3GFIA

Crystal structure of st1710 complexed with its promoter dna
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
143
structure length
143
Chain Sequence
SNENRIQIMSTIAKIYRAMSRELNRRLGELNLSYLDFLVLRATSDGPKTMAYLANRYFVTQSAITASVDKLEEMGLVVRVRDREDRRKILIEITEKGLETFNKGIEIYKKLANEVTGDLSEDEVILVLDKISKILKRIEEISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 146aa long hypothetical transcriptional regulator
publication title ST1710-DNA complex crystal structure reveals the DNA binding mechanism of the MarR family of regulators.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Transcription/dna
total genus 56
structure length 143
sequence length 143
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3gfiA00
4M73A 5HLGA 2VBYA 3BJ6A 1R1UA 2M1BA 2ZBKA 1I5ZA 4XLPF 3F8BA 5A2QK 2W57A 1EV7A 3MAJA 5LBQA 4U0YA 3HSRA 3E3VA 2DI3A 2O0YA 1YG2A 1UHMA 3T8TA 2EV5A 4MEYF 4WF2A 4FX4A 1REPC 2C6YA 3PFIA 1S29A 1K79A 2HTSA 4KFCA 4L5JA 5HDKA 4EJTA 5EEGA 3WE2A 1G4DA 2E1CA 1JHFA 4HAMA 1WRJA 1T6SA 2HTJA 4A5NA 1K78B 4O3MA 4KN7X 5CVRA 5LHGA 5EEHA 3LQQA 4EM0B 1FSEA 3C3WA 1G3SA 4XSZF 3U1DA 4AIKA 3M9AA 1KYWA 5IT9K 1PUEE 4YIFA 3R60A 2AS5F 1TW2A 2VBZA 1Y0UA 1FP2A 2VE8A 2KIUA 4UV9A 3BDDA 4EM1A 1R23A 4G6QA 2A69F 4LG0A 5FFZA 1QZZA 6PAXA 2IJLA 1O7FA 3LA2A 3GYHX 3GWZA 3GVAA 3J7AO 3BPVA 3MZHA 4S04A 5LEJA 3RJPA 2PQ8A 4K2EA 3KP2A 4A0XA 4EMSA 3KETA 1KQ0A 1OMIA 5HS7A 1HW5A 1H0MA 1J7KA 4HX7A 2H27A 1J2XA 4U7BA 1T2KA 3GLXA 2IA0A 1HBXG 2EFWA 4OOIA 2XASA 1ZG5A 3F6OA 2DPUA 2IPQX 4M6YA 5E18F 1DPRA 2PLYA 5FO5A 2QYOA 2L02A 3RTRA 3IKTA 1XSXA 5BS6A 1IXSB 1K6OA 3SQNA 4ESBA 1SFEA 4N9HA 2CSOA 5HDNA 1YFHA 4XRFA 3RKXA 4JQFA 1R7JA 1XCBA 5ED4A 2XUBA 2OQRA 2XROA 4G94A 4IHSA 2F5FA 4WXHA 4JBAA 1JGSA 1Z1DA 2ZMEA 3V4GA 1BI1A 3ML6A 4P96A 1FWZA 3V7SA 1ZYRF 3FM5A 4UVCA 1USSA 4MGRA 3GW2A 1R1VA 4ZZLA 4EJVA 4A6EA 3RPUA 2XVCA 1HSTA 2GQQA 1LB2A 1K7AA 3SXYA 4F7ZA 3GZ5A 2GXBA 2ETHA 1ZREA 1ZG1A 3JAMK 1W5TA 1WI9A 2L54A 5J6XA 2QBYB 1SMTA 3RI4A 4O6JA 1ODDA 3ZMDA 2JTVA 2VT2A 3GFJA 1G6NA 3RKYA 1WKMA 1FLIA 2EA2A 4EGZA 3DQVC 3GFMA 4PZJA 5L3GA 4R8HA 1HKSA 5AONA 1D5VA 2FEZA 2W25A 3MZYA 3ECOA 4BYYA 2ZMEB 4KN4X 1TNSA 1P92A 3I59B 2STWA 2DK8A 1TBXA 3V7CA 4RS8A 3QOPA 1GHCA 4EVIA 5BPDA 4B8XA 4HLYA 4HOBA 2VN2A 2IRFG 1I6XA 2G7UA 2H6CA 3ELKA 3LWFA 4Q5SF 3KLNA 1QPMA 3RKWA 2ISYA 5D6FA 3HTUA 4Y17A 2E7XA 3KZYA 1BI3A 1ZRDA 3E6DA 1LDKB 1E2XA 2ESHA 1S6LA 1LEAA 1BIBA 5A2QZ 1FBSA 4XBFA 1L3LA 1OKRA 3BOQA 2J5OA 4E70A 2MLGA 1Z6TA 5LGTA 2V9VA 3IHUA 1W5SA 1D3YA 4WCGA 4I98B 1U5TB 1O3QA 3Q9VA 2KKOA 1RUNA 4I0AA 2LNBA 1R58A 1Z91A 2OBPA 5FFXA 4HQMA 2P7VB 4I2OA 2WC2A 1FZPB 2UXXA 5E8IA 4DNCA 5DCMA 4BH9A 3JSOA 3G3ZA 1XGNA 3KP5A 5IT9Z 4U0VA 4M71A 5LHIA 3WGIA 4MQVA 5CJ9A 1JXSA 4BHPA 5JFRA 5E20A 2YPRA 2L3DA 4KNYA 1J0RA 3F8CA 2TDXA 1B59A 1SAXA 2PFBA 2ZJ2A 3N97A 2PBIA 2OU2A 2BE5F 3BJOA 2DQRA 5F1RA 3TDZC 3CDHA 3LA7A 5HVQC 1MJBA 4A2UA 2QM3A 3V8KA 5LEKA 3IC7A 1HSJA 4FHTA 1WSUA 3PQJA 5D8KB 4ZYHA 1B4AA 2YU3A 3I64A 3JTGA 3HTSB 1MDMA 1SFXA 2ELHA 2Z5UA 2MH2A 1KQ9A 1IW7F 3F3XA 3HRSA 3I58A 4CDGA 3EYIA 1KA8A 1DDNA 1ULYA 1LDJA 4BQAA 1YO5C 2K27A 4A12A 2BGCA 3K69A 2QQ9A 3WGGA 2FMYA 4RGRA 2HZTA 1YIOA 1ZRFA 4HV5A 3SZTA 3G73A 2A61A 3ZP5A 1O3SA 2FNPA 3CJNA 2HFHA 4KA4A 3K1MA 4NB5A 4A6DA 4ASNA 4EQQA 2BEOA 1IRGA 1OYYA 3L09A 3I54A 1XDUA 4HDVA 3E6BA 5JI6A 2YSRA 2XHKA 4I7HA 5DUIA 2OA4A 1ZLKA 1O3TA 1ZH5A 2QQAA 4KUMA 2QZ8A 1C0WA 2HYGD 4ESFA 2LKPA 5L3EA 3J81Z 3ZN0A 1FC3A 5DDGA 3HOTA 1MDMB 2OD5A 1I1GA 1J9IA 3EETA 2PMHA 4HF0A 2LDUA 4D0PA 4ZZDA 1TQIA 3WTZA 1RZ4A 3TO9A 4KIGA 4WK8F 3I4PA 2V1XA 2M5WA 2EFQA 1F4KA 3MQ0A 1XGSA 3FXQA 3JAMZ 1IN7A 2DO7A 4GYGA 2VBWA 1BC7C 4LMYA 4MEXF 4IJAA 3RDIA 4AIHA 1BIAA 2DBBA 1K78A 2EV6A 2IP2A 2STTA 4KYWA 1KQ8A 5HLIA 4L9VA 1FPQA 3F6VA 2EK5A 4PCQA 1D8KA 2VC1A 4UVAA 3JSPA 1IN8A 5LRSA 2A6EF 3ROUA 3CUQC 4IHTA 2H09A 4CYDA 4M9SA 5BMZA 2O03A 2Z99A 2O3FA 2HWVA 3T5XA 5TJJA 3CUOA 3I53A 2J5PA 5D5UB 4R1HA 2G7HA 4BNCA 3GEZA 2Z9OA 4EM2A 5HS8A 2K7LA 2P6TA 3Q9SA 1U3EM 1BBYA 4ON0A 2ZKZA 1YLFA 4O5VA 4GO1A 3HRUA 5ILUA 3LA3A 3E6CC 3E5UA 1QGPA 4IPAA 1TNTA 2RKHA 2NNNA 2D45A 1R1TA 3HUGA 4XSXF 2BV6A 5E1XA 2O6GE 3QAHA 3BWGA 3TDUC 1DPUA 1W7PA 2KJCA 4QLCU 1RNLA 2VT3A 5FD5A 1A04A 2H6BA 1TTYA 1P4XA 3H92A 3IRQA 5H20A 2P5LC 2A68F 2CW0F 4HLXA 1OYWA 2R7FA 1MD0A 4U88A 2QLZA 2FRHA 2BBYA 2MH9A 3FXRA 3IWFA 4P9UA 2V79A 5K5OA 3FMQA 3HIFA 2L01A 2UXNA 1T0FA 5HLHA 5D4SA 2XAJA 1R5HA 2P5VA 1LNWA 1SD6A 3RYPA 3QU3A 4UXNA 1MJAA 2OQGA 2VOOA 4GCVA 1V3FA 4CZZA 1W7PB 3SZPA 2W84A 2DAOA 4U7DA 4HV6A 1UHWA 4ZYEA 3J80Z 3FMSA 4UHTA 2HQNA 4A0ZA 4EJUA 4S05A 2XAQA 2D2WA 5FB2A 3MWMA 2A6HF 4KICA 1XMAA 2QBYA 2P8TA 3F23A 2EV0A 2EJRA 3LQRA 3WTSC 3VB2A 4YFKF 5DV5A 3ZMTA 2M8EA 2RVCA 2HEOA 2K02A 3JW4A 3M8FA 4P9FA 1T39A 2ZNZA 4UV8A 3VFZA 1SD5A 1LVAA 5E1ZB 3B02A 4DQ2A 1R00A 3QU6A 1X3UA 3J81K 2GA1A 4OIQF 4L0ZB 2MC3A 1JHHA 3DFGA 3B73A 2F2EA 3I59A 2CWEA 1BOAA 4ENMA 2Q0OA 1XCVA 1ZHFA 2MBFA 2M30A 4PDKA 1IRFA 2Y0MA 3BY6A 3E5XA 4HBLA 3MCZA 5ICFA 1HW1A 4FX0A 3CO6C 4KIBA 4MHGA 3ZPLA 4L0YB 2RC4A 2XRNA 3V8LA 4LB6B 3RPQA 1Z7UA 3MEXA 3HRTA 5D4RA 4YFXF 2XGXA 3MFKA 3BROA 4M6XA 1YQAA 1MJ9A 2ACJA 1ZN2A 1T38A 5F64A 3NRVA 3P9KA 1SD4A 3KCCA 1U5TA 2ZCWA 2PG4A 4AD9A 1IN4A 1YW9A 4BAYA 5DCFA 2HKXA 2O8XA 3DPTA 4TV7A 5BQTA 4EV0A 2FMLA 4MTDA 1AWCA 1DP7P 1O57A 3TOBA 4L9TA 1WQ2A 2JZYA 1P6RA 1ZARA 2MD5A 3QRFF 4LD5A 4L9NA 4PGHA 4ETSA 1BM9A 2FA5A 4KT5C 1RUOA 4Y13A 4B09A 3ZMVA 4I0BA 3U9GA 3E6MA 3M1EA 4IRIA 1HQCA 1FYMA 3ULQB 1STZA 5L3FA 3V7RA 2KIMA 3WODF 4MNUA 1MGTA 1JE8A 2IT0A 3EDPA 1J59A 5DUKA 5D8LB 3L7WA 1S3JA 2GZWA 1FBUA 3H3UA 3VOEA 3F8NA 2YR2A 1G3TA 1WWXA 3VEPA 5K5QA 4LLNA 2FBIA 2EFOA 2RV8A 3FWEA 3ISPA 3QP6A 2V1DA 5CVVA 1HXDA 1P2FA 2O61A 4M9XA 3ZMUA 1BI2A 2A3SA 2V1UA 3ZMZA 3DKWA 3CUQB 3L2CA 1CGPA 4CGZA 2EB7A 3KP3A 1Z6RA 3BPXA 1F9NA 3TQNA 5L3BA 2L4AA 1TQPA 1TW3A 3LAPA 2Q2EA 1FP1D 1B9MA 3J80K 1YS7A 2OZ6A 3V8JA 3D0SA 2DQLA 1ON1A 1ON2A 5HDGA 5FGMA 3EYYA 4LLGF 4HYEA 3T0YA 1CF7A 1R36A 1QQIA 5L3DA 4RAZA 3I5UA 3K2ZA 4L9JA 2VBXA 2YX4A 4HDUA 3FF5A 1W4MA 2IA1A 5JHUA 1MKMA 3P9CA 3IWZA 1J75A 1GVJA 2GWRA 4U0WA 3EUHA 3WTVC 2CGPA 4OIOF 3E97A 1AOYA 2HOEA 3WU1B 3K1NA 3FZVA 2GAUA 2WV0A 2ISZA 2XV4S 4XLNF 3U2RA 3K0LA 4MQ9F 3RYRA 2WWYA 3ZN1A 1ZRCA 1QO0D 1UCRA 5ICGA 2A07F 2HKOA 1HKTA 3ABTA 5D5XB 2P5KA 1IZ1A 2H94A 5E8GA 1IAWA 1QBJA 2BYVE 1CF7B 3SHFA 1B6AA 2UZKA 3F8FA 3P7NA 4L5IA 2FQ3A 2DK5A 5BOXA 1QNTA 4M9ZA 2ZFWA 4BHCA 1FYKA 4H0EA 4Z2YA 2RQPA 3R6SA 3GFIA 1IXRC 4UUVA 4M72A 5AIQA 3F72A 4YFNF 4LFUA 3GUDA 5ILSA 5D5VB 2FOKA 2XKOA 3ZMSA 3ABUA 1XD7A 3VODA 1I1SA 1T98A 3R0JA 1R5GA 3DV8A 3WU0A 1U6GA 4OMYA 3R4KA 5H6QA 4ENKA 1YW7A 3DPLC 4IRGA 3WTUC 5LHHA 4WX9A 4KMUX 5LGUA 5FLXK 2VODA 1KYZA 2A5YB 4N0BA 2IW5A 1J5YA 3W6KB 4R79A 1BN5A 4OIRF 4GGGA 2QUFA 4HA8A 2RDPA 3M7GA 1UB9A 1HW2A 1PDNC 5DYMA 2LSOA 2OZUA 3S2WA 4MTEA 2XAGA 1YS6A 4I02A 4HZFA 2R3SA 3GZ6A 2HGCA 3D5LA 5ERIA 2M87A 3COAC 2PMUA 3W6JB 2GA2A 3LSTA 5KK1A 3T8RA 1OYIA 1YTYA 5H6RA 1XMKA 3FM3A 4HX4A 4CHUA 1ZGJA 2D1HA 1BI0A 5CVJA 4CICA 3HOSA 2PI0A 1PP8F 2EA4A 3IL2A 3CLOA 3DP7A 1NHAA 4IVNA 4ENNA 4YG2F 2KJBA 2X4HA 3REOA 2LF7A 4CO8A 3K1PA 3L00A 3QP5A 4RB2C 2P6SA 4GXOA 1XDSA 2XAHA 3I71A 3HSEA 3LAJA 4ZYDA 3PQKA 4KDPA 2EFNA 4AWXB 4Q4ZF 5IT3A 1O3RA 4EGYA 1KU3A 1XGOA 4G7OF 1FYLA 4LK0F 4KMFA 3KZZA 2WTEA 4PGGA 5TRDA 2KIFA 3TO6A 2CG4A 3WG9A 4G9YA 2HR3A 3KP6A 4RAYA 5CLSA 4BXUA 1FT9A 2ADUA 2EFPA 1ONVA 1Z9CA 3CO7C 5K1YA 4JK1X 5ILVA 3KEQA 1E17A 1LEBA 3DF8A 1H9TA 1S7AA 3O3KA 3E5QA 3O6BB 4ZYGA 3M8EA 4LG0B 2HDCA 2Q8KA 5BPIA 1L0OC 3KFWX 2VXZA 4HF1A 2RNJA 2ZXJA 5LGNA 3H3ZA 5ICCA 2NAZA 1O7LA 1GXQA 4P5OA 1UFMA 4OMZA 2K86A 2XAFA 4CXFA 3P9IA 1TLHB 3SFZA 4A5MA 2X0LA 3TO7A 1FX7A 4I01A 2PJPA 3EQLF 1ZAOA 3HSFA 5J8CA 5JVTA 1FY7A 3QPTA 1I27A 2UWMA 5CVUA 3TKYA 2QENA 4KIFA 4WWCA 2XIGA 3TOAA 3QPHA 4HF2A 2VOPA 4Q48A 3F8MA 3C18A 2L4MA 5CVIA 2NYXA 2JRTA 1P4WA 3NEUA 2DT5A 3K9TA 3JTHA 1FOKA 2AXLA 2LF8A 2NS0A 2MLKA 1IUYA 2E7WA 2NRAC 2D1VA 3KLOA 5DD8A 5E1WA 2FE3A 2YX7A 1MZBA 2ZO4A 4Q47A 1XSVA 4IRHA 3I0TA 1ZLJA 1OPCA 5ICEA 3C1DA 1YYVA 2ESNA 3HHHA 1VTNC 1ZG3A 2QVOA 5FLXZ 2P7CB 4AIJA 1IN5A 3Q5FA 3WGHA 3F22A 4OINF 3CUQA 2W24A 2GXGA 1FSHA 3GX4X 3KEOA 2CYYA 2PEXA 2Z33A 2PN6A 2MA3A 1EH7A 5F6FA 1RIOH 4IF4A 4YIIA 4G7ZF 2R7DA 1B1BA 2G9WA 2FNAA 2P4WA 4RB0A 4EJWA 4ZH4F 1BJAA 1LDDA 2IA2A 3GO5A 1G3WA 4LJZF 1XN7A 5K5RA 1LQ1A 1Q1HA 3OOPA 5D6EA 3GFLA 2V6CA 2FF4A 3OV8A 3IKVA 1U78A 1PP7U 1V4RA 2DW4A 2F5DA 3LFKA 3ZQ7A 1USTA 1IF1A 1W7PD 4ESJA 2RN7A 4LB5A 3C7JA 3GXOA 2VE9A 2QQBA 5AIPA 4NHJA 5LLQA 4UVBA 3F21A 4I09A 2Y75A 2JPCA 4RGXA 1XGMA 2GIVA 3WTXC 4RB1A 3HYIA 1U2WA 3L9FA 2CQKA 3T1BA 2CO5A 2K4JA 2COMA 4GYIA 4L18B 4Y15A 5JR3A 2DFIA 2W85A 5FD6A 2DPDA 5HS9A 1RI7A 5DEQA 2K4BA 3WE3A 3DXJF 1S7OA 2JSCA 2HYFA 1SFUA 4OU0A 4LLLA 4G6DA 5HOOA 3FXUA 3O2PE 5DD4A 2F5EA 1KU7A 2KRFA 2RGVA 4WXCA 2F5CA 2HS5A 5DCMB 3WTWC 4RGSA 1B9NA 5J8FA 3FHZA 4HX8A 2FBHA 2OAZA 1DUXC 2EWNA 1F1ZA 3WTTC 2HQRA 1KU9A 4P55A 4N9IA 2FU4A 3KP4A 2XKPA 1G3YA 1KGSA 2VC0A 1EH6A 2IVMA 5LRRA 2ZNYA 1FNNA 2FSWA 2FBKA 1KU2A 1EH8A 2DU9A 3DEUA 1IXCA 4HW0A 3IRRA 3AAFA 3NQOA 1Z05A 1LJ9A 1F5TA 1GXPA 1ZGAA 2Y48A 2JT1A 5KVRA 4WXDA 3R0AA 1P4AA 2JPBA 5E17F 1YW8A 3FX3A 3R61A 4IXAA 4M74A 4ENJA 5L3CA 1U8RA 4EJOA 3FMRA 3HRMA 3GF2A 4A0YA 1SMYF 2QWWA 5D5WB 1HKQA 1D8JA 1XB4A 1U5TC 1BC8C 1OR7A 3N4MA 4UNOA 4HQEA 4G8XA 4NQWA 3CTAA 2B0LA 4QWQA 1SD7A 3BZ6A 2DLLA 2E1NA 2CFXA 4G7HF 1TQMA 4LK1F 3ECHA 2FXAA 2VONA 3HHGA 1H9GA 3KP7A 1S8NA 3WTYC 3ERED 2DTRA 4AVPA 3RIRA 1XSDA 1IN6A 4FT8A 1FBQA 3TGNA 5CYVA 2Z3YA 1QZYA 3KE2A 3BP8A 4RB3C 3BJAA 4LGWA 4RGUA 4BHBA 2NNYA 4OIPF 2M45A 1R22A
chains in the Genus database with same CATH superfamily
3CF2A 4M73A 5HLGA 4II3A 3GCMA 3PNTA 2VBYA 3JR9A 2VXDA 2MYSA 3BJ6A 1R1UA 2M1BA 2L9NA 2ZBKA 1I5ZA 2BOLA 4XLPF 3F8BA 1FOXA 5A2QK 2W57A 1EV7A 1R6RA 3MAJA 3A0HC 5LBQA 4U0YA 4BXXJ 1XPXA 1OJLA 3HSRA 5TGTA 3E3VA 2DI3A 2Y9YA 3LSIA 2O0YA 1MBKA 1YG2A 1UHMA 3T8TA 2EV5A 4MEYF 4WF2A 1AHDP 4FX4A 1REPC 4IQ4A 2C6YA 3PFIA 4NC7A 1S29A 5F04A 2HTSA 4NQWB 1ORKA 3VYTB 2DCEA 4L5JA 3ZXSA 1K79A 4KFCA 5HDKA 4EJTA 5EEGA 1X19A 3WE2A 3ZQCA 1G4DA 1JHFA 2E1CA 1WVRA 4ZTFA 4UUTA 4F3QA 4HAMA 1WRJA 1T6SA 3S16J 2HTJA 4A5NA 2IS6A 3BCAA 5KCMA 1K78B 4O3MA 3RKQA 4KN7X 2GIZA 4DZJA 3G71I 5CVRA 3CZ6A 1OISA 5LHGA 5EEHA 3CP8A 4ZDPA 3LQQA 4EM0B 4EEFG 1FSEA 3C3WA 1ZQ3P 1G3SA 4XSZF 3U1DA 4AIKA 3MKZA 3W2AA 2M4KA 3M9AA 1KYWA 5IT9K 3BTCA 1Y1WJ 1PUEE 4YIFA 2HXOA 2EILH 4MFDA 4ZDOA 4FETA 3R60A 5C4JJ 3WU2C 2AS5F 1TW2A 2VBZA 1Y0UA 2X1EA 1K83J 1X1CA 1FP2A 2AO9A 2ID6A 4J19A 2HOSA 1A5JA 2VE8A 2KIUA 4UV9A 3BDDA 4EM1A 1R23A 3RCOA 2X48A 1IDYA 2DA2A 5IYCJ 4G6QA 2A69F 4LG0A 5FFZA 3FXMA 1QZZA 1WJCA 2IJLA 3DWLE 6PAXA 2JA2A 1O7FA 4RM2A 2CMPA 5C3EJ 3X2QH 2OV7A 4DBQA 3LA2A 3GYHX 3GWZA 3GVAA 3AG2H 3J7AO 5GPCA 3BPVA 3AG3H 4S04A 3MZHA 5LEJA 4BGDA 1WJBA 2AHQA 2XF5A 3RJPA 2PQ8A 4M6VA 2CUFA 2HDDA 3ZQQA 4K2EA 4A69C 3KP2A 4A0XA 3L1PA 4EMSA 3KETA 3CC2I 1UMQA 2DA4A 5EZHA 1D1AA 3IUOA 3FXLA 3EPZA 1KQ0A 1OMIA 5HS7A 2WY7Q 1HW5A 1TL8A 3FK6A 1LFPA 3GLLA 1H0MA 1J7KA 4HX7A 4LIUA 2RAEA 1IUFA 1J2XA 4U7BA 1T2KA 2H27A 2ELJA 3GLXA 4PJJA 2IA0A 1A36A 3BT9A 1HBXG 3AL0C 4DW6A 2M8GX 2ECCA 1CGPA 2EFWA 4OOIA 2XASA 1ZG5A 3F6OA 4LOCA 1W1WE 1GLNA 2DPUA 2IPQX 4M6YA 3UR3C 1OLTA 4XMYA 1RESA 4C30A 2ZXHA 4ITVA 2ZSHB 5E18F 1DPRA 2K9LA 1IRXA 2PLYA 3I9V2 5FO5A 1TWHJ 2MABA 2QYOA 2CV2A 2L02A 3RTRA 3CMAI 1VF9A 5B1BH 2ME6A 3OYBA 3IKTA 4A3IJ 1XSXA 4DGWB 1P9QC 5BS6A 1IXSB 4PJMA 1K6OA 1WPKA 2IGNA 3BG3A 3GZNB 4CYCA 3SQNA 4ESBA 2E2IJ 2MGQA 1SFEA 3S2HJ 4N9HA 2CSOA 3HGGA 5HDNA 3OYNA 1YFHA 4XRFA 1ETXA 1SANA 2QQ8A 3RKXA 2ZJRF 1W0UA 2XSDC 3BG6A 4JQFA 1UG2A 1R7JA 3MD2A 1XCBA 3H1CA 1MMAA 4E7IA 3NWTA 3SJMA 5ED4A 1QHGA 2HPIA 2OQRA 2XUBA 2XROA 4G94A 4IHSA 2F5FA 3DU6A 4X1EA 2R5ZB 2CW7A 2Y0SN 3BZCA 1MMGA 4WXHA 1D1BA 3GTMJ 2WV1A 4JBAA 3A01B 1JGSA 1Z1DA 2ZMEA 3KYLA 1MNMC 4Y7NJ 2F6CA 2XPVA 3V4GA 1BI1A 3ML6A 2KHMA 4C3HJ 4P96A 4BU2A 3BLYA 1FWZA 2V1NA 3V7SA 1T33A 3PL8A 1ZYRF 3FM5A 4UVCA 3HGYA 4GRIA 1PVEA 1USSA 3GW2A 1R1VA 4MGRA 2JSPA 4EJVA 4ZZLA 4A6EA 5TISC 1YHQI 5M5XJ 3RPUA 2XVCA 2H1LA 3B6AA 1HSTA 2GQQA 1LB2A 1K7AA 1OCTC 3NARA 2VI6A 3SXYA 4F7ZA 2R7VA 3GZ5A 2GXBA 2CQQA 2ETHA 1ZREA 1ZG1A 3JAMK 1W5TA 3J7ZI 3I3LA 1WI9A 2L54A 5J6XA 2X51A 2QBYB 4XN3A 5J1UA 3VYSB 3S3OA 2OCEA 1SMTA 5FKNA 3RI4A 5GAEJ 2IAIA 4O6JA 1BJZA 4C2UA 1HC8A 1R5ID 3LSPA 1ODDA 1WH5A 3ZMDA 2JTVA 2VT2A 2LLKA 3GFJA 1G6NA 3W2WA 3RKYA 1WKMA 1FLIA 2EA2A 2V9PA 4EGZA 3H5RA 1A6QA 3DQVC 1PJRA 3GFMA 4PZJA 1UG0A 4CCJA 5L3GA 1WGXA 4D7MA 4R8HA 1HKSA 2DT6A 5IY5H 5AONA 1D5VA 2FEZA 4FCYA 2W25A 1FTZA 3BTIA 3MZYA 3ECOA 4BYYA 1RR8C 2ZMEB 4KN4X 1TNSA 1P92A 2KMUA 4II2A 1VQMI 3I59B 3KYDB 2STWA 2DK8A 3JRIA 1X2MA 1TBXA 2VQCA 4M3FA 3K4JA 3V7CA 4RS8A 3BC8A 5CPRB 3QOPA 1GHCA 1MIJA 4EVIA 5BPDA 2QKMB 3GTLJ 1I3QJ 4B8XA 1VQPI 2CQ7A 1YJ9I 4HLYA 3LSHA 3CJRB 5KAIC 4HOBA 2VN2A 2IRFG 1I6XA 4IOAF 4KITB 3HOVJ 2G7UA 1IC8A 2H6CA 4AM3A 3ELKA 1B8IA 2GOMA 3LWFA 2R93J 4Q5SF 2LTPA 1QPMA 3KLNA 4PSXA 3RKWA 3SDGA 2ISYA 5D6FA 2KL4A 3JREA 2RQQA 3HTUA 4Y17A 4IHVA 2E7XA 1DP3A 2E5ZA 3KZYA 1BI3A 1ZRDA 4GFBA 5B3SH 3E6DA 1MH3A 1G59A 1E0EA 1LDKB 1E2XA 2WAQA 4AYBA 1B72A 2ESHA 4RBOA 1S6LA 1LEAA 1BIBA 5A2QZ 3GTGJ 3HOWJ 1FBSA 3TBIA 4XBFA 1L3LA 2W1OA 4V2GA 5FLMJ 1OKRA 1LFBA 3BOQA 2J5OA 4E70A 2MLGA 1Z6TA 5LGTA 4PJLA 3D5SC 2V9VA 2LBFA 1WJDA 2EZHA 3IHUA 1W5SA 4YIRX 1D3YA 4WCGA 2PMZA 4I98B 1U5TB 3ZQLA 2JWTA 1O3QA 1ITYA 3Q9VA 2KKOA 1RUNA 1JGGA 2HYJA 4YELA 4I0AA 2LNBA 5H2FC 1R58A 3FDYA 1X4PA 3ZR8X 1Z91A 2O8KA 5F08A 2OBPA 5FFXA 2XAUA 4ABZA 4HQMA 2P7VB 4I2OA 2WC2A 1MBEA 3OSFA 1FZPB 1T56A 2UXXA 5E8IA 4DNCA 5DCMA 1IV6A 4XICA 3OIOA 2VKEA 4BH9A 3JSOA 1DU6A 3K70C 5B1AH 3G3ZA 1XGNA 2K3PA 3KP5A 4RA2A 3K4KA 3BG9A 5IT9Z 4U0VA 4M71A 3C2GA 4XORA 5LHIA 4H4KC 3WGIA 2JVGA 5HNHA 4MQVA 5CJ9A 1JXSA 4BHPA 1RKTA 2ELKA 5JFRA 1DGRM 5E20A 2YPRA 2L3DA 1HLVA 2R92J 4KNYA 2XSJC 1J0RA 2NXNB 3F8CA 2TDXA 3ABKH 1B59A 5JVGF 1BR1A 1SAXA 2PFBA 2B7EA 3FKJA 2ZJ2A 2XPWA 3NAUA 3TP3A 4XQFA 5F0HA 1AU7A 3N97A 4XIDA 2COBA 2NVUB 2PBIA 2OU2A 3S1QJ 4A3GJ 2BE5F 3BJOA 3LSJA 4AC0A 2DQRA 2XF7A 5F1RA 3KPHA 3TDZC 3CDHA 4E7HA 3LA7A 5HVQC 1MJBA 2CS3A 4A2UA 2E1MC 1HA8A 2QM3A 3V8KA 4BBRJ 5LEKA 1G8XA 1HSJA 3IC7A 3DBHB 4FHTA 2LBFB 1WSUA 2VPLA 3PQJA 5D8KB 4ZYHA 1B4AA 2YU3A 3I64A 3JTGA 1JKQC 1QVTA 1V55H 4B4CA 3HTSB 3D1NI 1NH3A 3H36A 1MDMA 1SFXA 2ELHA 2Z5UA 3K70D 3OYDA 3MKYB 2MH2A 5B5EC 1XS9A 1KQ9A 2K9NA 2EZIA 1IW7F 2ID3A 3F3XA 3HRSA 1WHUA 3I58A 4CDGA 3EYIA 1KA8A 3BQYA 1DDNA 3PSIA 1ULYA 1LDJA 4DYCA 4BQAA 2X9DA 5J4VA 2EIKH 1YO5C 2K27A 3BG5A 4XLHA 2VQGA 4A12A 2BGCA 4M3DA 3K69A 2JVHA 2QQ9A 1VQ9I 3WGGA 2IS2A 2FMYA 4RGRA 2HZTA 1YIOA 2CJJA 1ZRFA 3HZJA 4HV5A 5JHFA 4CGZA 3SZTA 3G73A 2A61A 2XC7A 3ZP5A 1O3SA 2FNPA 3CJNA 2HFHA 4KA4A 4BACA 2W4SA 3K1MA 1T08B 2KISA 4NB5A 4A6DA 1IV8A 3LMMA 2KDOA 4ASNA 3MVPA 3MKLA 5HNFA 3OL3A 4BL0B 3Q0UA 2R7QA 4EQQA 2BEOA 4KJZA 1IRGA 5FRMA 1OYYA 3QOEA 1NG7A 3I54A 3L09A 1XDUA 2VIXA 1SVMA 4XONA 2FOWA 4HDVA 3E6BA 5JI6A 2YSRA 2E60A 2XHKA 3K7AJ 4I7HA 3J7YJ 5DUIA 4IHXA 2OA4A 2HOAA 1ZLKA 5GAGJ 1O3TA 4XLAA 1ZH5A 2QQAA 4KUMA 2QZ8A 1C0WA 2HYGD 2E5NA 4ESFA 2LKPA 5L3EA 3CLQA 3OWTA 2IGKA 3IH2A 3J81Z 3ZN0A 2VUMJ 4A3LJ 1FC3A 5DDGA 3HOTA 1K4SA 1MDMB 2OD5A 3FXOA 2DJIA 1I1GA 1J9IA 2LREA 3EETA 2PMHA 4HF0A 3S2DJ 2TCTA 1H89C 2LDUA 2MW8A 1MH4A 4D0PA 4ZZDA 1TQIA 3WTZA 1RZ4A 4XRMA 3TO9A 3OYMA 3HOXJ 4KIGA 4C2TA 2Y69H 4BBSJ 3A0BC 3S8PA 4WK8F 2R7OA 2DOFA 3J7AY 3AL0B 3I4PA 4UY8I 4JYKA 2V1XA 2M5WA 2LFBA 2HVSA 2EFQA 2AQEA 3MQ0A 1F4KA 1XGSA 3FXQA 1VQ5I 3JAMZ 2A05A 1IN7A 2K5CA 2DO7A 3I56I 4GYGA 2VBWA 1BC7C 4LMYA 1N25A 2CUJA 4MEXF 4IJAA 5F27A 4AU7A 3RDIA 2DA5A 3HJEA 4AIHA 2RREA 1BIAA 2DBBA 1YITI 1K78A 5LD2C 2EV6A 2IP2A 2STTA 4KYWA 5JLWA 1KQ8A 2DMPA 4LIVA 3OYHA 5HLIA 4L9VA 2L9VA 1FPQA 3F6VA 4NC8A 2EK5A 3CMEI 2ZC2A 4PCQA 1D8KA 3HEFA 2VC1A 4UVAA 4C2MJ 1IN8A 3JSPA 4XM3A 3TW6A 2A6EF 5LRSA 1LE8B 3ROUA 4FASD 3CUQC 2Y2ZA 2H09A 4IHTA 4XKWA 4CYDA 4M9SA 5BMZA 2K9QA 1OCCH 2O03A 2Z99A 2O3FA 2HWVA 3T5XA 5TJJA 3S1RJ 3CUOA 3I53A 2J5PA 1JT6A 5D5UB 4R1HA 2G7HA 2QA4I 4BNCA 2L9RA 3GEZA 2Z9OA 4EM2A 5HS8A 2K7LA 2VKDA 3M1CA 3CCVI 2P6TA 2Z16A 3OY9A 3Q9SA 1ENHA 1U3EM 1BBYA 2O7OA 2GLOA 2QSHX 3FKIJ 3BTJA 2HQ5A 4ON0A 5IYBJ 4B44A 3GTJJ 2ZKZA 1YLFA 4O5VA 1Z7LA 4GO1A 3HRUA 5ILUA 3LA3A 3S93A 4UUSB 3E6CC 3E5UA 1QGPA 1MMDA 4IPAA 1TNTA 2VKVA 1VQLI 2RKHA 2NNNA 2D45A 1R1TA 2LKXA 2EH3A 3Q0VA 3HUGA 1E3PA 3DTKA 3QYBA 2JA5J 4XSXF 5KAFC 2BV6A 5K7FA 5EGOB 4BQQA 2V7FA 1TT0A 5E1XA 2LY2A 2O6GE 2WAQN 3QAHA 3AG1H 4AYBN 2FQ4A 4Z6YA 3BWGA 3G1OA 3TDUC 1ZTRA 1DPUA 3FK7A 2KP6A 3TP0A 2JUCA 5GAHJ 1W7PA 1OQYA 2KJCA 3DBRB 4BEHA 4QLCU 4PSWA 1RNLA 3PFYA 2VT3A 3Q0WA 5FD5A 2XPUA 5F0CA 2EINH 1A04A 2H6BA 1TTYA 2VPRA 2OUMA 1YRNA 1P4XA 3HC7A 1XTAA 4LG3A 2DXIA 3H92A 3IRQA 2DDAA 5H20A 1VZ0A 2M0CA 3KYCB 2P5LC 2A68F 5EZGA 3BQZA 1XMXA 1ZELA 2CW0F 4HLXA 5CQGA 4DJAA 3PIPF 3RQIA 4X6AJ 1OYWA 2R7FA 2VB6A 1MD0A 4XN0A 4DYQA 3MMYB 4U88A 2DMTA 4RAGA 2QLZA 2FRHA 5J4YA 2BBYA 2Z2SB 4BE1A 1POGA 2MH9A 3FXRA 3IWFA 4V19K 3CCSI 3OS2A 4P9UA 2V79A 5HODA 2V9KA 5K7ZA 5K5OA 3FMQA 4BQOA 3HIFA 2L01A 2UXNA 1T0FA 3A1YA 3VYUB 1VQ6I 2FD5A 2R5ZA 1YIJI 1JKOC 5HLHA 5D4SA 1MBFA 2G0EA 2XAJA 2DFHA 3S15J 2DFEA 3HUGB 1R5HA 1DGWY 4S0HB 2P5VA 4F52A 3A01A 1SFKA 2JQ7A 3KX2A 4NNJA 3S14J 1LNWA 1SD6A 3RYPA 3BTLA 1X3WB 2I5UA 3OIQA 2IEKA 1GUUA 3QU3A 4I6ZA 4FE7A 4UXNA 1MJAA 3QQAA 3W2VA 2BXZA 2OQGA 1MMNA 1X1BA 2VOOA 1ETWA 4GCVA 5M3MJ 1V3FA 4CZZA 1AA7A 1W7PB 1MBGA 4BEHB 3SZPA 4BKXA 2W84A 2DAOA 3EUHC 4U7DA 2QSGX 4HV6A 2L9SA 4F91B 3CCQI 1UHWA 4ZYEA 3J80Z 1YRNB 2R7ZJ 2F4IA 3FMSA 4UHTA 2HQNA 3TMOA 1YOVB 4A0ZA 4EJUA 4S05A 2H8RA 3PSFA 2XAQA 2D2WA 3HDDA 5FB2A 1ZKGA 3MWMA 3CMMA 1TZLA 1JUSA 2A6HF 3M07A 4KICA 1XMAA 5J3LA 2QBYA 2P8TA 3F23A 4HPQA 4HNUA 1BA5A 1I50J 1XG1A 1Y1VJ 2EV0A 2EJRA 3LQRA 4YRVA 3WTSC 2HQAA 3VB2A 4YFKF 1LUJB 5DV5A 2ECBA 3ZMTA 2M8EA 2NVXJ 1Y6IA 4XK4A 3VPRA 2B63J 3G1LA 3OYGA 1OCPA 3GTQJ 2RVCA 2HEOA 2K02A 3JW4A 3M8FA 2KIQA 4P9FA 4PK4A 3IV5A 4HG2A 2ZNZA 1T39A 4UV8A 1VQNI 3VFZA 1SD5A 2BY3A 3G2BA 1LVAA 5E1ZB 3B02A 2E1OA 3C2HA 4DQ2A 1R00A 3CCLI 4B1RA 3QU6A 4Y52J 1X3UA 3J81K 2GA1A 4OIQF 4L0ZB 3BR5A 1OCZH 2MC3A 1VQ4I 5IP6A 1JHHA 1GV2A 3DFGA 3SDBA 3B73A 2F2EA 3I59A 4NC6A 2CWEA 4A3JJ 3JCUC 3ONQA 1BOAA 4ENMA 3W3CA 2VJJA 2WAEA 2LD5A 2Q0OA 4GDFA 4BJTA 1XCVA 1ZHFA 2R0QC 1Y8RB 2HZDA 2MBFA 2M30A 2XGEA 4PDKA 1IRFA 2Y0MA 3BY6A 2ZXIA 4D7NA 3H3VK 3E5XA 3O8GA 2DYSH 2R7TA 4HBLA 3WHBA 2WB1A 1QZEA 3MCZA 3A02A 1WJAA 5ICFA 4XKBA 1ZGWA 4RLQA 1HW1A 1OR7C 4FX0A 3CO6C 4KIBA 4MHGA 3ZPLA 4L0YB 1OCOH 2DTZA 3I4NJ 2E1MB 2ZJQF 5IOYA 3VWBA 2RC4A 1JUMA 3QYEA 2E36A 3FHNA 4A3CJ 1VQ7I 2NVYJ 2BZTA 2IBDA 1MSFC 1LKXA 2XRNA 3V8LA 3OR2C 1MNEA 2ZXWH 1HOMA 4LB6B 5M5WJ 2K9MA 4CUGA 3RPQA 1Z7UA 2L7KA 1GV5A 3MEXA 5FKLA 1I39A 3HRTA 5D4RA 4YFXF 2KRCA 2XGXA 3MFKA 3LSGA 2V6EA 3BROA 4M6XA 2EZLA 2HOTA 4BUPA 1YQAA 1MJ9A 4JP0A 3PM1A 3F0CA 3L2WA 3CCJI 2ACJA 2NVTJ 5EF6A 1ZN2A 1T38A 3CDIA 5F64A 4BJ5C 3NRVA 5J47A 1R71A 4QPOA 2IS4A 3P9KA 1SD4A 3KCCA 4XLEA 1U5TA 2ZCWA 2PG4A 4CCKA 4AD9A 1IN4A 1YW9A 2NS7A 3CMYA 4BAYA 4FISA 1VNDA 3TW7A 4M3GA 5DCFA 3A03A 3DKYA 3H0GJ 1BR4A 1YI2I 5KNLA 5E3LA 1VQKI 2HKXA 2O8XA 3DPTA 4TV7A 5BQTA 4F93B 1MBHA 3PO3J 4EV0A 2FMLA 4MTDA 5BNGA 1AWCA 4UB8C 1F36A 1DP7P 2E35A 1Y8QB 3O8HA 3S1MJ 1O57A 3TOBA 2Y30A 1WQ2A 4L9TA 1GVDA 3MN2A 4E7ZA 2R7SA 3ZQIA 2WY8Q 3S3NA 4NUBA 2JZYA 1P6RA 1ZARA 2MD5A 3QRFF 4LD5A 4L9NA 4PGHA 4XR6A 4ETSA 2X6YA 1BM9A 4FE4A 3A2KA 2FA5A 2L7FP 4KT5C 5GPAA 1EA3A 1RUOA 2ZJPF 4Y13A 3JRBA 4B09A 3ZMVA 4I0BA 1DU0A 3FISA 3U9GA 1FIAA 3E6MA 3M1EA 4IRIA 1RPWA 1HQCA 3K10A 1FYMA 3ULQB 1STZA 3ERMA 3V7RA 1V5FA 2GBYA 2KIMA 3KZIC 3DU5A 5L3FA 3OYAA 1D0YA 3WODF 1EKEA 3RZDJ 2R5YA 4MNUA 1WZ2A 1MGTA 1JE8A 2WADA 3EUAA 1A31A 1D5YA 3EDPA 3KEYA 2IT0A 3DEWA 1J59A 5DUKA 5D8LB 2RNGA 1VFCA 1D0ZA 3L7WA 1S3JA 2GZWA 1FBUA 3H3UA 3VOEA 5FRNA 3F8NA 2E34A 2YR2A 2F4OB 2X85A 3P5JA 2A6TA 1G3TA 1WWXA 2IGMA 3HM5A 3VEPA 3H9QA 5K5QA 4LLNA 2FBIA 2EFOA 2CUZA 2Q1ZB 2F4MB 2RV8A 3FWEA 3ISPA 3QP6A 4I76A 2V1DA 5CVVA 1HXDA 2ZSIB 4XKCA 1P2FA 2O61A 4KT6A 4BJ6C 5GTIC 4M9XA 3ZMUA 1Z3XA 1BI2A 4IZZA 1FEXA 2A3SA 2V1UA 3ZMZA 4AIDA 5EJCA 4B3AA 4A93J 3DKWA 3CUQB 3L2CA 2KLOA 5J1RA 5E3OA 4IX7A 1APLC 2EB7A 2MC4A 1Z6RA 3BPXA 3KP3A 4A3BJ 1F9NA 3TQNA 5L3BA 2L4AA 3BR6A 5IPAA 1TQPA 1TW3A 4RMNA 2Q2EA 3LAPA 1FP1D 1B9MA 3J80K 2EIMH 1UJ8A 1YS7A 1ACIA 1Z67A 2OZ6A 3V8JA 3OS1A 3D0SA 3VSKA 2K3FA 3JRCA 2CQNA 3H5AA 3B6CA 2DQLA 1ON1A 1ON2A 2R7XA 5GP9A 4FTHA 1ETYA 5HDGA 3HOZJ 1MSEC 5FGMA 3EYYA 1ETKA 2R5YB 2HPMA 1TWCJ 4LLGF 4HYEA 3T0YA 1CF7A 1R36A 1QQIA 5L3DA 4RAZA 3I5UA 4IO9F 3E1SA 1G2HA 4MFEA 3K2ZA 4L9JA 2VBXA 3OYJA 4E7SA 2YX4A 2NOGA 5E3NA 4LITA 3S32A 4HDUA 3FF5A 1W4MA 2IA1A 5JHUA 1MKMA 1SEUA 3P9CA 4XRSA 3MKWB 2WBMA 1X58A 3IWZA 2DMQA 1J75A 2EQRA 3CP2A 1JJ6C 1RC9A 5E79C 1GDTA 1GVJA 4L5EA 2GWRA 4PUSA 4U0WA 1I6HJ 3EUHA 5C4XJ 1X3ZB 1F43A 1PUFA 5KHDA 2IGOA 1MBJA 3OR1C 3WTVC 2CGPA 4OIOF 2ZMEC 1V5EA 3E97A 3G4SI 4A3EJ 1AOYA 2HOEA 3WU1B 3K1NA 3FZVA 1JTYA 2GAUA 2LC2A 3OOUA 5DS9A 2Q2EB 4ZDLA 2WV0A 3UNGC 2ISZA 1HF0A 3K4BA 2XV4S 1ZR2A 2BHYA 1X1AA 4XLNF 3U2RA 3K0LA 4MQ9F 1BOBA 3RYRA 2X6WA 4DBRA 3DBLB 3PNYA 2WWYA 4IHYA 4J00A 3ZN1A 1ZRCA 1QO0D 1UCRA 4BS9A 1LE8A 5ICGA 2A07F 3IAS2 2HKOA 3IH3A 1HKTA 3RSNA 3M8JA 3ABTA 5D5XB 2O5RA 2P5KA 4QSHA 1IZ1A 1DQUA 2H94A 5E8GA 1IAWA 1QBJA 2BYVE 4BDYA 1CF7B 2CW8A 1B6AA 4XOPA 3SHFA 2UZKA 3F8FA 3P7NA 4L5IA 4YEJA 1WH7A 2FQ3A 2DK5A 5BOXA 1QNTA 3BZKA 2K85A 1BL0A 3CCEI 2L7MP 2WB1N 4M9ZA 3PJRA 2ZFWA 4HSTA 2JK3A 2IXSA 4BHCA 1FYKA 4QIWN 4H0EA 4Z2YA 2RQPA 3R6SA 3GFIA 2BVMA 3WHCA 4KISA 1IXRC 4BY7J 4UUVA 4M72A 5AIQA 4UUSA 2BVLA 2GM4A 2R7UA 1VI0A 3F72A 1JKPC 4XOTA 4YFNF 3ABLH 1QU3A 4LFUA 3GUDA 5ILSA 1TWAJ 3AKZA 1PUFB 2FX0A 5D5VB 2FOKA 4D5FA 5M3FJ 3L2UA 5EGOA 2XKOA 3ZMSA 2WAFA 4IQJA 2D5VA 3GTPJ 3ABUA 2JA8J 1E3HA 2CFOA 2O9LA 1WJFA 1XD7A 3RPUD 3VODA 1FJLA 1I1SA 5J40A 1T98A 2DOEA 3R0JA 1R5GA 3PNVA 2W82A 3DV8A 1JJ8C 1GT0C 4B3XA 3WU0A 1U6GA 4OMYA 5IYDJ 3R4KA 5H6QA 1QHHD 2DYRH 4ENKA 1YW7A 3DPLC 2XB0X 3K4LA 3ASOH 4IRGA 3WTUC 4F92B 1AKHA 5LHHA 4WX9A 4KMUX 5LGUA 2DN0A 1IO2A 5FLXK 2BHZA 2VODA 1FIPA 1N77A 3F9KA 1KYZA 1D0XA 2A5YB 4JX4A 2LOOA 4N0BA 2NS8A 2IW5A 3OIPA 2YS9A 5DM7F 1J5YA 3W6KB 3FXJA 3CCUI 4R79A 5K7HA 2Y31A 1Z77A 1BN5A 1W5CC 1NTCA 2VL8A 1BR2A 3NWSA 4OIRF 4GGGA 2QUFA 4HA8A 2X1DA 3CQZJ 2JUGA 2RDPA 3CD6I 3M7GA 3LNQA 1UB9A 1HW2A 1PDNC 5DYMA 2LSOA 2OZUA 3S2WA 4MTEA 2XAGA 1YS6A 4I02A 2W00A 4HZFA 1ETOA 5IP7J 2R3SA 3GZ6A 3CCYA 3GMEA 2HGCA 1R49A 3D5LA 2PJRB 1RKWA 2DA3A 3K4NA 5ERIA 1MMSA 2M87A 1BW5A 3COAC 2CUEA 2CV1A 1HDPA 2PMUA 2KDZA 2H8WA 2EZKA 2V4JC 4BQNA 2JJ7A 4IOCF 2EIJH 3W6JB 2GA2A 3LSTA 4JX5A 5KK1A 3I4MJ 3HXLA 2M7BA 3T8RA 3L2QA 1OYIA 2HXIA 1YTYA 5DM6F 5H6RA 1TWFJ 1XMKA 4QPQA 3FM3A 4HX4A 3CESA 1YE9A 1KONA 1X4OA 1BI0A 1ZGJA 2D1HA 2DMNA 3FIWA 5CVJA 1LVKA 4CICA 3HOSA 3HB9A 2KPMA 3QPLA 1A35A 4C9YA 1AKHB 2PI0A 1PP8F 2W48A 3IP4B 5E3MA 3JRGA 2VLAA 3FXKA 4UB6C 2EA4A 4C3JJ 3CLOA 3IL2A 2LH9A 3DP7A 3QWLA 2DJNA 1NHAA 1WI3A 2PMZN 4IVNA 1P7JA 4ENNA 1XC5A 2X6OA 4YG2F 4IL6C 2E2HJ 2KJBA 2X4HA 2JA7J 3REOA 2LF7A 4CO8A 2VKHA 1BW6A 2BY0A 3K1PA 3L00A 3QP5A 2DA1A 4Y3OA 1SFOJ 3CCMI 2MG4A 4RB2C 2XDVA 1CQTA 1ERDA 3ZGKA 3RQ4A 2P6SA 4GXOA 1XDSA 2XAHA 2IS1A 3I71A 3HSEA 3LAJA 5CKTA 