;  3DEU A;  2KIF A;  2NNY A;  3MAJ A;  5HLH A;  3ZN0 A;  5JVT A;  4ASN A;  1BN5 A;  3AAF A;  4AIJ A;  2OQG A;  2HR3 A;  3LA2 A;  1W5T A;  3QOP A;  1IXS B;  4GGG A;  4RGX A;  3GX4 X;  4MEX F;  2V79 A;  1ZRE A;  3J7A O;  2ETH A;  3LA7 A;  2DQL A;  1XDU A;  1IRF A;  4KMU X;  3BJA A;  4I09 A;  4FX4 A;  4QLC U;  2PEX A;  2HGC A;  4M72 A;  2IJL A;  4EJV A;  3WTZ A;  4OIQ F;  2UXX A;  1HKQ A;  3TGN A;  3ML6 A;  1U3E M;  4EJT A;  2ZBK A;  2JZY A;  5DV5 A;  1MDM B;  4GXO A;  3WE2 A;  4R8H A;  1ODD A;  1LVA A;  2IPQ X;  3L09 A;  3GZ6 A;  4MGR A;  3CTA A;  1XGM A;  2JSC A;  2KJB A;  3HIF A;  4MTE A;  2ZFW A;  1P2F A;  2DBB A;  2P5L C;  5LGN A;  4UNO A;  3GW2 A;  2FE3 A;  3KP4 A;  2Z5U A;  2DI3 A;  2XAS A;  5IT9 Z;  2W24 A;  5FFZ A;  4M6X A;  3I59 A;  3R0A A;  6PAX A;  1IXR C;  2QQ9 A;  4OIO F;  3F23 A;  1KA8 A;  2OZU A;  2W84 A;  5DCM A;  3R0J A;  3W6J B;  4A5N A;  1T6S A;  5J8F A;  5DUI A;  2QBY B;  3WGI A;  1R00 A;  2V1X A;  4IHT A;  1D5V A;  4ENN A;  1IRG A;  1SD7 A;  2CW0 F;  3DKW A;  4OOI A;  1K79 A;  5JR3 A;  3GWZ A;  4ZYH A;  2KRF A;  4EJU A;  2H6B A;  4LG0 B;  4UHT A;  2NRA C;  2P5K A;  1PP8 F;  1UCR A;  4EVI A;  2G7H A;  3I5U A;  1K7A A;  2VBW A;  5CJ9 A;  3IRQ A;  1Z05 A;  1FPQ A;  3F6V A;  3L00 A;  1WRJ A;  1LEA A;  1T2K A;  2FBH A;  3ABU A;  3KFW X;  4EV0 A;  3DQV C;  2IA2 A;  3KLN A;  1AOY A;  4S04 A;  4YFN F;  1T0F A;  3WTT C;  2HKX A;  1R5G A;  4M9X A;  4EMS A;  3V8J A;  3SXY A;  4MQ9 F;  4AD9 A;  2MH9 A;  4OIR F;  2M1B A;  1L0O C;  5L3E A;  2M30 A;  2QUF A;  5LEJ A;  3GFM A;  3F21 A;  3LAJ A;  4RGR A;  2OU2 A;  2HTJ A;  4ZYG A;  1LB2 A;  3V7S A;  2ZCW A;  3IWF A;  3N4M A;  1YS7 A;  4E70 A;  4UUV A;  5LBQ A;  1R22 A;  4WWC A;  1QO0 D;  5JFR A;  4GCV A;  2PJP A;  3H92 A;  2G9W A;  3RI4 A;  2HYF A;  2YX7 A;  5TJJ A;  3J81 K;  3IC7 A;  2RV8 A;  5LHI A;  1TNT A;  3NRV A;  2Z33 A;  4HAM A;  1G3Y A;  1XSX A;  3HYI A;  3J81 Z;  2PN6 A;  4HQM A;  3T0Y A;  2HWV A;  2COM A;  3TOA A;  1UHW A;  5IT3 A;  1ZHF A;  1R7J A;  4G7H F;  1ZRC A;  1FOK A;  5H6R A;  4N0B A;  1RUN A;  4HDU A;  1Z6R A;  4WF2 A;  1D3Y A;  3QU3 A;  4HLY A;  3CO6 C;  2QEN A;  4CZZ A;  4RGU A;  1EH6 A;  5H20 A;  1TQP A;  1DUX C;  3M7G A;  3ZMU A;  3BP8 A;  2EJR A;  2A5Y B;  1ZLJ A;  3I58 A;  2GXB A;  4WK8 F;  2O03 A;  3U9G A;  1H0M A;  1U78 A;  1A04 A;  1IAW A;  1K78 A;  3GYH X;  4GO1 A;  4EGZ A;  2DO7 A;  3WU0 A;  1SMY F;  1J2X A;  4FHT A;  3D5L A;  2H6C A;  3GVA A;  1HKS A;  4XLP F;  2VOD A;  4KNY A;  3KET A;  1YW8 A;  2HKO A;  1BOA A;  1FBU A;  1T39 A;  4QWQ A;  2ELH A;  3ABT A;  1R1U A;  5L3B A;  1O7F A;  2JRT A;  5DD4 A;  4AVP A;  2QQB A;  3E5Q A;  1QPM A;  3EYI A;  2MC3 A;  3VOD A;  1FYK A;  1GHC A;  2LNB A;  3LST A;  3JTH A;  1G6N A;  4BYY A;  3DP7 A;  4UVC A;  1I5Z A;  2STW A;  3CUQ C;  2HOE A;  3V8L A;  2WWY A;  5FLX Z;  3JW4 A;  5FGM A;  4IRI A;  3TO7 A;  4KMF A;  2DK8 A;  1O3R A;  5ICC A;  1JGS A;  2RNJ A;  1JHF A;  2KIU A;  3PQJ A;  5ED4 A;  2V6C A;  4MEY F;  4Q4Z F;  1BI1 A;  2ISY A;  1C0W A;  3EYY A;  3E5U A;  4PDK A;  4N9H A;  3MFK A;  1USS A;  3MCZ A;  3EQL F;  2FA5 A;  2L4M A;  3K1P A;  3BJ6 A;  1EV7 A;  5D5U B;  1BM9 A;  2GXG A;  3ECO A;  1U2W A;  3SQN A;  2PLY A;  1KU2 A;  5AIQ A;  4YII A;  2EFN A;  2ZJ2 A;  2M87 A;  4LK0 F;  3T8T A;  2V1D A;  2FF4 A;  5F6F A;  1KQ9 A;  2KJC A;  1L3L A;  4U7B A;  4U7D A;  1HXD A;  2DQR A;  1OYY A;  3KLO A;  1W7P A;  2L3D A;  3FM3 A;  1REP C;  2FRH A;  3FMQ A;  1IN6 A;  4A2U A;  3H3Z A;  1MJA A;  3V7R A;  1UB9 A;  5DEQ A;  3BZ6 A;  1CF7 B;  1WQ2 A;  1FZP B;  1TBX A;  5HS7 A;  4RB3 C;  3VB2 A;  1KU3 A;  1SFE A;  4EJO A;  4UVB A;  1HQC A;  3R60 A;  4LFU A;  1OMI A;  1R1V A;  1FSH A;  2EFO A;  4KUM A;  2XAQ A;  4L5I A;  4LD5 A;  1OPC A;  4PZJ A;  1UST A;  3NEU A;  1E17 A;  2IA1 A;  1TQI A;  2GIV A;  1YG2 A;  2HTS A;  2VN2 A;  1ZAO A;  3F8N A;  2E7W A;  2OAZ A;  4AWX B;  3ELK A;  1B9M A;  4LJZ F;  1F1Z A;  4MHG A;  4HYE A;  1XD7 A;  3GO5 A;  2XRN A;  2ESH A;  4Q47 A;  1EH7 A;  4CO8 A;  3WGG A;  2H09 A;  5A2Q K;  4ENJ A;  1FYM A;  2H94 A;  3JSP A;  5J8C A;  4U0V A;  3EET A;  2P7C B;  2FBI A;  2M8E A;  5HDK A;  4L0Z B;  3MEX A;  1T98 A;  2K86 A;  1J0R A;  3RPU A;  3SFZ A;  3FF5 A;  3C18 A;  2RVC A;  3QP5 A;  4UV8 A;  3LFK A;  3F8M A;  2YU3 A;  3M9A A;  5D5X B;  5F64 A;  4IRG A;  3ZPL A;  4IJA A;  1FSE A;  3ECH A;  3ZMT A;  5HDG A;  1SAX A;  2K4B A;  2Q2E A;  5D5W B;  4KN4 X;  4KIF A;  2EWN A;  4HV5 A;  4BHB A;  5F1R A;  1CGP A;  1XGO A;  2E1C A;  4BNC A;  3E5X A;  1ZH5 A;  4EJW A;  5KVR A;  5E1W A;  4AIK A;  1S8N A;  1BJA A;  3K9T A;  1ZGA A;  2VT2 A;  4LB6 B;  3ZMV A;  2NS0 A;  1TQM A;  3KEQ A;  1YLF A;  1GXP A;  5L3D A;  3RJP A;  4ETS A;  2QQA A;  4HQE A;  2ZNY A;  2O6G E;  2VOP A;  2QBY A;  1I27 A;  4I0B A;  3GFJ A;  1RZ4 A;  5FO5 A;  2XIG A;  1Z6T A;  4ZYE A;  4R1H A;  1ZAR A;  3FX3 A;  1JE8 A;  3EDP A;  3PFI A;  4LK1 F;  3PQK A;  4NB5 A;  2O3F A;  3HTS B;  1PDN C;  1J9I A;  5CVI A;  2BYV E;  2P6S A;  2CGP A;  4PGG A;  1DP7 P;  5BPI A;  1XSV A;  4IRH A;  5CVR A;  2VC0 A;  2CQK A;  2YR2 A;  2VON A;  1SMT A;  3K0L A;  4KT5 C;  3QU6 A;  3SHF A;  4L9T A;  3B73 A;  3RYP A;  1JHH A;  4Q5S F;  2FNA A;  4O5V A;  5HVQ C;  1W7P B;  1G3T A;  3KP5 A;  2FU4 A;  3Q9V A;  4HOB A;  3KP7 A;  2ADU A;  2QLZ A;  1PP7 U;  5D4S A;  4ZZL A;  1FT9 A;  4ZZD A;  1W5S A;  1K78 B;  3ULQ B;  3TQN A;  3SZT A;  1FLI A;  4G94 A;  1XCB A;  5IT9 K;  2HFH A;  4L18 B;  4WX9 A;  3S2W A;  1SFX A;  1FX7 A;  3GUD A;  4HLX A;  3C7J A;  1T38 A;  5ICG A;  1TTY A;  2IW5 A;  1ULY A;  2A69 F;  1J59 A;  1ON1 A;  1D8K A;  3TO6 A;  2DPD A;  4DNC A;  3WTW C;  3RDI A;  1KQ0 A;  1I1S A;  1G3S A;  1S7O A;  1KYW A;  4XSZ F;  3G73 A;  3E97 A;  3F8B A;  2GWR A;  1S29 A;  2CG4 A;  3K1M A;  3WTX C;  3HOS A;  1LDJ A;  1LDD A;  3FXQ A;  2DW4 A;  5TRD A;  1HKT A;  1Z91 A;  4IVN A;  4L9V A;  4LLG F;  4PGH A;  3DV8 A;  3MZH A;  1E2X A;  3NQO A;  3IWZ A;  2VBZ A;  2ZME A;  3P9I A;  2FML A;  2VOO A;  5E1Z B;  3LQR A;  1O7L A;  3P9K A;  1XSD A;  3MQ0 A;  1MGT A;  3RIR A;  4A6E A;  4M74 A;  1V4R A;  5JI6 A;  4KN7 X;  3RYR A;  4M71 A;  3T1B A;  4I0A A;  2QYO A;  2L02 A;  3T8R A;  3DPT A;  5E17 F;  4XBF A;  5L3C A;  5AIP A;  4L5J A;  5DYM A;  1IF1 A;  3KCC A;  3IHU A;  1MJB A;  1XGN A;  1BBY A;  4WXH A;  5D6F A;  4A0Y A;  1B4A A;  4AIH A;  2ESN A;  4ESB A;  4HX8 A;  1RNL A;  3I4P A;  1P4X A;  5CVJ A;  3V4G A;  4WXC A;  1YFH A;  3E6C C;  1DPR A;  3EUH A;  3QRF F;  5ILS A;  5CYV A;  4A6D A;  1S7A A;  2GA2 A;  5LHG A;  4M73 A;  3HRS A;  1X3U A;  3KZZ A;  2WTE A;  1XMA A;  2VE8 A;  2E1N A;  4F7Z A;  2BBY A;  1HBX G;  3REO A;  4OIP F;  