3GFWA

Crystal structure of human dual specificity protein kinase (ttk) in complex with a pyrolo-pyridin ligand
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
280
structure length
253
Chain Sequence
FQSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIAGTVNYMPPEAIKDSKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dual specificity protein kinase TTK
publication title Small-molecule kinase inhibitors provide insight into Mps1 cell cycle function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 76
structure length 253
sequence length 280
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2009-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3gfwA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3gfwA01
1XQZA 1H07A 2OIDA 4ZTLA 2Y4PA 4RLLA 4C8BA 4JLCA 4WOVA 5BUJA 2YERA 2UZLA 3MGYA 5AUVA 1NXKA 3F66A 5JK3A 4O0SA 2QOFA 3OMVA 3TV7A 1BYGA 3E62A 3R21A 3R2YA 3QD0A 5IISA 3LLTA 3QUPA 4JX7A 3FLSA 4C4EA 5IQIA 5M08A 2X39A 2WMUA 4CFXA 1XJDA 3SQQA 3F69A 4CGAA 5CEPA 2W1EA 3CQWA 4FSTA 4Y8DA 3PJ2A 3R22A 4KAOA 4NM5A 4D2VA 3FZRA 2VTMA 4ACCA 4OTRA 2LAVA 4DFBA 3Q53A 3R9DA 2GHMA 5IQEA 4MF1A 5M44A 4O2ZA 2J0MB 4L3LA 4NWMA 4S34A 3ZLYA 2EB2A 2GFSA 2JIIA 4QMYA 2WEVA 4Y46A 4A7CA 4AT4A 4FKVA 4P2KA 5AA8A 3HV7A 4WO5A 2Z7LA 3VN9A 4XG3A 1H1SA 4D1ZA 4GFMA 4W8DA 3E88A 4IDVA 5DT3A 3PZEA 3ORNA 4HNFA 4ANNA 3MW1A 5LCKA 4RFZA 3KU2A 3O7LD 4JI9A 5AP6A 5AUXA 3WE8A 4B6LA 2CHLA 1ND4A 3VS5A 5FUTA 5AJQA 3V6RA 2W5HA 3G33A 4RIWA 5F20A 4CQEA 4J7BA 3ATTA 3SW7A 2VTQA 4K6ZA 3VJNA 2XNBA 1XH7A 2IVVA 2VO3A 4XRLA 3QL8A 4DGNA 4CXAA 3BU5A 2X4FA 4IM2A 4TYHA 1BUHA 5ANJA 4TTHB 3IOPA 4KSPA 3DKGA 2F4JA 5A4LA 2C0OA 4YSMA 4D4RA 3KK8A 5CNOA 3LFNA 3IW5A 3NNWA 4RWLA 2PY3A 5GINE 3FMNA 4GS6A 4KKHA 4YZMA 3HUBA 2JKKA 4QTEA 4JQ8A 1Z57A 4OTPA 3Q32A 3VS4A 4EK8A 5CU3A 4MD9E 2G2FA 5J87A 4IAKA 3VULA 3WILA 3BLRA 5I5ZA 4RC3A 2PZIA 2VX0A 4AGWA 4FICA 3ZFXA 4CT2A 5IA0A 4IJPA 3AD6A 4ZY6A 1FMKA 4BB4A 4EH9A 4IZAA 5HIDA 2C6MA 3GU6A 4YR8A 1WBVA 1SNXA 4MXOA 4U42A 3LE6A 3RCDA 3ANQA 4PPBA 4YGAA 5HZNA 5IG1A 3OROA 4QNYA 3P78A 4MKCA 4UBAA 3L1SA 3N4TA 4XG8A 2WB8A 2XUUA 2V55A 2QO9A 5E7RA 4OUCA 5GZ9A 4RX7A 3QQLA 4NEUA 2ZJWA 4O96A 5CZHA 3UQCA 5DEWA 3B2WA 3R8VA 3P9JA 4PTEA 3POZA 5HE3A 5F95A 1A06A 4BGGA 4JXFA 4FT7A 2VWUA 4ACMA 2F7XE 4TWPA 3R02A 3E92A 1ZARA 2BRBA 3PZHA 3WBLA 5C26A 5AR4A 5BQ0A 4YO4A 5TT7A 3KMMA 3RPSA 4RC2A 3FC1X 5HTCA 2WAJA 4ZLOA 2QG5A 4GT3A 2DQ7X 4LI5A 4PX6A 4PWNA 4RC4A 4GYGA 3SXFA 2LGCA 2P4IA 4FV6A 4M69B 3S4QA 1YWVA 3TV6A 4EL9A 5IUGA 4ANQA 2RG6A 1AGWA 1R0EA 4J71A 4FZ7A 4BCMA 4EOMA 3ZLWA 5C8MA 4OAVB 4L3PA 2C69A 2Z02A 3GC9A 4M12A 2IZUA 3RWPA 5AFVA 2G1TA 1ZRZA 3SOCA 2R3QA 3D7TB 3DS6A 1U5QA 3F2NA 4XV9A 5BMSA 3NDMA 5HHWA 1ZY5A 1P14A 3V8WA 2WTWA 4H36A 2P55A 4QRCA 5H3QA 3A61A 4J95A 3L9NA 1BL6A 4TYGA 2PVKA 4NYEA 4GV1A 2P33A 1PYEA 2WMVA 3MN3A 3DXQA 5JGBA 3VUKA 4V0GB 3DXNA 3C13A 4PTCA 2HOGA 3F3TA 3NUYA 3SLSA 3T3UA 1DI9A 2V62A 4HPTE 3VRYA 4PP9A 4A9YA 5HEZA 4U81A 3ACJA 2YJRA 3AOXA 3COKA 3G0EA 4QMOA 5FQDC 5DI1A 4QMWA 4JDIA 3V8TA 3MIAA 1JAMA 2J0JA 4X3FC 3DQXA 4EOPA 3I0QA 4FV1A 2QD9A 4F9CA 4RA5A 3PLAE 2XK4A 3EMGA 5C01A 4QMPA 1ERKA 4O22A 3RMFA 3QRIA 2Y7JA 1LR4A 2IVTA 3BHVA 3SG9A 3FLYA 4RVMA 2WNTA 3PJ8A 4DEHA 4TRLA 4OTGA 1H1RA 3QXPA 3OY1A 2G2HA 4I1ZA 5LWNA 2XIXA 3WF8A 4V01A 5KBRA 5D11A 3LJ2A 4Y83A 5KUPA 1Q8ZA 3ORXA 2YHVA 4OTWA 4AE6A 4XP2A 3I1AA 2CMWA 3RCJA 4EH8A 3ZSHA 4B8LA 5D7VA 3MY1A 3R73A 3EN4A 2E2BA 2YDJA 4BDKA 5FXQA 3GCSA 4NL0A 4HYSA 5J7HA 2BDWA 3ZH8A 3DFAA 4A4XA 1K3AA 2CGXA 4JQ7A 2E9NA 3AG9A 4L3JA 1JWHA 4RRVA 2OH0E 3ULZA 5E90A 3DPKA 3IS5A 3EKKA 2JAVA 3COMA 3BIZA 4S30A 5HU3A 2OF2A 3NYNA 4QTAA 3VAPA 3RPVA 1Y91A 2XKEA 2R2PA 3OXZA 3MESA 3U6JA 5FBNC 3S2PA 2CKOA 4C0TA 3RINA 3HMIA 3PXFA 3ZFYA 4MBLA 5HG7A 3VNTA 2W1HA 2F49A 3U4UA 3ZHPC 1KV2A 2PWLA 5HNBA 3TV4A 3Q5ZA 4FT5A 2UVYA 5EDPA 4L52A 1YXTA 3PA3A 4AOJA 4F7JA 5LMKA 2PVNA 1TQIA 5EFQA 1O6YA 4KNBA 3VO3A 2VNWA 3CY3A 4ALWA 2VX1A 5D7AA 1RW8A 2C30A 5DEYA 4DG3E 4FA2A 4NU1A 3HMPA 2HIWA 5HCXA 2J51A 4GG5A 3PPJA 3CJFA 5HOAA 1QPCA 3KKVA 3SOAA 4C3PA 3V5TA 3LKMA 3ZDUA 1YDSE 2YM4A 3ORKA 2O64A 3UNKA 4CFUA 5EDQA 4LM5A 3KVXA 5HLPA 4WG4A 2QKWB 2EWAA 2WIHA 5A3XA 3U8WA 2VTTA 5JH6A 2GFCA 1Q24A 2RKUA 3VS0A 3PP0A 3UTOA 3K5UA 3BYUA 5IUIA 3UPXA 3R7UA 2PVJA 3EN6A 5BX0A 4TL0A 3GOPA 3A2CA 2PMLX 3N9XA 3VUDA 1ZXEA 2R3OA 3H0YA 5B2KA 5TF9A 5CWZA 3FDNA 4ITJA 1DM2A 4EORA 2HWPA 3C5UA 2CN5A 3TIZA 4ZK5A 3VBQA 4IHPA 2R7IA 2BPMA 1NA7A 4XOZA 4DITA 2XK6A 2UZBA 4PPAA 4RFMA 5TOZA 5EM6A 3QX2A 2C3KA 4IB1A 4FK6A 3TZMA 2IW6A 3SDJA 2I0YA 4IFGA 3SVVA 4YTHA 5EQPA 4WKQA 3LFQA 4QP7A 3BHHA 4WRSA 4FTKA 4BCIA 5EI8A 5AX9A 3DCVA 2OH4A 4GYIA 4CYJA 2WZJA 1MQ4A 4DGLC 4C58A 4F6UA 3WZDA 3HVCA 3OEZA 1J91A 3HKOA 4PMSA 5ANDA 5FBOA 4IVCA 3FE3A 3CCNA 2BR1A 4IX6A 3NW7A 2R0UA 4EH4A 1CKIA 3O17A 4GEOA 5I9UA 1GIJA 3FMMA 2I6LA 5EM8A 4X2KA 3HV4A 2JAMA 4BZNA 4DH7A 2RGPA 3ZYAA 4H39A 5E8UA 4X3FB 3OC1A 