3SZGA 2KQRA 4ZYDA 2R7RA 1QVUA 3PQKA 4KDPA 1TT5B 2EFNA 4AWXB 1FMVA 5EYRA 3CF5F 2M0MA 4Q4ZF 2M34A 5IT3A 1O3RA 4EGYA 1KU3A 3H9JA 1XGOA 3IH4A 3UKGA 5FLVA 4G7OF 4G12A 3E7LA 3I55I 1FYLA 2BW3A 1SAUA 1U0JA 4LK0F 1NG6A 2CH0A 3SYTA 2DFFA 2EBIA 4KMFA 3KZZA 2WTEA 4PGGA 5TRDA 4PFPA 4DZPA 2KIFA 3TO6A 2LYCA 1V54H 2CG4A 2L2OA 3WG9A 4G9YA 2HR3A 3KP6A 4RAYA 1T95A 5CLSA 2DMUA 2OCCH 2OC6A 3K4CA 3DTIA 4DOZA 3PO2J 4BXUA 5FJ8J 1FOYA 2LR8A 1FT9A 2OPTA 4JOMA 2B9SA 2ADUA 2EFPA 2UV1A 1X2NA 3BG7A 4ZYAA 4NBQA 1LFUP 4A3FJ 4XLCA 4B48A 1ONVA 1Z9CA 2DOAA 2VQHA 2ME0A 3CO7C 1WCMJ 5K1YA 4JK1X 5ILVA 2I8DA 5IOZA 1FMWA 3KEQA 2WA0A 1E17A 1M1EB 1LEBA 2ZB9A 3DF8A 4CHUA 1K61A 3D5RC 1H9TA 1S7AA 1TWGJ 2M7AA 3QYFA 2Z1DA 1E3OC 1H8AC 3O3KA 2ZFUA 1I3AA 4OWRB 4FQGA 2VJIA 3E5QA 3O6BB 4ZYGA 3M8EA 3H9GA 3LFUA 4LG0B 3CC4I 2HDCA 1HDDC 2LK2A 2Q8KA 5BPIA 1L0OC 3FBIB 3KFWX 2VXZA 4HF1A 1UZCA 2BW3B 4ZTJA 3HKZA 1SC7A 1EJ9A 3TL4X 4E6KG 2RNJA 1TC3C 2ZXJA 5B66C 2KZVA 1SVOA 4XRSG 5LGNA 3H3ZA 3OYLA 4IHWA 5ICCA 4HSRA 3BR2A 2NAZA 4XKVA 1O7LA 2BY2A 1GXQA 4P5OA 1UFMA 4PJ0C 4RLFA 4ZJZA 2K40A 1OCRH 4ANJA 4OMZA 1S72I 3LSKA 1S5LC 2OTJI 2K86A 4CZCA 1WFXA 2XAFA 3ZCOA 3JRFA 4CXFA 3P9IA 1TLHB 4BXFA 3SFIA 3SFZA 5HLTA 4A5MA 4CCMA 2X0LA 2HNHA 3TO7A 3K4MA 1FX7A 1N75A 1QRYA 4I01A 3G1MA 2PJPA 3EQLF 1ZAOA 3HSFA 5J8CA 5JVTA 3H35A 1FY7A 3QPTA 3SEQA 1Y39A 4MO7A 1I27A 2UWMA 5CVUA 3TKYA 4G6TB 2M4GA 2QENA 1K4TA 4KIFA 4WWCA 2XIGA 3TOAA 3QPHA 4F55A 4HF2A 2VOPA 4E7KA 3AFHA 4HNTA 4Q48A 3F8MA 3OSGA 3ZQGA 3C18A 2L4MA 5CVIA 2NYXA 2JRTA 1J09A 1P4WA 1Z0XA 4HNVA 2YUSA 1A6IA 3NEUA 2JMWA 3PIOF 1U9OA 3QPSA 5EG0A 4CYCB 2DT5A 3K9TA 5FKMA 3JTHA 3BR0A 4B47A 1FOKA 4D1QA 2AXLA 2LMDA 4P1WA 2LF8A 1R9TJ 2NS0A 2MLKA 2I10A 1IUYA 2E7WA 2NRAC 3BR3A 2MD0A 2CU7A 2D1VA 3KLOA 4ZC3A 2W7NA 1P7IA 5DD8A 5E1WA 2DT7B 2FE3A 2CRGA 4E7LA 1XX5A 2YX7A 1MZBA 2ZO4A 4U87A 4Q47A 1U9NA 2LY1A 1ETVA 4AVZA 1XSVA 4IRHA 4N4NB 4CCOA 2NOJB 1JTXA 3I0TA 3RZOJ 2E2JJ 3BR1A 4AUXA 1ZLJA 1OPCA 3LOCA 5JLXA 1Z21A 2DODA 5ICEA 1JT0A 3GBGA 3C1DA 1YYVA 3Q3SA 1UHSA 1QPIA 2ESNA 2P0WA 3HHHA 1VTNC 1ZG3A 3U21A 2QVOA 5FLXZ 3IAM2 2KT0A 2P7CB 1R4NB 3OL4A 4AIJA 2F48A 3DTEA 1IN5A 2GXAA 3Q5FA 4A3MJ 3WGHA 2XRLA 2PX9A 2QCOA 3F22A 4OINF 3CUQA 2W24A 2MFZA 2GXGA 3LL7A 5CQEA 1FSHA 2FJ1A 3GX4X 4RDUA 2JA6J 3KEOA 2CYYA 2PEXA 4IEJA 3U1KA 1YX3A 2FUG2 4D5CA 1X1PA 2Z33A 3HOYJ 4QTRA 3DLAA 2JN6A 4W97A 2PN6A 3HOUJ 4XNFA 2MA3A 3CJTB 1EH7A 2XGDA 5EG0B 1ZR4A 1YX5A 2V26A 5F6FA 2K9SA 1RIOH 5FROA 4IF4A 1IGNA 3ZQHA 1Z3YA 4YIIA 5IP9J 4G7ZF 2R7DA 3PUFA 3CC7I 4MLOA 5DTDA 2HDWA 1EF4A 1B1BA 2G9WA 2FNAA 2P4WA 3HG9A 4RB0A 3S1NJ 2UUZA 3ASNH 3N05A 4EJWA 4HEA2 1N78A 4ZH4F 1W36C 4E4HA 3VDXA 2OTLI 4XL9A 2HI3A 2OF7A 3JRAA 1IJWC 1BJAA 3HBLA 4PFOA 1JKRC 3E0JB 2H1KA 2Y9ZA 1LDDA 2IA2A 2HVQA 2VJ5A 5FKOA 2HVRA 3GO5A 1G3WA 2MSYA 4LJZF 2NVQJ 2AXTC 1XN7A 1U8BA 5K5RA 1RRJA 1LQ1A 1FOWA 1Q1HA 3OOPA 5D6EA 5F1JA 3GFLA 1MW7A 2FF4A 2V6CA 3OV8A 3IKVA 1T0FC 4RAFA 2N8GA 2LKSA 1U78A 3H5NA 2L7ZA 1PP7U 4CCNA 3DKXA 2LVSA 1V4RA 2DW4A 2F5DA 3LFKA 3ZQ7A 4M3EA 1USTA 1IF1A 1R4MB 1W7PD 3L2VA 5J1YA 4ESJA 4OAZA 2RN7A 4J01A 4LB5A 2LRDA 1X1DA 3C7JA 4W1UA 9ANTA 2QF7A 3GXOA 3DPUA 2L0KA 2TRTA 2VE9A 4IKFA 2QQBA 5AIPA 1B8IB 4NHJA 3K6GA 1FTTA 3AG4H 5LLQA 4UVBA 1D1CA 2LP0A 3F21A 1YJNI 4I09A 3A4CA 1HCRA 4Y4RA 2Y75A 2JPCA 4RGXA 3TEDA 1W36D 1XGMA 3MZ8A 4N4OB 3VSLA 2GIVA 1NK2P 3WTXC 4OAYA 1S7EA 4RB1A 3HYIA 4B43A 3OS0A 4A3KJ 5F0FA 1U2WA 1RR7A 2HU9A 5FKKA 3L9FA 2CQKA 1Q1VA 3ABMH 2VJ4A 3T1BA 4JX6A 3DCFA 1B72B 4E7JA 2CO5A 4RM3A 2K4JA 4BDZA 2COMA 2QSFX 4GYIA 3OYEA 4L18B 4Y15A 5GTHC 5JR3A 1SVLA 3W6VA 1Y0NA 3CJQB 2DFIA 2W85A 3WG7H 5FD6A 2DPDA 4PJNA 5HS9A 1TP4A 3M3YJ 2QEXI 1RI7A 4CSWA 2M3AA 2CQXA 5DEQA 2K4BA 4V2FA 1VQOI 3L2RA 3WE3A 3G6EI 3DLLF 3DXJF 2A5WA 1S7OA 3H0DA 2JSCA 2HYFA 1SFUA 1WJEA 2E71A 3DEEA 4A3DJ 4OU0A 4LLLA 4DIQA 4G6DA 5HOOA 3FXUA 3O2PE 1ETQA 1JI8A 5DD4A 2F5EA 1PYVA 1KU7A 2DA7A 2KRFA 2RGVA 2X6XA 2ICWG 4WXCA 2F5CA 2HS5A 5DCMB 1KZHA 4I99C 2P81A 3WTWC 3GTOJ 4RGSA 1B9NA 5J8FA 4Y33A 3FHZA 4HRIA 3S17J 2XF6A 4HX8A 2QGUA 4C3IJ 1RETA 3OYKA 2FBHA 2OAZA 1DUXC 2EWNA 1O4XA 1MNDA 1F1ZA 3WTTC 5EDNA 3ZQFA 2HQRA 1UELB 3OYFA 1KU9A 4P55A 3BCBA 4N9IA 2FU4A 3KP4A 3HKZN 3VYRB 2XKPA 3EUKL 1G3YA 2BY1A 2Y0SA 1KGSA 1WJ5A 2VC0A 2EPFA 1EH6A 1NK3P 2DA6A 2IVMA 5LRRA 5EEAA 2CV0A 4MIMA 2ZNYA 1FNNA 3CCRI 2FSWA 1S9HA 2FBKA 2OJED 1KU2A 3OYIA 3M4OJ 1EH8A 3PUBA 1IRZA 2DU9A 2X1CA 3DEUA 1IXCA 4M3BA 3GTKJ 4HW0A 3IRRA 3AAFA 3NQOA 1YJWI 4D9JA 1Z05A 3K2AA 2LY9A 4EATA 1LJ9A 1F5TA 4NDLA 1GXPA 1ZGAA 5C44J 3JRDA 2Y48A 2AQFA 2JT1A 5KVRA 2JRMA 4WXDA 3R0AA 3JRHA 1JUPA 1P4AA 2F5VA 2JPBA 3OYCA 3ZRGA 5E17F 2GOXB 4BE0A 1YW8A 3HPHA 3FX3A 3R61A 3QODA 2PJRA 4IXAA 3CDLA 4M74A 4ENJA 5L3CA 1U8RA 3ZOBA 3C2BA 4EJOA 1IG7A 3FMRA 3OMYA 4CA0A 3HRMA 2KZGA 4BE2A 3GF2A 4A0YA 1SMYF 2L5QA 2QWWA 1HKQA 5D5WB 2M2EA 3KIOA 3V42A 1D8JA 1XB4A 1U5TC 1BC8C 4DYRA 2YU9J 1OR7A 3N4MA 4UNOA 4HQEA 1OFCX 4G8XA 4NQWA 2VQLA 3CTAA 2B0LA 2BXYA 4QWQA 1SD7A 2M9HA 1IDZA 3BZ6A 2DLLA 2E19A 2VASA 2XB5A 2E1NA 4CCLA 3LSMA 3S3MA 2QKLB 1V5GA 2CFXA 4G7HF 1H88C 1TQMA 4X0GA 1W0TA 5LFAA 4LK1F 2KRHA 3ECHA 1T8IA 2FXAA 2LG4A 2VONA 4CH7A 3HHGA 1H9GA 2XGCA 3ESWB 3KP7A 1QA6A 3LSRA 1S8NA 1K6YA 4BY1J 2R4GA 4XLFA 5M5YJ 3WTYC 3ERED 2DTRA 4AVPA 1ZK8A 3RIRA 1XSDA 1IN6A 2KFDA 4FT8A 1Y56A 1FBQA 3FBNB 2DDBA 3TGNA 5CYVA 1VQ8I 2Z3YA 3SEZA 3HPGA 1QZYA 3HL2A 3KE2A 5GADJ 3BP8A 3BJAA 4LGWA 4RGUA 4RB3C 4BHBA 2NNYA 1UAAA 4OIPF 2R7WA 1LPQA 2M45A 1R22A
chains in the Genus database with same CATH topology
4M73A 5HLGA 2VBYA 3BJ6A 1R1UA 2M1BA 2ZBKA 1I5ZA 4XLPF 3F8BA 5A2QK 2W57A 1EV7A 3MAJA 5LBQA 4U0YA 3HSRA 3E3VA 2DI3A 2O0YA 1YG2A 1UHMA 3T8TA 2EV5A 4MEYF 4WF2A 4FX4A 1REPC 2C6YA 3PFIA 1S29A 1K79A 2HTSA 4KFCA 4L5JA 5HDKA 4EJTA 5EEGA 3WE2A 1G4DA 2E1CA 1JHFA 4HAMA 1WRJA 1T6SA 2HTJA 4A5NA 1K78B 4O3MA 4KN7X 5CVRA 5LHGA 5EEHA 3LQQA 4EM0B 1FSEA 3C3WA 1G3SA 4XSZF 3U1DA 4AIKA 3M9AA 1KYWA 5IT9K 1PUEE 4YIFA 3R60A 2AS5F 1TW2A 2VBZA 1Y0UA 1FP2A 2VE8A 2KIUA 4UV9A 3BDDA 4EM1A 1R23A 4G6QA 2A69F 4LG0A 5FFZA 1QZZA 6PAXA 2IJLA 1O7FA 3LA2A 3GYHX 3GWZA 3GVAA 3J7AO 3BPVA 3MZHA 4S04A 5LEJA 3RJPA 2PQ8A 4K2EA 3KP2A 4A0XA 4EMSA 3KETA 1KQ0A 1OMIA 5HS7A 1HW5A 1H0MA 1J7KA 4HX7A 2H27A 1J2XA 4U7BA 1T2KA 3GLXA 2IA0A 1HBXG 2EFWA 4OOIA 2XASA 1ZG5A 3F6OA 2DPUA 2IPQX 4M6YA 5E18F 1DPRA 2PLYA 5FO5A 2QYOA 2L02A 3RTRA 3IKTA 1XSXA 5BS6A 1IXSB 1K6OA 3SQNA 4ESBA 1SFEA 4N9HA 2CSOA 5HDNA 1YFHA 4XRFA 3RKXA 4JQFA 1R7JA 1XCBA 5ED4A 2XUBA 2OQRA 2XROA 4G94A 4IHSA 2F5FA 4WXHA 4JBAA 1JGSA 1Z1DA 2ZMEA 3V4GA 1BI1A 3ML6A 4P96A 1FWZA 3V7SA 1ZYRF 3FM5A 4UVCA 1USSA 4MGRA 3GW2A 1R1VA 4ZZLA 4EJVA 4A6EA 3RPUA 2XVCA 1HSTA 2GQQA 1LB2A 1K7AA 3SXYA 4F7ZA 3GZ5A 2GXBA 2ETHA 1ZREA 1ZG1A 3JAMK 1W5TA 1WI9A 2L54A 5J6XA 2QBYB 1SMTA 3RI4A 4O6JA 1ODDA 3ZMDA 2JTVA 2VT2A 3GFJA 1G6NA 3RKYA 1WKMA 1FLIA 2EA2A 4EGZA 3DQVC 3GFMA 4PZJA 5L3GA 4R8HA 1HKSA 5AONA 1D5VA 2FEZA 2W25A 3MZYA 3ECOA 4BYYA 2ZMEB 4KN4X 1TNSA 1P92A 3I59B 2STWA 2DK8A 1TBXA 3V7CA 4RS8A 3QOPA 1GHCA 4EVIA 5BPDA 4B8XA 4HLYA 4HOBA 2VN2A 2IRFG 1I6XA 2G7UA 2H6CA 3ELKA 3LWFA 4Q5SF 3KLNA 1QPMA 3RKWA 2ISYA 5D6FA 3HTUA 4Y17A 2E7XA 3KZYA 1BI3A 1ZRDA 3E6DA 1LDKB 1E2XA 2ESHA 1S6LA 1LEAA 1BIBA 5A2QZ 1FBSA 4XBFA 1L3LA 1OKRA 3BOQA 2J5OA 4E70A 2MLGA 1Z6TA 5LGTA 2V9VA 3IHUA 1W5SA 1D3YA 4WCGA 4I98B 1U5TB 1O3QA 3Q9VA 2KKOA 1RUNA 4I0AA 2LNBA 1R58A 1Z91A 2OBPA 5FFXA 4HQMA 2P7VB 4I2OA 2WC2A 1FZPB 2UXXA 5E8IA 4DNCA 5DCMA 4BH9A 3JSOA 3G3ZA 1XGNA 3KP5A 5IT9Z 4U0VA 4M71A 5LHIA 3WGIA 4MQVA 5CJ9A 1JXSA 4BHPA 5JFRA 5E20A 2YPRA 2L3DA 4KNYA 1J0RA 3F8CA 2TDXA 1B59A 1SAXA 2PFBA 2ZJ2A 3N97A 2PBIA 2OU2A 2BE5F 3BJOA 2DQRA 5F1RA 3TDZC 3CDHA 3LA7A 5HVQC 1MJBA 4A2UA 2QM3A 3V8KA 5LEKA 3IC7A 1HSJA 4FHTA 1WSUA 3PQJA 5D8KB 4ZYHA 1B4AA 2YU3A 3I64A 3JTGA 3HTSB 1MDMA 1SFXA 2ELHA 2Z5UA 2MH2A 1KQ9A 1IW7F 3F3XA 3HRSA 3I58A 4CDGA 3EYIA 1KA8A 1DDNA 1ULYA 1LDJA 4BQAA 1YO5C 2K27A 4A12A 2BGCA 3K69A 2QQ9A 3WGGA 2FMYA 4RGRA 2HZTA 1YIOA 1ZRFA 4HV5A 3SZTA 3G73A 2A61A 3ZP5A 1O3SA 2FNPA 3CJNA 2HFHA 4KA4A 3K1MA 4NB5A 4A6DA 4ASNA 4EQQA 2BEOA 1IRGA 1OYYA 3L09A 3I54A 1XDUA 4HDVA 3E6BA 5JI6A 2YSRA 2XHKA 4I7HA 5DUIA 2OA4A 1ZLKA 1O3TA 1ZH5A 2QQAA 4KUMA 2QZ8A 1C0WA 2HYGD 4ESFA 2LKPA 5L3EA 3J81Z 3ZN0A 1FC3A 5DDGA 3HOTA 1MDMB 2OD5A 1I1GA 1J9IA 3EETA 2PMHA 4HF0A 2LDUA 4D0PA 4ZZDA 1TQIA 3WTZA 1RZ4A 3TO9A 4KIGA 4WK8F 3I4PA 2V1XA 2M5WA 2EFQA 1F4KA 3MQ0A 1XGSA 3FXQA 3JAMZ 1IN7A 2DO7A 4GYGA 2VBWA 1BC7C 4LMYA 4MEXF 4IJAA 3RDIA 4AIHA 1BIAA 2DBBA 1K78A 2EV6A 2IP2A 2STTA 4KYWA 1KQ8A 5HLIA 4L9VA 1FPQA 3F6VA 2EK5A 4PCQA 1D8KA 2VC1A 4UVAA 3JSPA 1IN8A 5LRSA 2A6EF 3ROUA 3CUQC 4IHTA 2H09A 4CYDA 4M9SA 5BMZA 2O03A 2Z99A 2O3FA 2HWVA 3T5XA 5TJJA 3CUOA 3I53A 2J5PA 5D5UB 4R1HA 2G7HA 4BNCA 3GEZA 2Z9OA 4EM2A 5HS8A 2K7LA 2P6TA 3Q9SA 1U3EM 1BBYA 4ON0A 2ZKZA 1YLFA 4O5VA 4GO1A 3HRUA 5ILUA 3LA3A 3E6CC 3E5UA 1QGPA 4IPAA 1TNTA 2RKHA 2NNNA 2D45A 1R1TA 3HUGA 4XSXF 2BV6A 5E1XA 2O6GE 3QAHA 3BWGA 3TDUC 1DPUA 1W7PA 2KJCA 4QLCU 1RNLA 2VT3A 5FD5A 1A04A 2H6BA 1TTYA 1P4XA 3H92A 3IRQA 5H20A 2P5LC 2A68F 2CW0F 4HLXA 1OYWA 2R7FA 1MD0A 4U88A 2QLZA 2FRHA 2BBYA 2MH9A 3FXRA 3IWFA 4P9UA 2V79A 5K5OA 3FMQA 3HIFA 2L01A 2UXNA 1T0FA 5HLHA 5D4SA 2XAJA 1R5HA 2P5VA 1LNWA 1SD6A 3RYPA 3QU3A 4UXNA 1MJAA 2OQGA 2VOOA 4GCVA 1V3FA 4CZZA 1W7PB 3SZPA 2W84A 2DAOA 4U7DA 4HV6A 1UHWA 4ZYEA 3J80Z 3FMSA 4UHTA 2HQNA 4A0ZA 4EJUA 4S05A 2XAQA 2D2WA 5FB2A 3MWMA 2A6HF 4KICA 1XMAA 2QBYA 2P8TA 3F23A 2EV0A 2EJRA 3LQRA 3WTSC 3VB2A 4YFKF 5DV5A 3ZMTA 2M8EA 2RVCA 2HEOA 2K02A 3JW4A 3M8FA 4P9FA 1T39A 2ZNZA 4UV8A 3VFZA 1SD5A 1LVAA 5E1ZB 3B02A 4DQ2A 1R00A 3QU6A 1X3UA 3J81K 2GA1A 4OIQF 4L0ZB 2MC3A 1JHHA 3DFGA 3B73A 2F2EA 3I59A 2CWEA 1BOAA 4ENMA 2Q0OA 1XCVA 1ZHFA 2MBFA 2M30A 4PDKA 1IRFA 2Y0MA 3BY6A 3E5XA 4HBLA 3MCZA 5ICFA 1HW1A 4FX0A 3CO6C 4KIBA 4MHGA 3ZPLA 4L0YB 2RC4A 2XRNA 3V8LA 4LB6B 3RPQA 1Z7UA 3MEXA 3HRTA 5D4RA 4YFXF 2XGXA 3MFKA 3BROA 4M6XA 1YQAA 1MJ9A 2ACJA 1ZN2A 1T38A 5F64A 3NRVA 3P9KA 1SD4A 3KCCA 1U5TA 2ZCWA 2PG4A 4AD9A 1IN4A 1YW9A 4BAYA 5DCFA 2HKXA 2O8XA 3DPTA 4TV7A 5BQTA 4EV0A 2FMLA 4MTDA 1AWCA 1DP7P 1O57A 3TOBA 4L9TA 1WQ2A 2JZYA 1P6RA 1ZARA 2MD5A 3QRFF 4LD5A 4L9NA 4PGHA 4ETSA 1BM9A 2FA5A 4KT5C 1RUOA 4Y13A 4B09A 3ZMVA 4I0BA 3U9GA 3E6MA 3M1EA 4IRIA 1HQCA 1FYMA 3ULQB 1STZA 5L3FA 3V7RA 2KIMA 3WODF 4MNUA 1MGTA 1JE8A 2IT0A 3EDPA 1J59A 5DUKA 5D8LB 3L7WA 1S3JA 2GZWA 1FBUA 3H3UA 3VOEA 3F8NA 2YR2A 1G3TA 1WWXA 3VEPA 5K5QA 4LLNA 2FBIA 2EFOA 2RV8A 3FWEA 3ISPA 3QP6A 2V1DA 5CVVA 1HXDA 1P2FA 2O61A 4M9XA 3ZMUA 1BI2A 2A3SA 2V1UA 3ZMZA 3DKWA 3CUQB 3L2CA 1CGPA 4CGZA 2EB7A 3KP3A 1Z6RA 3BPXA 1F9NA 3TQNA 5L3BA 2L4AA 1TQPA 1TW3A 3LAPA 2Q2EA 1FP1D 1B9MA 3J80K 1YS7A 2OZ6A 3V8JA 3D0SA 2DQLA 1ON1A 1ON2A 5HDGA 5FGMA 3EYYA 4LLGF 4HYEA 3T0YA 1CF7A 1R36A 1QQIA 5L3DA 4RAZA 3I5UA 3K2ZA 4L9JA 2VBXA 2YX4A 4HDUA 3FF5A 1W4MA 2IA1A 5JHUA 1MKMA 3P9CA 3IWZA 1J75A 1GVJA 2GWRA 4U0WA 3EUHA 3WTVC 2CGPA 4OIOF 3E97A 1AOYA 2HOEA 3WU1B 3K1NA 3FZVA 2GAUA 2WV0A 2ISZA 2XV4S 4XLNF 3U2RA 3K0LA 4MQ9F 3RYRA 2WWYA 3ZN1A 1ZRCA 1QO0D 1UCRA 5ICGA 2A07F 2HKOA 1HKTA 3ABTA 5D5XB 2P5KA 1IZ1A 2H94A 5E8GA 1IAWA 1QBJA 2BYVE 1CF7B 3SHFA 1B6AA 2UZKA 3F8FA 3P7NA 4L5IA 2FQ3A 2DK5A 5BOXA 1QNTA 4M9ZA 2ZFWA 4BHCA 1FYKA 4H0EA 4Z2YA 2RQPA 3R6SA 3GFIA 1IXRC 4UUVA 4M72A 5AIQA 3F72A 4YFNF 4LFUA 3GUDA 5ILSA 5D5VB 2FOKA 2XKOA 3ZMSA 3ABUA 1XD7A 3VODA 1I1SA 1T98A 3R0JA 1R5GA 3DV8A 3WU0A 1U6GA 4OMYA 3R4KA 5H6QA 4ENKA 1YW7A 3DPLC 4IRGA 3WTUC 5LHHA 4WX9A 4KMUX 5LGUA 5FLXK 2VODA 1KYZA 2A5YB 4N0BA 2IW5A 1J5YA 3W6KB 4R79A 1BN5A 4OIRF 4GGGA 2QUFA 4HA8A 2RDPA 3M7GA 1UB9A 1HW2A 1PDNC 5DYMA 2LSOA 2OZUA 3S2WA 4MTEA 2XAGA 1YS6A 