1U5T C;  2K4J A;  3CLO A;  5BOX A;  3BPX A;  3FZV A;  4P96 A;  4I7H A;  1LQ1 A;  1WWX A;  4FT8 A;  3T5X A;  2RN7 A;  5FD6 A;  3L7W A;  3BY6 A;  3ZP5 A;  4U88 A;  2F5D A;  3QAH A;  1HW2 A;  2VBX A;  3QPH A;  2V9V A;  4WXD A;  5EEG A;  2CFX A;  5DCF A;  5HDN A;  1TLH B;  2FSW A;  1Y0U A;  3BRO A;  2P6T A;  3FXR A;  2KIM A;  4DQ2 A;  5D5V B;  3WTV C;  2E7X A;  4A0X A;  1F5T A;  4KFC A;  3ZMS A;  2A07 F;  4A5M A;  2OD5 A;  4EQQ A;  4ESF A;  5HS8 A;  4JBA A;  1KGS A;  1SD4 A;  4EM1 A;  1R1T A;  2M5W A;  4ENK A;  2ZKZ A;  3K69 A;  4GYI A;  5D8L B;  3OV8 A;  4HW0 A;  4ZH4 F;  3COA C;  2PMH A;  1BIA A;  2D1V A;  2P5V A;  4JK1 X;  1R5H A;  3ROU A;  3BJO A;  2MA3 A;  4G9Y A;  3W6K B;  2UWM A;  2IRF G;  4I01 A;  3V8K A;  4Y15 A;  4HF0 A;  3CUQ A;  4N9I A;  2NYX A;  2L54 A;  2HQR A;  1YW7 A;  2C6Y A;  2X4H A;  2GAU A;  1ZG5 A;  1KYZ A;  4U0Y A;  1BIB A;  2FNP A;  4G7O F;  4L0Y B;  1ZYR F;  4HBL A;  5ICE A;  4R79 A;  3FMS A;  3O6B B;  5HLI A;  4I2O A;  5KK1 A;  4IF4 A;  2BEO A;  1Z7U A;  3ZMD A;  4IXA A;  3KEO A;  3GZ5 A;  2DU9 A;  2QM3 A;  1WI9 A;  3QPT A;  4WCG A;  2P8T A;  5HLG A;  1K6O A;  4BHP A;  3E6D A;  1U8R A;  1ZRD A;  4HF1 A;  3RPQ A;  1B9N A;  3VOE A;  2IA0 A;  3HTU A;  4ZYD A;  3I71 A;  3E6M A;  3HRU A;  1ZLK A;  2XKO A;  2P7V B;  1J75 A;  2YSR A;  5BMZ A;  3ZMZ A;  1HW1 A;  1U5T A;  4M6Y A;  4BHC A;  2J5O A;  4CGZ A;  3LAP A;  1VTN C;  5FD5 A;  1QBJ A;  1IXC A;  4PCQ A;  3DFG A;  4NQW A;  4RB2 C;  4K2E A;  2F5E A;  4HDV A;  3KZY A;  2LKP A;  3MZY A;  2A3S A;  2JTV A;  3HRM A;  2NAZ A;  1G3W A;  2DAO A;  5K5R A;  2PG4 A;  4D0P A;  2MD5 A;  3CUQ B;  3HSR A;  2EK5 A;  3R6S A;  2DPU A;  2YPR A;  4RAZ A;  1RUO A;  2F5F A;  2V1U A;  3O3K A;  2HZT A;  2B0L A;  3GF2 A;  1F4K A;  4KYW A;  2JPC A;  4EM2 A;  2D45 A;  4KIB A;  5LGT A;  3ZN1 A;  4YFX F;  4CYD A;  4HV6 A;  2PI0 A;  4G7Z F;  1QQI A;  1XDS A;  2L4A A;  3I64 A;  5LGU A;  2W25 A;  4UV9 A;  4EGY A;  2STT A;  2W57 A;  2P4W A;  2EV5 A;  4HX4 A;  3GEZ A;  2XVC A;  5FB2 A;  3C1D A;  2PFB A;  4RAY A;  1XCV A;  5D8K B;  2ZXJ A;  4RGS A;  3F22 A;  1YIO A;  1MDM A;  4UXN A;  2EV6 A;  2EA4 A;  2CSO A;  4Y17 A;  4JQF A;  3RTR A;  2XAJ A;  2RC4 A;  4Q48 A;  4CDG A;  1B6A A;  3GFL A;  2DK5 A;  5L3G A;  1S6L A;  2Z9O A;  1IN8 A;  3TO9 A;  2VXZ A;  1DPU A;  4CIC A;  3VEP A;  1U5T B;  3L2C A;  3BWG A;  1KU9 A;  5DD8 A;  2VC1 A;  1IZ1 A;  4OIN F;  2IT0 A;  1OYI A;  2VBY A;  3WTY C;  3M8F A;  2KKO A;  2K27 A;  2Z99 A;  3WE3 A;  3LQQ A;  1P4W A;  1DDN A;  1HST A;  1LJ9 A;  1H9G A;  1UHM A;  3SZP A;  1ZRF A;  2MLK A;  4G6D A;  1BI0 A;  4LB5 A;  4LLN A;  3BDD A;  4A0Z A;  4LG0 A;  3WGH A;  1QZZ A;  1R58 A;  1QGP A;  2Z3Y A;  1BC7 C;  4HX7 A;  1FNN A;  3HSE A;  5J6X A;  3CO7 C;  2XUB A;  2O0Y A;  5FFX A;  3F3X A;  3C3W A;  2RQP A;  1CF7 A;  3R61 A;  2GA1 A;  5LEK A;  1GVJ A;  1H9T A;  4I98 B;  5EEH A;  1FBS A;  2IP2 A;  1W7P D;  1NHA A;  2OZ6 A;  1TW3 A;  4M9S A;  2QZ8 A;  1I1G A;  3RKW A;  1WKM A;  4BAY A;  1U6G A;  1IW7 F;  1ZG3 A;  3FWE A;  2M45 A;  2BGC A;  4A12 A;  3WU1 B;  1MD0 A;  4S05 A;  5L3F A;  3P9C A;  3J80 Z;  2HS5 A;  1FP1 D;  3DF8 A;  4O6J A;  3I0T A;  4I02 A;  4Y13 A;  1XGS A;  2DT5 A;  1V3F A;  2XAG A;  3CDH A;  3WTU C;  3I54 A;  5FLX K;  2FBK A;  3HRT A;  2MLG A;  2H27 A;  2IVM A;  1AWC A;  2OA4 A;  3M1E A;  2MBF A;  2RGV A;  1YQA A;  3GFI A;  2LDU A;  1D8J A;  3FMR A;  3GXO A;  4FX0 A;  2FOK A;  2XRO A;  3VFZ A;  2JPB A;  5CVU A;  5E18 F;  2ZNZ A;  1XB4 A;  3OOP A;  2A6E F;  3MWM A;  5CVV A;  1WSU A;  5JHU A;  2BV6 A;  4G8X A;  3J80 K;  1JXS A;  4IHS A;  1LDK B;  4LLL A;  2AXL A;  4KIG A;  3V7C A;  3Q5F A;  4KDP A;  5ERI A;  5ILU A;  3RKX A;  4CHU A;  2UXN A;  3H3U A;  1F9N A;  4UVA A;  5A2Q Z;  2XV4 S;  5D4R A;  2Y0M A;  1ZGJ A;  4OU0 A;  1ONV A;  2FXA A;  4KIC A;  5D6E A;  2A6H F;  2CYY A;  5H6Q A;  4TV7 A;  2TDX A;  2EFQ A;  2W85 A;  1P6R A;  2HEO A;  2XAF A;  3IL2 A;  2FEZ A;  4EM0 B;  1G4D A;  1ZG1 A;  2K7L A;  3HSF A;  1KQ8 A;  1UFM A;  4ON0 A;  1IN5 A;  3HUG A;  4L9N A;  5HS9 A;  1FC3 A;  2FQ3 A;  2HDC A;  4O3M A;  3TOB A;  5K5Q A;  1QNT A;  2MH2 A;  2PQ8 A;  2ACJ A;  1Q1H A;  2ZO4 A;  2D2W A;  5K5O A;  5CLS A;  2ZME B;  1O3S A;  1FWZ A;  5LRR A;  1Z9C A;  4MQV A;  5E8I A;  4YFK F;  1IN7 A;  3HHG A;  3FXU A;  1TNS A;  3DPL C;  3ISP A;  1GXQ A;  2A68 F;  1FBQ A;  5E20 A;  4P55 A;  2ISZ A;  3JSO A;  2WV0 A;  3B02 A;  4H0E A;  1SD6 A;  4BQA A;  3F8F A;  2LF7 A;  4RB0 A;  2Y75 A;  2EV0 A;  4XSX F;  2RDP A;  4NHJ A;  2L01 A;  3F8C A;  3KE2 A;  2X0L A;  3JAM K;  2XKP A;  2VT3 A;  4XLN F;  1LNW A;  1OR7 A;  1YYV A;  4U0W A;  4P9U A;  3WTS C;  4L9J A;  2RKH A;  2XGX A;  1J5Y A;  5BQT A;  1B1B A;  1P4A A;  3CJN A;  3D0S A;  3HHH A;  2YX4 A;  3WOD F;  2F2E A;  3KP6 A;  3IKV A;  4YIF A;  2Y48 A;  3RKY A;  4HZF A;  3TKY A;  5LHH A;  3K2Z A;  2R7D A;  2J5P A;  3E3V A;  4BXU A;  4B09 A;  3Q9S A;  4HF2 A;  1RI7 A;  1EH8 A;  1Z1D A;  3F72 A;  1SD5 A;  1KU7 A;  3L9F A;  2DLL A;  3KP2 A;  1J7K A;  3I59 B;  2PBI A;  3E6B A;  3F6O A;  3G3Z A;  2LSO A;  4GYG A;  5DCM B;  2DTR A;  3JAM Z;  5AON A;  3WG9 A; 
#chains in the Genus database with same CATH topology
 2EZH A;  1RIO H;  1DP3 A;  2HQN A;  2GQQ A;  1HA8 A;  3RCO A;  4KA4 A;  3QP6 A;  3TMO A;  3P7N A;  1B72 A;  1HW5 A;  1BC8 C;  1MZB A;  3DTK A;  1YE9 A;  4RS8 A;  1VFC A;  2VL8 A;  3GTJ J;  1I50 J;  1Y56 A;  3JTG A;  2KT0 A;  5B1A H;  3C2B A;  2O61 A;  1FYL A;  1O57 A;  2HYG D;  2W7N A;  1TT5 B;  3IRR A;  2E1O A;  1YRN B;  1GDT A;  2GBY A;  3CUO A;  1S3J A;  2R3S A;  2L9R A;  5B1B H;  2K02 A;  1LFP A;  1MMN A;  2EB7 A;  3RZO J;  4M9Z A;  1ZN2 A;  4A3E J;  2JT1 A;  5LLQ A;  1WJA A;  3AG1 H;  4LGW A;  2Q0O A;  2R7F A;  1OKR A;  3LSH A;  3LWF A;  4B8X A;  4LMY A;  1YW9 A;  1R23 A;  3CMY A;  1O3T A;  2R7U A;  1I6X A;  2PJR A;  1TW2 A;  2R7O A;  2FUG 2;  2F5C A;  2ICW G;  2HPI A;  4JX5 A;  2CO5 A;  4XOT A;  1YO5 C;  5HOO A;  2PMU A;  3BPV A;  2LF8 A;  1BW6 A;  1XN7 A;  3I53 A;  3U2R A;  4JYK A;  2DJI A;  1FEX A;  3FM5 A;  1W4M A;  4MTD A;  4Z2Y A;  2IXS A;  3ZQI A;  2GZW A;  4UUS B;  3H0D A;  2NNN A;  4W1U A;  2NOJ B;  2NS8 A;  1V5E A;  2Y69 H;  2ME0 A;  4E7I A;  4IPA A;  4RB1 A;  2WV1 A;  3IKT A;  1BR2 A;  1SAN A;  1UJ8 A;  2OV7 A;  2G0E A;  2X1E A;  2XAH A;  5ICF A;  3ZQ7 A;  5BS6 A;  3W3C A;  3K1N A;  3MD2 A;  4XOP A;  2O8X A;  1X3W B;  1VQO I;  1FP2 A;  2F4O B;  3LSI A;  1QZY A;  3IUO A;  5E1X A;  1OFC X;  1P92 A;  4YG2 F;  3N97 A;  4XLF A;  1K61 A;  1FY7 A;  3O2P E;  1XMK A;  5K7F A;  1BI2 A;  1MKM A;  2KMU A;  4F52 A;  3BOQ A;  2EFW A;  1R36 A;  3PJR A;  2GOX B;  4G6Q A;  4CYC A;  4ESJ A;  2DFI A;  1OYW A;  4OMZ A;  3U1D A;  2FMY A;  3K4L A;  5J1R A;  4YEJ A;  2AS5 F;  5E8G A;  1O4X A;  3DU6 A;  3GLX A;  1ON2 A;  4XRF A;  2LKX A;  4OMY A;  3DCF A;  1OJL A;  3R4K A;  4P9F A;  1WCM J;  1IN4 A;  1B8I A;  3CJR B;  1Z0X A;  3TDZ C;  1PUE E;  4HA8 A;  5ILV A;  3KP3 A;  5DUK A;  2QF7 A;  4CXF A;  2XHK A;  3K4J A;  3DXJ F;  1X1D A;  2JA6 J;  2VJ4 A;  5E3M A;  2CJJ A;  2OQR A;  3LA3 A;  1WJE A;  2VXD A;  2FOW A;  2G7U A;  2DMQ A;  4NC6 A;  2WC2 A;  2OBP A;  2X85 A;  2EH3 A;  3ERE D;  4B4C A;  5LRS A;  2K85 A;  3GCM A;  5JLW A;  1D1B A;  1HSJ A;  1YTY A;  4Z6Y A;  4UUT A;  1STZ A;  4MNU A;  3HM5 A;  1IUY A;  2A61 A;  2EIL H;  4M3D A;  2D1H A;  2Q8K A;  2EA2 A;  2ECB A;  3ZCO A;  3TDU C;  1OCZ H;  4P5O A;  2EFP A;  4CCL A;  5F0H A;  1SFU A;  3F0C A;  1BI3 A;  1A35 A;  3JRB A;  4IOC F;  5F1J A;  5K1Y A;  2QVO A;  3OY9 A;  1MJ9 A;  5BPD A;  4E7Z A;  2BE5 F;  3HOT A;  2TCT A;  3PIO F;  1LEB A;  3RPU D;  2QWW A;  3OYM A;  2VE9 A;  1OCO H;  2Y31 A;  4DBR A;  4J00 A;  1YS6 A;  4BH9 A;  3PNV A;  2CWE A;  2UZK A;  1O3Q A;  3FHZ A;  3M8E A;  1QVT A;  5DDG A;  1FIA A;  3ABL H;  3FXJ A;  4ENM A;  1MMD A;  1B59 A;  1VI0 A;  2KIF A;  3DEU A;  2NNY A;  2L7F P;  3S32 A;  3MAJ A;  5HLH A;  3ZN0 A;  4V2G A;  5JVT A;  1YJW I;  3LSM A;  4ASN A;  4IOA F;  1BN5 A;  1K6Y A;  3AAF A;  4AIJ A;  3TW7 A;  1BL0 A;  3CC7 I;  2OQG A;  1QZE A;  2E2J J;  2HR3 A;  2GLO A;  3LSK A;  3NAR A;  3LA2 A;  1U8B A;  2OTJ I;  4XRS A;  4XKV A;  1K4T A;  1W5T A;  3FKJ A;  1IXS B;  3QOP A;  2RRE A;  2DTZ A;  2IBD A;  2L5Q A;  4F55 A;  4GGG A;  4RGX A;  3GX4 X;  5GP9 A;  3FBI B;  3K4M A;  4MEX F;  2HXI A;  2V79 A;  2LRE A;  5M5Y J;  1ZRE A;  3J7A O;  2ETH A;  3LA7 A;  3OYF A;  2DQL A;  2QSH X;  1XDU A;  3KIO A;  4C2U A;  1V55 H;  1IRF A;  4A3B J;  3TBI A;  4KMU X;  3CCQ I;  3BJA A;  4EEF G;  4I09 A;  2VLA A;  4FX4 A;  4QLC U;  2PEX A;  2HGC A;  4M72 A;  2IJL A;  3MZ8 A;  4EJV A;  3WTZ A;  4OIQ F;  1Z7L A;  2UXX A;  3QYE A;  1VQ4 I;  3BR1 A;  1HKQ A;  3TGN A;  3ML6 A;  3ESW B;  3GTL J;  1TL8 A;  1U3E M;  4EJT A;  2ZBK A;  4A3K J;  2DCE A;  4IO9 F;  3K10 A;  2JZY A;  2M7B A;  5DV5 A;  1MDM B;  2NS7 A;  3BTI A;  3G4S I;  4GXO A;  5FKO A;  3WE2 A;  4R8H A;  1ODD A;  1LVA A;  2IPQ X;  5M5X J;  3L09 A;  3GZ6 A;  1SFK A;  5C44 J;  4A3M J;  4MGR A;  1OCR H;  4C30 A;  2XSD C;  4KJZ A;  3ZQC A;  3M07 A;  3CTA A;  1XGM A;  2JSC A;  2KJB A;  2K3F A;  4KIS A;  3HIF A;  4MTE A;  2ZFW A;  1P2F A;  1RET A;  2DBB A;  2KPM A;  3BQY A;  5EYR A;  2P5L C;  2HPM A;  5LGN A;  4UNO A;  1E3H A;  2FE3 A;  3GW2 A;  3KP4 A;  3NAU A;  2Z5U A;  3CCR I;  2DI3 A;  2XAS A;  1YX3 A;  5IT9 Z;  2W24 A;  5FFZ A;  4II2 A;  2DA4 A;  3I3L A;  4M6X A;  4E7S A;  3I59 A;  4E7J A;  3R0A A;  6PAX A;  1IXR C;  2QQ9 A;  4OIO F;  2XGD A;  3PL8 A;  1RRJ A;  1TP4 A;  2BVM A;  4BY7 J;  3F23 A;  1KA8 A;  2OZU A;  4LOC A;  3BG6 A;  2W84 A;  5DCM A;  3R0J A;  3H5A A;  4ABZ A;  1WJB A;  2XGC A;  4BKX A;  1TWF J;  3OYH A;  3W6J B;  3BG5 A;  2WBM A;  4A5N A;  1T6S A;  5J8F A;  5DUI A;  2QBY B;  3WGI A;  1R00 A;  4A69 C;  2V1X A;  2E36 A;  4IHT A;  1UMQ A;  4L5E A;  1D5V A;  4BEH B;  2VQG A;  5HNF A;  1Y0N A;  4ENN A;  2MD0 A;  1IRG A;  1SD7 A;  4MFD A;  2CW0 F;  1YI2 I;  4IKF A;  3DKW A;  4OOI A;  2V26 A;  1K79 A;  2R7W A;  4FCY A;  2FQ4 A;  2YUS A;  9ANT A;  5JR3 A;  1TWA J;  4N4O B;  4C3J J;  3GWZ A;  4ZYH A;  2KRF A;  4EJU A;  2H6B A;  2ME6 A;  4LG0 B;  4V2F A;  4UHT A;  2COB A;  1FOX A;  1KZH A;  2NRA C;  4YEL A;  2P5K A;  1PP8 F;  1ETX A;  3OYC A;  1LUJ B;  1UCR A;  4EVI A;  1D5Y A;  2XPW A;  1T08 B;  4FTH A;  3HOZ J;  2G7H A;  3BR0 A;  4ZTJ A;  2QSF X;  3I5U A;  4M3E A;  1K7A A;  2LRD A;  3Q0V A;  3EUA A;  1T0F C;  3HJE A;  2VBW A;  2VQC A;  5CJ9 A;  1WGX A;  3Q3S A;  4BL0 B;  1DGW Y;  3IRQ A;  4BQO A;  3L2U A;  2IGN A;  2KFD A;  1Z05 A;  5JVG F;  1FPQ A;  3F6V A;  3L00 A;  3VYT B;  1WRJ A;  1LEA A;  2M0C A;  4QIW N;  2FBH A;  2XC7 A;  1T2K A;  3ABU A;  3CP8 A;  3KFW X;  1WZ2 A;  4EV0 A;  3DQV C;  3OIQ A;  2W00 A;  4C2M J;  2BY2 A;  2IA2 A;  3KLN A;  1AOY A;  2NVU B;  4S04 A;  2K3P A;  2I5U A;  4I99 C;  4YFN F;  1T0F A;  5FLM J;  4ZC3 A;  3WTT C;  2HKX A;  2WAF A;  1VQ5 I;  1IV6 A;  1PUF B;  2DA3 A;  1AHD P;  3BCB A;  2K9N A;  3G2B A;  1MH3 A;  1R5G A;  3H35 A;  3CCE I;  2EIM H;  4BQN A;  2LR8 A;  2JUC A;  2NVX J;  4AYB A;  2D5V A;  1V54 H;  4A3G J;  1PJR A;  2R7X A;  4M9X A;  4EMS A;  3V8J A;  2HDD A;  3SXY A;  4E4H A;  4MQ9 F;  3S1Q J;  2BXY A;  4AD9 A;  2MH9 A;  1MMA A;  2JMW A;  4OIR F;  2LK2 A;  2JA2 A;  3HL2 A;  2M1B A;  1L0O C;  5L3E A;  1X1A A;  5IPA A;  2FJ1 A;  2M30 A;  3G1O A;  4PJM A;  1HDD C;  2DFF A;  2QUF A;  4I76 A;  3S3M A;  5LEJ A;  3PSF A;  3K70 D;  1N75 A;  1M1E B;  2ID3 A;  3RSN A;  3GFM A;  5IP6 A;  2V9P A;  1MBJ A;  1BR1 A;  3W2W A;  3F21 A;  1UZC A;  2JUG A;  5IOZ A;  3ZQF A;  3VSL A;  3LAJ A;  1FTT A;  2DDA A;  4RGR A;  1YJ9 I;  1NK3 P;  2OU2 A;  1G59 A;  2HTJ A;  4ZYG A;  1LB2 A;  1APL C;  3V7S A;  1Y8Q B;  3CP2 A;  2ZCW A;  4XKB A;  2LC2 A;  3IWF A;  1AKH B;  2X6W A;  3N4M A;  3CCU I;  1YS7 A;  4E70 A;  4UUV A;  5CPR B;  1A6Q A;  2E1M C;  3G1L A;  1ENH A;  3TP0 A;  5LBQ A;  1R22 A;  4WWC A;  1QO0 D;  5JFR A;  4GCV A;  3OYG A;  2PJP A;  2IS4 A;  3H92 A;  3BG7 A;  2G9W A;  2JN6 A;  2HZD A;  4C9Y A;  3RI4 A;  3A01 B;  5JHF A;  2HYF A;  4CCJ A;  2YX7 A;  5TJJ A;  1I39 A;  3J81 K;  3IC7 A;  5B5E C;  1OR7 C;  1P9Q C;  3ASN H;  4KT6 A;  4QPQ A;  2RV8 A;  5LHI A;  1TNT A;  5F27 A;  1SEU A;  3NRV A;  2Z33 A;  2KRC A;  4HAM A;  4AUX A;  3VSK A;  5H2F C;  1G3Y A;  2IS6 A;  1XSX A;  2XPU A;  3LOC A;  2KZG A;  3HYI A;  3J81 Z;  1OIS A;  1MW7 A;  2LY9 A;  2PN6 A;  4HQM A;  3T0Y A;  5GPA A;  2HWV A;  2COM A;  3CZ6 A;  3TED A;  3TOA A;  4XQF A;  1UHW A;  5IT3 A;  1HCR A;  1ZHF A;  1R7J A;  2VIX A;  1P7I A;  4G7H F;  1ZRC A;  1FOK A;  5H6R A;  3OL4 A;  3FBN B;  2NVQ J;  4N0B A;  3FXL A;  5KAI C;  3OYI A;  3AKZ A;  1RUN A;  4HRI A;  4HDU A;  4ZJZ A;  3UNG C;  2KHM A;  4CCO A;  5FJ8 J;  1Z6R A;  3D5R C;  2QSG X;  4XLE A;  5J40 A;  3S1M J;  4WF2 A;  1H8A C;  3OYA A;  4G6T B;  1D3Y A;  4C3H J;  3QU3 A;  4HLY A;  3CO6 C;  2QEN A;  1JKR C;  2V1N A;  1X19 A;  4AYB N;  4RGU A;  4CZZ A;  5EG0 A;  4JP0 A;  2W1O A;  1EH6 A;  3FKI J;  5H20 A;  1TQP A;  5CQE A;  1OLT A;  1DUX C;  3OYK A;  3M7G A;  3G6E I;  1I3A A;  3O8H A;  1MMS A;  3ZMU A;  3S2H J;  3BP8 A;  5J4V A;  2EJR A;  5IP9 J;  2A5Y B;  2LG4 A;  4NDL A;  4UY8 I;  2LBF B;  2X51 A;  1A5J A;  1ZLJ A;  3I58 A;  2GXB A;  1Y39 A;  4WK8 F;  2DFE A;  3HB9 A;  2O03 A;  4ZTF A;  2E71 A;  2EZL A;  2BHY A;  3U9G A;  