4IBMA 4R78A 5AEPA 4FYNA 3R8LA 1G8SA 3Q3BA 5KO1A 3LXKA 3UYTA 3VF9A 4TWOA 4B9DA 4EQUA 5L4QA 4D4VA 4HVIA 4ERKA 5HG5A 1WBOA 3CIKA 3DJ7A 4CCBA 1PY5A 3BYOA 3PG1A 3K5VA 3VUMA 1WZYA 4K9YA 5AR5A 5CXZA 1YRPA 4G9RA 1URWA 4TY1A 1J7LA 3R30A 3NWWA 1JPAA 4FK3A 4U44A 2XIRA 1JSTA 5BVNA 4UALA 2OI4X 2YCRA 3QXOA 3DV3A 2YWVA 3O23A 4M97A 3Q4CA 4M69A 3AQVA 5HBJA 4YLKA 3OWKA 2ZOQA 4D2RA 5LMAA 3RPRA 4BDBA 4RA4A 4U5JA 2YEXA 4IAZA 2XS0A 5H8GA 5HNGA 3ZSIA 4EWQA 5HG8A 3VQUA 2AC3A 2FH9A 4EK5A 1LPUA 1RDQE 4ZJJA 4ZOGA 3TDVA 4DFUA 4MAOA 3MI9A 4MX9A 2H8HA 4L7SA 2BRNA 2CSNA 3QFVA 4TW9A 4AZSA 5AP7A 1WMKA 2O2UA 2UVZA 3MPAA 4BDCA 5CAUA 1GZ8A 5CSPA 4LL5A 3ENMA 3M11A 3Q9XA 4NH1A 3P7BA 4MD7E 3T9IA 3QRKA 4QPAA 4DH5A 4R7HA 4E6QA 4X2JA 5JRSA 4G3DA 4X21A 4XG6A 4MTAA 2OZAA 3NAYA 3G6HA 4J8NA 4U0IA 5AUZA 4KSQA 4FTJA 5DR9A 4CZYB 5GZAA 1Q61A 3HAMA 1PMEA 2HAKA 3PIZA 3TJCA 4IAFA 4QMSA 4YPDA 1YI3A 1YOLA 5DVRA 1NT2A 5KZIA 4N4SA 5J95A 3MWUA 4O0UA 4NUSA 4BCOA 4UWCA 3ZRKA 4JS8A 3KRJA 2ITOA 4FGRA 2VTAA 3ENHA 4BCPA 2ZM1A 1PXKA 3R8UA 4USFA 4RJ3A 3F5GA 4IB3A 4FEWA 4QD6A 3W33A 2XMYA 3ZO1A 2VZ6A 2ETMA 4CCUA 4G3CA 3CS9A 4FGBA 4A4OA 3PPKA 1K9AA 3UIMA 3U9NA 3ZBXA 4XJ0A 5J7BA 2J90A 2H9VA 4MNEB 4Q9SA 5H2UA 4G3GA 3QD3A 3ZLXA 2GNFA 2XRWA 2PTKA 2W7XA 4EOQA 2VTIA 3PP1A 4AGDA 3BGQA 5A6OA 3KULB 3KRXA 1MQBA 4O0YA 4EHGA 3ITZA 4WNOA 3Q6UA 5J8IA 1YI4A 4D2PA 5AUWA 2NPQA 2VTLA 3A8XA 3PSBA 5FEQA 3A7JA 3IGGA 3MY5A 1H0VA 1QL6A 4K33A 4BIBA 4BZDA 3KEXA 2VTNA 4BHNA 4OTDA 4BTJA 2UZWE 2Y4IC 4BHZA 3JY9A 2XK8A 1QPEA 5JSMA 3W8QA 2ZVAA 4TYIA 3QTWA 4YZ9A 4IZ7A 3SXSA 5KMMA 5M4IA 4E8AA 3PTGA 4IC8A 3OW4A 2C5NA 3FJQE 3L9PA 4PMMA 3KGAA 4DHFA 1WVXA 2WTIA 5IQBA 4W8EA 2ZMCA 4OW8A 2X8DA 2XM8A 2OIQA 2ITQA 4I5CA 1AQ1A 2UW0A 2JGZA 3DBFA 3HMOA 2O63A 4FTIA 4P4CA 5ANEA 5AM6A 3KVWA 3KF4A 3ZFMA 2R3HA 3CJGA 1PXNA 3OEFX 4LOQA 2O0UA 3DDPA 3PXQA 3HX4A 4K77A 3LPBA 4ITIA 3TACA 1TVOA 3BYSA 5HCYA 4DT8A 3PA4A 4DFXE 2W1DA 4FOCA 5CYIA 5A46A 4BY9E 3VS7A 4O0XA 2BILB 3SXRA 1UV5A 3F61A 1FPUA 4I24A 3RPOA 3L9LA 3R71A 3WF5A 5B2LA 2Z7RA 3OS3A 4D4YA 4U80A 3DT1A 3LCKA 3DB8A 2UZTA 4NK9A 2XNNA 2OJFE 4OTIA 3LCSA 3ZUVA 4BWXA 5FP5A 2VGPA 3O8PA 3VC4A 2ZDTA 1L3RE 4ZZMA 3UMWA 4YJTA 1YOMA 4KS7A 3TNIA 4FTLA 3ZEWA 2OICA 1H8FA 3GU7A 4JAJA 4H58A 3H9FA 4TNBA 2VX3A 1WBPA 5L2IA 4AS0A 3FMDA 4C38A 1YI6A 2DS1A 2R3NA 2VRXA 3W2PA 1BMKA 4AXAA 2OO8X 1IR3A 5HI2A 4QNAA 3UZRA 2BMCA 4IAYA 4RIWB 4AGUA 1PXMA 2W96B 3MH1A 3QYWA 3OWLA 2UZNA 4IZYA 2BHEA 4L8MA 3OY3A 4DLJA 4H3PA 3B2TA 4TYEA 4HZSA 2OXDA 3KF7A 5DRDA 2IW8A 2R5TA 4CD0A 4TYHB 4FG7A 4K2RA 4KBKA 1VR2A 4FVQA 2B9HA 2F2CB 4EHEA 2JLDA 2QO2A 3OOGA 3LCOA 3PJ1A 4LQMA 5EHOA 3V5LA 4J96A 2BROA 4BI2A 5CAOA 3PIXA 4OAUC 3LFCA 4AWIA 1OL6A 1P5EA 4F9WA 5C4LA 4NIFB 2HZ4A 5IEVA 3OW3A 4DINA 4GIHA 3RM6A 3FMEA 3Q9WA 1MUOA 2QU6A 3A4OX 2ZV2A 3RKBA 5M4FA 2Y8OA 3PY1A 1A48A 4W4WA 2ONLA 4Z7GA 3PA5A 1T46A 4X6QC 5IEXA 1PKDA 2RFEA 2R3FA 4WBOA 4IMYA 4C3RA 2BZKB 2WMRA 2QHNA 2ITXA 4DN5A 1Z9XA 3NCGA 5EDRA 2EVAA 4O0WA 1M2RA 3KRLA 3QTIA 2BZIB 4FSMA 2BRHA 3BEAA 3AC1A 2WKMA 5LVOA 4JBPA 5AV0A 5ETIA 4XV1A 1XBBA 5LMKC 1OL1A 3QCYA 4FL3A 4MBJA 1YWNA 4KIPA 4AA5A 3Q2MA 4ZAUA 3W2RA 4U3YA 5M09A 3DB6A 4A4LA 1LEZA 3PJCA 3Q6WA 3E64A 2CCHA 4I6FA 4R1YA 3W18A 5JGAA 2VWIA 4YHFA 3UO6A 2Y4IB 1GOLA 3BBWA 4E5AX 1R39A 3MFSA 1ZOHA 3WIGA 4E6CA 3R9RA 2WXVA 5L8JA 3GQLA 2PHKA 4HOKA 4B4LA 3EZVA 4ORKA 3RBWA 1PKGA 5LARA 2R3GA 3QHWA 4E4MA 3B8RA 3OBGA 1OPJA 4DFLA 4IEBA 4N6YA 4DH3A 5GHVA 1ZMVA 3KMUA 3BHTA 3GGFA 4UYNA 5AP5A 2SRCA 2UZOA 3MA3A 4QTBA 1UNLA 3C51A 3UO4A 3ZSGA 4EH7A 2GNHA 4II5A 4NSTA 4DC2A 3SKCA 1OKVA 1M7NA 2FGIA 5J9LA 3GCQA 4D5KA 1KE6A 1A9UA 3HNGA 3ZONA 3C4XA 3FYJX 2C5XA 1FINA 3HA6A 1S9IA 3PUPA 3IGOA 2BVAA 2CKPA 1G5SA 3MBLA 2GPHA 4BKYA 4M66A 3KCKA 2XNEA 4RJ8A 5HE2A 4DA5A 4RPVA 3BPRA 4I6BA 3U4WA 4EH3A 5HO6A 3DJ6A 3VW8A 3IOKA 5HIEA 4UZDA 2RFDA 4HCUA 2UZVA 2W1ZA 4UY9A 1H4LA 1BI8A 4YHJA 5DNRA 2C6LA 1BX6A 5IH4A 2HWOA 1FVVA 4XNEA 2YACA 3P79A 4WD5A 2WD1A 2F57A 2XNGA 3Q4ZA 4FKRA 3HZTA 3O2MA 4O6EA 3BQCA 3ORZA 1PF8A 2X2MA 3UGCA 4L44A 2JIVA 3JXWA 3MSSA 4MQ1A 4UWYA 4Y95A 1PXPA 4ZS0A 3V01A 4E6AA 1F3MC 3RK7A 2ITZA 4ACGA 3EQPA 1Y8GA 4IJ9A 4J98A 2B52A 5CVFA 4GVJA 3TNWA 4O0VA 4AFJA 4AW0A 2ERKA 4RWJA 4MXAA 5CEIA 2J5FA 4FV3A 4U3ZA 4Y73A 4FX3A 5AP4A 4C02A 3QTSA 5I0BA 5G1XA 3EZRA 5HVKA 2UZUE 3R1NA 3OCBA 3D14A 3V3VA 3VBXA 4AZTA 2QODA 4DFNA 2H6DA 3TNQB 4I22A 2UZEA 3VF8A 3E3PA 4GFGA 5CSWA 2W0JA 1IRKA 3DLZA 4J53A 2XJ0A 3QGYA 4FOBA 2X4ZA 3BWJA 3DOGA 3F3WA 2R3MA 2WQBA 4BTFA 4EOIA 3UOJA 3EN7A 4E26A 2X2KA 3I81A 4O38A 1U46A 3DBEA 5A6NA 2IW9A 1OBDA 4XG9A 2OJJA 2JBPA 1NW1A 2XB7A 4ASZA 2YIXA 4RX8A 2XKCA 4F1OA 4BI1A 4NW6A 4F7LA 4O7YA 4JDJA 2H34A 4L00A 4BCGA 4KKGA 1STCE 5C8KA 4IX3A 4N70A 1PXIA 3QKKA 4ENYA 4R8QA 4RJ5A 4MQ2A 4CRLA 3ZZEA 3KA0A 5CVGA 5M4UA 4ERWA 4MWIA 2W1FA 1DAWA 5CU2A 5ICPA 4G6OA 5CEQA 2YM3A 4K0YA 4PNIA 5EOLA 3Q96A 5E9EA 3FMLA 3MB7A 3DNDA 4QP2A 2OGVA 4DEIA 3T9TA 2QVSE 2ZM3A 