4I02A 4HZFA 2R3SA 3GZ6A 2HGCA 3D5LA 5ERIA 2M87A 3COAC 2PMUA 3W6JB 2GA2A 3LSTA 5KK1A 3T8RA 1OYIA 1YTYA 5H6RA 1XMKA 3FM3A 4HX4A 4CHUA 1ZGJA 2D1HA 1BI0A 5CVJA 4CICA 3HOSA 2PI0A 1PP8F 2EA4A 3IL2A 3CLOA 3DP7A 1NHAA 4IVNA 4ENNA 4YG2F 2KJBA 2X4HA 3REOA 2LF7A 4CO8A 3K1PA 3L00A 3QP5A 4RB2C 2P6SA 4GXOA 1XDSA 2XAHA 3I71A 3HSEA 3LAJA 4ZYDA 3PQKA 4KDPA 2EFNA 4AWXB 4Q4ZF 5IT3A 1O3RA 4EGYA 1KU3A 1XGOA 4G7OF 1FYLA 4LK0F 4KMFA 3KZZA 2WTEA 4PGGA 5TRDA 2KIFA 3TO6A 2CG4A 3WG9A 4G9YA 2HR3A 3KP6A 4RAYA 5CLSA 4BXUA 1FT9A 2ADUA 2EFPA 1ONVA 1Z9CA 3CO7C 5K1YA 4JK1X 5ILVA 3KEQA 1E17A 1LEBA 3DF8A 1H9TA 1S7AA 3O3KA 3E5QA 3O6BB 4ZYGA 3M8EA 4LG0B 2HDCA 2Q8KA 5BPIA 1L0OC 3KFWX 2VXZA 4HF1A 2RNJA 2ZXJA 5LGNA 3H3ZA 5ICCA 2NAZA 1O7LA 1GXQA 4P5OA 1UFMA 4OMZA 2K86A 2XAFA 4CXFA 3P9IA 1TLHB 3SFZA 4A5MA 2X0LA 3TO7A 1FX7A 4I01A 2PJPA 3EQLF 1ZAOA 3HSFA 5J8CA 5JVTA 1FY7A 3QPTA 1I27A 2UWMA 5CVUA 3TKYA 2QENA 4KIFA 4WWCA 2XIGA 3TOAA 3QPHA 4HF2A 2VOPA 4Q48A 3F8MA 3C18A 2L4MA 5CVIA 2NYXA 2JRTA 1P4WA 3NEUA 2DT5A 3K9TA 3JTHA 1FOKA 2AXLA 2LF8A 2NS0A 2MLKA 1IUYA 2E7WA 2NRAC 2D1VA 3KLOA 5DD8A 5E1WA 2FE3A 2YX7A 1MZBA 2ZO4A 4Q47A 1XSVA 4IRHA 3I0TA 1ZLJA 1OPCA 5ICEA 3C1DA 1YYVA 2ESNA 3HHHA 1VTNC 1ZG3A 2QVOA 5FLXZ 2P7CB 4AIJA 1IN5A 3Q5FA 3WGHA 3F22A 4OINF 3CUQA 2W24A 2GXGA 1FSHA 3GX4X 3KEOA 2CYYA 2PEXA 2Z33A 2PN6A 2MA3A 1EH7A 5F6FA 1RIOH 4IF4A 4YIIA 4G7ZF 2R7DA 1B1BA 2G9WA 2FNAA 2P4WA 4RB0A 4EJWA 4ZH4F 1BJAA 1LDDA 2IA2A 3GO5A 1G3WA 4LJZF 1XN7A 5K5RA 1LQ1A 1Q1HA 3OOPA 5D6EA 3GFLA 2V6CA 2FF4A 3OV8A 3IKVA 1U78A 1PP7U 1V4RA 2DW4A 2F5DA 3LFKA 3ZQ7A 1USTA 1IF1A 1W7PD 4ESJA 2RN7A 4LB5A 3C7JA 3GXOA 2VE9A 2QQBA 5AIPA 4NHJA 5LLQA 4UVBA 3F21A 4I09A 2Y75A 2JPCA 4RGXA 1XGMA 2GIVA 3WTXC 4RB1A 3HYIA 1U2WA 3L9FA 2CQKA 3T1BA 2CO5A 2K4JA 2COMA 4GYIA 4L18B 4Y15A 5JR3A 2DFIA 2W85A 5FD6A 2DPDA 5HS9A 1RI7A 5DEQA 2K4BA 3WE3A 3DXJF 1S7OA 2JSCA 2HYFA 1SFUA 4OU0A 4LLLA 4G6DA 5HOOA 3FXUA 3O2PE 5DD4A 2F5EA 1KU7A 2KRFA 2RGVA 4WXCA 2F5CA 2HS5A 5DCMB 3WTWC 4RGSA 1B9NA 5J8FA 3FHZA 4HX8A 2FBHA 2OAZA 1DUXC 2EWNA 1F1ZA 3WTTC 2HQRA 1KU9A 4P55A 4N9IA 2FU4A 3KP4A 2XKPA 1G3YA 1KGSA 2VC0A 1EH6A 2IVMA 5LRRA 2ZNYA 1FNNA 2FSWA 2FBKA 1KU2A 1EH8A 2DU9A 3DEUA 1IXCA 4HW0A 3IRRA 3AAFA 3NQOA 1Z05A 1LJ9A 1F5TA 1GXPA 1ZGAA 2Y48A 2JT1A 5KVRA 4WXDA 3R0AA 1P4AA 2JPBA 5E17F 1YW8A 3FX3A 3R61A 4IXAA 4M74A 4ENJA 5L3CA 1U8RA 4EJOA 3FMRA 3HRMA 3GF2A 4A0YA 1SMYF 2QWWA 5D5WB 1HKQA 1D8JA 1XB4A 1U5TC 1BC8C 1OR7A 3N4MA 4UNOA 4HQEA 4G8XA 4NQWA 3CTAA 2B0LA 4QWQA 1SD7A 3BZ6A 2DLLA 2E1NA 2CFXA 4G7HF 1TQMA 4LK1F 3ECHA 2FXAA 2VONA 3HHGA 1H9GA 3KP7A 1S8NA 3WTYC 3ERED 2DTRA 4AVPA 3RIRA 1XSDA 1IN6A 4FT8A 1FBQA 3TGNA 5CYVA 2Z3YA 1QZYA 3KE2A 3BP8A 4RB3C 3BJAA 4LGWA 4RGUA 4BHBA 2NNYA 4OIPF 2M45A 1R22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M73 A;  5HLG A;  2VBY A;  3BJ6 A;  1R1U A;  2M1B A;  2ZBK A;  1I5Z A;  4XLP F;  3F8B A;  5A2Q K;  2W57 A;  1EV7 A;  3MAJ A;  5LBQ A;  4U0Y A;  3HSR A;  3E3V A;  2DI3 A;  2O0Y A;  1YG2 A;  1UHM A;  3T8T A;  2EV5 A;  4MEY F;  4WF2 A;  4FX4 A;  1REP C;  2C6Y A;  3PFI A;  1S29 A;  1K79 A;  2HTS A;  4KFC A;  4L5J A;  5HDK A;  4EJT A;  5EEG A;  3WE2 A;  1G4D A;  2E1C A;  1JHF A;  4HAM A;  1WRJ A;  1T6S A;  2HTJ A;  4A5N A;  1K78 B;  4O3M A;  4KN7 X;  5CVR A;  5LHG A;  5EEH A;  3LQQ A;  4EM0 B;  1FSE A;  3C3W A;  1G3S A;  4XSZ F;  3U1D A;  4AIK A;  3M9A A;  1KYW A;  5IT9 K;  1PUE E;  4YIF A;  3R60 A;  2AS5 F;  1TW2 A;  2VBZ A;  1Y0U A;  1FP2 A;  2VE8 A;  2KIU A;  4UV9 A;  3BDD A;  4EM1 A;  1R23 A;  4G6Q A;  2A69 F;  4LG0 A;  5FFZ A;  1QZZ A;  6PAX A;  2IJL A;  1O7F A;  3LA2 A;  3GYH X;  3GWZ A;  3GVA A;  3J7A O;  3BPV A;  3MZH A;  4S04 A;  5LEJ A;  3RJP A;  2PQ8 A;  4K2E A;  3KP2 A;  4A0X A;  4EMS A;  3KET A;  1KQ0 A;  1OMI A;  5HS7 A;  1HW5 A;  1H0M A;  1J7K A;  4HX7 A;  2H27 A;  1J2X A;  4U7B A;  1T2K A;  3GLX A;  2IA0 A;  1HBX G;  2EFW A;  4OOI A;  2XAS A;  1ZG5 A;  3F6O A;  2DPU A;  2IPQ X;  4M6Y A;  5E18 F;  1DPR A;  2PLY A;  5FO5 A;  2QYO A;  2L02 A;  3RTR A;  3IKT A;  1XSX A;  5BS6 A;  1IXS B;  1K6O A;  3SQN A;  4ESB A;  1SFE A;  4N9H A;  2CSO A;  5HDN A;  1YFH A;  4XRF A;  3RKX A;  4JQF A;  1R7J A;  1XCB A;  5ED4 A;  2XUB A;  2OQR A;  2XRO A;  4G94 A;  4IHS A;  2F5F A;  4WXH A;  4JBA A;  1JGS A;  1Z1D A;  2ZME A;  3V4G A;  1BI1 A;  3ML6 A;  4P96 A;  1FWZ A;  3V7S A;  1ZYR F;  3FM5 A;  4UVC A;  1USS A;  4MGR A;  3GW2 A;  1R1V A;  4ZZL A;  4EJV A;  4A6E A;  3RPU A;  2XVC A;  1HST A;  2GQQ A;  1LB2 A;  1K7A A;  3SXY A;  4F7Z A;  3GZ5 A;  2GXB A;  2ETH A;  1ZRE A;  1ZG1 A;  3JAM K;  1W5T A;  1WI9 A;  2L54 A;  5J6X A;  2QBY B;  1SMT A;  3RI4 A;  4O6J A;  1ODD A;  3ZMD A;  2JTV A;  2VT2 A;  3GFJ A;  1G6N A;  3RKY A;  1WKM A;  1FLI A;  2EA2 A;  4EGZ A;  3DQV C;  3GFM A;  4PZJ A;  5L3G A;  4R8H A;  1HKS A;  5AON A;  1D5V A;  2FEZ A;  2W25 A;  3MZY A;  3ECO A;  4BYY A;  2ZME B;  4KN4 X;  1TNS A;  1P92 A;  3I59 B;  2STW A;  2DK8 A;  1TBX A;  3V7C A;  4RS8 A;  3QOP A;  1GHC A;  4EVI A;  5BPD A;  4B8X A;  4HLY A;  4HOB A;  2VN2 A;  2IRF G;  1I6X A;  2G7U A;  2H6C A;  3ELK A;  3LWF A;  4Q5S F;  3KLN A;  1QPM A;  3RKW A;  2ISY A;  5D6F A;  3HTU A;  4Y17 A;  2E7X A;  3KZY A;  1BI3 A;  1ZRD A;  3E6D A;  1LDK B;  1E2X A;  2ESH A;  1S6L A;  1LEA A;  1BIB A;  5A2Q Z;  1FBS A;  4XBF A;  1L3L A;  1OKR A;  3BOQ A;  2J5O A;  4E70 A;  2MLG A;  1Z6T A;  5LGT A;  2V9V A;  3IHU A;  1W5S A;  1D3Y A;  4WCG A;  4I98 B;  1U5T B;  1O3Q A;  3Q9V A;  2KKO A;  1RUN A;  4I0A A;  2LNB A;  1R58 A;  1Z91 A;  2OBP A;  5FFX A;  4HQM A;  2P7V B;  4I2O A;  2WC2 A;  1FZP B;  2UXX A;  5E8I A;  4DNC A;  5DCM A;  4BH9 A;  3JSO A;  3G3Z A;  1XGN A;  3KP5 A;  5IT9 Z;  4U0V A;  4M71 A;  5LHI A;  3WGI A;  4MQV A;  5CJ9 A;  1JXS A;  4BHP A;  5JFR A;  5E20 A;  2YPR A;  2L3D A;  4KNY A;  1J0R A;  3F8C A;  2TDX A;  1B59 A;  1SAX A;  2PFB A;  2ZJ2 A;  3N97 A;  2PBI A;  2OU2 A;  2BE5 F;  3BJO A;  2DQR A;  5F1R A;  3TDZ C;  3CDH A;  3LA7 A;  5HVQ C;  1MJB A;  4A2U A;  2QM3 A;  3V8K A;  5LEK A;  3IC7 A;  1HSJ A;  4FHT A;  1WSU A;  3PQJ A;  5D8K B;  4ZYH A;  1B4A A;  2YU3 A;  3I64 A;  3JTG A;  3HTS B;  1MDM A;  1SFX A;  2ELH A;  2Z5U A;  2MH2 A;  1KQ9 A;  1IW7 F;  3F3X A;  3HRS A;  3I58 A;  4CDG A;  3EYI A;  1KA8 A;  1DDN A;  1ULY A;  1LDJ A;  4BQA A;  1YO5 C;  2K27 A;  4A12 A;  2BGC A;  3K69 A;  2QQ9 A;  3WGG A;  2FMY A;  4RGR A;  2HZT A;  1YIO A;  1ZRF A;  4HV5 A;  3SZT A;  3G73 A;  2A61 A;  3ZP5 A;  1O3S A;  2FNP A;  3CJN A;  2HFH A;  4KA4 A;  3K1M A;  4NB5 A;  4A6D A;  4ASN A;  4EQQ A;  2BEO A;  1IRG A;  1OYY A;  3L09 A;  3I54 A;  1XDU A;  4HDV A;  3E6B A;  5JI6 A;  2YSR A;  2XHK A;  4I7H A;  5DUI A;  2OA4 A;  1ZLK A;  1O3T A;  1ZH5 A;  2QQA A;  4KUM A;  2QZ8 A;  1C0W A;  2HYG D;  4ESF A;  2LKP A;  5L3E A;  3J81 Z;  3ZN0 A;  1FC3 A;  5DDG A;  3HOT A;  1MDM B;  2OD5 A;  1I1G A;  1J9I A;  3EET A;  2PMH A;  4HF0 A;  2LDU A;  4D0P A;  4ZZD A;  1TQI A;  3WTZ A;  1RZ4 A;  3TO9 A;  4KIG A;  4WK8 F;  3I4P A;  2V1X A;  2M5W A;  2EFQ A;  1F4K A;  3MQ0 A;  1XGS A;  3FXQ A;  3JAM Z;  1IN7 A;  2DO7 A;  4GYG A;  2VBW A;  1BC7 C;  4LMY A;  4MEX F;  4IJA A;  3RDI A;  4AIH A;  1BIA A;  2DBB A;  1K78 A;  2EV6 A;  2IP2 A;  2STT A;  4KYW A;  1KQ8 A;  5HLI A;  4L9V A;  1FPQ A;  3F6V A;  2EK5 A;  4PCQ A;  1D8K A;  2VC1 A;  4UVA A;  3JSP A;  1IN8 A;  5LRS A;  2A6E F;  3ROU A;  3CUQ C;  4IHT A;  2H09 A;  4CYD A;  4M9S A;  5BMZ A;  2O03 A;  2Z99 A;  2O3F A;  2HWV A;  3T5X A;  5TJJ A;  3CUO A;  3I53 A;  2J5P A;  5D5U B;  4R1H A;  2G7H A;  4BNC A;  3GEZ A;  2Z9O A;  4EM2 A;  5HS8 A;  2K7L A;  2P6T A;  3Q9S A;  1U3E M;  1BBY A;  4ON0 A;  2ZKZ A;  1YLF A;  4O5V A;  4GO1 A;  3HRU A;  5ILU A;  3LA3 A;  3E6C C;  3E5U A;  1QGP A;  4IPA A;  1TNT A;  2RKH A;  2NNN A;  2D45 A;  1R1T A;  3HUG A;  4XSX F;  2BV6 A;  5E1X A;  2O6G E;  3QAH A;  3BWG A;  3TDU C;  1DPU A;  1W7P A;  2KJC A;  4QLC U;  1RNL A;  2VT3 A;  5FD5 A;  1A04 A;  2H6B A;  1TTY A;  1P4X A;  3H92 A;  3IRQ A;  5H20 A;  2P5L C;  2A68 F;  2CW0 F;  4HLX A;  1OYW A;  2R7F A;  1MD0 A;  4U88 A;  2QLZ A;  2FRH A;  2BBY A;  2MH9 A;  3FXR A;  3IWF A;  4P9U A;  2V79 A;  5K5O A;  3FMQ A;  3HIF A;  2L01 A;  2UXN A;  1T0F A;  5HLH A;  5D4S A;  2XAJ A;  1R5H A;  2P5V A;  1LNW A;  1SD6 A;  3RYP A;  3QU3 A;  4UXN A;  1MJA A;  2OQG A;  2VOO A;  4GCV A;  1V3F A;  4CZZ A;  1W7P B;  3SZP A;  2W84 A;  2DAO A;  4U7D A;  4HV6 A;  1UHW A;  4ZYE A;  3J80 Z;  3FMS A;  4UHT A;  2HQN A;  4A0Z A;  4EJU A;  4S05 A;  2XAQ A;  2D2W A;  5FB2 A;  3MWM A;  2A6H F;  4KIC A;  1XMA A;  2QBY A;  2P8T A;  3F23 A;  2EV0 A;  2EJR A;  3LQR A;  3WTS C;  3VB2 A;  4YFK F;  5DV5 A;  3ZMT A;  2M8E A;  2RVC A;  2HEO A;  2K02 A;  3JW4 A;  3M8F A;  4P9F A;  1T39 A;  2ZNZ A;  4UV8 A;  3VFZ A;  1SD5 A;  1LVA A;  5E1Z B;  3B02 A;  4DQ2 A;  1R00 A;  3QU6 A;  1X3U A;  3J81 K;  2GA1 A;  4OIQ F;  4L0Z B;  2MC3 A;  1JHH A;  3DFG A;  3B73 A;  2F2E A;  3I59 A;  2CWE A;  1BOA A;  4ENM A;  2Q0O A;  1XCV A;  1ZHF A;  2MBF A;  2M30 A;  4PDK A;  1IRF A;  2Y0M A;  3BY6 A;  3E5X A;  4HBL A;  3MCZ A;  5ICF A;  1HW1 A;  4FX0 A;  3CO6 C;  4KIB A;  4MHG A;  3ZPL A;  4L0Y B;  2RC4 A;  2XRN A;  3V8L A;  4LB6 B;  3RPQ A;  1Z7U A;  3MEX A;  3HRT A;  5D4R A;  4YFX F;  2XGX A;  3MFK A;  3BRO A;  4M6X A;  1YQA A;  1MJ9 A;  2ACJ A;  1ZN2 A;  1T38 A;  5F64 A;  3NRV A;  3P9K A;  1SD4 A;  3KCC A;  1U5T A;  2ZCW A;  2PG4 A;  4AD9 A;  1IN4 A;  1YW9 A;  4BAY A;  5DCF A;  2HKX A;  2O8X A;  3DPT A;  4TV7 A;  5BQT A;  4EV0 A;  2FML A;  4MTD A;  1AWC A;  1DP7 P;  1O57 A;  3TOB A;  4L9T A;  1WQ2 A;  2JZY A;  1P6R A;  1ZAR A;  2MD5 A;  3QRF F;  4LD5 A;  4L9N A;  4PGH A;  4ETS A;  1BM9 A;  2FA5 A;  4KT5 C;  1RUO A;  4Y13 A;  4B09 A;  3ZMV A;  4I0B A;  3U9G A;  3E6M A;  3M1E A;  4IRI A;  1HQC A;  1FYM A;  3ULQ B;  1STZ A;  5L3F A;  3V7R A;  2KIM A;  3WOD F;  4MNU A;  1MGT A;  1JE8 A;  2IT0 A;  3EDP A;  1J59 A;  5DUK A;  5D8L B;  3L7W A;  1S3J A;  2GZW A;  1FBU A;  3H3U A;  3VOE A;  3F8N A;  2YR2 A;  1G3T A;  1WWX A;  3VEP A;  5K5Q A;  4LLN A;  2FBI A;  2EFO A;  2RV8 A;  3FWE A;  3ISP A;  3QP6 A;  2V1D A;  5CVV A;  1HXD A;  1P2F A;  2O61 A;  4M9X A;  3ZMU A;  1BI2 A;  2A3S A;  2V1U A;  3ZMZ A;  3DKW A;  3CUQ B;  3L2C A;  1CGP A;  4CGZ A;  2EB7 A;  3KP3 A;  1Z6R A;  3BPX A;  1F9N A;  3TQN A;  5L3B A;  2L4A A;  1TQP A;  1TW3 A;  3LAP A;  2Q2E A;  1FP1 D;  1B9M A;  3J80 K;  1YS7 A;  2OZ6 A;  3V8J A;  3D0S A;  2DQL A;  1ON1 A;  1ON2 A;  5HDG A;  5FGM A;  3EYY A;  4LLG F;  4HYE A;  3T0Y A;  1CF7 A;  1R36 A;  1QQI A;  5L3D A;  4RAZ A;  3I5U A;  3K2Z A;  4L9J A;  2VBX A;  2YX4 A;  4HDU A;  3FF5 A;  1W4M A;  2IA1 A;  5JHU A;  1MKM A;  3P9C A;  3IWZ A;  1J75 A;  1GVJ A;  2GWR A;  4U0W A;  3EUH A;  3WTV C;  2CGP A;  4OIO F;  3E97 A;  1AOY A;  2HOE A;  3WU1 B;  3K1N A;  3FZV A;  2GAU A;  2WV0 A;  2ISZ A;  2XV4 S;  4XLN F;  3U2R A;  3K0L A;  4MQ9 F;  3RYR A;  2WWY A;  3ZN1 A;  1ZRC A;  1QO0 D;  1UCR A;  5ICG A;  2A07 F;  2HKO A;  1HKT A;  3ABT A;  5D5X B;  2P5K A;  1IZ1 A;  2H94 A;  5E8G A;  1IAW A;  1QBJ A;  2BYV E;  1CF7 B;  3SHF A;  1B6A A;  2UZK A;  3F8F A;  3P7N A;  4L5I A;  2FQ3 A;  2DK5 A;  5BOX A;  1QNT A;  4M9Z A;  2ZFW A;  4BHC A;  1FYK A;  4H0E A;  4Z2Y A;  2RQP A;  3R6S A;  3GFI A;  1IXR C;  4UUV A;  4M72 A;  5AIQ A;  3F72 A;  4YFN F;  4LFU A;  3GUD A;  5ILS A;  5D5V B;  2FOK A;  2XKO A;  3ZMS A;  3ABU A;  1XD7 A;  3VOD A;  1I1S A;  1T98 A;  3R0J A;  1R5G A;  3DV8 A;  3WU0 A;  1U6G A;  4OMY A;  3R4K A;  5H6Q A;  