3LFU A;  2E34 A;  2CMP A;  1XS9 A;  5M5W J;  1H0M A;  1U78 A;  1S5L C;  3RKQ A;  3KEY A;  1RKT A;  5FKL A;  1A04 A;  1IAW A;  1K78 A;  3GYH X;  4GO1 A;  2DYR H;  4EGZ A;  5C3E J;  2DO7 A;  3WU0 A;  1SMY F;  1J2X A;  3HC7 A;  3ONQ A;  4FHT A;  3SDB A;  2HI3 A;  2DJN A;  3D5L A;  2CQQ A;  2H6C A;  2Y0S A;  3GVA A;  1BOB A;  1HKS A;  4XLP F;  2VOD A;  1A36 A;  2VJJ A;  2JK3 A;  4I6Z A;  3GTP J;  5F0C A;  4KNY A;  1ETV A;  3KET A;  4BDY A;  1YW8 A;  2HKO A;  1BOA A;  2W48 A;  1FBU A;  1T39 A;  1D0Z A;  3D1N I;  4QWQ A;  2ELH A;  3ABT A;  1R1U A;  5L3B A;  2BY1 A;  1WJC A;  1O7F A;  2JRT A;  5DD4 A;  2ZSI B;  4AVP A;  2QQB A;  4DW6 A;  3E5Q A;  2HQA A;  2BY0 A;  2R5Y A;  1QPM A;  5GAE J;  3EYI A;  2XAU A;  3S17 J;  2MC3 A;  3ZQL A;  3VOD A;  1FYK A;  3K2A A;  4RLF A;  5JLX A;  1GHC A;  2LNB A;  3LST A;  3JTH A;  1IC8 A;  1G6N A;  4PFO A;  5J4Y A;  4BYY A;  2Y0S N;  2Y30 A;  4A3C J;  3DP7 A;  4HNT A;  4UVC A;  1I5Z A;  2STW A;  4J01 A;  3CUQ C;  2HOE A;  3V8L A;  3I9V 2;  2WWY A;  2R7T A;  5FLX Z;  2O8K A;  3SEZ A;  4M3G A;  2WAD A;  2F5V A;  1ETK A;  1VQN I;  2BVL A;  3JW4 A;  2VJI A;  5FGM A;  3TO7 A;  4IRI A;  3Q0U A;  2WAE A;  4KMF A;  4RA2 A;  2DK8 A;  1O3R A;  5BNG A;  5ICC A;  1TWG J;  1UG0 A;  1ERD A;  1JGS A;  4BUP A;  4A3D J;  4BY1 J;  1FJL A;  2RNJ A;  4EAT A;  2CW8 A;  1JHF A;  2KIU A;  3EUK L;  3PQJ A;  2LP0 A;  2OC6 A;  5ED4 A;  2V6C A;  5EGO A;  4MEY F;  3K4N A;  1Q1V A;  3IH4 A;  2ECC A;  1H89 C;  1LPQ A;  4Q4Z F;  1BI1 A;  2ISY A;  3ABK H;  1C0W A;  4D7N A;  1K4S A;  3EYY A;  3E5U A;  3GME A;  3ZQH A;  4PDK A;  3BTC A;  4N9H A;  2DOF A;  2CV2 A;  2K9S A;  3CQZ J;  3S1N J;  3MFK A;  5J47 A;  4YIR X;  3O8G A;  3OOU A;  2A05 A;  1USS A;  3MCZ A;  3EQL F;  1POG A;  2FA5 A;  2L4M A;  3K1P A;  3BJ6 A;  1JT0 A;  1ZR4 A;  1EV7 A;  5KHD A;  5D5U B;  1BM9 A;  1FMV A;  1X1C A;  2GXG A;  3GTQ J;  3ECO A;  1U2W A;  3SQN A;  3PSI A;  3K4K A;  3E0J B;  3VYR B;  2PLY A;  3CDL A;  2OF7 A;  3RQI A;  2E60 A;  1LKX A;  5DTD A;  3ZXS A;  1KU2 A;  5AIQ A;  4YII A;  2EFN A;  2ZJ2 A;  4UB6 C;  2M87 A;  4LK0 F;  2EZK A;  3T8T A;  4A3I J;  3H5R A;  4XID A;  2V1D A;  1PVE A;  1IJW C;  1JKQ C;  1HLV A;  2FF4 A;  1Y1W J;  1IV8 A;  1YIT I;  1VQ6 I;  5F6F A;  1KQ9 A;  3HEF A;  2KJC A;  4XR6 A;  1L3L A;  1TWH J;  4F91 B;  4Y33 A;  3HOX J;  1WI3 A;  4PFP A;  1UAA A;  1JUM A;  2FX0 A;  3QQA A;  4FE4 A;  4CA0 A;  1I3Q J;  1R71 A;  2QGU A;  4LIU A;  4U7B A;  2R5Y B;  2BW3 B;  4U7D A;  1Y1V J;  1HXD A;  3I55 I;  2DQR A;  1TZL A;  1OYY A;  3JRG A;  3BR6 A;  3KLO A;  1W7P A;  2L3D A;  2GIZ A;  2PMZ N;  3H9J A;  2E2I J;  3FM3 A;  3KYL A;  1REP C;  2V7F A;  3DBH B;  2FRH A;  4E7H A;  1F43 A;  3FMQ A;  1IN6 A;  1IDZ A;  1UG2 A;  4A2U A;  4XKC A;  3H3Z A;  1MJA A;  1XC5 A;  4E7K A;  3V7R A;  1UB9 A;  5DEQ A;  3BZ6 A;  3UKG A;  3JRH A;  1CF7 B;  2WA0 A;  4B44 A;  3K4B A;  1ZKG A;  3LSG A;  4JX6 A;  2PJR B;  2M4K A;  3CC4 I;  1WQ2 A;  1FZP B;  1A6I A;  1UEL B;  4XL9 A;  1X1P A;  3DKY A;  2QCO A;  1TBX A;  1T95 A;  5HS7 A;  3J7Y J;  4CYC B;  4RB3 C;  5EEA A;  3VB2 A;  1KU3 A;  1SFE A;  1DU0 A;  2L9N A;  2R4G A;  4EJO A;  2DA2 A;  4UVB A;  1HQC A;  1FOW A;  3R60 A;  3ZR8 X;  2FD5 A;  4LFU A;  5IP7 J;  1FOY A;  1OMI A;  1MND A;  1R1V A;  1FSH A;  2EFO A;  1XMX A;  4KUM A;  2XAQ A;  4L5I A;  4A3L J;  2L0K A;  1LE8 A;  4AVZ A;  3WHB A;  2DMN A;  5FRM A;  4LD5 A;  1OPC A;  2KP6 A;  2WAQ N;  4HEA 2;  3S93 A;  1Z77 A;  2B7E A;  4PZJ A;  2IS1 A;  2OPT A;  1UST A;  2AO9 A;  3CD6 I;  3H1C A;  5LFA A;  1SC7 A;  3NEU A;  2VKD A;  1E17 A;  2DA1 A;  2IA1 A;  1TQI A;  2GIV A;  3H3V K;  2MFZ A;  1YG2 A;  2HTS A;  2VI6 A;  2VN2 A;  3B6A A;  3H9G A;  5LD2 C;  2P0W A;  1ZAO A;  3F8N A;  3L1P A;  2E7W A;  1WH7 A;  2OAZ A;  3M8J A;  4BE1 A;  1D0Y A;  3HXL A;  3C2H A;  3ELK A;  4AWX B;  1B8I B;  1B9M A;  4LJZ F;  1YIJ I;  2L7M P;  1F1Z A;  4IEJ A;  5F08 A;  4MHG A;  2MG4 A;  2ZME C;  3MMY B;  4BBS J;  4HYE A;  1X4P A;  4NNJ A;  4QSH A;  2F4I A;  1XD7 A;  3GO5 A;  1R4M B;  1DQU A;  1XTA A;  2XRN A;  2ESH A;  4RDU A;  2E5Z A;  4Q47 A;  2BW3 A;  1EH7 A;  4CO8 A;  3AG3 H;  3WGG A;  2K9Q A;  2PMZ A;  1JUP A;  2H09 A;  2DA6 A;  1SVO A;  3OS2 A;  1WPK A;  1WHU A;  2MGQ A;  5A2Q K;  3CCM I;  4ENJ A;  2M9H A;  1FYM A;  2Y9Y A;  3S16 J;  2XF7 A;  2H94 A;  3BR2 A;  5EF6 A;  2B9S A;  4ZDP A;  5CKT A;  3JSP A;  5J8C A;  4U0V A;  2AXT C;  3EET A;  2P7C B;  2FBI A;  2M8E A;  5HDK A;  5FRO A;  4L0Z B;  3MEX A;  4X0G A;  1T98 A;  2K86 A;  1J0R A;  4HG2 A;  3RPU A;  3SFZ A;  3HOW J;  3FF5 A;  3C18 A;  4XK4 A;  2Z16 A;  4A3J J;  3BG3 A;  4HPQ A;  2RVC A;  3IAM 2;  2R7S A;  2DN0 A;  4P1W A;  1FMW A;  4Y52 J;  4DZJ A;  2E19 A;  3QP5 A;  4UV8 A;  3LFK A;  1T56 A;  3F8M A;  2ID6 A;  2YU3 A;  3M9A A;  3ZQG A;  4NBQ A;  5D5X B;  5F64 A;  4IRG A;  1BW5 A;  3ZPL A;  3QWL A;  4IJA A;  2HOA A;  1VQ9 I;  1EJ9 A;  1FSE A;  2CUJ A;  1LVK A;  3ECH A;  3ZMT A;  4PJN A;  4Y4R A;  2KDZ A;  4A93 J;  5HDG A;  1SAX A;  2K4B A;  2Q2E A;  5D5W B;  4KN4 X;  3W2V A;  4KIF A;  2EWN A;  1E0E A;  3BLY A;  4HV5 A;  2LH9 A;  4BHB A;  5F1R A;  2MYS A;  1JTY A;  1CGP A;  2R7Q A;  1XGO A;  2X9D A;  2X1C A;  2E1C A;  2M34 A;  3SFI A;  3IV5 A;  4B1R A;  3HUG B;  4BNC A;  3E5X A;  4ZYA A;  4CH7 A;  1ZH5 A;  4EJW A;  5KVR A;  3U21 A;  5E1W A;  1WJF A;  1IG7 A;  4AIK A;  1S8N A;  3ABM H;  1BJA A;  2XB5 A;  2L9S A;  1I6H J;  3OR2 C;  3K9T A;  1ZGA A;  2VT2 A;  5M3F J;  1MNM C;  4LB6 B;  3FK6 A;  3ZMV A;  2NS0 A;  1TQM A;  2EIK H;  2LY2 A;  3KZI C;  5EZH A;  2CS3 A;  4NQW B;  3KEQ A;  2DMT A;  4W97 A;  1YLF A;  2OJE D;  1GXP A;  5L3D A;  2RQQ A;  3RJP A;  4ETS A;  1ZGW A;  2LOO A;  2QQA A;  4HQE A;  2ZNY A;  3CCS I;  3JRF A;  2O6G E;  1SVM A;  2VOP A;  2KIS A;  2A6T A;  4BJT A;  1R9T J;  2HQ5 A;  3S3O A;  2QBY A;  1I27 A;  2V9K A;  4J19 A;  5EZG A;  5J3L A;  4I0B A;  3GFJ A;  1VND A;  4XON A;  1R5I D;  1X2N A;  1RZ4 A;  4RLQ A;  2H1K A;  5FO5 A;  2XIG A;  1Z6T A;  4ZYE A;  1RR8 C;  1E3O C;  4R1H A;  3OYD A;  1ZAR A;  3OYN A;  3BZC A;  2W4S A;  3FX3 A;  3KPH A;  1OCP A;  1N25 A;  4RAG A;  4NC7 A;  1T33 A;  2E1M B;  2IAI A;  1JE8 A;  2ZFU A;  4AID A;  3EDP A;  3PFI A;  4LK1 F;  3PQK A;  2BY3 A;  3DEE A;  1XX5 A;  1G8X A;  4NB5 A;  2JA8 J;  2O3F A;  2LYC A;  3HTS B;  3L2W A;  1PDN C;  3GBG A;  1G2H A;  2R5Z A;  1J9I A;  3IH2 A;  5CVI A;  1DU6 A;  2BYV E;  2P6S A;  2CGP A;  1RKW A;  4PGG A;  1DP7 P;  5BPI A;  1XSV A;  3S15 J;  4IRH A;  4BXF A;  5CVR A;  2VC0 A;  2CQK A;  2YR2 A;  2VON A;  1SMT A;  3K0L A;  1XPX A;  4KT5 C;  3QU6 A;  3SHF A;  4L9T A;  1U9O A;  3B73 A;  3FDY A;  3RYP A;  3J7A