5IDPA 3ORTA 4U79A 4I20A 4BBMA 3W2SA 3HRCA 1NVRA 1UU8A 3WI6A 2C6OA 2CN8A 3C50A 3QKLA 4O84A 3II5A 1H08A 5L2WA 5JGDA 4UX9A 2QOOA 3PYYA 2Z7SA 3Q52A 4V05A 3R6XA 4P90A 1JOWB 3FZTA 4IIRA 5B0XA 4HGTA 4JRVA 4DCEA 2E9UA 2P0CA 3QAME 4LRJA 4HGSA 1JNKA 1FMOE 4IW0A 3ULIA 4ZY4A 2HW6A 1E1XA 4ALVA 4EZ7A 3WYXA 5IQGA 2V5QA 4AF3A 3A60A 1EH4A 4JX3A 4EUTA 4DG2E 1FGKA 2JEDA 4DBXA 3FY2A 1Y57A 2YDKA 5J9YA 5TE0A 3E63A 5HGIA 2XCKA 5DR6A 1DS5A 5CEKA 3C4WA 5IQFA 4AN2A 1XBCA 2VN9A 5DLSA 3RNYA 2J4ZA 3TNHA 4NIFA 4ASEA 4AAAA 1J1CA 4FNXA 4I4FA 4L46A 1T45A 5IZFA 4C33A 3R7EA 3UYSA 3FEGA 3POOA 1YXXA 4CMTA 5EI6A 3OOMA 5IH6A 1UKHA 1REKA 4QMZA 2BTRA 4RWKA 2BUJA 1KUTA 4PNKA 5JMSA 3M42A 3QQKA 2GNGA 4F9BA 4IWPA 1GY3A 4DH1A 4XP0A 4S32A 4XV3A 5LXMA 2ZV9A 2WFYA 2WIPA 4ALUA 4WSYA 2XM9A 4H1MA 5EW9A 3LQ3A 3PRIA 3K54A 2R3JA 5E8TA 1ZZ2A 3D4QA 5H9BA 4M0YA 1ZAOA 5HVYA 1DAYA 3CPBA 4WSQA 4I3ZA 5KMKA 3QRTA 1Y6BA 2QLUA 2JFMA 3CGFA 3U6HA 4BBFA 4ZMEA 4YZBA 2X0GA 5E8YA 5B2MA 4PDOA 4LOOA 1JKTA 2QLQA 5HICA 5JQ8A 3LAUA 4YSJA 5HCZA 5LVPA 2BALA 4FV9A 5KMLA 1NY3A 2PVRA 3MTFA 2Y9QA 4PF4A 4BVUA 4F1MA 1VYZA 4XP3A 3WARA 3PVUA 1OUKA 1KWPA 4YJOA 2WMSA 4GT5A 4M0ZA 4QQCA 4O82A 3KN6A 3LJ1A 3KXHA 2ERZE 4FBXA 2BFYA 4JR7A 3FWQA 4M67A 3U51A 2IZRA 4C4HA 3IECA 4QMUA 1R3CA 4HVSA 3BRBA 4GIIA 4Y72A 4IQ6A 3QTQA 4YPSA 4RT7A 3PDTA 2UW7A 2X7OA 5AX3A 4YTIA 5KMOA 2R64A 2ZMDA 2OLCA 1S9JA 1E1VA 1P2AA 5K0XA 5EYCA 2NO3A 2Z8CA 3W10A 1BKXA 5ETCA 3F3VA 2HENA 3WZKA 3BV2A 4QMTA 3RAIA 5LCJA 3FMHA 2EXEA 4CTCA 2J0LA 3LVPA 4RZVA 2C6EA 3JPVA 2J50A 2C6DA 2X6EA 2AUHA 1U5RA 4I93A 3UIBA 1Q3WA 2XIZA 4DGMA 3PXRA 3RZFA 4WT6A 2OZAB 4R77A 2BFXA 2PMNX 3CEKA 5DR2A 2QURA 4ITHA 5CXHA 2YFXA 2O65A 4WNKA 1PXLA 2IO6A 4EC9A 4AN3A 2NP8A 4HGEA 3LM0A 2PVLA 5FRIA 3R7OA 3A7HA 3ZM4A 4CG8A 1YW2A 3BX5A 4QTDA 2DYLA 4RLKA 4YBJA 4AX8A 2C4GA 2BRGA 2ONLC 4PQNA 2DUVA 2WELA 3IG7A 5T68A 3FAAA 4R1VA 3TZ7A 5JZJA 3E8CA 4HW7A 4HZRA 5ANOA 4BF2A 4C4GA 4RJ7A 4EH2A 3KB7A 4JNWA 1NVQA 4C34A 5HNIX 3MVMA 4YNOA 3UZTA 3GQIA 2HY0A 2YIRA 3D15A 3G90X 4FSRA 5D41A 4R7IA 3FQHA 2YCSA 4QYGA 4PTGA 4ZP5A 3K3IA 3TZ8A 1KSWA 3VW6A 3QD4A 4J97A 1ZYCA 4AN9A 4BYIA 3ZO2A 4Q9ZA 3KK9A 2EXCX 4FV7A 4ARKA 3EN9A 3OZ6A 4APPA 2O5KA 3NIZA 1OBGA 4FTNA 5J1WA 4HCVA 4ZTHA 3K3JA 4FV0A 5F9EA 3EQGA 2OU7A 2WQNA 3WF9A 3E7OA 5E1SA 3IKAA 3MS9A 3UP2A 2XCHA 4FKPA 4IWOA 2YITA 4B8MA 2JDSA 4GT4A 4KWPA 5E8WA 1SM2A 5EHLA 3L8PA 4ZZNA 3CGOA 4EQMA 3FPQA 4YJUA 4BDGA 2PVYA 5L6PA 3U9CA 2XK3A 3QU0A 4GJ2A 1OIRA 3A7GA 4GSBA 4IWDA 3LFDA 4DEDA 4O7ZA 3HYHA 4JG7A 3ZDIA 5M53A 4BIDA 1B38A 3CXWA 4C36A 1VYWA 1XBAA 2CKQA 4NTSA 2QKRA 5H8BA 4AOIA 2XNPA 4ZSJA 5BVDA 2IWIA 2Q0NA 5TR6A 4BICA 1XH5A 3ZS5A 4ZMFA 2EUFB 4ZS4A 3I7CA 4EYMA 2H96A 4EOJA 5KE0A 5CTPA 3RPYA 4CMUA 5D10A 1OIYA 4PRJA 2IG7A 3SHEA 3D2KA 4H3QA 5HBEA 4ANOA 2PU8A 2VGOA 2XNMA 3QALE 3ZUUA 5KNJA 4IC7A 4QP9A 5E1EA 2C68A 4AQCA 4IACA 3OWJA 4IANA 3CLYA 5H8EA 1H28A 1YHWA 3CR0A 1KOAA 3DDQA 5FTOA 4O21A 4FEQA 4ANBA 1TQPA 4GK4A 3FXZA 2HY81 3A4PA 2BAKA 3BGZA 3HA8A 3W2CA 4B0GA 5ETFA 3OWPA 3I5ZA 3ANRA 4FZAB 3BQRA 4RWIA 5E92A 2A1AB 4J99A 4G3FA 5BMMA 3LFEA 5J9ZA 3DK7A 3MH3A 5DGZA 5DIAA 4XG4A 1F5QA 3V8SA 2VO0A 3H9RA 2OK1A 2I1MA 3CPCA 3LJ0A 3SAYA 4D4SA 4WNPA 2C6IA 4F63A 4IE9A 3F6XA 3EFWA 4FTMA 4O7RA 1XO2B 4HNIA 3COIA 3QC4A 4IDTA 2I0EA 5CF5A 5IQAA 3NUAA 2GS7A 3LM5A 3QZFA 5DOSA 4IB5A 3RAKA 4Z55A 4A9UA 3IPHA 5AIKA 2R3RA 3HL7A 4HVHA 3NR9A 4LRKA 5ACKA 1FVRA 3TNPC 4CFMA 3KXXA 4NKAA 3IK3A 3QD2B 3PFQA 5IUHA 3V5QA 3EN5A 1UA2A 4D1SA 4O7NA 2A2AA 4D28A 3E87A 2YAKA 1VJYA 3PG3A 2AYPA 2PSQA 4ZJIA 3UDBA 5KKRB 4KINA 2RSVA 2O8YA 3P5KA 1URCA 3UOLA 5DT4A 2UVXA 2WQEA 2W1CA 3PY0A 2YABA 3P7AA 4RX5A 3DXPA 1TQMA 2VWVA 2I0VA 4BGHA 1H26A 3AC2A 4GU9A 4UN0C 5CAPA 2C5YA 5BVFA 4FUYA 4FV4A 5JT2A 4EBWA 3DA6A 2WTDA 2FB8A 2Y6MA 4FKLA 4I94A 1YWRA 5B7VA 1R78A 4DGGA 4EEVA 4RQKA 4F0GA 1V0PA 1H25A 1WBSA 3LXLA 3I6UA 3H9OA 3PY3A 3NW5A 2V7OA 2IZSA 2OXYA 3ZO4A 3R00A 1FGIA 3NNUA 3RK9A 2BAQA 2X1NA 3A8WA 2C3IB 1Y8YA 4CFVA 4DGOA 2EU9A 2OJGA 4EH5A 1H1WA 2P3GX 3QUDA 4AOTA 5CX9A 2F2UA 4XRJA 4LUDA 4NKSA 4I5MA 4ANMA 3AC8A 2YIYA 4BWPA 4XYFA 4RBLA 4CV9A 3F7ZA 3LCDA 3QHRA 4IAAA 3R2BA 3G51A 4DF3A 2B55A 3DKFA 3R1YA 4J52A 4AW1A 2VO7A 4A06A 1XKKA 3S00A 1G3NA 2A4LA 3C4EA 4GFOA 3FI3A 5I9WA 4FNYA 4PMTA 4PL5A 4NZWB 4CZUA 3P23A 3IDPA 4D9UA 2B7AA 4BCQA 1WAKA 3FL5A 5DPVA 4I0TA 3ZRMA 2GHLA 4M84A 4X0MA 1WVYA 4I6QA 4W4XA 3BHYA 4AA4A 1Z5MA 3CKWA 3QWKA 4MXYA 3ZM9A 3L8VA 2BKKA 2WGJA 3CSVA 4FT9A 3W8LA 2PE1A 5BUIA 2FUMA 3DNEA 3OTUA 3UODA 4P5ZA 3GCUA 1V0OA 1Q8WA 3ALOA 3GT8A 3NGAA 3QCSA 1TKIA 4IX5A 4RIXB 2VTOA 4RJ6A 3FLNC 2OFUA 3LQ8A 3W2QA 3QQJA 4J8MA 5CF8A 1KOBA 3O96A 5KZ0A 4QYEA 4LV8A 3EJ1A 3UNZA 4H05A 4H3BA 4BKZA 1LUFA 1OL7A 2HZ0A 4GMYA 1OI9A 2RL5A 5KX8A 1M2QA 4CG9A 3UG2A 2XBAA 2XKDA 3DJ5A 3P0MA 1O6KA 3WF7A 3F3ZA 5JFXA 1CTPE 3ZO3A 5L2QA 4DCAA 3RAWA 2JDVA 2OKRA 1Y6AA 2X7FA 3EQCA 3LFSA 3MDYA 4U43A 4AW5A 3N4UA 3HLLA 2XJ2A 3O8UA 4OTFA 3JR1A 3PXYA 