4ENK A;  1YW7 A;  3DPL C;  4IRG A;  3WTU C;  5LHH A;  4WX9 A;  4KMU X;  5LGU A;  5FLX K;  2VOD A;  1KYZ A;  2A5Y B;  4N0B A;  2IW5 A;  1J5Y A;  3W6K B;  4R79 A;  1BN5 A;  4OIR F;  4GGG A;  2QUF A;  4HA8 A;  2RDP A;  3M7G A;  1UB9 A;  1HW2 A;  1PDN C;  5DYM A;  2LSO A;  2OZU A;  3S2W A;  4MTE A;  2XAG A;  1YS6 A;  4I02 A;  4HZF A;  2R3S A;  3GZ6 A;  2HGC A;  3D5L A;  5ERI A;  2M87 A;  3COA C;  2PMU A;  3W6J B;  2GA2 A;  3LST A;  5KK1 A;  3T8R A;  1OYI A;  1YTY A;  5H6R A;  1XMK A;  3FM3 A;  4HX4 A;  4CHU A;  1ZGJ A;  2D1H A;  1BI0 A;  5CVJ A;  4CIC A;  3HOS A;  2PI0 A;  1PP8 F;  2EA4 A;  3IL2 A;  3CLO A;  3DP7 A;  1NHA A;  4IVN A;  4ENN A;  4YG2 F;  2KJB A;  2X4H A;  3REO A;  2LF7 A;  4CO8 A;  3K1P A;  3L00 A;  3QP5 A;  4RB2 C;  2P6S A;  4GXO A;  1XDS A;  2XAH A;  3I71 A;  3HSE A;  3LAJ A;  4ZYD A;  3PQK A;  4KDP A;  2EFN A;  4AWX B;  4Q4Z F;  5IT3 A;  1O3R A;  4EGY A;  1KU3 A;  1XGO A;  4G7O F;  1FYL A;  4LK0 F;  4KMF A;  3KZZ A;  2WTE A;  4PGG A;  5TRD A;  2KIF A;  3TO6 A;  2CG4 A;  3WG9 A;  4G9Y A;  2HR3 A;  3KP6 A;  4RAY A;  5CLS A;  4BXU A;  1FT9 A;  2ADU A;  2EFP A;  1ONV A;  1Z9C A;  3CO7 C;  5K1Y A;  4JK1 X;  5ILV A;  3KEQ A;  1E17 A;  1LEB A;  3DF8 A;  1H9T A;  1S7A A;  3O3K A;  3E5Q A;  3O6B B;  4ZYG A;  3M8E A;  4LG0 B;  2HDC A;  2Q8K A;  5BPI A;  1L0O C;  3KFW X;  2VXZ A;  4HF1 A;  2RNJ A;  2ZXJ A;  5LGN A;  3H3Z A;  5ICC A;  2NAZ A;  1O7L A;  1GXQ A;  4P5O A;  1UFM A;  4OMZ A;  2K86 A;  2XAF A;  4CXF A;  3P9I A;  1TLH B;  3SFZ A;  4A5M A;  2X0L A;  3TO7 A;  1FX7 A;  4I01 A;  2PJP A;  3EQL F;  1ZAO A;  3HSF A;  5J8C A;  5JVT A;  1FY7 A;  3QPT A;  1I27 A;  2UWM A;  5CVU A;  3TKY A;  2QEN A;  4KIF A;  4WWC A;  2XIG A;  3TOA A;  3QPH A;  4HF2 A;  2VOP A;  4Q48 A;  3F8M A;  3C18 A;  2L4M A;  5CVI A;  2NYX A;  2JRT A;  1P4W A;  3NEU A;  2DT5 A;  3K9T A;  3JTH A;  1FOK A;  2AXL A;  2LF8 A;  2NS0 A;  2MLK A;  1IUY A;  2E7W A;  2NRA C;  2D1V A;  3KLO A;  5DD8 A;  5E1W A;  2FE3 A;  2YX7 A;  1MZB A;  2ZO4 A;  4Q47 A;  1XSV A;  4IRH A;  3I0T A;  1ZLJ A;  1OPC A;  5ICE A;  3C1D A;  1YYV A;  2ESN A;  3HHH A;  1VTN C;  1ZG3 A;  2QVO A;  5FLX Z;  2P7C B;  4AIJ A;  1IN5 A;  3Q5F A;  3WGH A;  3F22 A;  4OIN F;  3CUQ A;  2W24 A;  2GXG A;  1FSH A;  3GX4 X;  3KEO A;  2CYY A;  2PEX A;  2Z33 A;  2PN6 A;  2MA3 A;  1EH7 A;  5F6F A;  1RIO H;  4IF4 A;  4YII A;  4G7Z F;  2R7D A;  1B1B A;  2G9W A;  2FNA A;  2P4W A;  4RB0 A;  4EJW A;  4ZH4 F;  1BJA A;  1LDD A;  2IA2 A;  3GO5 A;  1G3W A;  4LJZ F;  1XN7 A;  5K5R A;  1LQ1 A;  1Q1H A;  3OOP A;  5D6E A;  3GFL A;  2V6C A;  2FF4 A;  3OV8 A;  3IKV A;  1U78 A;  1PP7 U;  1V4R A;  2DW4 A;  2F5D A;  3LFK A;  3ZQ7 A;  1UST A;  1IF1 A;  1W7P D;  4ESJ A;  2RN7 A;  4LB5 A;  3C7J A;  3GXO A;  2VE9 A;  2QQB A;  5AIP A;  4NHJ A;  5LLQ A;  4UVB A;  3F21 A;  4I09 A;  2Y75 A;  2JPC A;  4RGX A;  1XGM A;  2GIV A;  3WTX C;  4RB1 A;  3HYI A;  1U2W A;  3L9F A;  2CQK A;  3T1B A;  2CO5 A;  2K4J A;  2COM A;  4GYI A;  4L18 B;  4Y15 A;  5JR3 A;  2DFI A;  2W85 A;  5FD6 A;  2DPD A;  5HS9 A;  1RI7 A;  5DEQ A;  2K4B A;  3WE3 A;  3DXJ F;  1S7O A;  2JSC A;  2HYF A;  1SFU A;  4OU0 A;  4LLL A;  4G6D A;  5HOO A;  3FXU A;  3O2P E;  5DD4 A;  2F5E A;  1KU7 A;  2KRF A;  2RGV A;  4WXC A;  2F5C A;  2HS5 A;  5DCM B;  3WTW C;  4RGS A;  1B9N A;  5J8F A;  3FHZ A;  4HX8 A;  2FBH A;  2OAZ A;  1DUX C;  2EWN A;  1F1Z A;  3WTT C;  2HQR A;  1KU9 A;  4P55 A;  4N9I A;  2FU4 A;  3KP4 A;  2XKP A;  1G3Y A;  1KGS A;  2VC0 A;  1EH6 A;  2IVM A;  5LRR A;  2ZNY A;  1FNN A;  2FSW A;  2FBK A;  1KU2 A;  1EH8 A;  2DU9 A;  3DEU A;  1IXC A;  4HW0 A;  3IRR A;  3AAF A;  3NQO A;  1Z05 A;  1LJ9 A;  1F5T A;  1GXP A;  1ZGA A;  2Y48 A;  2JT1 A;  5KVR A;  4WXD A;  3R0A A;  1P4A A;  2JPB A;  5E17 F;  1YW8 A;  3FX3 A;  3R61 A;  4IXA A;  4M74 A;  4ENJ A;  5L3C A;  1U8R A;  4EJO A;  3FMR A;  3HRM A;  3GF2 A;  4A0Y A;  1SMY F;  2QWW A;  5D5W B;  1HKQ A;  1D8J A;  1XB4 A;  1U5T C;  1BC8 C;  1OR7 A;  3N4M A;  4UNO A;  4HQE A;  4G8X A;  4NQW A;  3CTA A;  2B0L A;  4QWQ A;  1SD7 A;  3BZ6 A;  2DLL A;  2E1N A;  2CFX A;  4G7H F;  1TQM A;  4LK1 F;  3ECH A;  2FXA A;  2VON A;  3HHG A;  1H9G A;  3KP7 A;  1S8N A;  3WTY C;  3ERE D;  2DTR A;  4AVP A;  3RIR A;  1XSD A;  1IN6 A;  4FT8 A;  1FBQ A;  3TGN A;  5CYV A;  2Z3Y A;  1QZY A;  3KE2 A;  3BP8 A;  4RB3 C;  3BJA A;  4LGW A;  4RGU A;  4BHB A;  2NNY A;  4OIP F;  2M45 A;  1R22 A; 
#chains in the Genus database with same CATH topology
 3CF2 A;  4M73 A;  5HLG A;  4II3 A;  3GCM A;  3PNT A;  2VBY A;  3JR9 A;  2VXD A;  2MYS A;  3BJ6 A;  1R1U A;  2M1B A;  2L9N A;  2ZBK A;  1I5Z A;  2BOL A;  4XLP F;  3F8B A;  1FOX A;  5A2Q K;  2W57 A;  1EV7 A;  1R6R A;  3MAJ A;  3A0H C;  5LBQ A;  4U0Y A;  4BXX J;  1XPX A;  1OJL A;  3HSR A;  5TGT A;  3E3V A;  2DI3 A;  2Y9Y A;  3LSI A;  2O0Y A;  1MBK A;  1YG2 A;  1UHM A;  3T8T A;  2EV5 A;  4MEY F;  4WF2 A;  1AHD P;  4FX4 A;  1REP C;  4IQ4 A;  2C6Y A;  3PFI A;  4NC7 A;  1S29 A;  5F04 A;  2HTS A;  4NQW B;  1ORK A;  3VYT B;  2DCE A;  4L5J A;  3ZXS A;  1K79 A;  4KFC A;  5HDK A;  4EJT A;  5EEG A;  1X19 A;  3WE2 A;  3ZQC A;  1G4D A;  1JHF A;  2E1C A;  1WVR A;  4ZTF A;  4UUT A;  4F3Q A;  4HAM A;  1WRJ A;  1T6S A;  3S16 J;  2HTJ A;  4A5N A;  2IS6 A;  3BCA A;  5KCM A;  1K78 B;  4O3M A;  3RKQ A;  4KN7 X;  2GIZ A;  4DZJ A;  3G71 I;  5CVR A;  3CZ6 A;  1OIS A;  5LHG A;  5EEH A;  3CP8 A;  4ZDP A;  3LQQ A;  4EM0 B;  4EEF G;  1FSE A;  3C3W A;  1ZQ3 P;  1G3S A;  4XSZ F;  3U1D A;  4AIK A;  3MKZ A;  3W2A A;  2M4K A;  3M9A A;  1KYW A;  5IT9 K;  3BTC A;  1Y1W J;  1PUE E;  4YIF A;  2HXO A;  2EIL H;  4MFD A;  4ZDO A;  4FET A;  3R60 A;  5C4J J;  3WU2 C;  2AS5 F;  1TW2 A;  2VBZ A;  1Y0U A;  2X1E A;  1K83 J;  1X1C A;  1FP2 A;  2AO9 A;  2ID6 A;  4J19 A;  2HOS A;  1A5J A;  2VE8 A;  2KIU A;  4UV9 A;  3BDD A;  4EM1 A;  1R23 A;  3RCO A;  2X48 A;  1IDY A;  2DA2 A;  5IYC J;  4G6Q A;  2A69 F;  4LG0 A;  5FFZ A;  3FXM A;  1QZZ A;  1WJC A;  2IJL A;  3DWL E;  6PAX A;  2JA2 A;  1O7F A;  4RM2 A;  2CMP A;  5C3E J;  3X2Q H;  2OV7 A;  4DBQ A;  3LA2 A;  3GYH X;  3GWZ A;  3GVA A;  3AG2 H;  3J7A O;  5GPC A;  3BPV A;  3AG3 H;  4S04 A;  3MZH A;  5LEJ A;  4BGD A;  1WJB A;  2AHQ A;  2XF5 A;  3RJP A;  2PQ8 A;  4M6V A;  2CUF A;  2HDD A;  3ZQQ A;  4K2E A;  4A69 C;  3KP2 A;  4A0X A;  3L1P A;  4EMS A;  3KET A;  3CC2 I;  1UMQ A;  2DA4 A;  5EZH A;  1D1A A;  3IUO A;  3FXL A;  3EPZ A;  1KQ0 A;  1OMI A;  5HS7 A;  2WY7 Q;  1HW5 A;  1TL8 A;  3FK6 A;  1LFP A;  3GLL A;  1H0M A;  1J7K A;  4HX7 A;  4LIU A;  2RAE A;  1IUF A;  1J2X A;  4U7B A;  1T2K A;  2H27 A;  2ELJ A;  3GLX A;  4PJJ A;  2IA0 A;  1A36 A;  3BT9 A;  1HBX G;  3AL0 C;  4DW6 A;  2M8G X;  2ECC A;  1CGP A;  2EFW A;  4OOI A;  2XAS A;  1ZG5 A;  3F6O A;  4LOC A;  1W1W E;  1GLN A;  2DPU A;  2IPQ X;  4M6Y A;  3UR3 C;  1OLT A;  4XMY A;  1RES A;  4C30 A;  2ZXH A;  4ITV A;  2ZSH B;  5E18 F;  1DPR A;  2K9L A;  1IRX A;  2PLY A;  3I9V 2;  5FO5 A;  1TWH J;  2MAB A;  2QYO A;  2CV2 A;  2L02 A;  3RTR A;  3CMA I;  1VF9 A;  5B1B H;  2ME6 A;  3OYB A;  3IKT A;  4A3I J;  1XSX A;  4DGW B;  1P9Q C;  5BS6 A;  1IXS B;  4PJM A;  1K6O A;  1WPK A;  2IGN A;  3BG3 A;  3GZN B;  4CYC A;  3SQN A;  4ESB A;  2E2I J;  2MGQ A;  1SFE A;  3S2H J;  4N9H A;  2CSO A;  3HGG A;  5HDN A;  3OYN A;  1YFH A;  4XRF A;  1ETX A;  1SAN A;  2QQ8 A;  3RKX A;  2ZJR F;  1W0U A;  2XSD C;  3BG6 A;  4JQF A;  1UG2 A;  1R7J A;  3MD2 A;  1XCB A;  3H1C A;  1MMA A;  4E7I A;  3NWT A;  3SJM A;  5ED4 A;  1QHG A;  2HPI A;  2OQR A;  2XUB A;  2XRO A;  4G94 A;  4IHS A;  2F5F A;  3DU6 A;  4X1E A;  2R5Z B;  2CW7 A;  2Y0S N;  3BZC A;  1MMG A;  4WXH A;  1D1B A;  3GTM J;  2WV1 A;  4JBA A;  3A01 B;  1JGS A;  1Z1D A;  2ZME A;  3KYL A;  1MNM C;  4Y7N J;  2F6C A;  2XPV A;  3V4G A;  1BI1 A;  3ML6 A;  2KHM A;  4C3H J;  4P96 A;  4BU2 A;  3BLY A;  1FWZ A;  2V1N A;  3V7S A;  1T33 A;  3PL8 A;  1ZYR F;  3FM5 A;  4UVC A;  3HGY A;  4GRI A;  1PVE A;  1USS A;  3GW2 A;  1R1V A;  4MGR A;  2JSP A;  4EJV A;  4ZZL A;  4A6E A;  5TIS C;  1YHQ I;  5M5X J;  3RPU A;  2XVC A;  2H1L A;  3B6A A;  1HST A;  2GQQ A;  1LB2 A;  1K7A A;  1OCT C;  3NAR A;  2VI6 A;  3SXY A;  4F7Z A;  2R7V A;  3GZ5 A;  2GXB A;  2CQQ A;  2ETH A;  1ZRE A;  1ZG1 A;  3JAM K;  1W5T A;  3J7Z I;  3I3L A;  1WI9 A;  2L54 A;  5J6X A;  2X51 A;  2QBY B;  4XN3 A;  5J1U A;  3VYS B;  3S3O A;  2OCE A;  1SMT A;  5FKN A;  3RI4 A;  5GAE J;  2IAI A;  4O6J A;  1BJZ A;  4C2U A;  1HC8 A;  1R5I D;  3LSP A;  1ODD A;  1WH5 A;  3ZMD A;  2JTV A;  2VT2 A;  2LLK A;  3GFJ A;  1G6N A;  3W2W A;  3RKY A;  1WKM A;  1FLI A;  2EA2 A;  2V9P A;  4EGZ A;  3H5R A;  1A6Q A;  3DQV C;  1PJR A;  3GFM A;  4PZJ A;  1UG0 A;  4CCJ A;  5L3G A;  1WGX A;  4D7M A;  4R8H A;  1HKS A;  2DT6 A;  5IY5 H;  5AON A;  1D5V A;  2FEZ A;  4FCY A;  2W25 A;  1FTZ A;  3BTI A;  3MZY A;  3ECO A;  4BYY A;  1RR8 C;  2ZME B;  4KN4 X;  1TNS A;  1P92 A;  2KMU A;  4II2 A;  1VQM I;  3I59 B;  3KYD B;  2STW A;  2DK8 A;  3JRI A;  1X2M A;  1TBX A;  2VQC A;  4M3F A;  3K4J A;  3V7C A;  4RS8 A;  3BC8 A;  5CPR B;  3QOP A;  1GHC A;  1MIJ A;  4EVI A;  5BPD A;  2QKM B;  3GTL J;  1I3Q J;  4B8X A;  1VQP I;  2CQ7 A;  1YJ9 I;  4HLY A;  3LSH A;  3CJR B;  5KAI C;  4HOB A;  2VN2 A;  2IRF G;  1I6X A;  4IOA F;  4KIT B;  3HOV J;  2G7U A;  1IC8 A;  2H6C A;  4AM3 A;  3ELK A;  1B8I A;  2GOM A;  3LWF A;  2R93 J;  4Q5S F;  2LTP A;  1QPM A;  3KLN A;  4PSX A;  3RKW A;  3SDG A;  2ISY A;  5D6F A;  2KL4 A;  3JRE A;  2RQQ A;  3HTU A;  4Y17 A;  4IHV A;  2E7X A;  1DP3 A;  2E5Z A;  3KZY A;  1BI3 A;  1ZRD A;  4GFB A;  5B3S H;  3E6D A;  1MH3 A;  1G59 A;  1E0E A;  1LDK B;  1E2X A;  2WAQ A;  4AYB A;  1B72 A;  2ESH A;  4RBO A;  1S6L A;  1LEA A;  1BIB A;  5A2Q Z;  3GTG J;  3HOW J;  1FBS A;  3TBI A;  4XBF A;  1L3L A;  2W1O A;  4V2G A;  5FLM J;  1OKR A;  1LFB A;  3BOQ A;  2J5O A;  4E70 A;  2MLG A;  1Z6T A;  5LGT A;  4PJL A;  3D5S C;  2V9V A;  2LBF A;  1WJD A;  2EZH A;  3IHU A;  1W5S A;  4YIR X;  1D3Y A;  4WCG A;  2PMZ A;  4I98 B;  1U5T B;  3ZQL A;  2JWT A;  1O3Q A;  1ITY A;  3Q9V A;  2KKO A;  1RUN A;  1JGG A;  2HYJ A;  4YEL A;  4I0A A;  2LNB A;  5H2F C;  1R58 A;  3FDY A;  1X4P A;  3ZR8 X;  1Z91 A;  2O8K A;  5F08 A;  2OBP A;  5FFX A;  2XAU A;  4ABZ A;  4HQM A;  2P7V B;  4I2O A;  2WC2 A;  1MBE A;  3OSF A;  1FZP B;  1T56 A;  2UXX A;  5E8I A;  4DNC A;  5DCM A;  1IV6 A;  4XIC A;  3OIO A;  2VKE A;  4BH9 A;  3JSO A;  1DU6 A;  3K70 C;  5B1A H;  3G3Z A;  1XGN A;  2K3P A;  3KP5 A;  4RA2 A;  3K4K A;  3BG9 A;  5IT9 Z;  4U0V A;  4M71 A;  3C2G A;  4XOR A;  5LHI A;  4H4K C;  3WGI A;  2JVG A;  5HNH A;  4MQV A;  5CJ9 A;  1JXS A;  4BHP A;  1RKT A;  2ELK A;  5JFR A;  1DGR M;  5E20 A;  2YPR A;  2L3D A;  1HLV A;  2R92 J;  4KNY A;  2XSJ C;  1J0R A;  2NXN B;  3F8C A;  2TDX A;  3ABK H;  1B59 A;  5JVG F;  1BR1 A;  1SAX A;  2PFB A;  2B7E A;  3FKJ A;  2ZJ2 A;  2XPW A;  3NAU A;  3TP3 A;  4XQF A;  5F0H A;  1AU7 A;  3N97 A;  4XID A;  2COB A;  2NVU B;  2PBI A;  2OU2 A;  3S1Q J;  4A3G J;  2BE5 F;  3BJO A;  3LSJ A;  4AC0 A;  2DQR A;  2XF7 A;  5F1R A;  3KPH A;  3TDZ C;  3CDH A;  4E7H A;  3LA7 A;  5HVQ C;  1MJB A;  2CS3 A;  4A2U A;  2E1M C;  1HA8 A;  2QM3 A;  3V8K A;  4BBR J;  5LEK A;  1G8X A;  1HSJ A;  3IC7 A;  3DBH B;  4FHT A;  2LBF B;  1WSU A;  2VPL A;  3PQJ A;  5D8K B;  4ZYH A;  1B4A A;  2YU3 A;  3I64 A;  3JTG A;  1JKQ C;  1QVT A;  1V55 H;  4B4C A;  3HTS B;  3D1N I;  1NH3 A;  3H36 A;  1MDM A;  1SFX A;  2ELH A;  2Z5U A;  3K70 D;  3OYD A;  3MKY B;  2MH2 A;  5B5E C;  1XS9 A;  1KQ9 A;  