Y;  4XRM A;  1JHH A;  5FKM A;  4BBR J;  2Q2E B;  1K83 J;  4YRV A;  4Q5S F;  2QKM B;  3WU2 C;  2LFB A;  2FNA A;  4O5V A;  5HVQ C;  1QRY A;  1W7P B;  2O9L A;  1G3T A;  2JVG A;  2X6X A;  2ZSH B;  1S9H A;  3KP5 A;  1ITY A;  2FU4 A;  3Q9V A;  4HOB A;  3KP7 A;  2ADU A;  2QLZ A;  1PP7 U;  5D4S A;  4ZZL A;  1FT9 A;  2X48 A;  3VPR A;  4ZZD A;  4Y7N J;  2GM4 A;  1ETY A;  3QPS A;  1W5S A;  3ULQ B;  3PFY A;  1K78 B;  3TQN A;  4F3Q A;  1LFU P;  1PUF A;  3SZT A;  4B3A A;  1FLI A;  4G94 A;  1QHG A;  1XCB A;  5IT9 K;  1ETO A;  2HFH A;  3V42 A;  4L18 B;  4WX9 A;  1IRX A;  3GTG J;  3S2W A;  3MKY B;  4OAZ A;  1SFX A;  1FX7 A;  2I10 A;  4DYC A;  1EA3 A;  3GUD A;  2QEX I;  3HDD A;  1ETQ A;  1JKP C;  4HLX A;  2K9M A;  3E7L A;  1W36 D;  3C7J A;  2MC4 A;  1NG6 A;  1T38 A;  1W1W E;  5ICG A;  5GTH C;  1TTY A;  2IW5 A;  1ULY A;  1RC9 A;  3HOV J;  2A69 F;  3QYF A;  4BU2 A;  1J59 A;  1ON1 A;  1D8K A;  2KLO A;  4C3I J;  2GOM A;  3TO6 A;  4IL6 C;  2DPD A;  3UR3 C;  1Z67 A;  4DNC A;  3WTW C;  3RDI A;  2HU9 A;  2KRH A;  1MSE C;  1VQM I;  4HNU A;  4DJA A;  1KQ0 A;  1I1S A;  5B66 C;  2JVH A;  1G3S A;  2V4J C;  3LSJ A;  5K7H A;  1S7O A;  1KYW A;  2CV0 A;  4XSZ F;  3G73 A;  5HLT A;  3MN2 A;  3BQZ A;  2JJ7 A;  4PSW A;  3FXM A;  3QOD A;  3E97 A;  3BT9 A;  2HVR A;  3F8B A;  1HC8 A;  2DOE A;  2GWR A;  1S29 A;  2CG4 A;  3DEW A;  3K1M A;  3LL7 A;  3WTX C;  2XRL A;  1GV2 A;  3HZJ A;  3HOS A;  4IHV A;  4JOM A;  2M4G A;  4N4N B;  1LDJ A;  1VZ0 A;  5HOD A;  2HYJ A;  1LDD A;  2LMD A;  2DW4 A;  3FXQ A;  5TRD A;  1HKT A;  1Z91 A;  3PIP F;  4IVN A;  2ZXI A;  4L9V A;  4LLG F;  1ORK A;  2VB6 A;  4PGH A;  3DV8 A;  3IH3 A;  3MZH A;  3HKZ N;  1E2X A;  3NQO A;  2OTL I;  3IWZ A;  3OSF A;  2VBZ A;  2ZME A;  1JUS A;  1YJN I;  4BGD A;  5C4X J;  2X6O A;  5F04 A;  3P9I A;  2FML A;  2NOG A;  2F4M B;  2VOO A;  3BC8 A;  5E1Z B;  3LQR A;  1O7L A;  3P9K A;  2OCC H;  2CUZ A;  4MFE A;  3FXO A;  1XSD A;  3MQ0 A;  2W82 A;  1MGT A;  3RIR A;  4A3F J;  4A6E A;  4M74 A;  1BJZ A;  2PX9 A;  1V4R A;  3CME I;  2NVT J;  3NWS A;  2JQ7 A;  5JI6 A;  4KN7 X;  3RYR A;  4M71 A;  4BJ6 C;  1OQY A;  3T1B A;  2QQ8 A;  4DGW B;  4I0A A;  5E3O A;  2QYO A;  2L02 A;  3H5N A;  4PK4 A;  3T8R A;  4CZC A;  4BEH A;  4KIT B;  4UB8 C;  2OUM A;  3DPT A;  5E17 F;  5J1U A;  4XBF A;  5L3C A;  5AIP A;  1X1B A;  4L5J A;  1ZQ3 P;  5DYM A;  1IF1 A;  3KCC A;  3AG4 H;  3IHU A;  4X1E A;  1MJB A;  1XGN A;  1BBY A;  1IUF A;  3IP4 B;  4WXH A;  5D6F A;  1TWC J;  4A0Y A;  1B4A A;  2IS2 A;  3K4C A;  3IAS 2;  4M3B A;  2XB0 X;  4AIH A;  4ANJ A;  2ESN A;  2WB1 A;  4ESB A;  2KL4 A;  4BJ5 C;  4HX8 A;  3A0H C;  1RNL A;  3I4P A;  2HNH A;  1P4X A;  4GDF A;  5CVJ A;  3V4G A;  2DMP A;  4WXC A;  1YFH A;  3A1Y A;  3E6C C;  1DPR A;  4D1Q A;  2CQX A;  4D5C A;  5E3N A;  4D7M A;  3B6C A;  2H1L A;  3EUH A;  3QRF F;  3QYB A;  5ILS A;  4IZZ A;  1QU3 A;  5CYV A;  4A6D A;  1S7A A;  2GA2 A;  5LHG A;  2IGM A;  4M73 A;  3HRS A;  1W36 C;  1X3U A;  3KZZ A;  2KDO A;  2LD5 A;  2CQ7 A;  4LG3 A;  2LBF A;  2F48 A;  2WTE A;  3OMY A;  3HG9 A;  2VPR A;  2H8W A;  1XMA A;  3G71 I;  3S14 J;  2VE8 A;  1GV5 A;  1F36 A;  3CCL I;  2E1N A;  4F7Z A;  2BBY A;  4DOZ A;  1HBX G;  2WAQ A;  3REO A;  1BR4 A;  4OIP F;  2ZXH A;  1U5T C;  1N78 A;  1ZK8 A;  1Z3Y A;  3E1S A;  1NH3 A;  2K4J A;  3CLO A;  3U1K A;  5BOX A;  3BPX A;  3FZV A;  2K5C A;  4P96 A;  4I7H A;  1LQ1 A;  1WWX A;  3MKL A;  4FT8 A;  3JR9 A;  2ZC2 A;  2Z1D A;  3T5X A;  1R49 A;  2EBI A;  4M6V A;  1D1C A;  2RN7 A;  1GVD A;  5FD6 A;  2L7Z A;  3L7W A;  4IHW A;  3BY6 A;  1Z21 A;  3ZP5 A;  4U88 A;  2F5D A;  3QAH A;  4B47 A;  1HW2 A;  2MSY A;  2VBX A;  4FAS D;  2RAE A;  2LTP A;  3QPH A;  2V9V A;  3GLL A;  5HNH A;  4WXD A;  5EEG A;  1H88 C;  3N05 A;  2CFX A;  5DCF A;  5HDN A;  1TLH B;  2FSW A;  1Y0U A;  2JSP A;  3BRO A;  1X3Z B;  4XLC A;  2P6T A;  3FXR A;  1SAU A;  2KIM A;  3PUB A;  3OR1 C;  4DQ2 A;  2LVS A;  2E7X A;  4A0X A;  5D5V B;  3WTV C;  2K40 A;  4BE0 A;  1F5T A;  2XSJ C;  4KFC A;  3ZMS A;  3OS1 A;  3BR3 A;  3A2K A;  3ZRG A;  2A07 F;  4A5M A;  2OD5 A;  3FHN A;  2F6C A;  4EQQ A;  4ESF A;  2R5Z B;  3L2R A;  5HS8 A;  1AA7 A;  1KGS A;  4JBA A;  1SD4 A;  4EM1 A;  1GUU A;  1R1T A;  2M5W A;  4ENK A;  3DWL E;  4UUS A;  2ZKZ A;  3K69 A;  4GYI A;  5D8L B;  3K70 C;  3OV8 A;  1JJ6 C;  4HW0 A;  4ZH4 F;  3COA C;  3SDG A;  3CES A;  5M3M J;  2PMH A;  1BIA A;  4HNV A;  2D1V A;  3Q0W A;  2P5V A;  2EZI A;  1R5H A;  4FQG A;  4JK1 X;  3ROU A;  3PUF A;  3BJO A;  3PO3 J;  2MA3 A;  4G9Y A;  3W6K B;  2UWM A;  2IRF G;  4I01 A;  3V8K A;  2E5N A;  4Y15 A;  4HF0 A;  3CUQ A;  3DLL F;  4N9I A;  2NYX A;  2L54 A;  2HQR A;  4OWR B;  1YW7 A;  5B3S H;  1V5F A;  1A31 A;  2CW7 A;  3HOU J;  2C6Y A;  1VQK I;  1X58 A;  3CMM A;  1MBG A;  2X4H A;  2VPL A;  2GAU A;  2E35 A;  1ZG5 A;  1KYZ A;  4U0Y A;  3AL0 C;  3HOY J;  1BIB A;  4XLH A;  1ZEL A;  2FNP A;  1T8I A;  3KYC B;  4G7O F;  4L0Y B;  2BHZ A;  2EIJ H;  1ZYR F;  3A03 A;  4HBL A;  1P7J A;  5ICE A;  4R79 A;  4BXX J;  3FMS A;  3O6B B;  1IDY A;  5HLI A;  4I2O A;  5KK1 A;  4D5F A;  3SJM A;  4IF4 A;  2LY1 A;  3FK7 A;  2BEO A;  1Z7U A;  3ZMD A;  1VF9 A;  3I4N J;  1MBK A;  4IXA A;  2L7K A;  3BR5 A;  3A0B C;  3GZ5 A;  3KEO A;  2MAB A;  4IHX A;  2DU9 A;  2QM3 A;  5EDN A;  4AM3 A;  1WI9 A;  1XG1 A;  3QPT A;  5EG0 B;  1MBH A;  2XDV A;  3CF2 A;  1FTZ A;  5KAF C;  4WCG A;  2CV1 A;  2P8T A;  5HLG A;  1K6O A;  5K7Z A;  3BZK A;  1N77 A;  4BHP A;  3E6D A;  3BTL A;  1U8R A;  3I4M J;  3H0G J;  1ZRD A;  4HF1 A;  5IYB J;  3RPQ A;  1B9N A;  4GRI A;  1OCC H;  3VOE A;  2IA0 A;  2NXN B;  1ACI A;  3HTU A;  4ZYD A;  1S72 I;  3I71 A;  3E6M A;  2BOL A;  3HRU A;  1ZLK A;  2XKO A;  2P7V B;  1J75 A;  4B43 A;  1BA5 A;  2YSR A;  3VYS B;  5BMZ A;  3ZMZ A;  1HW1 A;  1U5T A;  1OCT C;  1IRZ A;  4M6Y A;  5KNL A;  1MNE A;  4BHC A;  2J5O A;  1ZTR A;  4CGZ A;  2CH0 A;  3LAP A;  3CJT B;  2KQR A;  5FD5 A;  1VTN C;  3FXK A;  3SYT A;  1QBJ A;  1IXC A;  4PCQ A;  4IX7 A;  3DFG A;  4NQW A;  4RB2 C;  2JA5 J;  4K2E A;  2F5E A;  4II3 A;  4HDV A;  2IEK A;  1MH4 A;  3KZY A;  2LKP A;  4XIC A;  3OYL A;  3F9K A;  2A3S A;  3MZY A;  3FIS A;  2B63 J;  1X4O A;  2O5R A;  3S3N A;  3M3Y J;  2JTV A;  2DA7 A;  1QVU A;  2DFH A;  3HRM A;  2NAZ A;  1G3W A;  3GZN B;  4X6A J;  2DAO A;  2ELJ A;  5K5R A;  2PG4 A;  4D0P A;  3K7A J;  1JKO C;  5CQG A;  4XN0 A;  2MD5 A;  3CUQ B;  4S0H B;  3HSR A;  3PM1 A;  3X2Q H;  4AC0 A;  2JA7 J;  2EK5 A;  3R6S A;  2DPU A;  2XF5 A;  1Z3X A;  1YX5 A;  2YPR A;  4RAZ A;  1RUO A;  2ELK A;  2F5F A;  2HOT A;  5FKN A;  3O3K A;  2HZT A;  5IY5 H;  2V1U A;  2B0L A;  3HBL A;  3GF2 A;  1F4K A;  4KYW A;  1YRN A;  2UV1 A;  