1HCLA 2EXMA 2XH5A 3CY2A 5K0KA 5LWMA 4EC8A 3E5AA 2QOKA 4KA3A 1CSNA 4OBQA 3OT8A 3ZEPA 2HCKA 3CP9A 4HVDA 5C8NA 4IAIA 1QPDA 5AV4A 3BHUA 1MRVA 1PW2A 3NNVA 3QWJA 4W9XA 3WZUA 4C61A 2RFSA 1IAHA 3VIDA 4D0WA 3F5UA 4JL9A 2G2IA 2OBJA 2R4BA 3Q04A 4ZTQA 4JR3A 3W16A 1FVTA 4M13A 1YHSA 4D2SA 4F1TA 3HMMA 4LMNA 4U97A 1PMUA 3GENA 3MV5A 3ZZWA 4E73A 3TI1A 2GQSA 3EFJA 3LXPA 2PMIA 1I09A 3KQ7A 4ZTSA 4G6NA 5I9VA 4C57A 5A9UA 3EQRA 5L2TA 3UOKA 2OWBA 1UNHA 5G6VA 1AD5A 4EKKA 2A27A 3RVGA 2W4JA 4MD8E 5AUYA 3EWHA 4NFMA 3F82A 1IAJA 4O0RA 4BR3A 4TWCA 5IA3A 5E8XA 3DZQA 4ANLA 3LOKA 2GHGA 5HORA 3O71A 5I9ZA 1MRYA 3CTHA 4RIOA 5FDPA 4AACA 5IQCA 4W9WA 3MH0A 4XBUA 2UZDA 3GXLA 4RVLA 5J5SA 4U7ZA 3CD3A 3DBQA 4BBEA 5AR8A 3V51A 4QMXA 3E8EA 3QYZA 4MXCA 4Y5HA 2JC6A 4EBVA 4EI4A 4USDA 1LEWA 4YJPA 2GTNA 4B99A 5BYLA 4QTCA 1NVSA 1WBNA 5CAQA 3EQHA 5IA4A 2G01A 4FL1A 2YCFA 5FD2A 3QTUA 3RP9A 2QNJA 4OT5A 4UV0A 5DBXA 3R7IA 4RZWA 4DEBA 4YURA 3LFFA 4FVRA 1OB3A 2ZAZA 4FSQA 3SC1A 3NIEA 1FBNA 2R0IA 3Q2JA 4O83A 3S3IA 1YXVA 1W83A 4MEDA 2YLEA 3GCPA 4ZSAA 3PSCA 4I5HA 5L6WL 1YOJA 3UMXA 3JUHA 3V04A 4AE9A 4Y85A 2GQGA 2CNQA 2P2IA 3CTJA 4FKJA 1WBWA 3PVGA 5L8KA 4QYHA 4DFYA 5AV3A 4U41A 5FXSA 1H0WA 2C3LA 4S33A 2VD5A 4YLJA 3ZU7A 2VTJA 4KABA 4BTKA 3ODZX 4GKHA 4FVPA 2UW5A 1XH4A 1PMVA 3I4BA 4ZTMA 3C0IA 3I7BA 3C5IA 2WTKB 1SZMA 4FMQA 3QKMA 2YA9A 3AT3A 4RVTA 3LXNA 4AZWA 3V6SA 3BYVA 5IA1A 5GIOE 3OTVA 4LMUA 4JIKA 2YCQA 3UC4A 5ITAA 4FKWA 4X2FA 2HW7A 4U6RA 4YC8A 5CT0A 5J79A 4PV0A 3O0GA 3HUCA 1J7UA 5A54A 4YC6A 2J5EA 3R83A 4EHVA 2JDOA 3NUNA 1U54A 3NEWA 1OECA 5CQWA 5FM3A 2ETRA 1R1WA 4CLIA 4I92A 4FIEA 1PHKA 2I0HA 2W5BA 4NM3A 5ANIA 4D55A 4P7EA 4R6VA 2OSCA 5IA2A 3H0ZA 2WHBA 3A62A 3QLFA 1RE8A 2BKZA 3AD4A 4Y5QA 4LL0A 1XH6A 1UNGA 1ZMWA 4L43A 4D9TA 1H01A 4FT0A 3U87A 1PXJA 5HQ0A 5K4JA 3U54A 4DFZE 3HAVA 1J1BA 5HD7A 3QTRA 4ACDA 2A19B 4BDDA 4QT1A 4X7QA 1SVGA 3GCVA 4IFCA 4YUQA 1M14A 4R3PA 2GNJA 3EYGA 2OG8A 4F08A 2JKOA 3CD8A 3MY0A 3VS1A 3ERKA 4A9RA 4E6DA 3ORMA 3QBNA 3TKHA 3IW6A 3O8TA 4CZTA 4YJVA 4I23A 3E93A 2F7EE 3BU3A 3THBA 4L7FA 2GS2A 3PSDA 4RG0A 3UZPA 1H24A 3NVMB 5HBHA 4PDSA 3R7YA 1FQ1B 1IASA 3GC8A 4U9AA 4YTCA 4BCFA 3REPA 2XP2A 1B39A 1XR1A 4IXPA 2ZV7A 1Q8UA 3BU6A 3COHA 4F65A 1RJBA 5EOBA 4FC0A 2VWBA 4RGJA 3UG1A 2XK7A 3QLGA 5C1QB 2W99B 3TUBA 4Q5EA 1UKIA 1OMWA 3R1QA 4FE2A 4A9TA 4ZLYA 4RIXA 3W32A 2YM7A 3TUDA 1ZLTA 2V22A 5AR7A 4GUBA 3NLBA 4GK2A 4FIGA 4M68A 5FLFA 2B9IA 4IH8A 1OUYA 1YDTE 3OUNB 5FEEA 4BWKA 4GH2A 4UYAA 1ATPE 3AMBA 2ZM4A 2QC6A 3MTLA 3NX8A 4YO6A 5EYMA 2R7BA 4E93A 5CAVA 3HECA 3KCFA 4KIKB 3DQWA 4U40A 4W4YA 1W0XC 3ORIA 3DGKA 3PXKA 2JFLA 3UVPA 3AC3A 2XIYA 4IVDA 2QOQA 3VBWA 2XYUA 1F0QA 2C6KA 3RNIA 2GTMA 5EHYA 4F9YA 2WQOA 3ID6C 3RI1A 1U4DA 3ELJA 3KXMA 3FV8A 4IADA 4IM0A 4ZY5A 4Q5HA 4R3RA 4E4XA 3CE3A 4BKJA 4RFYA 1Q62A 5HTBA 3AC5A 3OVVA 5CEMA 3LHJA 5K3YA 3BELA 3G6GA 1OVEA 4XLIA 3V5WA 5FM2A 4BCHA 1WVWA 4AGCA 5DG5A 4G31A 3NYVA 3M1SA 5ETAA 3VBTA 3PE2A 3TXOA 2QQ7A 2IVUA 4F9AA 5AM7A 3FKOA 2FO0A 4KS8A 2WTJA 4KBCA 3IQ7A 3OG7A 4QP3A 1U59A 2QOHA 4V04A 1YDRE 1JVPP 4EK4A 4D1XA 4AG8A 1IG1A 2WTCA 3IW8A 4YBKA 5BNJA 2V0DA 5CU6A 3EKNA 4UZHA 4FKSA 5DT0A 3SRVB 4BYJA 4FKIA 1UU9A 4FSNA 1Q3DA 3ALNA 3EOCA 3FYKX 3T3VA 5AUUA 4ACHA 2VTRA 1BI7A 5D9HA 3KXZA 5CENA 3HP2A 1UU7A 5FGKA 3AT2A 2XBJA 3SGCA 5KMIA 4FSZA 3FLQA 5EYDA 5BVEA 5FXRA 4BGQA 2KTYA 4X2GA 1JKLA 4ZLZA 2FA2A 1SVEA 4FZFB 4HYHA 4XMOA 3KXNA 4JBVA 2RG5A 3E7VA 5IA5A 3H3CA 2W9FB 3DTWA 5K5NA 3VVHA 3I5NA 5IDNA 2G15A 5GZ8A 3Q4TA 5DRBA 1LP4A 2VTHA 4RSSA 3GEQA 1YXUA 1PRYA 4EOSA 5IF1A 3KXGA 1BL7A 4G5JA 2BIKB 4WHZA 4RQVA 3RTPA 4UWBA 2WMXA 5HKMA 4CEGA 3NUXA 5CSHA 4LV5A 4GU6A 3OFMA 3ZOSA 5LVNA 5HLWA 2W1IA 2VTPA 3DU8A 1R0PA 4Z3VA 3OT3A 3P7CA 3OCTA 4F4PA 3R04A 5K5XA 4E4NA 3OXIA 3GBZA 5BVOA 4BC6A 4KIOA 3BKBA 3MFRA 4R5YA 4M3QA 1XH9A 1M52A 2X7GA 2CGWA 1E9HA 3FUPA 3C4CA 3I79A 2VAGA 1XH8A 3R01A 4JBQA 5LVMA 4NM0A 2C0IA 2J6MA 3R63A 4FF8A 1JSUA 3QZGA 4C37A 2PYWA 1QMZA 3QC9A 4FSUA 4WIHA 4E5WA 3KMWA 3O51A 4IM3A 3TL8A 4JG6A 1SVHA 4EJNA 5AAFA 2OIBA 3VS3A 2QR8A 2W06A 4GL9A 2VUWA 4FTAA 5EKNA 4QQ5A 4E1ZA 4CNHA 2PK9A 1Q8YA 4FIHA 5AA9A 3GFWA 3UJGA 1GNGA 2YM8A 2XEYA 5AP3A 3LCTA 4DBNA 4EHZA 2I40A 4MXZA 4LOPA 5HX8A 3W2OA 5FEDA 3EQFA 1OKZA 4PDYA 2NRUA 5EKOA 3VUIA 1M7QA 2J9MA 5M55A 4M7IA 2WMQA 3DBCA 4H1JA 4BDJA 2XRUA 3U55A 3IW4A 4D0XA 3HV3A 2Q83A 3BGPA 3D9VA 4FV2A 3R8PA 4QYFA 4DEGA 5JQ5A 5J1VA 3SV0A 5E8ZA 4UMUA 3G9LX 2W9ZB 2WQMA 3P1AA 4DLIA 3GNIB 2ZB0A 4EOOA 2ZYBA 3DAKA 2QCSA 1KE8A 4OBPA 4FEXA 2W1GA 4N6ZA 3ZC6A 4NW5A 4UXLA 2E9OA 3UBDA 3L8SA 4CTBA 4TXCA 4ASDA 5C9CA 2WOUA 1CKPA 2EB3A 5FDXA 2WOTA 2Z60A 2UW6A 4GG7A 5CU0A 3H4JA 2R9SA 2JDTA 3UC3A 1YXSA 3OD6X 4EK3A 5JEBA 3C0GA 3EQBA 4CKRA 5KHXA 5IMXA 4AT3A 4G17A 4GK3A 1BLXA 1HCKA 5F1ZA 5KHWA 2QOLA 2B1PA 3GVUA 2ITYA 4PMPA 5CI7A 2JKMA 3GC7A 5KBQA 4YHTA 5D12A 5KMNA 5GNKA 1Q41A 2ZDUA 4KRDA 4AZFA 1OPKA 2PMOX 3QZHA 4MWHA 5CANA 3NRMA 1RQQA 5L2SA 5I9XA 1YKRA 4YU2A 4EKLA 