2K9N A;  2EZI A;  1IW7 F;  2ID3 A;  3F3X A;  3HRS A;  1WHU A;  3I58 A;  4CDG A;  3EYI A;  1KA8 A;  3BQY A;  1DDN A;  3PSI A;  1ULY A;  1LDJ A;  4DYC A;  4BQA A;  2X9D A;  5J4V A;  2EIK H;  1YO5 C;  2K27 A;  3BG5 A;  4XLH A;  2VQG A;  4A12 A;  2BGC A;  4M3D A;  3K69 A;  2JVH A;  2QQ9 A;  1VQ9 I;  3WGG A;  2IS2 A;  2FMY A;  4RGR A;  2HZT A;  1YIO A;  2CJJ A;  1ZRF A;  3HZJ A;  4HV5 A;  5JHF A;  4CGZ A;  3SZT A;  3G73 A;  2A61 A;  2XC7 A;  3ZP5 A;  1O3S A;  2FNP A;  3CJN A;  2HFH A;  4KA4 A;  4BAC A;  2W4S A;  3K1M A;  1T08 B;  2KIS A;  4NB5 A;  4A6D A;  1IV8 A;  3LMM A;  2KDO A;  4ASN A;  3MVP A;  3MKL A;  5HNF A;  3OL3 A;  4BL0 B;  3Q0U A;  2R7Q A;  4EQQ A;  2BEO A;  4KJZ A;  1IRG A;  5FRM A;  1OYY A;  3QOE A;  1NG7 A;  3I54 A;  3L09 A;  1XDU A;  2VIX A;  1SVM A;  4XON A;  2FOW A;  4HDV A;  3E6B A;  5JI6 A;  2YSR A;  2E60 A;  2XHK A;  3K7A J;  4I7H A;  3J7Y J;  5DUI A;  4IHX A;  2OA4 A;  2HOA A;  1ZLK A;  5GAG J;  1O3T A;  4XLA A;  1ZH5 A;  2QQA A;  4KUM A;  2QZ8 A;  1C0W A;  2HYG D;  2E5N A;  4ESF A;  2LKP A;  5L3E A;  3CLQ A;  3OWT A;  2IGK A;  3IH2 A;  3J81 Z;  3ZN0 A;  2VUM J;  4A3L J;  1FC3 A;  5DDG A;  3HOT A;  1K4S A;  1MDM B;  2OD5 A;  3FXO A;  2DJI A;  1I1G A;  1J9I A;  2LRE A;  3EET A;  2PMH A;  4HF0 A;  3S2D J;  2TCT A;  1H89 C;  2LDU A;  2MW8 A;  1MH4 A;  4D0P A;  4ZZD A;  1TQI A;  3WTZ A;  1RZ4 A;  4XRM A;  3TO9 A;  3OYM A;  3HOX J;  4KIG A;  4C2T A;  2Y69 H;  4BBS J;  3A0B C;  3S8P A;  4WK8 F;  2R7O A;  2DOF A;  3J7A Y;  3AL0 B;  3I4P A;  4UY8 I;  4JYK A;  2V1X A;  2M5W A;  2LFB A;  2HVS A;  2EFQ A;  2AQE A;  3MQ0 A;  1F4K A;  1XGS A;  3FXQ A;  1VQ5 I;  3JAM Z;  2A05 A;  1IN7 A;  2K5C A;  2DO7 A;  3I56 I;  4GYG A;  2VBW A;  1BC7 C;  4LMY A;  1N25 A;  2CUJ A;  4MEX F;  4IJA A;  5F27 A;  4AU7 A;  3RDI A;  2DA5 A;  3HJE A;  4AIH A;  2RRE A;  1BIA A;  2DBB A;  1YIT I;  1K78 A;  5LD2 C;  2EV6 A;  2IP2 A;  2STT A;  4KYW A;  5JLW A;  1KQ8 A;  2DMP A;  4LIV A;  3OYH A;  5HLI A;  4L9V A;  2L9V A;  1FPQ A;  3F6V A;  4NC8 A;  2EK5 A;  3CME I;  2ZC2 A;  4PCQ A;  1D8K A;  3HEF A;  2VC1 A;  4UVA A;  4C2M J;  1IN8 A;  3JSP A;  4XM3 A;  3TW6 A;  2A6E F;  5LRS A;  1LE8 B;  3ROU A;  4FAS D;  3CUQ C;  2Y2Z A;  2H09 A;  4IHT A;  4XKW A;  4CYD A;  4M9S A;  5BMZ A;  2K9Q A;  1OCC H;  2O03 A;  2Z99 A;  2O3F A;  2HWV A;  3T5X A;  5TJJ A;  3S1R J;  3CUO A;  3I53 A;  2J5P A;  1JT6 A;  5D5U B;  4R1H A;  2G7H A;  2QA4 I;  4BNC A;  2L9R A;  3GEZ A;  2Z9O A;  4EM2 A;  5HS8 A;  2K7L A;  2VKD A;  3M1C A;  3CCV I;  2P6T A;  2Z16 A;  3OY9 A;  3Q9S A;  1ENH A;  1U3E M;  1BBY A;  2O7O A;  2GLO A;  2QSH X;  3FKI J;  3BTJ A;  2HQ5 A;  4ON0 A;  5IYB J;  4B44 A;  3GTJ J;  2ZKZ A;  1YLF A;  4O5V A;  1Z7L A;  4GO1 A;  3HRU A;  5ILU A;  3LA3 A;  3S93 A;  4UUS B;  3E6C C;  3E5U A;  1QGP A;  1MMD A;  4IPA A;  1TNT A;  2VKV A;  1VQL I;  2RKH A;  2NNN A;  2D45 A;  1R1T A;  2LKX A;  2EH3 A;  3Q0V A;  3HUG A;  1E3P A;  3DTK A;  3QYB A;  2JA5 J;  4XSX F;  5KAF C;  2BV6 A;  5K7F A;  5EGO B;  4BQQ A;  2V7F A;  1TT0 A;  5E1X A;  2LY2 A;  2O6G E;  2WAQ N;  3QAH A;  3AG1 H;  4AYB N;  2FQ4 A;  4Z6Y A;  3BWG A;  3G1O A;  3TDU C;  1ZTR A;  1DPU A;  3FK7 A;  2KP6 A;  3TP0 A;  2JUC A;  5GAH J;  1W7P A;  1OQY A;  2KJC A;  3DBR B;  4BEH A;  4QLC U;  4PSW A;  1RNL A;  3PFY A;  2VT3 A;  3Q0W A;  5FD5 A;  2XPU A;  5F0C A;  2EIN H;  1A04 A;  2H6B A;  1TTY A;  2VPR A;  2OUM A;  1YRN A;  1P4X A;  3HC7 A;  1XTA A;  4LG3 A;  2DXI A;  3H92 A;  3IRQ A;  2DDA A;  5H20 A;  1VZ0 A;  2M0C A;  3KYC B;  2P5L C;  2A68 F;  5EZG A;  3BQZ A;  1XMX A;  1ZEL A;  2CW0 F;  4HLX A;  5CQG A;  4DJA A;  3PIP F;  3RQI A;  4X6A J;  1OYW A;  2R7F A;  2VB6 A;  1MD0 A;  4XN0 A;  4DYQ A;  3MMY B;  4U88 A;  2DMT A;  4RAG A;  2QLZ A;  2FRH A;  5J4Y A;  2BBY A;  2Z2S B;  4BE1 A;  1POG A;  2MH9 A;  3FXR A;  3IWF A;  4V19 K;  3CCS I;  3OS2 A;  4P9U A;  2V79 A;  5HOD A;  2V9K A;  5K7Z A;  5K5O A;  3FMQ A;  4BQO A;  3HIF A;  2L01 A;  2UXN A;  1T0F A;  3A1Y A;  3VYU B;  1VQ6 I;  2FD5 A;  2R5Z A;  1YIJ I;  1JKO C;  5HLH A;  5D4S A;  1MBF A;  2G0E A;  2XAJ A;  2DFH A;  3S15 J;  2DFE A;  3HUG B;  1R5H A;  1DGW Y;  4S0H B;  2P5V A;  4F52 A;  3A01 A;  1SFK A;  2JQ7 A;  3KX2 A;  4NNJ A;  3S14 J;  1LNW A;  1SD6 A;  3RYP A;  3BTL A;  1X3W B;  2I5U A;  3OIQ A;  2IEK A;  1GUU A;  3QU3 A;  4I6Z A;  4FE7 A;  4UXN A;  1MJA A;  3QQA A;  3W2V A;  2BXZ A;  2OQG A;  1MMN A;  1X1B A;  2VOO A;  1ETW A;  4GCV A;  5M3M J;  1V3F A;  4CZZ A;  1AA7 A;  1W7P B;  1MBG A;  4BEH B;  3SZP A;  4BKX A;  2W84 A;  2DAO A;  3EUH C;  4U7D A;  2QSG X;  4HV6 A;  2L9S A;  4F91 B;  3CCQ I;  1UHW A;  4ZYE A;  3J80 Z;  1YRN B;  2R7Z J;  2F4I A;  3FMS A;  4UHT A;  2HQN A;  3TMO A;  1YOV B;  4A0Z A;  4EJU A;  4S05 A;  2H8R A;  3PSF A;  2XAQ A;  2D2W A;  3HDD A;  5FB2 A;  1ZKG A;  3MWM A;  3CMM A;  1TZL A;  1JUS A;  2A6H F;  3M07 A;  4KIC A;  1XMA A;  5J3L A;  2QBY A;  2P8T A;  3F23 A;  4HPQ A;  4HNU A;  1BA5 A;  1I50 J;  1XG1 A;  1Y1V J;  2EV0 A;  2EJR A;  3LQR A;  4YRV A;  3WTS C;  2HQA A;  3VB2 A;  4YFK F;  1LUJ B;  5DV5 A;  2ECB A;  3ZMT A;  2M8E A;  2NVX J;  1Y6I A;  4XK4 A;  3VPR A;  2B63 J;  3G1L A;  3OYG A;  1OCP A;  3GTQ J;  2RVC A;  2HEO A;  2K02 A;  3JW4 A;  3M8F A;  2KIQ A;  4P9F A;  4PK4 A;  3IV5 A;  4HG2 A;  2ZNZ A;  1T39 A;  4UV8 A;  1VQN I;  3VFZ A;  1SD5 A;  2BY3 A;  3G2B A;  1LVA A;  5E1Z B;  3B02 A;  2E1O A;  3C2H A;  4DQ2 A;  1R00 A;  3CCL I;  4B1R A;  3QU6 A;  4Y52 J;  1X3U A;  3J81 K;  2GA1 A;  4OIQ F;  4L0Z B;  3BR5 A;  1OCZ H;  2MC3 A;  1VQ4 I;  5IP6 A;  1JHH A;  1GV2 A;  3DFG A;  3SDB A;  3B73 A;  2F2E A;  3I59 A;  4NC6 A;  2CWE A;  4A3J J;  3JCU C;  3ONQ A;  1BOA A;  4ENM A;  3W3C A;  2VJJ A;  2WAE A;  2LD5 A;  2Q0O A;  4GDF A;  4BJT A;  1XCV A;  1ZHF A;  2R0Q C;  1Y8R B;  2HZD A;  2MBF A;  2M30 A;  2XGE A;  4PDK A;  1IRF A;  2Y0M A;  3BY6 A;  2ZXI A;  4D7N A;  3H3V K;  3E5X A;  3O8G A;  2DYS H;  2R7T A;  4HBL A;  3WHB A;  2WB1 A;  1QZE A;  3MCZ A;  3A02 A;  1WJA A;  5ICF A;  4XKB A;  1ZGW A;  4RLQ A;  1HW1 A;  1OR7 C;  4FX0 A;  3CO6 C;  4KIB A;  4MHG A;  3ZPL A;  4L0Y B;  1OCO H;  2DTZ A;  3I4N J;  2E1M B;  2ZJQ F;  5IOY A;  3VWB A;  2RC4 A;  1JUM A;  3QYE A;  2E36 A;  3FHN A;  4A3C J;  1VQ7 I;  2NVY J;  2BZT A;  2IBD A;  1MSF C;  1LKX A;  2XRN A;  3V8L A;  3OR2 C;  1MNE A;  2ZXW H;  1HOM A;  4LB6 B;  5M5W J;  2K9M A;  4CUG A;  3RPQ A;  1Z7U A;  2L7K A;  1GV5 A;  3MEX A;  5FKL A;  1I39 A;  3HRT A;  5D4R A;  4YFX F;  2KRC A;  2XGX A;  3MFK A;  3LSG A;  2V6E A;  3BRO A;  4M6X A;  2EZL A;  2HOT A;  4BUP A;  1YQA A;  1MJ9 A;  4JP0 A;  3PM1 A;  3F0C A;  3L2W A;  3CCJ I;  2ACJ A;  2NVT J;  5EF6 A;  1ZN2 A;  1T38 A;  3CDI A;  5F64 A;  4BJ5 C;  3NRV A;  5J47 A;  1R71 A;  4QPO A;  2IS4 A;  3P9K A;  1SD4 A;  3KCC A;  4XLE A;  1U5T A;  2ZCW A;  2PG4 A;  4CCK A;  4AD9 A;  1IN4 A;  1YW9 A;  2NS7 A;  3CMY A;  4BAY A;  4FIS A;  1VND A;  3TW7 A;  4M3G A;  5DCF A;  3A03 A;  3DKY A;  3H0G J;  1BR4 A;  1YI2 I;  5KNL A;  5E3L A;  1VQK I;  2HKX A;  2O8X A;  3DPT A;  4TV7 A;  5BQT A;  4F93 B;  1MBH A;  3PO3 J;  4EV0 A;  2FML A;  4MTD A;  5BNG A;  1AWC A;  4UB8 C;  1F36 A;  1DP7 P;  2E35 A;  1Y8Q B;  3O8H A;  3S1M J;  1O57 A;  3TOB A;  2Y30 A;  1WQ2 A;  4L9T A;  1GVD A;  3MN2 A;  4E7Z A;  2R7S A;  3ZQI A;  2WY8 Q;  3S3N A;  4NUB A;  2JZY A;  1P6R A;  1ZAR A;  2MD5 A;  3QRF F;  4LD5 A;  4L9N A;  4PGH A;  4XR6 A;  4ETS A;  2X6Y A;  1BM9 A;  4FE4 A;  3A2K A;  2FA5 A;  2L7F P;  4KT5 C;  5GPA A;  1EA3 A;  1RUO A;  2ZJP F;  4Y13 A;  3JRB A;  4B09 A;  3ZMV A;  4I0B A;  1DU0 A;  3FIS A;  3U9G A;  1FIA A;  3E6M A;  3M1E A;  4IRI A;  1RPW A;  1HQC A;  3K10 A;  1FYM A;  3ULQ B;  1STZ A;  3ERM A;  3V7R A;  1V5F A;  2GBY A;  2KIM A;  3KZI C;  3DU5 A;  5L3F A;  3OYA A;  1D0Y A;  3WOD F;  1EKE A;  3RZD J;  2R5Y A;  4MNU A;  1WZ2 A;  1MGT A;  1JE8 A;  2WAD A;  3EUA A;  1A31 A;  1D5Y A;  3EDP A;  3KEY A;  2IT0 A;  3DEW A;  1J59 A;  5DUK A;  5D8L B;  2RNG A;  1VFC A;  1D0Z A;  3L7W A;  1S3J A;  2GZW A;  1FBU A;  3H3U A;  3VOE A;  5FRN A;  3F8N A;  2E34 A;  2YR2 A;  2F4O B;  2X85 A;  3P5J A;  2A6T A;  1G3T A;  1WWX A;  2IGM A;  3HM5 A;  3VEP A;  3H9Q A;  5K5Q A;  4LLN A;  2FBI A;  2EFO A;  2CUZ A;  2Q1Z B;  2F4M B;  2RV8 A;  3FWE A;  3ISP A;  3QP6 A;  4I76 A;  2V1D A;  5CVV A;  1HXD A;  2ZSI B;  4XKC A;  1P2F A;  2O61 A;  4KT6 A;  4BJ6 C;  5GTI C;  4M9X A;  3ZMU A;  1Z3X A;  1BI2 A;  4IZZ A;  1FEX A;  2A3S A;  2V1U A;  3ZMZ A;  4AID A;  5EJC A;  4B3A A;  4A93 J;  3DKW A;  3CUQ B;  3L2C A;  2KLO A;  5J1R A;  5E3O A;  4IX7 A;  1APL C;  2EB7 A;  2MC4 A;  1Z6R A;  3BPX A;  3KP3 A;  4A3B J;  1F9N A;  3TQN A;  5L3B A;  2L4A A;  3BR6 A;  5IPA A;  1TQP A;  1TW3 A;  4RMN A;  2Q2E A;  3LAP A;  1FP1 D;  1B9M A;  3J80 K;  2EIM H;  1UJ8 A;  1YS7 A;  1ACI A;  1Z67 A;  2OZ6 A;  3V8J A;  3OS1 A;  3D0S A;  3VSK A;  2K3F A;  3JRC A;  2CQN A;  3H5A A;  3B6C A;  2DQL A;  1ON1 A;  1ON2 A;  2R7X A;  5GP9 A;  4FTH A;  1ETY A;  5HDG A;  3HOZ J;  1MSE C;  5FGM A;  3EYY A;  1ETK A;  2R5Y B;  2HPM A;  1TWC J;  4LLG F;  4HYE A;  3T0Y A;  1CF7 A;  1R36 A;  1QQI A;  5L3D A;  4RAZ A;  3I5U A;  4IO9 F;  3E1S A;  1G2H A;  4MFE A;  3K2Z A;  4L9J A;  2VBX A;  3OYJ A;  4E7S A;  2YX4 A;  2NOG A;  5E3N A;  4LIT A;  3S32 A;  4HDU A;  3FF5 A;  1W4M A;  2IA1 A;  5JHU A;  1MKM A;  1SEU A;  3P9C A;  4XRS A;  3MKW B;  2WBM A;  1X58 A;  3IWZ A;  2DMQ A;  1J75 A;  2EQR A;  3CP2 A;  1JJ6 C;  1RC9 A;  5E79 C;  1GDT A;  1GVJ A;  4L5E A;  2GWR A;  4PUS A;  4U0W A;  1I6H J;  3EUH A;  5C4X J;  1X3Z B;  1F43 A;  1PUF A;  5KHD A;  2IGO A;  1MBJ A;  3OR1 C;  3WTV C;  2CGP A;  4OIO F;  2ZME C;  1V5E A;  3E97 A;  3G4S I;  4A3E J;  1AOY A;  2HOE A;  3WU1 B;  3K1N A;  3FZV A;  1JTY A;  2GAU A;  2LC2 A;  3OOU A;  5DS9 A;  2Q2E B;  4ZDL A;  2WV0 A;  3UNG C;  2ISZ A;  1HF0 A;  3K4B A;  2XV4 S;  1ZR2 A;  2BHY A;  1X1A A;  4XLN F;  3U2R A;  3K0L A;  4MQ9 F;  1BOB A;  3RYR A;  2X6W A;  4DBR A;  3DBL B;  3PNY A;  2WWY A;  4IHY A;  4J00 A;  3ZN1 A;  1ZRC A;  1QO0 D;  1UCR A;  4BS9 A;  1LE8 A;  5ICG A;  2A07 F;  3IAS 2;  2HKO A;  3IH3 A;  1HKT A;  3RSN A;  3M8J A;  3ABT A;  5D5X B;  2O5R A;  2P5K A;  4QSH A;  1IZ1 A;  1DQU A;  2H94 A;  5E8G A;  1IAW A;  1QBJ A;  2BYV E;  4BDY A;  1CF7 B;  2CW8 A;  1B6A A;  4XOP A;  3SHF A;  2UZK A;  3F8F A;  3P7N A;  4L5I A;  4YEJ A;  1WH7 A;  2FQ3 A;  2DK5 A;  5BOX A;  1QNT A;  3BZK A;  2K85 A;  1BL0 A;  3CCE I;  2L7M P;  2WB1 N;  4M9Z A;  3PJR A;  2ZFW A;  4HST A;  2JK3 A;  2IXS A;  4BHC A;  1FYK A;  4QIW N;  4H0E A;  4Z2Y A;  2RQP A;  3R6S A;  3GFI A;  2BVM A;  3WHC A;  4KIS A;  1IXR C;  4BY7 J;  4UUV A;  4M72 A;  5AIQ A;  4UUS A;  2BVL A;  2GM4 A;  2R7U A;  1VI0 A;  3F72 A;  1JKP C;  4XOT A;  4YFN F;  3ABL H;  1QU3 A;  4LFU A;  3GUD A;  5ILS A;  1TWA J;  3AKZ A;  1PUF B;  2FX0 A;  5D5V B;  2FOK A;  4D5F A;  5M3F J;  3L2U A;  5EGO A;  2XKO A;  3ZMS A;  2WAF A;  4IQJ A;  2D5V A;  3GTP J;  3ABU A;  2JA8 J;  1E3H A;  2CFO A;  2O9L A;  1WJF A;  1XD7 A;  3RPU D;  3VOD A;  1FJL A;  1I1S A;  5J40 A;  1T98 A;  2DOE A;  3R0J A;  1R5G A;  3PNV A;  2W82 A;  3DV8 A;  1JJ8 C;  1GT0 C;  4B3X A;  3WU0 A;  1U6G A;  4OMY A;  5IYD J;  3R4K A;  5H6Q A;  1QHH D;  2DYR H;  4ENK A;  1YW7 A;  3DPL C;  2XB0 X;  3K4L A;  3ASO H;  4IRG A;  3WTU C;  4F92 B;  1AKH A;  5LHH A;  4WX9 A;  4KMU X;  5LGU A;  2DN0 A;  1IO2 A;  5FLX K;  2BHZ A;  2VOD A;  1FIP A;  1N77 A;  3F9K A;  1KYZ A;  1D0X A;  2A5Y B;  4JX4 A;  2LOO