2Y9Z A;  2JPC A;  3BCA A;  5TGT A;  4EM2 A;  2D45 A;  4H4K C;  2VJ5 A;  1WJ5 A;  3G1M A;  4KIB A;  5LGT A;  4QPO A;  1VQP I;  3ZN1 A;  4YFX F;  3ZQQ A;  4HV6 A;  4CYD A;  1S7E A;  4G7Z F;  3LSR A;  2PI0 A;  1JI8 A;  1QQI A;  2QKL B;  2VQH A;  1XDS A;  2L4A A;  3I64 A;  3ERM A;  5LGU A;  2W25 A;  4UV9 A;  2R93 J;  4EGY A;  2XF6 A;  2STT A;  2W57 A;  2P4W A;  2EV5 A;  3WG7 H;  4HX4 A;  1YHQ I;  3A01 A;  3GEZ A;  2XVC A;  5FB2 A;  3C1D A;  2PFB A;  3NWT A;  3OIO A;  4RAY A;  1XCV A;  4U87 A;  3W2A A;  4DZP A;  2YU9 J;  5D8K B;  2ZXJ A;  4RGS A;  3DKX A;  3ASO H;  2IGO A;  3F22 A;  1YIO A;  1MDM A;  1NK2 P;  4UXN A;  2EV6 A;  2EA4 A;  4IQ4 A;  2CSO A;  2CUE A;  4Y17 A;  4JQF A;  3RTR A;  1DGR M;  2XAJ A;  4E6K G;  2M3A A;  2RC4 A;  4Q48 A;  1HDP A;  5E3L A;  1B6A A;  4CDG A;  3GFL A;  2DK5 A;  5L3G A;  4M3F A;  1S6L A;  2Z9O A;  3BG9 A;  1IN8 A;  4DYQ A;  3TO9 A;  2VXZ A;  2VKV A;  2DDB A;  1DPU A;  1LFB A;  3AFH A;  2TRT A;  3PO2 J;  4CIC A;  4HSR A;  3VEP A;  5GPC A;  1U5T B;  2L2O A;  2X6Y A;  2AHQ A;  3L2C A;  3BWG A;  1KU9 A;  1MBF A;  1WFX A;  5DD8 A;  2VC1 A;  1IZ1 A;  4OIN F;  2IT0 A;  5GAH J;  1OYI A;  5FLV A;  2VBY A;  3BTJ A;  2CRG A;  4F93 B;  3WTY C;  3M8F A;  2DOA A;  1HF0 A;  2KKO A;  3JCU C;  2K27 A;  2Z99 A;  3WHC A;  1RES A;  3CLQ A;  3WE3 A;  3LQQ A;  1P4W A;  1DDN A;  2DT7 B;  1HST A;  3SZG A;  4BAC A;  1E3P A;  1IGN A;  2YS9 A;  1LJ9 A;  4XM3 A;  1H9G A;  1MMG A;  4PJJ A;  1UHM A;  3SZP A;  3S8P A;  1ZRF A;  2V6E A;  2MLK A;  4G6D A;  1BI0 A;  4LB5 A;  2CUF A;  4LLN A;  3BDD A;  4A0Z A;  4LG0 A;  3TP3 A;  3VYU B;  4CCM A;  3WGH A;  3JRC A;  1QZZ A;  1R58 A;  1JT6 A;  1QGP A;  2Z3Y A;  3AG2 H;  4PJ0 C;  1BC7 C;  4HX7 A;  3FIW A;  2RNG A;  3P5J A;  4B3X A;  1FNN A;  2IGK A;  3HSE A;  4OAY A;  5J6X A;  3VDX A;  3CO7 C;  1V5G A;  2O7O A;  2DOD A;  2XUB A;  2O0Y A;  3S1R J;  5FFX A;  3F3X A;  3C3W A;  2RQP A;  1CF7 A;  3R61 A;  3OSG A;  2GA1 A;  2DA5 A;  2CQN A;  5LEK A;  2ZJQ F;  1GVJ A;  1H9T A;  4C2T A;  3LNQ A;  3HGG A;  1SVL A;  4I98 B;  4E7L A;  5EEH A;  1FBS A;  2AQE A;  4MO7 A;  3S2D J;  2IP2 A;  4DIQ A;  1W7P D;  1QA6 A;  3LSP A;  3RQ4 A;  1NHA A;  2OZ6 A;  4PUS A;  5EJC A;  3W6V A;  3M1C A;  1RPW A;  1TW3 A;  2VKE A;  1EKE A;  1FIP A;  4M9S A;  3A4C A;  3A02 A;  3HKZ A;  1AU7 A;  1B72 B;  2QZ8 A;  1I1G A;  3RKW A;  5FKK A;  1WKM A;  3ZOB A;  2R0Q C;  4BAY A;  2ZXW H;  1U6G A;  1TC3 C;  1IW7 F;  1ZG3 A;  3FWE A;  4BDZ A;  2M45 A;  2BGC A;  5E79 C;  1VQ8 I;  3RZD J;  4A12 A;  3WU1 B;  1MD0 A;  1HOM A;  4S05 A;  5L3F A;  3P9C A;  3J80 Z;  2HS5 A;  1GLN A;  4LIV A;  1FP1 D;  3DF8 A;  4O6J A;  3I0T A;  1ZR2 A;  3D5S C;  3KX2 A;  4I02 A;  4Y13 A;  3LMM A;  1XGS A;  2DT5 A;  1V3F A;  2XAG A;  3CDH A;  4BQQ A;  5DS9 A;  3DU5 A;  3WTU C;  2Z2S B;  4DBQ A;  3I54 A;  5FLX K;  2FBK A;  3HRT A;  2ZJR F;  2MLG A;  2H27 A;  2IVM A;  2P81 A;  1AWC A;  2OA4 A;  3QPL A;  3M1E A;  2MBF A;  3H36 A;  2RGV A;  1YQA A;  3GFI A;  4XKW A;  1JJ8 C;  4XNF A;  2LDU A;  3DPU A;  1D1A A;  2R92 J;  1D8J A;  3FMR A;  1NG7 A;  1PYV A;  3GXO A;  4CUG A;  4XN3 A;  2MW8 A;  1JTX A;  4FX0 A;  4B48 A;  2FOK A;  1EF4 A;  3GTO J;  4QTR A;  3C2G A;  5GTI C;  2XRO A;  1GT0 C;  3CJQ B;  2WY8 Q;  3VFZ A;  1NTC A;  2JPB A;  4BS9 A;  3HGY A;  5CVU A;  1UHS A;  2I8D A;  5E18 F;  2JRM A;  2ZNZ A;  1XB4 A;  3OOP A;  2R7V A;  2ZJP F;  2A6E F;  3MWM A;  5CVV A;  3OS0 A;  1WSU A;  5JHU A;  2Q1Z B;  2M8G X;  4RBO A;  2BV6 A;  3HPG A;  4G8X A;  3J80 K;  1W0U A;  2BZT A;  4IHS A;  1JXS A;  1LDK B;  1AKH A;  4LLL A;  5C4J J;  2M0M A;  3OIP A;  3ZGK A;  1U0J A;  2AXL A;  4KIG A;  3V7C A;  2VAS A;  3Q5F A;  4KDP A;  5ERI A;  4XOR A;  3RKX A;  5ILU A;  1W0T A;  5FRN A;  3DBL B;  3M4O J;  2LKS A;  3CDI A;  2XGE A;  4XRS G;  4CHU A;  2UXN A;  4PJL A;  3MKW B;  3H3U A;  1F9N A;  3PNT A;  4UVA A;  3OYE A;  2K9L A;  5A2Q Z;  1IO2 A;  2XV4 S;  2HDW A;  4RMN A;  3HPH A;  5D4R A;  3L2V A;  1VQL I;  2Y0M A;  2NVY J;  1D0X A;  5J1Y A;  2N8G A;  4FET A;  1ZGJ A;  4OU0 A;  1ONV A;  2FXA A;  4PSX A;  4KIC A;  2H8R A;  5D6E A;  1WVR A;  2BXZ A;  2A6H F;  2CYY A;  5H6Q A;  2EPF A;  4TV7 A;  2TDX A;  5IOY A;  1KON A;  3OYB A;  3JRD A;  2WY7 Q;  3DLA A;  3OL3 A;  2DMU A;  4V19 K;  2HOS A;  2EFQ A;  2W85 A;  1P6R A;  2EQR A;  4FIS A;  2HEO A;  2XAF A;  3IL2 A;  2FEZ A;  4EM0 B;  1G4D A;  1ZG1 A;  3KYD B;  3OYJ A;  2HVS A;  2K7L A;  2A5W A;  3HSF A;  3J7Z I;  1KQ8 A;  4BE2 A;  2DYS H;  1UFM A;  4ON0 A;  1IN5 A;  3OWT A;  3HUG A;  4L9N A;  2ZB9 A;  5HS9 A;  3TW6 A;  5DM7 F;  1FC3 A;  3AL0 B;  4MIM A;  5GAG J;  2FQ3 A;  2HDC A;  2JWT A;  2X1D A;  5DM6 F;  3DTI A;  5F0F A;  5IYC J;  1WH5 A;  1X2M A;  4O3M A;  3CCJ I;  3TOB A;  4NUB A;  3SEQ A;  5K5Q A;  4F92 B;  1QNT A;  2CFO A;  1U9N A;  2MH2 A;  2PQ8 A;  4Y3O A;  3K6G A;  4CCK A;  2L9V A;  2ACJ A;  2R7Z J;  1Q1H A;  1CQT A;  2ZO4 A;  3EUH C;  4NC8 A;  2D2W A;  5K5O A;  5CLS A;  2ZME B;  1O3S A;  4XMY A;  1FWZ A;  5LRR A;  4RM2 A;  3CMA I;  1Z9C A;  3VWB A;  4CSW A;  4MQV A;  3CCY A;  5E8I A;  4YFK F;  3CF5 F;  1W5C C;  1IN7 A;  3CCV I;  2HVQ A;  3HHG A;  2LLK A;  2HXO A;  2DT6 A;  5KCM A;  1Y8R B;  3FXU A;  2R7R A;  1TNS A;  2XPV A;  3DPL C;  5TIS C;  3ISP A;  1GXQ A;  2A68 F;  1FBQ A;  5E20 A;  4P55 A;  4MLO A;  1QHH D;  2ISZ A;  3JSO A;  1RR7 A;  2WV0 A;  1LE8 B;  3B02 A;  4H0E A;  1SD6 A;  4BQA A;  1ETW A;  3F8F A;  2CU7 A;  2LF7 A;  4RB0 A;  4IHY A;  2M7A A;  2Y75 A;  2EV0 A;  4XSX F;  2RDP A;  4NHJ A;  2L01 A;  3F8C A;  4ZDO A;  2Y2Z A;  4RM3 A;  3KE2 A;  2X0L A;  3JAM K;  2XKP A;  2VQL A;  3MKZ A;  2VT3 A;  4XLN F;  1LNW A;  1OR7 A;  1YYV A;  3H9Q A;  1MBE A;  1R6R A;  2QA4 I;  3JRI A;  1J09 A;  4U0W A;  4P9U A;  1MSF C;  3QOE A;  1TT0 A;  3WTS C;  2KZV A;  4L9J A;  2RKH A;  3MVP A;  1WJD A;  2XGX A;  2KIQ A;  4RAF A;  1J5Y A;  2VKH A;  1B1B A;  3PNY A;  1P4A A;  2OCE A;  3CJN A;  3D0S A;  5BQT A;  3HHH A;  4HST A;  5EGO B;  2YX4 A;  3WOD F;  2F2E A;  1YOV B;  2DXI A;  3KP6 A;  3GTK J;  4JX4 A;  3I56 I;  3IKV A;  1QPI A;  2EIN H;  4YIF A;  5GAD J;  2Y48 A;  3RKY A;  1SFO J;  4HZF A;  1MIJ A;  3TKY A;  5LHH A;  3K2Z A;  4ZDL A;  2E2H J;  2AQF A;  2R7D A;  4GFB A;  2J5P A;  1JGG A;  3E3V A;  4BXU A;  4B09 A;  3Q9S A;  4HF2 A;  1RI7 A;  1EH8 A;  1Z1D A;  3F72 A;  4IQJ A;  3DTE A;  1SD5 A;  1KU7 A;  3L2Q A;  3L9F A;  3JRE A;  2DLL A;  3KP2 A;  1J7K A;  3I59 B;  3TL4 X;  2M2E A;  4CCN A;  2PBI A;  3E6B A;  3EPZ A;  4D9J A;  3F6O A;  3G3Z A;  4G12 A;  2LSO A;  3GTM J;  4GYG A;  1VQ7 I;  5IYD J;  2GXA A;  4ITV A;  2UUZ A;  4LIT A;  4FE7 A;  1R4N B;  3DBR B;  2DTR A;  5DCM B;  1Y6I A;  4DYR A;  3JAM Z;  3CC2 I;  4XLA A;  4AU7 A;  5AON A;  2VUM J;  3WG9 A;  3JRA A;  2WB1 N; 