3PIYA 5LVLA 3RWQA 3WF6A 5AWMA 2BZJA 3DTCA 3IW7A 4DH8A 2WEIA 1FOTA 2FYSA 3M2WA 2VU3A 4FTQA 3FMJA 2OW3A 4PL3A 5CASA 3QA0A 4TYJA 5EK7A 2OZOA 5K4IA 5L3AA 4MHAA 4AFEA 4HYIA 4HCTA 2CLXA 4MH7A 4XG7A 3Q4UA 3HV6A 5GJDA 3C4FA 4YJQA 3OCSA 4RX9A 5AAEA 4O7VA 2UW3A 3MPMA 3FI4A 4F99A 1CM8A 4CLJA 2YJSA 4EH6A 4GVAA 3TZ9A 2RFNA 2CPKE 4KD1A 5GJGA 1X8BA 4F7NA 5E91A 3A7IA 4QO9A 2W17A 3VWAA 2PUUA 2ZB1A 4FL2A 4FV8A 4QMLA 3R28A 5EH0A 3GUBA 2JDRA 5CY3A 3ATSA 2B53A 2FSOX 3O7LB 2YAAA 3W1FA 2NRYA 3Q60A 3G15A 3VHEA 5A4QA 4WA9A 2YIWA 4EONA 2HXQA 5KKRC 2PZ5A 2UV2A 4ZXTA 2HYYA 4KIKA 4LGGA 4G34A 4QPMA 1UWJA 2Z2WA 4C7TA 3D83A 3CKXA 4OTQA 2IJMA 3HGKA 3C1XA 4WUNA 4YZNA 4O86A 4JG8A 3NPCA 3UOHA 4CFNA 3RALA 2CNUA 4CKIA 3BE9A 4O0TA 3UVRA 3D7ZA 4EZ5A 4FEUA 4K18A 4DE4A 1JBPE 4O91A 2FSTX 4QPSA 3LFAA 1OL2A 3MYGA 3MVJA 4TZRA 3UPZA 4CVAA 4FKQA 3IONA 4N57A 4RIYA 4CSVA 4X2NA 3PWYA 4OTHA 1GJOA 4F70A 5LOHA 1APME 2B4SB 4PPCA 2IPXA 2QOIA 2PL0A 5HVJA 3HP5A 2XK9A 3FXXA 4GW8A 4FTUA 1PJKA 3VRZA 5CNNA 4FUXA 4E4LA 5BVWA 5K9IA 1W98A 4DAWA 4LUEA 3AD5A 2UW4A 5GIPE 3SRVA 2YISA 1JQHA 2VNYA 4I41A 2ITTA 3I0OA 4PP7A 4FEVA 3DK3A 4PY1A 3N4VA 1W82A 4WRGA 2ITNA 4M15A 2P2HA 4ZSGA 2V7AA 4BCNA 4FZDB 4NCTA 4O6LA 3OHTA 4KBAA 2XJ1A 3ORLA 4XH6A 3TIYA 2GMXA 2YWPA 4I0RA 1GAGA 4FIJA 2JIUA 4C4FA 2R3IA 5FWKK 2GNIA 2QONA 4L53A 2CKEA 3D2IA 5AV2A 4C2VA 4F0IA 4XX9A 3MB6A 3UIUA 3LW0A 4JIAA 3KREA 2PZYA 4UMTA 1UWHA 5KMJA 1UVRA 3IDCA 1ZYDA 3D5XA 4FTCA 1GIHA 2B54A 5IU2A 5BVKA 4C62A 5AUTA 1GIIA 3IDBA 3NYOA 3KRWA 1W7HA 3RK5A 2YN8A 1OZ1A 2WU7A 4AT5A 4B7TA 1JKSA 3JY0A 3BWFA 1MRUA 3C4ZA 4IZ5A 2W05A 4JRNA 4YZCA 3UIXA 4CQGA 4UB7A 1Q97A 1DI8A 1OIUA 2X8EA 3LZBA 3FI8A 4OBOA 3HEGA 3FL4A 3FC2A 3FQSA 3NUSA 1GZNA 4FR4A 4JDHA 5DE2A 5CQUA 3QA8A 2GQRA 2HXLA 2Z7QA 3NVKI 1W84A 5E8SA 4E3CA 4G2FA 4TT7A 4FTTA 4C4IA 3NYXA 1IA9A 2XEZA 2ACXA 3BLQA 4XS2A 4C35A 2WMAA 2OF4A 3TTJA 5HU9A 5M06A 4CKJA 5AADA 2NNWB 4DEEA 3RAHA 5ACBC 2J2IB 4NTTA 3GB2A 2GU8A 3F2AA 3I6WA 2QO7A 1OPLA 3AMAA 3QTZA 4IX4A 5TO8A 3EYHA 3D0EA 3FKLA 5IKWA 2CJMA 4FNWA 4O1PA 3FY0A 3KFAA 5AMNA 5CT7A 1SMHA 5FTQA 5BYYA 2BIYA 1YQJA 3ZCLA 3QQHA 3ROYA 3PLSA 3NZ0A 2WO6A 3RJCA 5BYZA 5DYJA 4TN6A 4IVBA 4AZEA 2QOCA 4YJNA 2YM5A 3VJOA 4ASXA 5CU4A 1KE5A 5T3QA 3BYMA 1VZOA 1J3HA 1IA8A 4X6RA 5HTIA 2E9PA 1CKJA 1XHAA 3CBLA 3Q9ZA 5CI6A 3BE2A 3MVHA 3D5VA 4W4VA 1OM1A 2BTSA 4JAIA 4FNZA 4L6QA 5AP1A 2A0CX 3FPMA 3F2RA 5E4HA 3JS2A 3VUTA 3CQEA 3KC3A 3TG1A 3EQDA 1U54B 3G9NA 3FLZA 4PDPA 2C1AA 3VS2A 4DG0E 4O81A 4QP6A 5JKGA 2HELA 4D5HA 5JFVA 2WMBA 3WOWA 4WG3A 2YDIA 3NW6A 3G2FA 5HESA 3QRUA 2PE2A 5GJFA 1GZOA 2PVMA 2PZRA 4BCJA 5CSXA 2I7QA 3PVWA 1WBTA 2J0IA 3RZBA 3S0OA 3PWDA 4F09A 3FZ1A 3BLHA 1OITA 3P86A 4J1RA 4YZDA 3OCGA 3QTXA 4QP4A 3HRFA 4FIFA 4S2ZA 2QU5A 4Q2AA 3NMUF 3ZTXA 3VHKA 3KRRA 3DKCA 5HO7A 2C47A 3TKUA 1XWSA 3VBVA 3LIJA 2WMTA 3ETAA 5ANGA 2JD5A 3V5JA 3AC4A 5M4CA 3DK6A 3FBVA 5I9YA 4C3FA 2WPAA 5LMBA 4G1WA 3C0HA 3ROCA 2C6TA 4PUZA 4S31A 3EB0A 3EFLA 3JVSA 3GU4A 4I0SA 4X3JA 5HIBA 1B6CB 4K1BA 4K11A 2X81A 1IEPA 4OR5A 4F6WA 1O9UA 5I4NA 1V0BA 2R3LA 4L67A 4YC3A 2XF0A 4A07A 4DT9A 3OBJA 3TCPA 3D94A 4FG9A 3NAXA 4KIQA 5AR3A 2BDJA 3NCZA 3GI3A 1QCFA 4XUFA 2WTKC 3D7TA 2F9GA 4JQEA 3RHKA 4YTFA 2YLFA 2R3KA 3QQGA 3SX9A 5AV1A 2VV9A 3Q9YA 1SNUA 3AXWA 3R7VA 4XOYA 4IVAA 3EH9A 4BDHA 3MFTA 5A4TA 4CFWA 3EL8A 3WIKA 4NT4A 2OFVA 3I60A 4QQJA 4APCA 2C0TA 1ZOGA 2BDFA 4RJ4A 3WZEA 2VWXA 3F88A 4I4EA 5FTGA 2C5VA 3QGWA 5DFPA 4L68A 2UUEA 3QCXA 4V0GA 2HZNA 3U6IA 1JKKA 4CYIA 4G9CA 4ZEGA 5M56A 3DAEA 4WUAA 5HE0A 2Q0BA 4JOAA 4EOLA 3ZXZA 2JBOA 3PE1A 3QQUA 2X2LA 2BRMA 5DMZA 3FLWA 2GS6A 3R8ZA 4UMRA 4GKIA 4P5QA 2FSMX 2GNLA 1YHVA 3ZBFA 2X6DA 2OJIA 4E7WA 3UQFA 5FG8A 3N51A 3AGLA 2GCDA 2QI8A 2X9FA 4LG4A 4ZSLA 3HDNA 5L8LA 3GU5A 3P4KA 2O3PA 2YIQA 5DA3A 5CSVA 4KB8A 1ZMUA 3E8NA 3MJ1A 4MBIA 3VBYA 3RHXA 5BPYA 3EQIA 3IO7A 1VEBA 5HD4A 2REIA 4BDFA 4XHKB 4YJSA 4WG5A 4G3EA 2VWYA 3QZIA 5AR2A 3RM7A 4RVKA 3UE4A 3VS6A 2ETKA 3TT0A 4USEA 5JN2A 1Q4LA 3ET7A 3ORPA 4FV5A 5EQYA 4K8AA 5CVHA 3TKIA 5ANKA 1WCCA 4LGHA 1G8AA 5BUEA 3DZOA 4ID7A 1PMNA 3KL8A 3LMIA 4AZVA 3H10A 3R8MA 3NS9A 3OXTA 5EW8A 5JFSA 1ZYSA 2CDZA 4BDEA 3TDWA 3WYYA 4FZ6A 5F4NA 4KKEA 4TWNA 3LFBA 3OUKA 4XLVA 4YLLA 2IZTA 3FHRA 5JFWA 4DYMA 3BEGA 2VWZA 4DEAA 4MCVA 3UQGA 3WZJA 5J5TA 4F7SA 2E9VA 3R9OA 2PZPA 3JVRA 3O50A 5T6KA 2FVDA 2WU6A 4JBOA 4MF0A 3JYAA 4QMQA 3PVBA 5HG9A 3MFUA 3HDMA 3V5PA 4BDAA 1OIQA 4QOXA 3FSKA 2VO6A 2YM6A 2BCJA 5DHJA 4CFFA 1J7IA 4NFNA 4EYJA 2VWWA 4ZZOA 4ZTNA 4QMNA 4XG2A 2QR7A 4UMQA 4AU8A 4MYGA 2WTVA 1M2PA 5IEYA 4Z9LA 2B9JA 4JDKA 4ONAA 4O7SA 3DLSA 5EI2A 2J0KA 3QF9A 4JT3A 4DTKA 4E5BA 5I3RA 1OKWA 1ZYLA 3DY7A 3B8QA 4FG8A 3R0TA 2PUNA 3FKNA 5JZNA 3PJ3A 1ZY4A 1SYKA 4U8ZA 2CGVA 4UEUA 5HO8A 4HJOA 5EW3A 1Q8TA 4ANSA 3E3BX 2RF9A 4M8TA 3GC0A 4BDIA 4UMPA 4LRMA 1P4FA 2C1BA 1PXOA 2Y6OA 4LYNA 3GU8A 1CMKE 3CC6A 4GRBA 3ZXTA 3Q5IA 3RGFA 4QMMA 4C2WA 1I44A 3UP7A 5IPJA 1CDKA 2QHMA 4IWQA 3TEIA 5LJJA 5E8VA 