A;  4N0B A;  2NS8 A;  2IW5 A;  3OIP A;  2YS9 A;  5DM7 F;  1J5Y A;  3W6K B;  3FXJ A;  3CCU I;  4R79 A;  5K7H A;  2Y31 A;  1Z77 A;  1BN5 A;  1W5C C;  1NTC A;  2VL8 A;  1BR2 A;  3NWS A;  4OIR F;  4GGG A;  2QUF A;  4HA8 A;  2X1D A;  3CQZ J;  2JUG A;  2RDP A;  3CD6 I;  3M7G A;  3LNQ A;  1UB9 A;  1HW2 A;  1PDN C;  5DYM A;  2LSO A;  2OZU A;  3S2W A;  4MTE A;  2XAG A;  1YS6 A;  4I02 A;  2W00 A;  4HZF A;  1ETO A;  5IP7 J;  2R3S A;  3GZ6 A;  3CCY A;  3GME A;  2HGC A;  1R49 A;  3D5L A;  2PJR B;  1RKW A;  2DA3 A;  3K4N A;  5ERI A;  1MMS A;  2M87 A;  1BW5 A;  3COA C;  2CUE A;  2CV1 A;  1HDP A;  2PMU A;  2KDZ A;  2H8W A;  2EZK A;  2V4J C;  4BQN A;  2JJ7 A;  4IOC F;  2EIJ H;  3W6J B;  2GA2 A;  3LST A;  4JX5 A;  5KK1 A;  3I4M J;  3HXL A;  2M7B A;  3T8R A;  3L2Q A;  1OYI A;  2HXI A;  1YTY A;  5DM6 F;  5H6R A;  1TWF J;  1XMK A;  4QPQ A;  3FM3 A;  4HX4 A;  3CES A;  1YE9 A;  1KON A;  1X4O A;  1BI0 A;  1ZGJ A;  2D1H A;  2DMN A;  3FIW A;  5CVJ A;  1LVK A;  4CIC A;  3HOS A;  3HB9 A;  2KPM A;  3QPL A;  1A35 A;  4C9Y A;  1AKH B;  2PI0 A;  1PP8 F;  2W48 A;  3IP4 B;  5E3M A;  3JRG A;  2VLA A;  3FXK A;  4UB6 C;  2EA4 A;  4C3J J;  3CLO A;  3IL2 A;  2LH9 A;  3DP7 A;  3QWL A;  2DJN A;  1NHA A;  1WI3 A;  2PMZ N;  4IVN A;  1P7J A;  4ENN A;  1XC5 A;  2X6O A;  4YG2 F;  4IL6 C;  2E2H J;  2KJB A;  2X4H A;  2JA7 J;  3REO A;  2LF7 A;  4CO8 A;  2VKH A;  1BW6 A;  2BY0 A;  3K1P A;  3L00 A;  3QP5 A;  2DA1 A;  4Y3O A;  1SFO J;  3CCM I;  2MG4 A;  4RB2 C;  2XDV A;  1CQT A;  1ERD A;  3ZGK A;  3RQ4 A;  2P6S A;  4GXO A;  1XDS A;  2XAH A;  2IS1 A;  3I71 A;  3HSE A;  3LAJ A;  5CKT A;  3SZG A;  2KQR A;  4ZYD A;  2R7R A;  1QVU A;  3PQK A;  4KDP A;  1TT5 B;  2EFN A;  4AWX B;  1FMV A;  5EYR A;  3CF5 F;  2M0M A;  4Q4Z F;  2M34 A;  5IT3 A;  1O3R A;  4EGY A;  1KU3 A;  3H9J A;  1XGO A;  3IH4 A;  3UKG A;  5FLV A;  4G7O F;  4G12 A;  3E7L A;  3I55 I;  1FYL A;  2BW3 A;  1SAU A;  1U0J A;  4LK0 F;  1NG6 A;  2CH0 A;  3SYT A;  2DFF A;  2EBI A;  4KMF A;  3KZZ A;  2WTE A;  4PGG A;  5TRD A;  4PFP A;  4DZP A;  2KIF A;  3TO6 A;  2LYC A;  1V54 H;  2CG4 A;  2L2O A;  3WG9 A;  4G9Y A;  2HR3 A;  3KP6 A;  4RAY A;  1T95 A;  5CLS A;  2DMU A;  2OCC H;  2OC6 A;  3K4C A;  3DTI A;  4DOZ A;  3PO2 J;  4BXU A;  5FJ8 J;  1FOY A;  2LR8 A;  1FT9 A;  2OPT A;  4JOM A;  2B9S A;  2ADU A;  2EFP A;  2UV1 A;  1X2N A;  3BG7 A;  4ZYA A;  4NBQ A;  1LFU P;  4A3F J;  4XLC A;  4B48 A;  1ONV A;  1Z9C A;  2DOA A;  2VQH A;  2ME0 A;  3CO7 C;  1WCM J;  5K1Y A;  4JK1 X;  5ILV A;  2I8D A;  5IOZ A;  1FMW A;  3KEQ A;  2WA0 A;  1E17 A;  1M1E B;  1LEB A;  2ZB9 A;  3DF8 A;  4CHU A;  1K61 A;  3D5R C;  1H9T A;  1S7A A;  1TWG J;  2M7A A;  3QYF A;  2Z1D A;  1E3O C;  1H8A C;  3O3K A;  2ZFU A;  1I3A A;  4OWR B;  4FQG A;  2VJI A;  3E5Q A;  3O6B B;  4ZYG A;  3M8E A;  3H9G A;  3LFU A;  4LG0 B;  3CC4 I;  2HDC A;  1HDD C;  2LK2 A;  2Q8K A;  5BPI A;  1L0O C;  3FBI B;  3KFW X;  2VXZ A;  4HF1 A;  1UZC A;  2BW3 B;  4ZTJ A;  3HKZ A;  1SC7 A;  1EJ9 A;  3TL4 X;  4E6K G;  2RNJ A;  1TC3 C;  2ZXJ A;  5B66 C;  2KZV A;  1SVO A;  4XRS G;  5LGN A;  3H3Z A;  3OYL A;  4IHW A;  5ICC A;  4HSR A;  3BR2 A;  2NAZ A;  4XKV A;  1O7L A;  2BY2 A;  1GXQ A;  4P5O A;  1UFM A;  4PJ0 C;  4RLF A;  4ZJZ A;  2K40 A;  1OCR H;  4ANJ A;  4OMZ A;  1S72 I;  3LSK A;  1S5L C;  2OTJ I;  2K86 A;  4CZC A;  1WFX A;  2XAF A;  3ZCO A;  3JRF A;  4CXF A;  3P9I A;  1TLH B;  4BXF A;  3SFI A;  3SFZ A;  5HLT A;  4A5M A;  4CCM A;  2X0L A;  2HNH A;  3TO7 A;  3K4M A;  1FX7 A;  1N75 A;  1QRY A;  4I01 A;  3G1M A;  2PJP A;  3EQL F;  1ZAO A;  3HSF A;  5J8C A;  5JVT A;  3H35 A;  1FY7 A;  3QPT A;  3SEQ A;  1Y39 A;  4MO7 A;  1I27 A;  2UWM A;  5CVU A;  3TKY A;  4G6T B;  2M4G A;  2QEN A;  1K4T A;  4KIF A;  4WWC A;  2XIG A;  3TOA A;  3QPH A;  4F55 A;  4HF2 A;  2VOP A;  4E7K A;  3AFH A;  4HNT A;  4Q48 A;  3F8M A;  3OSG A;  3ZQG A;  3C18 A;  2L4M A;  5CVI A;  2NYX A;  2JRT A;  1J09 A;  1P4W A;  1Z0X A;  4HNV A;  2YUS A;  1A6I A;  3NEU A;  2JMW A;  3PIO F;  1U9O A;  3QPS A;  5EG0 A;  4CYC B;  2DT5 A;  3K9T A;  5FKM A;  3JTH A;  3BR0 A;  4B47 A;  1FOK A;  4D1Q A;  2AXL A;  2LMD A;  4P1W A;  2LF8 A;  1R9T J;  2NS0 A;  2MLK A;  2I10 A;  1IUY A;  2E7W A;  2NRA C;  3BR3 A;  2MD0 A;  2CU7 A;  2D1V A;  3KLO A;  4ZC3 A;  2W7N A;  1P7I A;  5DD8 A;  5E1W A;  2DT7 B;  2FE3 A;  2CRG A;  4E7L A;  1XX5 A;  2YX7 A;  1MZB A;  2ZO4 A;  4U87 A;  4Q47 A;  1U9N A;  2LY1 A;  1ETV A;  4AVZ A;  1XSV A;  4IRH A;  4N4N B;  4CCO A;  2NOJ B;  1JTX A;  3I0T A;  3RZO J;  2E2J J;  3BR1 A;  4AUX A;  1ZLJ A;  1OPC A;  3LOC A;  5JLX A;  1Z21 A;  2DOD A;  5ICE A;  1JT0 A;  3GBG A;  3C1D A;  1YYV A;  3Q3S A;  1UHS A;  1QPI A;  2ESN A;  2P0W A;  3HHH A;  1VTN C;  1ZG3 A;  3U21 A;  2QVO A;  5FLX Z;  3IAM 2;  2KT0 A;  2P7C B;  1R4N B;  3OL4 A;  4AIJ A;  2F48 A;  3DTE A;  1IN5 A;  2GXA A;  3Q5F A;  4A3M J;  3WGH A;  2XRL A;  2PX9 A;  2QCO A;  3F22 A;  4OIN F;  3CUQ A;  2W24 A;  2MFZ A;  2GXG A;  3LL7 A;  5CQE A;  1FSH A;  2FJ1 A;  3GX4 X;  4RDU A;  2JA6 J;  3KEO A;  2CYY A;  2PEX A;  4IEJ A;  3U1K A;  1YX3 A;  2FUG 2;  4D5C A;  1X1P A;  2Z33 A;  3HOY J;  4QTR A;  3DLA A;  2JN6 A;  4W97 A;  2PN6 A;  3HOU J;  4XNF A;  2MA3 A;  3CJT B;  1EH7 A;  2XGD A;  5EG0 B;  1ZR4 A;  1YX5 A;  2V26 A;  5F6F A;  2K9S A;  1RIO H;  5FRO A;  4IF4 A;  1IGN A;  3ZQH A;  1Z3Y A;  4YII A;  5IP9 J;  4G7Z F;  2R7D A;  3PUF A;  3CC7 I;  4MLO A;  5DTD A;  2HDW A;  1EF4 A;  1B1B A;  2G9W A;  2FNA A;  2P4W A;  3HG9 A;  4RB0 A;  3S1N J;  2UUZ A;  3ASN H;  3N05 A;  4EJW A;  4HEA 2;  1N78 A;  4ZH4 F;  1W36 C;  4E4H A;  3VDX A;  2OTL I;  4XL9 A;  2HI3 A;  2OF7 A;  3JRA A;  1IJW C;  1BJA A;  3HBL A;  4PFO A;  1JKR C;  3E0J B;  2H1K A;  2Y9Z A;  1LDD A;  2IA2 A;  2HVQ A;  2VJ5 A;  5FKO A;  2HVR A;  3GO5 A;  1G3W A;  2MSY A;  4LJZ F;  2NVQ J;  2AXT C;  1XN7 A;  1U8B A;  5K5R A;  1RRJ A;  1LQ1 A;  1FOW A;  1Q1H A;  3OOP A;  5D6E A;  5F1J A;  3GFL A;  1MW7 A;  2FF4 A;  2V6C A;  3OV8 A;  3IKV A;  1T0F C;  4RAF A;  2N8G A;  2LKS A;  1U78 A;  3H5N A;  2L7Z A;  1PP7 U;  4CCN A;  3DKX A;  2LVS A;  1V4R A;  2DW4 A;  2F5D A;  3LFK A;  3ZQ7 A;  4M3E A;  1UST A;  1IF1 A;  1R4M B;  1W7P D;  3L2V A;  5J1Y A;  4ESJ A;  4OAZ A;  2RN7 A;  4J01 A;  4LB5 A;  2LRD A;  1X1D A;  3C7J A;  4W1U A;  9ANT A;  2QF7 A;  3GXO A;  3DPU A;  2L0K A;  2TRT A;  2VE9 A;  4IKF A;  2QQB A;  5AIP A;  1B8I B;  4NHJ A;  3K6G A;  1FTT A;  3AG4 H;  5LLQ A;  4UVB A;  1D1C A;  2LP0 A;  3F21 A;  1YJN I;  4I09 A;  3A4C A;  1HCR A;  4Y4R A;  2Y75 A;  2JPC A;  4RGX A;  3TED A;  1W36 D;  1XGM A;  3MZ8 A;  4N4O B;  3VSL A;  2GIV A;  1NK2 P;  3WTX C;  4OAY A;  1S7E A;  4RB1 A;  3HYI A;  4B43 A;  3OS0 A;  4A3K J;  5F0F A;  1U2W A;  1RR7 A;  2HU9 A;  5FKK A;  3L9F A;  2CQK A;  1Q1V A;  3ABM H;  2VJ4 A;  3T1B A;  4JX6 A;  3DCF A;  1B72 B;  4E7J A;  2CO5 A;  4RM3 A;  2K4J A;  4BDZ A;  2COM A;  2QSF X;  4GYI A;  3OYE A;  4L18 B;  4Y15 A;  5GTH C;  5JR3 A;  1SVL A;  3W6V A;  1Y0N A;  3CJQ B;  2DFI A;  2W85 A;  3WG7 H;  5FD6 A;  2DPD A;  4PJN A;  5HS9 A;  1TP4 A;  3M3Y J;  2QEX I;  1RI7 A;  4CSW A;  2M3A A;  2CQX A;  5DEQ A;  2K4B A;  4V2F A;  1VQO I;  3L2R A;  3WE3 A;  3G6E I;  3DLL F;  3DXJ F;  2A5W A;  1S7O A;  3H0D A;  2JSC A;  2HYF A;  1SFU A;  1WJE A;  2E71 A;  3DEE A;  4A3D J;  4OU0 A;  4LLL A;  4DIQ A;  4G6D A;  5HOO A;  3FXU A;  3O2P E;  1ETQ A;  1JI8 A;  5DD4 A;  2F5E A;  1PYV A;  1KU7 A;  2DA7 A;  2KRF A;  2RGV A;  2X6X A;  2ICW G;  4WXC A;  2F5C A;  2HS5 A;  5DCM B;  1KZH A;  4I99 C;  2P81 A;  3WTW C;  3GTO J;  4RGS A;  1B9N A;  5J8F A;  4Y33 A;  3FHZ A;  4HRI A;  3S17 J;  2XF6 A;  4HX8 A;  2QGU A;  4C3I J;  1RET A;  3OYK A;  2FBH A;  2OAZ A;  1DUX C;  2EWN A;  1O4X A;  1MND A;  1F1Z A;  3WTT C;  5EDN A;  3ZQF A;  2HQR A;  1UEL B;  3OYF A;  1KU9 A;  4P55 A;  3BCB A;  4N9I A;  2FU4 A;  3KP4 A;  3HKZ N;  3VYR B;  2XKP A;  3EUK L;  1G3Y A;  2BY1 A;  2Y0S A;  1KGS A;  1WJ5 A;  2VC0 A;  2EPF A;  1EH6 A;  1NK3 P;  2DA6 A;  2IVM A;  5LRR A;  5EEA A;  2CV0 A;  4MIM A;  2ZNY A;  1FNN A;  3CCR I;  2FSW A;  1S9H A;  2FBK A;  2OJE D;  1KU2 A;  3OYI A;  3M4O J;  1EH8 A;  3PUB A;  1IRZ A;  2DU9 A;  2X1C A;  3DEU A;  1IXC A;  4M3B A;  3GTK J;  4HW0 A;  3IRR A;  3AAF A;  3NQO A;  1YJW I;  4D9J A;  1Z05 A;  3K2A A;  2LY9 A;  4EAT A;  1LJ9 A;  1F5T A;  4NDL A;  1GXP A;  1ZGA A;  5C44 J;  3JRD A;  2Y48 A;  2AQF A;  2JT1 A;  5KVR A;  2JRM A;  4WXD A;  3R0A A;  3JRH A;  1JUP A;  1P4A A;  2F5V A;  2JPB A;  3OYC A;  3ZRG A;  5E17 F;  2GOX B;  4BE0 A;  1YW8 A;  3HPH A;  3FX3 A;  3R61 A;  3QOD A;  2PJR A;  4IXA A;  3CDL A;  4M74 A;  4ENJ A;  5L3C A;  1U8R A;  3ZOB A;  3C2B A;  4EJO A;  1IG7 A;  3FMR A;  3OMY A;  4CA0 A;  3HRM A;  2KZG A;  4BE2 A;  3GF2 A;  4A0Y A;  1SMY F;  2L5Q A;  2QWW A;  1HKQ A;  5D5W B;  2M2E A;  3KIO A;  3V42 A;  1D8J A;  1XB4 A;  1U5T C;  1BC8 C;  4DYR A;  2YU9 J;  1OR7 A;  3N4M A;  4UNO A;  4HQE A;  1OFC X;  4G8X A;  4NQW A;  2VQL A;  3CTA A;  2B0L A;  2BXY A;  4QWQ A;  1SD7 A;  2M9H A;  1IDZ A;  3BZ6 A;  2DLL A;  2E19 A;  2VAS A;  2XB5 A;  2E1N A;  4CCL A;  3LSM A;  3S3M A;  2QKL B;  1V5G A;  2CFX A;  4G7H F;  1H88 C;  1TQM A;  4X0G A;  1W0T A;  5LFA A;  4LK1 F;  2KRH A;  3ECH A;  1T8I A;  2FXA A;  2LG4 A;  2VON A;  4CH7 A;  3HHG A;  1H9G A;  2XGC A;  3ESW B;  3KP7 A;  1QA6 A;  3LSR A;  1S8N A;  1K6Y A;  4BY1 J;  2R4G A;  4XLF A;  5M5Y J;  3WTY C;  3ERE D;  2DTR A;  4AVP A;  1ZK8 A;  3RIR A;  1XSD A;  1IN6 A;  2KFD A;  4FT8 A;  1Y56 A;  1FBQ A;  3FBN B;  2DDB A;  3TGN A;  5CYV A;  1VQ8 I;  2Z3Y A;  3SEZ A;  3HPG A;  1QZY A;  3HL2 A;  3KE2 A;  5GAD J;  3BP8 A;  3BJA A;  4LGW A;  4RGU A;  4RB3 C;  4BHB A;  2NNY A;  1UAA A;  4OIP F;  2R7W A;  1LPQ A;  2M45 A;  1R22 A; 
#chains in the Genus database with same CATH homology