#chains in the Genus database with same CATH homology
 1RIO H;  2HQN A;  2GQQ A;  4KA4 A;  3QP6 A;  3P7N A;  1HW5 A;  1BC8 C;  1MZB A;  4RS8 A;  3JTG A;  2O61 A;  1FYL A;  1O57 A;  2HYG D;  3IRR A;  3CUO A;  1S3J A;  2R3S A;  2K02 A;  2EB7 A;  4M9Z A;  1ZN2 A;  2JT1 A;  5LLQ A;  4LGW A;  2Q0O A;  2R7F A;  1OKR A;  4B8X A;  3LWF A;  4LMY A;  1YW9 A;  1R23 A;  1O3T A;  1I6X A;  1TW2 A;  2F5C A;  2CO5 A;  1YO5 C;  5HOO A;  2PMU A;  3BPV A;  2LF8 A;  1XN7 A;  3U2R A;  3I53 A;  3FM5 A;  1W4M A;  4MTD A;  4Z2Y A;  2GZW A;  2NNN A;  4IPA A;  4RB1 A;  3IKT A;  2XAH A;  3ZQ7 A;  5ICF A;  5BS6 A;  3K1N A;  2O8X A;  1FP2 A;  1QZY A;  5E1X A;  1P92 A;  4YG2 F;  3N97 A;  1FY7 A;  3O2P E;  1XMK A;  1BI2 A;  1MKM A;  2EFW A;  3BOQ A;  1R36 A;  4G6Q A;  4ESJ A;  2DFI A;  1OYW A;  4OMZ A;  3U1D A;  2FMY A;  2AS5 F;  5E8G A;  1ON2 A;  3GLX A;  4XRF A;  4OMY A;  3R4K A;  4P9F A;  1IN4 A;  3TDZ C;  1PUE E;  4HA8 A;  5ILV A;  3KP3 A;  5DUK A;  4CXF A;  2XHK A;  3DXJ F;  2OQR A;  3LA3 A;  2G7U A;  2WC2 A;  2OBP A;  3ERE D;  5LRS A;  1HSJ A;  1YTY A;  1STZ A;  4MNU A;  1IUY A;  2A61 A;  2D1H A;  2Q8K A;  2EA2 A;  3TDU C;  4P5O A;  2EFP A;  1SFU A;  1BI3 A;  5K1Y A;  2QVO A;  1MJ9 A;  5BPD A;  2BE5 F;  3HOT A;  1LEB A;  2QWW A;  2VE9 A;  1YS6 A;  4BH9 A;  2CWE A;  2UZK A;  1O3Q A;  3FHZ A;  3M8E A;  5DDG A;  4ENM A;  1B59 A;  3DEU A;  2KIF A;  2NNY A;  3MAJ A;  5HLH A;  3ZN0 A;  5JVT A;  4ASN A;  1BN5 A;  3AAF A;  4AIJ A;  2OQG A;  2HR3 A;  3LA2 A;  1W5T A;  3QOP A;  1IXS B;  4GGG A;  4RGX A;  3GX4 X;  4MEX F;  2V79 A;  1ZRE A;  3J7A O;  2ETH A;  3LA7 A;  2DQL A;  1XDU A;  1IRF A;  4KMU X;  3BJA A;  4I09 A;  4FX4 A;  4QLC U;  2PEX A;  2HGC A;  4M72 A;  2IJL A;  4EJV A;  3WTZ A;  4OIQ F;  2UXX A;  1HKQ A;  3TGN A;  3ML6 A;  1U3E M;  4EJT A;  2ZBK A;  2JZY A;  5DV5 A;  1MDM B;  4GXO A;  3WE2 A;  4R8H A;  1ODD A;  1LVA A;  2IPQ X;  3L09 A;  3GZ6 A;  4MGR A;  3CTA A;  1XGM A;  2JSC A;  2KJB A;  3HIF A;  4MTE A;  2ZFW A;  1P2F A;  2DBB A;  2P5L C;  5LGN A;  4UNO A;  3GW2 A;  2FE3 A;  3KP4 A;  2Z5U A;  2DI3 A;  2XAS A;  5IT9 Z;  2W24 A;  5FFZ A;  4M6X A;  3I59 A;  3R0A A;  6PAX A;  1IXR C;  2QQ9 A;  4OIO F;  3F23 A;  1KA8 A;  2OZU A;  2W84 A;  5DCM A;  3R0J A;  3W6J B;  4A5N A;  1T6S A;  5J8F A;  5DUI A;  2QBY B;  3WGI A;  1R00 A;  2V1X A;  4IHT A;  1D5V A;  4ENN A;  1IRG A;  1SD7 A;  2CW0 F;  3DKW A;  4OOI A;  1K79 A;  5JR3 A;  3GWZ A;  4ZYH A;  2KRF A;  4EJU A;  2H6B A;  4LG0 B;  4UHT A;  2NRA C;  2P5K A;  1PP8 F;  1UCR A;  4EVI A;  2G7H A;  3I5U A;  1K7A A;  2VBW A;  5CJ9 A;  3IRQ A;  1Z05 A;  1FPQ A;  3F6V A;  3L00 A;  1WRJ A;  1LEA A;  1T2K A;  2FBH A;  3ABU A;  3KFW X;  4EV0 A;  3DQV C;  2IA2 A;  3KLN A;  1AOY A;  4S04 A;  4YFN F;  1T0F A;  3WTT C;  2HKX A;  1R5G A;  4M9X A;  4EMS A;  3V8J A;  3SXY A;  4MQ9 F;  4AD9 A;  2MH9 A;  4OIR F;  2M1B A;  1L0O C;  5L3E A;  2M30 A;  2QUF A;  5LEJ A;  3GFM A;  3F21 A;  3LAJ A;  4RGR A;  2OU2 A;  2HTJ A;  4ZYG A;  1LB2 A;  3V7S A;  2ZCW A;  3IWF A;  3N4M A;  1YS7 A;  4E70 A;  4UUV A;  5LBQ A;  1R22 A;  4WWC A;  1QO0 D;  5JFR A;  4GCV A;  2PJP A;  3H92 A;  2G9W A;  3RI4 A;  2HYF A;  2YX7 A;  5TJJ A;  3J81 K;  3IC7 A;  2RV8 A;  5LHI A;  1TNT A;  3NRV A;  2Z33 A;  4HAM A;  1G3Y A;  1XSX A;  3HYI A;  3J81 Z;  2PN6 A;  4HQM A;  3T0Y A;  2HWV A;  2COM A;  3TOA A;  1UHW A;  5IT3 A;  1ZHF A;  1R7J A;  4G7H F;  1ZRC A;  1FOK A;  5H6R A;  4N0B A;  1RUN A;  4HDU A;  1Z6R A;  4WF2 A;  1D3Y A;  3QU3 A;  4HLY A;  3CO6 C;  2QEN A;  4CZZ A;  4RGU A;  1EH6 A;  5H20 A;  1TQP A;  1DUX C;  3M7G A;  3ZMU A;  3BP8 A;  2EJR A;  2A5Y B;  1ZLJ A;  3I58 A;  2GXB A;  4WK8 F;  2O03 A;  3U9G A;  1H0M A;  1U78 A;  1A04 A;  1IAW A;  1K78 A;  3GYH X;  4GO1 A;  4EGZ A;  2DO7 A;  3WU0 A;  1SMY F;  1J2X A;  4FHT A;  3D5L A;  2H6C A;  3GVA A;  1HKS A;  4XLP F;  2VOD A;  4KNY A;  3KET A;  1YW8 A;  2HKO A;  1BOA A;  1FBU A;  1T39 A;  4QWQ A;  2ELH A;  3ABT A;  1R1U A;  5L3B A;  1O7F A;  2JRT A;  5DD4 A;  4AVP A;  2QQB A;  3E5Q A;  1QPM A;  3EYI A;  2MC3 A;  3VOD A;  1FYK A;  1GHC A;  2LNB A;  3LST A;  3JTH A;  1G6N A;  4BYY A;  3DP7 A;  4UVC A;  1I5Z A;  2STW A;  3CUQ C;  2HOE A;  3V8L A;  2WWY A;  5FLX Z;  3JW4 A;  5FGM A;  4IRI A;  3TO7 A;  4KMF A;  2DK8 A;  1O3R A;  5ICC A;  1JGS A;  2RNJ A;  1JHF A;  2KIU A;  3PQJ A;  5ED4 A;  2V6C A;  4MEY F;  4Q4Z F;  1BI1 A;  2ISY A;  1C0W A;  3EYY A;  3E5U A;  4PDK A;  4N9H A;  3MFK A;  1USS A;  3MCZ A;  3EQL F;  2FA5 A;  2L4M A;  3K1P A;  3BJ6 A;  1EV7 A;  5D5U B;  1BM9 A;  2GXG A;  3ECO A;  1U2W A;  3SQN A;  2PLY A;  1KU2 A;  5AIQ A;  4YII A;  2EFN A;  2ZJ2 A;  2M87 A;  4LK0 F;  3T8T A;  2V1D A;  2FF4 A;  5F6F A;  1KQ9 A;  2KJC A;  1L3L A;  4U7B A;  4U7D A;  1HXD A;  2DQR A;  1OYY A;  3KLO A;  1W7P A;  2L3D A;  3FM3 A;  1REP C;  2FRH A;  3FMQ A;  1IN6 A;  4A2U A;  3H3Z A;  1MJA A;  3V7R A;  1UB9 A;  5DEQ A;  3BZ6 A;  1CF7 B;  1WQ2 A;  1FZP B;  1TBX A;  5HS7 A;  4RB3 C;  3VB2 A;  1KU3 A;  1SFE A;  4EJO A;  4UVB A;  1HQC A;  3R60 A;  4LFU A;  1OMI A;  1R1V A;  1FSH A;  2EFO A;  4KUM A;  2XAQ A;  4L5I A;  4LD5 A;  1OPC A;  4PZJ A;  1UST A;  3NEU A;  1E17 A;  2IA1 A;  1TQI A;  2GIV A;  1YG2 A;  2HTS A;  2VN2 A;  1ZAO A;  3F8N A;  2E7W A;  2OAZ A;  4AWX B;  3ELK A;  1B9M A;  4LJZ F;  1F1Z A;  4MHG A;  4HYE A;  1XD7 A;  3GO5 A;  2XRN A;  2ESH A;  4Q47 A;  1EH7 A;  4CO8 A;  3WGG A;  2H09 A;  5A2Q K;  4ENJ A;  1FYM A;  2H94 A;  3JSP A;  5J8C A;  4U0V A;  3EET A;  2P7C B;  2FBI A;  2M8E A;  5HDK A;  4L0Z B;  3MEX A;  1T98 A;  2K86 A;  1J0R A;  3RPU A;  3SFZ A;  3FF5 A;  3C18 A;  2RVC A;  3QP5 A;  4UV8 A;  3LFK A;  3F8M A;  2YU3 A;  3M9A A;  5D5X B;  5F64 A;  4IRG A;  3ZPL A;  4IJA A;  1FSE A;  3ECH A;  3ZMT A;  5HDG A;  1SAX A;  2K4B A;  2Q2E A;  5D5W B;  4KN4 X;  4KIF A;  2EWN A;  4HV5 A;  4BHB A;  5F1R A;  1CGP A;  1XGO A;  2E1C A;  4BNC A;  3E5X A;  1ZH5 A;  4EJW A;  5KVR A;  5E1W A;  4AIK A;  1S8N A;  1BJA A;  3K9T A;  1ZGA A;  2VT2 A;  4LB6 B;  3ZMV A;  2NS0 A;  1TQM A;  3KEQ A;  1YLF A;  1GXP A;  5L3D A;  3RJP A;  4ETS A;  2QQA A;  4HQE A;  2ZNY A;  2O6G E;  2VOP A;  2QBY A;  1I27 A;  4I0B A;  3GFJ A;  1RZ4 A;  5FO5 A;  2XIG A;  1Z6T A;  4ZYE A;  4R1H A;  1ZAR A;  3FX3 A;  1JE8 A;  3EDP A;  3PFI A;  4LK1 F;  3PQK A;  4NB5 A;  2O3F A;  3HTS B;  1PDN C;  1J9I A;  5CVI A;  2BYV E;  2P6S A;  2CGP A;  4PGG A;  1DP7 P;  5BPI A;  1XSV A;  4IRH A;  5CVR A;  2VC0 A;  2CQK A;  2YR2 A;  2VON A;  1SMT A;  3K0L A;  4KT5 C;  3QU6 A;  3SHF A;  4L9T A;  3B73 A;  3RYP A;  1JHH A;  