3QQFA 3LMHA 3C7QA 3EFKA 1KV1A 4BCKA 4G16A 4R7BA 4FYOA 4CRSA 1Q99A 4XBRA 5M07A 5CLPA 5CZIA 2XNOA 4D58A 4L01A 2DWBA 2ITVA 3TUCA 4UXQA 2ITPA 5C4KA 4FSYA 4O2PA 5EYKA 5FP6A 5IH5A 2YZAA 3MA6A 3MPTA 4BI0A 1L8TA 3TM0A 2HK5A 2FSLX 1W8CA 2CLQA 5LQFA 4JVGA 5EM7A 5L6OA 4Z7HA 3FXWA 3NUPA 3OP5A 3TTIA 4I6HA 3CQUA 4QMVA 5M57A 3QUEA 4G5PA 3OF0A 4XV2A 4MNFA 3BBTB 4O27B 1KE9A 3VQHA 1ZWSA 4A9SA 3AGMA 1YVJA 3W55A 4NJDA 4NCTC 4BL1A 4F64A 4HYUA 4HGLA 4AW2A 5HX6A 4ENXA 2WMWA 2JITA 1KE7A 2CGUA 2PVFA 5I3OA 4E20A 2Y0AA 4R5SA 4EQCA 1QPJA 2OXXA 2XA4A 3FHIA 5EG3A 2PULA 1MP8A 4FKOA 3DFCB 4YP8A 3BI6A 4GUEA 4X3FA 1V1KA 3R7GA 5AP0A 3VUGA 3UVQA 4EWHA 4QP8A 3AT4A 4QP1A 1JLUE 1P4OA 2GSFA 2XVDA 3PXZA 5AIRA 2G9XA 3ZUTA 4Z16A 1ZYJA 2GDOA 3L8XA 1H00A 3KN5A 3TJDA 4D2TA 2CNVA 3LQ5A 1Q5KA 1H1PA 2ITUA 2IN6A 2X8IA 3P08A 5DH3A 4YMJA 1JSVA 3PPZA 3PRFA 3NUUA 3EL7A 5KCVA 3FZSA 4WNMA 4XCUA 3QRJA 3ODYX 4D2WA 3SW4A 4AA0A 4N0SA 2W4OA 2C5OA 3QX4A 4I21A 3NNXA 4FKTA 3R9HA 3ZRLA 3LLAA 4OGRA 3D5UA 4QQTA 5IQDA 4ZJVA 3ACKA 3FZOA 4FI1A 4GJ3A 4I5PA 4JJRA 4BFMA 2RIOA 3UNJA 4F6SA 2BZHB 5CALA 1REJA 3MVLA 5HE1A 3ZLSA 3R1SA 4BZOA 4EZ3A 3E8DA 4OT6A 4FTRA 2B0QA 4MK0A 5DWRA 3T8OA 4M14A 4CV8A 3BCEA 2UW8A 4YNEA 4ZSEA 4BTMA 5M51A 5A14A 2C3JA 3K2LA 3MIYA 5HLNA 1M17A 4FSWA 5A4EA 1OL5A 4MVFA 4TNDA 2F7ZE 3C9WA 5IMEA 2XIKA 3HMNA 4L42A 3QCQA 2PVHA 3ZC5A 5CEOA 3FQEA 4O1OA 4DTBA 4C59A 4L45A 2R3PA 1OKYA 4CMOA 1ZZLA 4FTOA 4HVGA 5AAGA 4C4JA 2QOBA 4FT3A 4WBBB 2W4KA 2QG7A 3F5PA 3EIDA 3GOKA 3FMKA 3BV3A 3F7WA 2HZIA 3S1HA 4RMZA 2J7TA 3DBDA 3VUHA 5AP2A 3AMYA 4ZTRA 4EOKA 4TKSA 4EUUA 5DN3A 5D1JA 4TPTA 5EQEA 4YJRA 3A7FA 1PYXA 2VTSA 2CCIA 4IB0A 1K2PA 2ESMA 2XYNA 3F5XA 3BZ3A 3G0FA 2PUPA 4EK6A 4LGDA 4GCJA 3KY2A 1UU3A 3HV5A 3NSZA 3GFEA 4BN1A 4FKGA 4PL4A 4CT1A 4QYYA 3FSFA 2PPQA 4KRCA 4R3CA 4O7WA 2PE0A 4HPUE 4O7LA 5IQHA 1H1QA 1WFCA 5C27A 4O7TA 2BAJA 5TKDA 4BIEA 1HOWA 3HRBA 1H27A 2UW9A 2B9FA 4MNEA 1GZKA 3DAJA 5JRQA 4DTAA 4ZIMA 4AUAA 4RIYB 5A4CA 4FIIA 3SD0A 2AC5A 3KULA 3R9NA 3MH2A 5C03A 4L9IA 4U45A 4G6LA 3H30A 3FZPA 5CF6A 3L9MA 4NM7A 2XKFA 1OGUA 4OLIA 4AP7A 2XZSA 5EM5A 2X9EA 2OJ9A 2W5AA 3F9NA 4BRXA 3TN8A 1O6LA 5F94A 2ITWA 3LMGA 4FKUA 2ZV8A 3S95A 3SA0A 3MJ2A 5CF4A 2IVSA 3EHAA 4MXXA 5CS6A 3TWJA 3CTQA 3WE4A 3F3UA 4EJ7A 2KULA 3UO5A 3A99A 2PUIA 4XEYA 4FODA 2BHHA 3DKOA 4KUJA 3SG8A 3ZMMA 3FI2A 2JKQA 3G5DA 4NJ3A 4F0FA 3D5WA 3GP0A 1ZOEA 4LFIA 2YZLA
chains in the Genus database with same CATH superfamily
1XQZA 1H07A 2OIDA 4ZTLA 2Y4PA 4RLLA 4C8BA 4JLCA 4WOVA 5BUJA 2YERA 2UZLA 3MGYA 5AUVA 1NXKA 3F66A 5JK3A 4O0SA 2QOFA 3OMVA 3TV7A 1BYGA 3E62A 3R21A 3R2YA 3QD0A 5IISA 3LLTA 3QUPA 4JX7A 3FLSA 4C4EA 5IQIA 5M08A 2X39A 2WMUA 4CFXA 1XJDA 3SQQA 3F69A 4CGAA 5CEPA 2W1EA 3CQWA 4FSTA 4Y8DA 3PJ2A 3R22A 4KAOA 4NM5A 4D2VA 3FZRA 2VTMA 4ACCA 4OTRA 2LAVA 4DFBA 3Q53A 3R9DA 2GHMA 5IQEA 4MF1A 5M44A 4O2ZA 2J0MB 4L3LA 4NWMA 4S34A 3ZLYA 2EB2A 2GFSA 2JIIA 4QMYA 2WEVA 4Y46A 4A7CA 4AT4A 4FKVA 4P2KA 5AA8A 3HV7A 4WO5A 2Z7LA 3VN9A 4XG3A 1H1SA 4D1ZA 4GFMA 1TFFA 4W8DA 3E88A 4IDVA 5DT3A 3PZEA 3ORNA 4HNFA 4AXEA 4ANNA 3MW1A 5LCKA 4RFZA 3KU2A 3O7LD 4JI9A 5AP6A 5AUXA 3WE8A 4B6LA 2CHLA 1ND4A 3VS5A 5FUTA 5AJQA 3V6RA 2W5HA 3G33A 4RIWA 5F20A 4CQEA 4J7BA 3ATTA 3SW7A 2VTQA 4K6ZA 3VJNA 2XNBA 1XH7A 2IVVA 2VO3A 4XRLA 3QL8A 4DGNA 4CXAA 3BU5A 2X4FA 4IM2A 4TYHA 1BUHA 5ANJA 4TTHB 3IOPA 4KSPA 3DKGA 2F4JA 5A4LA 2C0OA 4YSMA 4D4RA 3KK8A 5CNOA 4F78A 3LFNA 3IW5A 3NNWA 4RWLA 2PY3A 5GINE 3FMNA 4GS6A 4KKHA 4YZMA 3HUBA 2JKKA 4QTEA 4JQ8A 1Z57A 4OTPA 3Q32A 3VS4A 4EK8A 5CU3A 4MD9E 2G2FA 5J87A 4IAKA 3VULA 3WILA 3BLRA 5I5ZA 4RC3A 2PZIA 2VX0A 4AGWA 4FICA 3ZFXA 4CT2A 5IA0A 4IJPA 4MUQA 3AD6A 4ZY6A 1FMKA 4BB4A 4EH9A 4IZAA 5HIDA 2C6MA 3GU6A 4YR8A 1WBVA 1SNXA 4MXOA 4U42A 3LE6A 3RCDA 3ANQA 4PPBA 4YGAA 5HZNA 5IG1A 3OROA 4QNYA 3P78A 4MKCA 4UBAA 3L1SA 3N4TA 4XG8A 2WB8A 2XUUA 2V55A 2QO9A 5E7RA 4OUCA 5GZ9A 4RX7A 3QQLA 4NEUA 2ZJWA 4O96A 5CZHA 3UQCA 5DEWA 3B2WA 3R8VA 3P9JA 4PTEA 3POZA 5HE3A 5F95A 1A06A 4BGGA 4FJVA 4JXFA 4DDIA 4FT7A 2VWUA 4ACMA 2F7XE 4TWPA 3R02A 3E92A 1ZARA 2BRBA 3PZHA 3WBLA 5C26A 5AR4A 5BQ0A 4YO4A 5TT7A 3KMMA 3RPSA 4RC2A 3FC1X 5HTCA 2WAJA 4ZLOA 2QG5A 4GT3A 2DQ7X 4LI5A 4PX6A 4PWNA 4RC4A 4GYGA 3SXFA 2LGCA 2P4IA 4FV6A 4M69B 4O4DA 1YWVA 3S4QA 3TV6A 4EL9A 4ANQA 5IUGA 2RG6A 1AGWA 1R0EA 4J71A 4FZ7A 4BCMA 4EOMA 3ZLWA 5C8MA 4OAVB 4L3PA 2C69A 2Z02A 3GC9A 4M12A 2XANA 2IZUA 3RWPA 5AFVA 2G1TA 1ZRZA 3SOCA 2R3QA 3D7TB 3DS6A 1U5QA 3F2NA 4XV9A 5BMSA 1XMMA 3NDMA 5HHWA 4AXCA 1ZY5A 1P14A 3V8WA 2WTWA 4H36A 2P55A 4QRCA 5H3QA 3A61A 4J95A 3L9NA 1BL6A 4TYGA 2PVKA 4NYEA 4GV1A 2P33A 1PYEA 2WMVA 3MN3A 3DXQA 5JGBA 3VUKA 4V0GB 3DXNA 3C13A 4PTCA 2HOGA 3F3TA 3NUYA 3SLSA 3T3UA 1DI9A 2V62A 4QEBA 4HPTE 3VRYA 4PP9A 4A9YA 5HEZA 4U81A 3ACJA 2YJRA 3AOXA 3COKA 3G0EA 4QMOA 5FQDC 5DI1A 4QMWA 4JDIA 3V8TA 3MIAA 1JAMA 2J0JA 4X3FC 3DQXA 4EOPA 3I0QA 4FV1A 2QD9A 4F9CA 4RA5A 3PLAE 2XK4A 3EMGA 5C01A 4QMPA 1ERKA 4O22A 