 4M73 A;  5HLG A;  2VBY A;  3BJ6 A;  1R1U A;  2M1B A;  2ZBK A;  1I5Z A;  4XLP F;  3F8B A;  5A2Q K;  2W57 A;  1EV7 A;  3MAJ A;  5LBQ A;  4U0Y A;  3HSR A;  3E3V A;  2DI3 A;  2O0Y A;  1YG2 A;  1UHM A;  3T8T A;  2EV5 A;  4MEY F;  4WF2 A;  4FX4 A;  1REP C;  2C6Y A;  3PFI A;  1S29 A;  1K79 A;  2HTS A;  4KFC A;  4L5J A;  5HDK A;  4EJT A;  5EEG A;  3WE2 A;  1G4D A;  2E1C A;  1JHF A;  4HAM A;  1WRJ A;  1T6S A;  2HTJ A;  4A5N A;  1K78 B;  4O3M A;  4KN7 X;  5CVR A;  5LHG A;  5EEH A;  3LQQ A;  4EM0 B;  1FSE A;  3C3W A;  1G3S A;  4XSZ F;  3U1D A;  4AIK A;  3M9A A;  1KYW A;  5IT9 K;  1PUE E;  4YIF A;  3R60 A;  2AS5 F;  1TW2 A;  2VBZ A;  1Y0U A;  1FP2 A;  2VE8 A;  2KIU A;  4UV9 A;  3BDD A;  4EM1 A;  1R23 A;  4G6Q A;  2A69 F;  4LG0 A;  5FFZ A;  1QZZ A;  6PAX A;  2IJL A;  1O7F A;  3LA2 A;  3GYH X;  3GWZ A;  3GVA A;  3J7A O;  3BPV A;  3MZH A;  4S04 A;  5LEJ A;  3RJP A;  2PQ8 A;  4K2E A;  3KP2 A;  4A0X A;  4EMS A;  3KET A;  1KQ0 A;  1OMI A;  5HS7 A;  1HW5 A;  1H0M A;  1J7K A;  4HX7 A;  2H27 A;  1J2X A;  4U7B A;  1T2K A;  3GLX A;  2IA0 A;  1HBX G;  2EFW A;  4OOI A;  2XAS A;  1ZG5 A;  3F6O A;  2DPU A;  2IPQ X;  4M6Y A;  5E18 F;  1DPR A;  2PLY A;  5FO5 A;  2QYO A;  2L02 A;  3RTR A;  3IKT A;  1XSX A;  5BS6 A;  1IXS B;  1K6O A;  3SQN A;  4ESB A;  1SFE A;  4N9H A;  2CSO A;  5HDN A;  1YFH A;  4XRF A;  3RKX A;  4JQF A;  1R7J A;  1XCB A;  5ED4 A;  2XUB A;  2OQR A;  2XRO A;  4G94 A;  4IHS A;  2F5F A;  4WXH A;  4JBA A;  1JGS A;  1Z1D A;  2ZME A;  3V4G A;  1BI1 A;  3ML6 A;  4P96 A;  1FWZ A;  3V7S A;  1ZYR F;  3FM5 A;  4UVC A;  1USS A;  4MGR A;  3GW2 A;  1R1V A;  4ZZL A;  4EJV A;  4A6E A;  3RPU A;  2XVC A;  1HST A;  2GQQ A;  1LB2 A;  1K7A A;  3SXY A;  4F7Z A;  3GZ5 A;  2GXB A;  2ETH A;  1ZRE A;  1ZG1 A;  3JAM K;  1W5T A;  1WI9 A;  2L54 A;  5J6X A;  2QBY B;  1SMT A;  3RI4 A;  4O6J A;  1ODD A;  3ZMD A;  2JTV A;  2VT2 A;  3GFJ A;  1G6N A;  3RKY A;  1WKM A;  1FLI A;  2EA2 A;  4EGZ A;  3DQV C;  3GFM A;  4PZJ A;  5L3G A;  4R8H A;  1HKS A;  5AON A;  1D5V A;  2FEZ A;  2W25 A;  3MZY A;  3ECO A;  4BYY A;  2ZME B;  4KN4 X;  1TNS A;  1P92 A;  3I59 B;  2STW A;  2DK8 A;  1TBX A;  3V7C A;  4RS8 A;  3QOP A;  1GHC A;  4EVI A;  5BPD A;  4B8X A;  4HLY A;  4HOB A;  2VN2 A;  2IRF G;  1I6X A;  2G7U A;  2H6C A;  3ELK A;  3LWF A;  4Q5S F;  3KLN A;  1QPM A;  3RKW A;  2ISY A;  5D6F A;  3HTU A;  4Y17 A;  2E7X A;  3KZY A;  1BI3 A;  1ZRD A;  3E6D A;  1LDK B;  1E2X A;  2ESH A;  1S6L A;  1LEA A;  1BIB A;  5A2Q Z;  1FBS A;  4XBF A;  1L3L A;  1OKR A;  3BOQ A;  2J5O A;  4E70 A;  2MLG A;  1Z6T A;  5LGT A;  2V9V A;  3IHU A;  1W5S A;  1D3Y A;  4WCG A;  4I98 B;  1U5T B;  1O3Q A;  3Q9V A;  2KKO A;  1RUN A;  4I0A A;  2LNB A;  1R58 A;  1Z91 A;  2OBP A;  5FFX A;  4HQM A;  2P7V B;  4I2O A;  2WC2 A;  1FZP B;  2UXX A;  5E8I A;  4DNC A;  5DCM A;  4BH9 A;  3JSO A;  3G3Z A;  1XGN A;  3KP5 A;  5IT9 Z;  4U0V A;  4M71 A;  5LHI A;  3WGI A;  4MQV A;  5CJ9 A;  1JXS A;  4BHP A;  5JFR A;  5E20 A;  2YPR A;  2L3D A;  4KNY A;  1J0R A;  3F8C A;  2TDX A;  1B59 A;  1SAX A;  2PFB A;  2ZJ2 A;  3N97 A;  2PBI A;  2OU2 A;  2BE5 F;  3BJO A;  2DQR A;  5F1R A;  3TDZ C;  3CDH A;  3LA7 A;  5HVQ C;  1MJB A;  4A2U A;  2QM3 A;  3V8K A;  5LEK A;  3IC7 A;  1HSJ A;  4FHT A;  1WSU A;  3PQJ A;  5D8K B;  4ZYH A;  1B4A A;  2YU3 A;  3I64 A;  3JTG A;  3HTS B;  1MDM A;  1SFX A;  2ELH A;  2Z5U A;  2MH2 A;  1KQ9 A;  1IW7 F;  3F3X A;  3HRS A;  3I58 A;  4CDG A;  3EYI A;  1KA8 A;  1DDN A;  1ULY A;  1LDJ A;  4BQA A;  1YO5 C;  2K27 A;  4A12 A;  2BGC A;  3K69 A;  2QQ9 A;  3WGG A;  2FMY A;  4RGR A;  2HZT A;  1YIO A;  1ZRF A;  4HV5 A;  3SZT A;  3G73 A;  2A61 A;  3ZP5 A;  1O3S A;  2FNP A;  3CJN A;  2HFH A;  4KA4 A;  3K1M A;  4NB5 A;  4A6D A;  4ASN A;  4EQQ A;  2BEO A;  1IRG A;  1OYY A;  3L09 A;  3I54 A;  1XDU A;  4HDV A;  3E6B A;  5JI6 A;  2YSR A;  2XHK A;  4I7H A;  5DUI A;  2OA4 A;  1ZLK A;  1O3T A;  1ZH5 A;  2QQA A;  4KUM A;  2QZ8 A;  1C0W A;  2HYG D;  4ESF A;  2LKP A;  5L3E A;  3J81 Z;  3ZN0 A;  1FC3 A;  5DDG A;  3HOT A;  1MDM B;  2OD5 A;  1I1G A;  1J9I A;  3EET A;  2PMH A;  4HF0 A;  2LDU A;  4D0P A;  4ZZD A;  1TQI A;  3WTZ A;  1RZ4 A;  3TO9 A;  4KIG A;  4WK8 F;  3I4P A;  2V1X A;  2M5W A;  2EFQ A;  1F4K A;  3MQ0 A;  1XGS A;  3FXQ A;  3JAM Z;  1IN7 A;  2DO7 A;  4GYG A;  2VBW A;  1BC7 C;  4LMY A;  4MEX F;  4IJA A;  3RDI A;  4AIH A;  1BIA A;  2DBB A;  1K78 A;  2EV6 A;  2IP2 A;  2STT A;  4KYW A;  1KQ8 A;  5HLI A;  4L9V A;  1FPQ A;  3F6V A;  2EK5 A;  4PCQ A;  1D8K A;  2VC1 A;  4UVA A;  3JSP A;  1IN8 A;  5LRS A;  2A6E F;  3ROU A;  3CUQ C;  4IHT A;  2H09 A;  4CYD A;  4M9S A;  5BMZ A;  2O03 A;  2Z99 A;  2O3F A;  2HWV A;  3T5X A;  5TJJ A;  3CUO A;  3I53 A;  2J5P A;  5D5U B;  4R1H A;  2G7H A;  4BNC A;  3GEZ A;  2Z9O A;  4EM2 A;  5HS8 A;  2K7L A;  2P6T A;  3Q9S A;  1U3E M;  1BBY A;  4ON0 A;  2ZKZ A;  1YLF A;  4O5V A;  4GO1 A;  3HRU A;  5ILU A;  3LA3 A;  3E6C C;  3E5U A;  1QGP A;  4IPA A;  1TNT A;  2RKH A;  2NNN A;  2D45 A;  1R1T A;  3HUG A;  4XSX F;  2BV6 A;  5E1X A;  2O6G E;  3QAH A;  3BWG A;  3TDU C;  1DPU A;  1W7P A;  2KJC A;  4QLC U;  1RNL A;  2VT3 A;  5FD5 A;  1A04 A;  2H6B A;  1TTY A;  1P4X A;  3H92 A;  3IRQ A;  5H20 A;  2P5L C;  2A68 F;  2CW0 F;  4HLX A;  1OYW A;  2R7F A;  1MD0 A;  4U88 A;  2QLZ A;  2FRH A;  2BBY A;  2MH9 A;  3FXR A;  3IWF A;  4P9U A;  2V79 A;  5K5O A;  3FMQ A;  3HIF A;  2L01 A;  2UXN A;  1T0F A;  5HLH A;  5D4S A;  2XAJ A;  1R5H A;  2P5V A;  1LNW A;  1SD6 A;  3RYP A;  3QU3 A;  4UXN A;  1MJA A;  2OQG A;  2VOO A;  4GCV A;  1V3F A;  4CZZ A;  1W7P B;  3SZP A;  2W84 A;  2DAO A;  4U7D A;  4HV6 A;  1UHW A;  4ZYE A;  3J80 Z;  3FMS A;  4UHT A;  2HQN A;  4A0Z A;  4EJU A;  4S05 A;  2XAQ A;  2D2W A;  5FB2 A;  3MWM A;  2A6H F;  4KIC A;  1XMA A;  2QBY A;  2P8T A;  3F23 A;  2EV0 A;  2EJR A;  3LQR A;  3WTS C;  3VB2 A;  4YFK F;  5DV5 A;  3ZMT A;  2M8E A;  2RVC A;  2HEO A;  2K02 A;  3JW4 A;  3M8F A;  4P9F A;  1T39 A;  2ZNZ A;  4UV8 A;  3VFZ A;  1SD5 A;  1LVA A;  5E1Z B;  3B02 A;  4DQ2 A;  1R00 A;  3QU6 A;  1X3U A;  3J81 K;  2GA1 A;  4OIQ F;  4L0Z B;  2MC3 A;  1JHH A;  3DFG A;  3B73 A;  2F2E A;  3I59 A;  2CWE A;  1BOA A;  4ENM A;  2Q0O A;  1XCV A;  1ZHF A;  2MBF A;  2M30 A;  4PDK A;  1IRF A;  2Y0M A;  3BY6 A;  3E5X A;  4HBL A;  3MCZ A;  5ICF A;  1HW1 A;  4FX0 A;  3CO6 C;  4KIB A;  4MHG A;  3ZPL A;  4L0Y B;  2RC4 A;  2XRN A;  3V8L A;  4LB6 B;  3RPQ A;  1Z7U A;  3MEX A;  3HRT A;  5D4R A;  4YFX F;  2XGX A;  3MFK A;  3BRO A;  4M6X A;  1YQA A;  1MJ9 A;  2ACJ A;  1ZN2 A;  1T38 A;  5F64 A;  3NRV A;  3P9K A;  1SD4 A;  3KCC A;  1U5T A;  2ZCW A;  2PG4 A;  4AD9 A;  1IN4 A;  1YW9 A;  4BAY A;  5DCF A;  2HKX A;  2O8X A;  3DPT A;  4TV7 A;  5BQT A;  4EV0 A;  2FML A;  4MTD A;  1AWC A;  1DP7 P;  1O57 A;  3TOB A;  4L9T A;  1WQ2 A;  2JZY A;  1P6R A;  1ZAR A;  2MD5 A;  3QRF F;  4LD5 A;  4L9N A;  4PGH A;  4ETS A;  1BM9 A;  2FA5 A;  4KT5 C;  1RUO A;  4Y13 A;  4B09 A;  3ZMV A;  4I0B A;  3U9G A;  3E6M A;  3M1E A;  4IRI A;  1HQC A;  1FYM A;  3ULQ B;  1STZ A;  5L3F A;  3V7R A;  2KIM A;  3WOD F;  4MNU A;  1MGT A;  1JE8 A;  2IT0 A;  3EDP A;  1J59 A;  5DUK A;  5D8L B;  3L7W A;  1S3J A;  2GZW A;  1FBU A;  3H3U A;  3VOE A;  3F8N A;  2YR2 A;  1G3T A;  1WWX A;  3VEP A;  5K5Q A;  4LLN A;  2FBI A;  2EFO A;  2RV8 A;  3FWE A;  3ISP A;  3QP6 A;  2V1D A;  5CVV A;  1HXD A;  1P2F A;  2O61 A;  4M9X A;  3ZMU A;  1BI2 A;  2A3S A;  2V1U A;  3ZMZ A;  3DKW A;  3CUQ B;  3L2C A;  1CGP A;  4CGZ A;  2EB7 A;  3KP3 A;  1Z6R A;  3BPX A;  1F9N A;  3TQN A;  5L3B A;  2L4A A;  1TQP A;  1TW3 A;  3LAP A;  2Q2E A;  1FP1 D;  1B9M A;  3J80 K;  1YS7 A;  2OZ6 A;  3V8J A;  3D0S A;  2DQL A;  1ON1 A;  1ON2 A;  5HDG A;  5FGM A;  3EYY A;  4LLG F;  4HYE A;  3T0Y A;  1CF7 A;  1R36 A;  1QQI A;  5L3D A;  4RAZ A;  3I5U A;  3K2Z A;  4L9J A;  2VBX A;  2YX4 A;  4HDU A;  3FF5 A;  1W4M A;  2IA1 A;  5JHU A;  1MKM A;  3P9C A;  3IWZ A;  1J75 A;  1GVJ A;  2GWR A;  4U0W A;  3EUH A;  3WTV C;  2CGP A;  4OIO F;  3E97 A;  1AOY A;  2HOE A;  3WU1 B;  3K1N A;  3FZV A;  2GAU A;  2WV0 A;  2ISZ A;  2XV4 S;  4XLN F;  3U2R A;  3K0L A;  4MQ9 F;  3RYR A;  2WWY A;  3ZN1 A;  1ZRC A;  1QO0 D;  1UCR A;  5ICG A;  2A07 F;  2HKO A;  1HKT A;  3ABT A;  5D5X B;  2P5K A;  1IZ1 A;  2H94 A;  5E8G A;  1IAW A;  1QBJ A;  2BYV E;  1CF7 B;  3SHF A;  1B6A A;  2UZK A;  3F8F A;  3P7N A;  4L5I A;  2FQ3 A;  2DK5 A;  5BOX A;  1QNT A;  4M9Z A;  2ZFW A;  4BHC A;  1FYK A;  4H0E A;  4Z2Y A;  2RQP A;  3R6S A;  3GFI A;  1IXR C;  4UUV A;  4M72 A;  5AIQ A;  3F72 A;  4YFN F;  4LFU A;  3GUD A;  5ILS A;  5D5V B;  2FOK A;  2XKO A;  3ZMS A;  3ABU A;  1XD7 A;  3VOD A;  1I1S A;  1T98 A;  3R0J A;  1R5G A;  3DV8 A;  3WU0 A;  1U6G A;  4OMY A;  3R4K A;  5H6Q A;  4ENK A;  1YW7 A;  3DPL C;  4IRG A;  3WTU C;  5LHH A;  4WX9 A;  4KMU X;  5LGU A;  5FLX K;  2VOD A;  1KYZ A;  2A5Y B;  4N0B A;  2IW5 A;  1J5Y A;  3W6K B;  4R79 A;  1BN5 A;  4OIR F;  4GGG A;  2QUF A;  4HA8 A;  2RDP A;  3M7G A;  1UB9 A;  1HW2 A;  1PDN C;  5DYM A;  2LSO A;  2OZU A;  3S2W A;  4MTE A;  2XAG A;  1YS6 A;  4I02 A;  4HZF A;  2R3S A;  3GZ6 A;  2HGC A;  3D5L A;  5ERI A;  2M87 A;  3COA C;  2PMU A;  3W6J B;  2GA2 A;  3LST A;  5KK1 A;  3T8R A;  1OYI A;  1YTY A;  5H6R A;  1XMK A;  3FM3 A;  4HX4 A;  4CHU A;  1ZGJ A;  2D1H A;  1BI0 A;  5CVJ A;  4CIC A;  3HOS A;  2PI0 A;  1PP8 F;  2EA4 A;  3IL2 A;  3CLO A;  3DP7 A;  1NHA A;  4IVN A;  4ENN A;  4YG2 F;  2KJB A;  2X4H A;  3REO A;  2LF7 A;  4CO8 A;  3K1P A;  3L00 A;  3QP5 A;  4RB2 C;  2P6S A;  4GXO A;  1XDS A;  2XAH A;  3I71 A;  3HSE A;  3LAJ A;  4ZYD A;  3PQK A;  4KDP A;  2EFN A;  4AWX B;  4Q4Z F;  5IT3 A;  1O3R A;  4EGY A;  1KU3 A;  1XGO A;  4G7O F;  1FYL A;  4LK0 F;  4KMF A;  3KZZ A;  2WTE A;  4PGG A;  5TRD A;  2KIF A;  3TO6 A;  2CG4 A;  3WG9 A;  4G9Y A;  2HR3 A;  3KP6 A;  4RAY A;  5CLS A;  4BXU A;  1FT9 A;  2ADU A;  2EFP A;  1ONV A;  1Z9C A;  3CO7 C;  5K1Y A;  4JK1 X;  5ILV A;  3KEQ A;  1E17 A;  1LEB A;  3DF8 A;  1H9T A;  1S7A A;  3O3K A;  3E5Q A;  3O6B B;  4ZYG A;  3M8E A;  4LG0 B;  2HDC A;  2Q8K A;  5BPI A;  1L0O C;  3KFW X;  2VXZ A;  4HF1 A;  2RNJ A;  2ZXJ A;  5LGN A;  3H3Z A;  5ICC A;  2NAZ A;  1O7L A;  1GXQ A;  4P5O A;  1UFM A;  4OMZ A;  2K86 A;  2XAF A;  4CXF A;  3P9I A;  1TLH B;  3SFZ A;  4A5M A;  2X0L A;  3TO7 A;  1FX7 A;  4I01 A;  2PJP A;  3EQL F;  1ZAO A;  3HSF A;  5J8C A;  5JVT A;  1FY7 A;  3QPT A;  1I27 A;  2UWM A;  5CVU A;  3TKY A;  2QEN A;  4KIF A;  4WWC A;  2XIG A;  3TOA A;  3QPH A;  4HF2 A;  2VOP A;  4Q48 A;  3F8M A;  3C18 A;  2L4M A;  5CVI A;  2NYX A;  2JRT A;  1P4W A;  3NEU A;  2DT5 A;  3K9T A;  3JTH A;  1FOK A;  2AXL A;  2LF8 A;  2NS0 A;  2MLK A;  1IUY A;  2E7W A;  2NRA C;  2D1V A;  3KLO A;  5DD8 A;  5E1W A;  2FE3 A;  2YX7 A;  1MZB A;  2ZO4 A;  4Q47 A;  1XSV A;  4IRH A;  3I0T A;  1ZLJ A;  1OPC A;  5ICE A;  3C1D A;  1YYV A;  2ESN A;  3HHH A;  1VTN C;  1ZG3 A;  2QVO A;  5FLX Z;  2P7C B;  4AIJ A;  1IN5 A;  3Q5F A;  3WGH A;  3F22 A;  4OIN F;  3CUQ A;  2W24 A;  2GXG A;  1FSH A;  3GX4 X;  3KEO A;  2CYY A;  2PEX A;  2Z33 A;  2PN6 A;  2MA3 A;  1EH7 A;  5F6F A;  1RIO H;  4IF4 A;  4YII A;  4G7Z F;  2R7D A;  1B1B A;  2G9W A;  2FNA A;  2P4W A;  4RB0 A;  4EJW A;  4ZH4 F;  1BJA A;  1LDD A;  2IA2 A;  3GO5 A;  1G3W A;  4LJZ F;  1XN7 A;  5K5R A;  1LQ1 A;  1Q1H A;  3OOP A;  5D6E A;  3GFL A;  2V6C A;  2FF4 A;  3OV8 A;  3IKV A;  1U78 A;  1PP7 U;  1V4R A;  2DW4 A;  2F5D A;  3LFK A;  3ZQ7 A;  1UST A;  1IF1 A;  1W7P D;  4ESJ A;  2RN7 A;  4LB5 A;  3C7J A;  3GXO A;  2VE9 A;  2QQB A;  5AIP A;  4NHJ A;  5LLQ A;  4UVB A;  3F21 A;  4I09 A;  2Y75 A;  2JPC A;  4RGX A;  1XGM A;  2GIV A;  3WTX C;  4RB1 A;  3HYI A;  1U2W A;  3L9F A;  2CQK A;  3T1B A;  2CO5 A;  2K4J A;  2COM A;  4GYI A;  4L18 B;  4Y15 A;  5JR3 A;  2DFI A;  2W85 A;  5FD6 A;  2DPD A;  5HS9 A;  1RI7 A;  5DEQ A;  2K4B A;  3WE3 A;  3DXJ F;  1S7O A;  2JSC A;  2HYF A;  1SFU A;  4OU0 A;  4LLL A;  4G6D A;  5HOO A;  3FXU A;  3O2P E;  5DD4 A;  2F5E A;  1KU7 A;  2KRF A;  2RGV A;  4WXC A;  2F5C A;  2HS5 A;  5DCM B;  3WTW C;  4RGS A;  1B9N A;  5J8F A;  3FHZ A;  4HX8 A;  2FBH A;  2OAZ A;  1DUX C;  2EWN A;  1F1Z A;  3WTT C;  2HQR A;  1KU9 A;  4P55 A;  4N9I A;  2FU4 A;  3KP4 A;  2XKP A;  1G3Y A;  1KGS A;  2VC0 A;  1EH6 A;  2IVM A;  5LRR A;  2ZNY A;  1FNN A;  2FSW A;  2FBK A;  1KU2 A;  1EH8 A;  2DU9 A;  3DEU A;  1IXC A;  4HW0 A;  3IRR A;  3AAF A;  3NQO A;  1Z05 A;  1LJ9 A;  1F5T A;  1GXP A;  1ZGA A;  2Y48 A;  2JT1 A;  5KVR A;  4WXD A;  3R0A A;  1P4A A;  2JPB A;  5E17 F;  1YW8 A;  3FX3 A;  3R61 A;  4IXA A;  4M74 A;  4ENJ A;  5L3C A;  1U8R A;  4EJO A;  3FMR A;  3HRM A;  3GF2 A;  4A0Y A;  1SMY F;  2QWW A;  5D5W B;  1HKQ A;  1D8J A;  1XB4 A;  1U5T C;  1BC8 C;  1OR7 A;  3N4M A;  4UNO A;  4HQE A;  4G8X A;  4NQW A;  3CTA A;  2B0L A;  4QWQ A;  1SD7 A;  3BZ6 A;  2DLL A;  2E1N A;  2CFX A;  4G7H F;  1TQM A;  4LK1 F;  3ECH A;  2FXA A;  2VON A;  3HHG A;  1H9G A;  3KP7 A;  1S8N A;  3WTY C;  3ERE D;  2DTR A;  4AVP A;  3RIR A;  1XSD A;  1IN6 A;  4FT8 A;  1FBQ A;  3TGN A;  5CYV A;  2Z3Y A;  1QZY A;  3KE2 A;  3BP8 A;  4RB3 C;  3BJA A;  4LGW A;  4RGU A;  4BHB A;  2NNY A;  4OIP F;  2M45 A;  1R22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...