4Q5S F;  2FNA A;  4O5V A;  5HVQ C;  1W7P B;  1G3T A;  3KP5 A;  2FU4 A;  3Q9V A;  4HOB A;  3KP7 A;  2ADU A;  2QLZ A;  1PP7 U;  5D4S A;  4ZZL A;  1FT9 A;  4ZZD A;  1W5S A;  1K78 B;  3ULQ B;  3TQN A;  3SZT A;  1FLI A;  4G94 A;  1XCB A;  5IT9 K;  2HFH A;  4L18 B;  4WX9 A;  3S2W A;  1SFX A;  1FX7 A;  3GUD A;  4HLX A;  3C7J A;  1T38 A;  5ICG A;  1TTY A;  2IW5 A;  1ULY A;  2A69 F;  1J59 A;  1ON1 A;  1D8K A;  3TO6 A;  2DPD A;  4DNC A;  3WTW C;  3RDI A;  1KQ0 A;  1I1S A;  1G3S A;  1S7O A;  1KYW A;  4XSZ F;  3G73 A;  3E97 A;  3F8B A;  2GWR A;  1S29 A;  2CG4 A;  3K1M A;  3WTX C;  3HOS A;  1LDJ A;  1LDD A;  3FXQ A;  2DW4 A;  5TRD A;  1HKT A;  1Z91 A;  4IVN A;  4L9V A;  4LLG F;  4PGH A;  3DV8 A;  3MZH A;  1E2X A;  3NQO A;  3IWZ A;  2VBZ A;  2ZME A;  3P9I A;  2FML A;  2VOO A;  5E1Z B;  3LQR A;  1O7L A;  3P9K A;  1XSD A;  3MQ0 A;  1MGT A;  3RIR A;  4A6E A;  4M74 A;  1V4R A;  5JI6 A;  4KN7 X;  3RYR A;  4M71 A;  3T1B A;  4I0A A;  2QYO A;  2L02 A;  3T8R A;  3DPT A;  5E17 F;  4XBF A;  5L3C A;  5AIP A;  4L5J A;  5DYM A;  1IF1 A;  3KCC A;  3IHU A;  1MJB A;  1XGN A;  1BBY A;  4WXH A;  5D6F A;  4A0Y A;  1B4A A;  4AIH A;  2ESN A;  4ESB A;  4HX8 A;  1RNL A;  3I4P A;  1P4X A;  5CVJ A;  3V4G A;  4WXC A;  1YFH A;  3E6C C;  1DPR A;  3EUH A;  3QRF F;  5ILS A;  5CYV A;  4A6D A;  1S7A A;  2GA2 A;  5LHG A;  4M73 A;  3HRS A;  1X3U A;  3KZZ A;  2WTE A;  1XMA A;  2VE8 A;  2E1N A;  4F7Z A;  2BBY A;  1HBX G;  3REO A;  4OIP F;  1U5T C;  2K4J A;  3CLO A;  5BOX A;  3BPX A;  3FZV A;  4P96 A;  4I7H A;  1LQ1 A;  1WWX A;  4FT8 A;  3T5X A;  2RN7 A;  5FD6 A;  3L7W A;  3BY6 A;  3ZP5 A;  4U88 A;  2F5D A;  3QAH A;  1HW2 A;  2VBX A;  3QPH A;  2V9V A;  4WXD A;  5EEG A;  2CFX A;  5DCF A;  5HDN A;  1TLH B;  2FSW A;  1Y0U A;  3BRO A;  2P6T A;  3FXR A;  2KIM A;  4DQ2 A;  5D5V B;  3WTV C;  2E7X A;  4A0X A;  1F5T A;  4KFC A;  3ZMS A;  2A07 F;  4A5M A;  2OD5 A;  4EQQ A;  4ESF A;  5HS8 A;  4JBA A;  1KGS A;  1SD4 A;  4EM1 A;  1R1T A;  2M5W A;  4ENK A;  2ZKZ A;  3K69 A;  4GYI A;  5D8L B;  3OV8 A;  4HW0 A;  4ZH4 F;  3COA C;  2PMH A;  1BIA A;  2D1V A;  2P5V A;  4JK1 X;  1R5H A;  3ROU A;  3BJO A;  2MA3 A;  4G9Y A;  3W6K B;  2UWM A;  2IRF G;  4I01 A;  3V8K A;  4Y15 A;  4HF0 A;  3CUQ A;  4N9I A;  2NYX A;  2L54 A;  2HQR A;  1YW7 A;  2C6Y A;  2X4H A;  2GAU A;  1ZG5 A;  1KYZ A;  4U0Y A;  1BIB A;  2FNP A;  4G7O F;  4L0Y B;  1ZYR F;  4HBL A;  5ICE A;  4R79 A;  3FMS A;  3O6B B;  5HLI A;  4I2O A;  5KK1 A;  4IF4 A;  2BEO A;  1Z7U A;  3ZMD A;  4IXA A;  3KEO A;  3GZ5 A;  2DU9 A;  2QM3 A;  1WI9 A;  3QPT A;  4WCG A;  2P8T A;  5HLG A;  1K6O A;  4BHP A;  3E6D A;  1U8R A;  1ZRD A;  4HF1 A;  3RPQ A;  1B9N A;  3VOE A;  2IA0 A;  3HTU A;  4ZYD A;  3I71 A;  3E6M A;  3HRU A;  1ZLK A;  2XKO A;  2P7V B;  1J75 A;  2YSR A;  5BMZ A;  3ZMZ A;  1HW1 A;  1U5T A;  4M6Y A;  4BHC A;  2J5O A;  4CGZ A;  3LAP A;  1VTN C;  5FD5 A;  1QBJ A;  1IXC A;  4PCQ A;  3DFG A;  4NQW A;  4RB2 C;  4K2E A;  2F5E A;  4HDV A;  3KZY A;  2LKP A;  3MZY A;  2A3S A;  2JTV A;  3HRM A;  2NAZ A;  1G3W A;  2DAO A;  5K5R A;  2PG4 A;  4D0P A;  2MD5 A;  3CUQ B;  3HSR A;  2EK5 A;  3R6S A;  2DPU A;  2YPR A;  4RAZ A;  1RUO A;  2F5F A;  2V1U A;  3O3K A;  2HZT A;  2B0L A;  3GF2 A;  1F4K A;  4KYW A;  2JPC A;  4EM2 A;  2D45 A;  4KIB A;  5LGT A;  3ZN1 A;  4YFX F;  4CYD A;  4HV6 A;  2PI0 A;  4G7Z F;  1QQI A;  1XDS A;  2L4A A;  3I64 A;  5LGU A;  2W25 A;  4UV9 A;  4EGY A;  2STT A;  2W57 A;  2P4W A;  2EV5 A;  4HX4 A;  3GEZ A;  2XVC A;  5FB2 A;  3C1D A;  2PFB A;  4RAY A;  1XCV A;  5D8K B;  2ZXJ A;  4RGS A;  3F22 A;  1YIO A;  1MDM A;  4UXN A;  2EV6 A;  2EA4 A;  2CSO A;  4Y17 A;  4JQF A;  3RTR A;  2XAJ A;  2RC4 A;  4Q48 A;  4CDG A;  1B6A A;  3GFL A;  2DK5 A;  5L3G A;  1S6L A;  2Z9O A;  1IN8 A;  3TO9 A;  2VXZ A;  1DPU A;  4CIC A;  3VEP A;  1U5T B;  3L2C A;  3BWG A;  1KU9 A;  5DD8 A;  2VC1 A;  1IZ1 A;  4OIN F;  2IT0 A;  1OYI A;  2VBY A;  3WTY C;  3M8F A;  2KKO A;  2K27 A;  2Z99 A;  3WE3 A;  3LQQ A;  1P4W A;  1DDN A;  1HST A;  1LJ9 A;  1H9G A;  1UHM A;  3SZP A;  1ZRF A;  2MLK A;  4G6D A;  1BI0 A;  4LB5 A;  4LLN A;  3BDD A;  4A0Z A;  4LG0 A;  3WGH A;  1QZZ A;  1R58 A;  1QGP A;  2Z3Y A;  1BC7 C;  4HX7 A;  1FNN A;  3HSE A;  5J6X A;  3CO7 C;  2XUB A;  2O0Y A;  5FFX A;  3F3X A;  3C3W A;  2RQP A;  1CF7 A;  3R61 A;  2GA1 A;  5LEK A;  1GVJ A;  1H9T A;  4I98 B;  5EEH A;  1FBS A;  2IP2 A;  1W7P D;  1NHA A;  2OZ6 A;  1TW3 A;  4M9S A;  2QZ8 A;  1I1G A;  3RKW A;  1WKM A;  4BAY A;  1U6G A;  1IW7 F;  1ZG3 A;  3FWE A;  2M45 A;  2BGC A;  4A12 A;  3WU1 B;  1MD0 A;  4S05 A;  5L3F A;  3P9C A;  3J80 Z;  2HS5 A;  1FP1 D;  3DF8 A;  4O6J A;  3I0T A;  4I02 A;  4Y13 A;  1XGS A;  2DT5 A;  1V3F A;  2XAG A;  3CDH A;  3WTU C;  3I54 A;  5FLX K;  2FBK A;  3HRT A;  2MLG A;  2H27 A;  2IVM A;  1AWC A;  2OA4 A;  3M1E A;  2MBF A;  2RGV A;  1YQA A;  3GFI A;  2LDU A;  1D8J A;  3FMR A;  3GXO A;  4FX0 A;  2FOK A;  2XRO A;  3VFZ A;  2JPB A;  5CVU A;  5E18 F;  2ZNZ A;  1XB4 A;  3OOP A;  2A6E F;  3MWM A;  5CVV A;  1WSU A;  5JHU A;  2BV6 A;  4G8X A;  3J80 K;  1JXS A;  4IHS A;  1LDK B;  4LLL A;  2AXL A;  4KIG A;  3V7C A;  3Q5F A;  4KDP A;  5ERI A;  5ILU A;  3RKX A;  4CHU A;  2UXN A;  3H3U A;  1F9N A;  4UVA A;  5A2Q Z;  2XV4 S;  5D4R A;  2Y0M A;  1ZGJ A;  4OU0 A;  1ONV A;  2FXA A;  4KIC A;  5D6E A;  2A6H F;  2CYY A;  5H6Q A;  4TV7 A;  2TDX A;  2EFQ A;  2W85 A;  1P6R A;  2HEO A;  2XAF A;  3IL2 A;  2FEZ A;  4EM0 B;  1G4D A;  1ZG1 A;  2K7L A;  3HSF A;  1KQ8 A;  1UFM A;  4ON0 A;  1IN5 A;  3HUG A;  4L9N A;  5HS9 A;  1FC3 A;  2FQ3 A;  2HDC A;  4O3M A;  3TOB A;  5K5Q A;  1QNT A;  2MH2 A;  2PQ8 A;  2ACJ A;  1Q1H A;  2ZO4 A;  2D2W A;  5K5O A;  5CLS A;  2ZME B;  1O3S A;  1FWZ A;  5LRR A;  1Z9C A;  4MQV A;  5E8I A;  4YFK F;  1IN7 A;  3HHG A;  3FXU A;  1TNS A;  3DPL C;  3ISP A;  1GXQ A;  2A68 F;  1FBQ A;  5E20 A;  4P55 A;  2ISZ A;  3JSO A;  2WV0 A;  3B02 A;  4H0E A;  1SD6 A;  4BQA A;  3F8F A;  2LF7 A;  4RB0 A;  2Y75 A;  2EV0 A;  4XSX F;  2RDP A;  4NHJ A;  2L01 A;  3F8C A;  3KE2 A;  2X0L A;  3JAM K;  2XKP A;  2VT3 A;  4XLN F;  1LNW A;  1OR7 A;  1YYV A;  4U0W A;  4P9U A;  3WTS C;  4L9J A;  2RKH A;  2XGX A;  1J5Y A;  5BQT A;  1B1B A;  1P4A A;  3CJN A;  3D0S A;  3HHH A;  2YX4 A;  3WOD F;  2F2E A;  3KP6 A;  3IKV A;  4YIF A;  2Y48 A;  3RKY A;  4HZF A;  3TKY A;  5LHH A;  3K2Z A;  2R7D A;  2J5P A;  3E3V A;  4BXU A;  4B09 A;  3Q9S A;  4HF2 A;  1RI7 A;  1EH8 A;  1Z1D A;  3F72 A;  1SD5 A;  1KU7 A;  3L9F A;  2DLL A;  3KP2 A;  1J7K A;  3I59 B;  2PBI A;  3E6B A;  3F6O A;  3G3Z A;  2LSO A;  4GYG A;  5DCM B;  2DTR A;  3JAM Z;  5AON A;  3WG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...