3RMFA 3QRIA 2Y7JA 1LR4A 2IVTA 3BHVA 3SG9A 3FLYA 4RVMA 2WNTA 3PJ8A 4DEHA 4TRLA 4OTGA 1H1RA 3QXPA 3OY1A 2G2HA 4I1ZA 5LWNA 2XIXA 4AAYA 3WF8A 4V01A 5KBRA 5D11A 3LJ2A 4Y83A 5KUPA 1Q8ZA 3ORXA 2YHVA 4OTWA 4AE6A 4XP2A 3I1AA 2CMWA 3RCJA 4EH8A 3ZSHA 4B8LA 5D7VA 3MY1A 3R73A 3EN4A 2E2BA 2YDJA 4BDKA 5FXQA 3GCSA 4NL0A 4HYSA 5J7HA 2BDWA 3ZH8A 3DFAA 4A4XA 1K3AA 2CGXA 4JQ7A 2E9NA 3AG9A 4L3JA 1JWHA 4RRVA 2OH0E 3ULZA 5E90A 3DPKA 3IS5A 3EKKA 2JAVA 3COMA 3BIZA 4S30A 5HU3A 2OF2A 3NYNA 4QTAA 3VAPA 3RPVA 1Y91A 2XKEA 2R2PA 3OXZA 3MESA 3U6JA 5FBNC 3S2PA 2CKOA 4C0TA 3RINA 3HMIA 3PXFA 3ZFYA 4MBLA 5HG7A 3VNTA 2W1HA 2F49A 3U4UA 3ZHPC 1KV2A 2PWLA 5HNBA 3TV4A 3Q5ZA 4AXDA 4FT5A 2UVYA 5EDPA 4L52A 1YXTA 3PA3A 4AOJA 4F7JA 5BV3A 5LMKA 2PVNA 1TQIA 5EFQA 1O6YA 4KNBA 3VO3A 2VNWA 3CY3A 4ALWA 2VX1A 5D7AA 1RW8A 2C30A 5DEYA 4DG3E 3NFGB 4FA2A 4NU1A 3HMPA 2HIWA 5HCXA 2J51A 4GG5A 3PPJA 3CJFA 5HOAA 1QPCA 3KKVA 3SOAA 4C3PA 3V5TA 2XALA 3ZDUA 1YDSE 2YM4A 3ORKA 2O64A 3UNKA 4CFUA 5EDQA 4LM5A 3KVXA 5HLPA 4WG4A 2QKWB 2EWAA 2WIHA 5A3XA 3U8WA 2VTTA 5JH6A 2GFCA 1Q24A 2RKUA 3VS0A 3PP0A 3UTOA 3K5UA 3BYUA 5IUIA 3UPXA 3R7UA 2PVJA 3EN6A 5BX0A 4TL0A 3GOPA 3A2CA 2PMLX 4JMQA 3N9XA 3VUDA 1ZXEA 2R3OA 3H0YA 5B2KA 5TF9A 5CWZA 3FDNA 4ITJA 1DM2A 4EORA 2HWPA 3C5UA 2CN5A 3TIZA 4ZK5A 3VBQA 4IHPA 2R7IA 2BPMA 1NA7A 4XOZA 4DITA 2XK6A 2UZBA 4PPAA 4RFMA 5TOZA 5EM6A 3QX2A 2C3KA 4IB1A 4FK6A 3TZMA 2IW6A 3SDJA 2I0YA 4IFGA 3SVVA 4YTHA 5EQPA 4WKQA 3LFQA 4QP7A 3BHHA 4WRSA 4FTKA 4BCIA 5EI8A 5AX9A 3DCVA 2OH4A 4GYIA 4CYJA 2WZJA 1MQ4A 4DGLC 4C58A 4F6UA 3WZDA 3HVCA 3OEZA 1J91A 3HKOA 4PMSA 5ANDA 5FBOA 4IVCA 3FE3A 3CCNA 1XMLA 2BR1A 4IX6A 3NW7A 2R0UA 4EH4A 1CKIA 3O17A 4GEOA 5I9UA 1GIJA 3FMMA 2I6LA 5EM8A 4X2KA 3HV4A 2JAMA 4BZNA 4DH7A 2RGPA 3ZYAA 4H39A 5E8UA 4X3FB 3OC1A 4IBMA 4R78A 5AEPA 4FYNA 3R8LA 1G8SA 3Q3BA 5KO1A 3LXKA 3UYTA 3VF9A 4TWOA 4B9DA 4EQUA 5L4QA 4D4VA 4HVIA 4ERKA 5HG5A 3W0RA 1WBOA 3CIKA 3DJ7A 1W2DA 4CCBA 1PY5A 3BYOA 3PG1A 3K5VA 3VUMA 1WZYA 4K9YA 5AR5A 5CXZA 1YRPA 4G9RA 1URWA 4TY1A 1J7LA 3R30A 3NWWA 1JPAA 4FK3A 4U44A 2XIRA 1JSTA 5BVNA 4UALA 2OI4X 2YCRA 3QXOA 3DV3A 2YWVA 3O23A 4M97A 3Q4CA 4M69A 3AQVA 5HBJA 4YLKA 3OWKA 4O4FA 2ZOQA 4D2RA 5LMAA 3RPRA 4BDBA 4RA4A 4U5JA 2YEXA 4IAZA 2XS0A 5H8GA 5HNGA 3ZSIA 1W2CA 4EWQA 5HG8A 3VQUA 2AC3A 2FH9A 4EK5A 1LPUA 1RDQE 4ZJJA 4ZOGA 3TDVA 4DFUA 4MAOA 3MI9A 4MX9A 2H8HA 4L7SA 2BRNA 2CSNA 3QFVA 4TW9A 4AZSA 5AP7A 1WMKA 2O2UA 2UVZA 3MPAA 4BDCA 5CAUA 1GZ8A 5CSPA 4LL5A 3ENMA 3M11A 3Q9XA 4NH1A 3P7BA 4MD7E 3T9IA 3QRKA 4QPAA 4DH5A 4R7HA 4E6QA 3VONA 4X2JA 5JRSA 4G3DA 4X21A 4XG6A 4MTAA 2OZAA 3NAYA 3G6HA 4J8NA 4U0IA 5AUZA 4KSQA 4FTJA 5DR9A 4CZYB 5GZAA 1Q61A 3HAMA 1PMEA 2HAKA 3PIZA 3TJCA 4IAFA 4QMSA 4YPDA 1YI3A 1YOLA 5DVRA 1NT2A 5KZIA 4N4SA 5J95A 3MWUA 4O0UA 4NUSA 4BCOA 4UWCA 3ZRKA 4JS8A 3KRJA 2ITOA 4FGRA 2VTAA 3ENHA 4BCPA 2ZM1A 1PXKA 3R8UA 4USFA 4RJ3A 3F5GA 4IB3A 4FEWA 4QD6A 3W33A 2XMYA 3ZO1A 2VZ6A 2ETMA 4CCUA 4G3CA 3CS9A 4FGBA 4A4OA 3PPKA 1K9AA 3UIMA 3U9NA 3ZBXA 4XJ0A 5J7BA 2J90A 2H9VA 4MNEB 4Q9SA 5H2UA 4G3GA 3QD3A 3ZLXA 2GNFA 2XRWA 2PTKA 2W7XA 4EOQA 2VTIA 3PP1A 4AGDA 3BGQA 5A6OA 3KULB 3KRXA 1MQBA 4O0YA 4EHGA 3ITZA 4WNOA 3Q6UA 5J8IA 1YI4A 4D2PA 5AUWA 2NPQA 3W0OA 2VTLA 3A8XA 3PSBA 5FEQA 3A7JA 3IGGA 3MY5A 1H0VA 1QL6A 4K33A 4BIBA 4BZDA 3KEXA 2VTNA 4BHNA 4OTDA 4BTJA 2UZWE 2Y4IC 4BHZA 3JY9A 2XK8A 1QPEA 5JSMA 3W8QA 2ZVAA 4TYIA 3QTWA 4YZ9A 4IZ7A 3SXSA 5KMMA 5M4IA 4E8AA 3PTGA 4IC8A 3OW4A 2C5NA 3FJQE 3L9PA 4PMMA 3KGAA 4DHFA 1WVXA 2WTIA 5IQBA 4W8EA 2ZMCA 4OW8A 2X8DA 2XM8A 2OIQA 2ITQA 4I5CA 1AQ1A 2UW0A 2JGZA 3DBFA 3HMOA 2O63A 4FTIA 4P4CA 5ANEA 5AM6A 3KVWA 3KF4A 3ZFMA 2R3HA 3CJGA 1PXNA 3OEFX 4LOQA 2O0UA 3DDPA 3PXQA 3HX4A 4K77A 3LPBA 4ITIA 3TACA 1TVOA 3BYSA 5HCYA 4DT8A 3PA4A 4DFXE 3BL9A 2W1DA 4FOCA 5CYIA 5A46A 4BY9E 3VS7A 4O0XA 2BILB 3SXRA 1UV5A 3F61A 1FPUA 4I24A 3RPOA 3L9LA 3R71A 3WF5A 5B2LA 2Z7RA 3OS3A 4D4YA 4U80A 3DT1A 3LCKA 3DB8A 2UZTA 4NK9A 2XNNA 2OJFE 4OTIA 3LCSA 3ZUVA 4BWXA 5FP5A 2VGPA 3O8PA 3VC4A 2ZDTA 1L3RE 4ZZMA 3UMWA 4YJTA 1YOMA 4KS7A 3TNIA 4FTLA 3ZEWA 2OICA 1H8FA 3GU7A 4JAJA 4H58A 3H9FA 4TNBA 2VX3A 1WBPA 5L2IA 4AS0A 3FMDA 4C38A 1YI6A 2DS1A 2R3NA 2VRXA 3W2PA 1BMKA 4AXAA 2OO8X 1IR3A 5HI2A 4QNAA 3UZRA 2BMCA 4IAYA 4RIWB 4AGUA 1PXMA 2W96B 3MH1A 3QYWA 3OWLA 2UZNA 4IZYA 2BHEA 4L8MA 3OY3A 4DLJA 4H3PA 3B2TA 4TYEA 4HZSA 2OXDA 3KF7A 5DRDA 2IW8A 1G8KA 2R5TA 4CD0A 4TYHB 4DDGA 4FG7A 4K2RA 4KBKA 4AXFA 1VR2A 4FVQA 2B9HA 2F2CB 4EHEA 2JLDA 2QO2A 3OOGA 3LCOA 3PJ1A 4LQMA 5EHOA 3V5LA 4J96A 2BROA 4BI2A 5CAOA 3PIXA 4OAUC 3LFCA 4AWIA 1OL6A 1P5EA 4F9WA 5C4LA 4NIFB 2HZ4A 5IEVA 3OW3A 4DINA 4GIHA 3RM6A 3FMEA 3Q9WA 1MUOA 2QU6A 3A4OX 2ZV2A 3RKBA 5M4FA 2Y8OA 3PY1A 1A48A 4W4WA 2ONLA 4Z7GA 3PA5A 1T46A 4X6QC 5IEXA 1PKDA 2RFEA 2R3FA 4WBOA 4IMYA 4C3RA 2BZKB 2WMRA 2QHNA 2ITXA 4DN5A 1Z9XA 3NCGA 5EDRA 2EVAA 4O0WA 1M2RA 3KRLA 3QTIA 2BZIB 4FSMA 2BRHA 3BEAA 3AC1A 2WKMA 3PUFC 5LVOA 4JBPA 5AV0A 5ETIA 4XV1A 1XBBA 5LMKC 1OL1A 3QCYA 4FL3A 4MBJA 1YWNA 4KIPA 4AA5A 3Q2MA 4ZAUA 3W2RA 4U3YA 5M09A 3DB6A 4A4LA 1LEZA 3PJCA 3Q6WA 3E64A 2CCHA 4I6FA 4R1YA 3W18A 5JGAA 2VWIA 4YHFA 3UO6A 2Y4IB 1GOLA 3BBWA 4E5AX 1R39A 3MFSA 1ZOHA 3WIGA 4E6CA 3R9RA 2WXVA 5L8JA 2X0QA 2PHKA 3GQLA 4HOKA 3EZVA 4B4LA 4ORKA 3RBWA 1PKGA 5LARA 2R3GA 3QHWA 4E4MA 3B8RA 3OBGA 1OPJA 4DFLA 4IEBA 4N6YA 4DH3A 5GHVA 1ZMVA 3KMUA 3BHTA 3GGFA 4UYNA 5AP5A 2SRCA 2UZOA 3MA3A 4QTBA 1UNLA 3C51A 3UO4A 3ZSGA 4EH7A 2GNHA 4II5A 4NSTA 4DC2A 3SKCA 1OKVA 1M7NA 2FGIA 5J9LA 3GCQA 4D5KA 1KE6A 1A9UA 3HNGA 3ZONA 1VLRA 3C4XA 3FYJX 2C5XA 1FINA 3HA6A 1S9IA 3PUPA 3IGOA 2BVAA 2CKPA 1G5SA 3MBLA 2GPHA 4BKYA 4M66A 3KCKA 2XNEA 4RJ8A 5HE2A 4DA5A 4RPVA 3BPRA 4I6BA 3U4WA 4EH3A 5HO6A 3DJ6A 3VW8A 3PFYA 3IOKA 5HIEA 4UZDA 3BL7A 2RFDA 4HCUA 2UZVA 2W1ZA 4UY9A 1H4LA 1BI8A 4YHJA 5DNRA 2C6LA 1BX6A 5IH4A 2HWOA 1FVVA 4XNEA 2YACA 3P79A 4WD5A 2WD1A 2F57A 2XNGA 3Q4ZA 4FKRA 3HZTA 3O2MA 4O6EA 3BQCA 3ORZA 1PF8A 2X2MA 3UGCA 4L44A 2JIVA 3JXWA 3MSSA 4MQ1A 4UWYA 4Y95A 1PXPA 4ZS0A 3V01A 4E6AA 1F3MC 3RK7A 2ITZA 4ACGA 3EQPA 1Y8GA 4IJ9A 4J98A 2B52A 5CVFA 4GVJA 3TNWA 4O0VA 4AFJA 4AW0A 2ERKA 4RWJA 4MXAA 5CEIA 2J5FA 4FV3A 4U3ZA 4Y73A 4FX3A 5AP4A 4C02A 3QTSA 5I0BA 5G1XA 3EZRA 5HVKA 2UZUE 3R1NA 3OCBA 3D14A 3V3VA 3VBXA 4AZTA 2QODA 4DFNA 2H6DA 3TNQB 4I22A 2UZEA 3VF8A 3E3PA 4GFGA 5CSWA 2W0JA 1IRKA 3DLZA 4J53A 2XJ0A 3QGYA 4FOBA 2X4ZA 3BWJA 3DOGA 3F3WA 2R3MA 2WQBA 4BTFA 4EOIA 3UOJA 3EN7A 4E26A 2X2KA 3I81A 4O38A 1U46A 3DBEA 5A6NA 2IW9A 1OBDA 4XG9A 2OJJA 2JBPA 1NW1A 2XB7A 4ASZA 2YIXA 4RX8A 2XKCA 4F1OA 4BI1A 4NW6A 4F7LA 4O7YA 4JDJA 2H34A 4L00A 4BCGA 4KKGA 1STCE 5C8KA 4IX3A 4N70A 1PXIA 3QKKA 4ENYA 4R8QA 4RJ5A 4MQ2A 4CRLA 3ZZEA 3KA0A 5CVGA 5M4UA 4ERWA 4MWIA 2W1FA 1DAWA 5CU2A 5ICPA 4G6OA 5CEQA 2YM3A 4K0YA 4PNIA 5EOLA 3Q96A 5E9EA 3FMLA 3MB7A 3DNDA 4QP2A 2OGVA 4DEIA 3T9TA 2QVSE 2ZM3A 5IDPA 3ORTA 4U79A 4I20A 4BBMA 3W2SA 3HRCA 1NVRA 1UU8A 3WI6A 2C6OA 2CN8A 3C50A 3QKLA 4O84A 3II5A 1H08A 5L2WA 5JGDA 4UX9A 2QOOA 3PYYA 2Z7SA 3Q52A 4V05A 3R6XA 4P90A 1JOWB 3FZTA 4IIRA 5B0XA 4HGTA 4JRVA 4O4CA 4DCEA 2E9UA 2P0CA 3QAME 4LRJA 4HGSA 1JNKA 1FMOE 4IW0A 3ULIA 4ZY4A 2HW6A 1E1XA 4ALVA 3AKLA 4EZ7A 3WYXA 5IQGA 2V5QA 4AF3A 3A60A 1EH4A 4JX3A 4EUTA 4DG2E 1FGKA 2JEDA 4DBXA 3FY2A 1Y57A 2YDKA 5J9YA 5TE0A 3E63A 5HGIA 2XCKA 5DR6A 1DS5A 5CEKA 3C4WA 5IQFA 4AN2A 1XBCA 2VN9A 5DLSA 3RNYA 2J4ZA 3TNHA 4NIFA 4ASEA 4AAAA 1J1CA 4FNXA 4I4FA 4L46A 1T45A 5IZFA 4C33A 3R7EA 3UYSA 3FEGA 3POOA 1YXXA 4CMTA 5EI6A 3OOMA 5IH6A 1UKHA 1REKA 4QMZA 2BTRA 4RWKA 2BUJA 1KUTA 4PNKA 5JMSA 3M42A 3QQKA 2GNGA 4F9BA 4IWPA 1GY3A 4DH1A 4XP0A 4S32A 4XV3A 5LXMA 2ZV9A 2WFYA 2WIPA 4ALUA 4WSYA 3UDSA 2XM9A 4H1MA 5EW9A 3LQ3A 3PRIA 3K54A 2R3JA 5E8TA 1ZZ2A 3D4QA 5H9BA 4M0YA 1ZAOA 5HVYA 1DAYA 3CPBA 4WSQA 4I3ZA 5KMKA 3QRTA 1Y6BA 2QLUA 2JFMA 3CGFA 3U6HA 4BBFA 4ZMEA 4YZBA 2X0GA 5E8YA 5B2MA 4PDOA 4BJJB 4LOOA 1JKTA 2QLQA 5HICA 5JQ8A 3LAUA 4YSJA 5HCZA 5LVPA 2BALA 4FV9A 4O4BB 5KMLA 1NY3A 2PVRA 3MTFA 2Y9QA 4PF4A 4BVUA 4F1MA 1VYZA 4XP3A 3WARA 3PVUA 1OUKA 1KWPA 4YJOA 2WMSA 4GT5A 4M0ZA 4QQCA 4O82A 3KN6A 3LJ1A 3KXHA 2ERZE 4FBXA 2BFYA 4JR7A 3FWQA 4M67A 3U51A 2IZRA 4C4HA 3IECA 4QMUA 1R3CA 4HVSA 3BRBA 4GIIA 4Y72A 4IQ6A 3QTQA 4YPSA 4RT7A 3PDTA 2UW7A 2X7OA 5AX3A 4YTIA 5KMOA 2R64A 2ZMDA 2OLCA 1S9JA 1E1VA 1P2AA 5K0XA 5EYCA 2NO3A 2Z8CA 3W10A 1BKXA 5ETCA 3F3VA 2HENA 3WZKA 3BV2A 4QMTA 3RAIA 5LCJA 3FMHA 2EXEA 4CTCA 2J0LA 3LVPA 4RZVA 2C6EA 3JPVA 2J50A 2C6DA 2X6EA 2AUHA 1U5RA 4I93A 3UIBA 1Q3WA 2XIZA 4DGMA 3PXRA 3RZFA 4WT6A 2OZAB 4R77A 2BFXA 2PMNX 3CEKA 5DR2A 2QURA 4ITHA 5CXHA 2YFXA 2O65A 4WNKA 1PXLA 2IO6A 4EC9A 4AN3A 2NP8A 4HGEA 3LM0A 2PVLA 5FRIA 3R7OA 3A7HA 3ZM4A 4CG8A 1YW2A 3BX5A 4QTDA 2DYLA 4RLKA 4YBJA 4AX8A 2C4GA 2BRGA 2ONLC 4PQNA 2DUVA 2WELA 3IG7A 5T68A 4DHIB 3FAAA 4R1VA 3TZ7A 5JZJA 3E8CA 4HW7A 4HZRA 5ANOA 4BF2A 4C4GA 4RJ7A 4EH2A 3KB7A 4JNWA 1NVQA 4C34A 5HNIX 3MVMA 4YNOA 3UZTA 3GQIA 2HY0A 2YIRA 3D15A 3G90X 4FSRA 5D41A 4R7IA 3FQHA 2YCSA 4QYGA 4PTGA 4ZP5A 3K3IA 3TZ8A 1KSWA 3VW6A 3QD4A 4J97A 1ZYCA 4AN9A 4BYIA 3ZO2A 4Q9ZA 3KK9A 2EXCX 4FV7A 4ARKA 3EN9A 3OZ6A 4APPA 2O5KA 3NIZA 1OBGA 4FTNA 3P5JC 5J1WA 4HCVA 4ZTHA 3K3JA 4FV0A 5F9EA 3EQGA 2OU7A 2WQNA 3WF9A 3E7OA 5E1SA 3IKAA 3MS9A 3UP2A 2XCHA 4FKPA 4IWOA 2YITA 4B8MA 2JDSA 4GT4A 4KWPA 5E8WA 1SM2A 5EHLA 3L8PA 4ZZNA 3CGOA 4EQMA 3FPQA 4YJUA 4BDGA 2PVYA 5L6PA 3U9CA 4I6LA 2XK3A 3QU0A 4GJ2A 1OIRA 3A7GA 4GSBA 4IWDA 3LFDA 4DEDA 4O7ZA 3HYHA 4JG7A 3ZDIA 5M53A 4BIDA 1B38A 3CXWA 4C36A 1VYWA 1XBAA 2CKQA 4NTSA 2QKRA 5H8BA 4AOIA 2XNPA 4ZSJA 5BVDA 2IWIA 2Q0NA 5TR6A 1ST4A 4BICA 1XH5A 3ZS5A 4ZMFA 2EUFB 4ZS4A 3I7CA 4EYMA 2H96A 4EOJA 5KE0A 5CTPA 3RPYA 4CMUA 5D10A 1OIYA 4PRJA 2IG7A 3SHEA 2XARA 3D2KA 4H3QA 5HBEA 4ANOA 2PU8A 2VGOA 2XNMA 3QALE 3ZUUA 5KNJA 4IC7A 4QP9A 5E1EA 2C68A 4AQCA 4IACA 3OWJA 4IANA 3CLYA 4FRFA 5H8EA 1H28A 1YHWA 3CR0A 1KOAA 3DDQA 5FTOA 3BLAA 4O21A 4FEQA 4ANBA 1TQPA 4GK4A 3FXZA 2HY81 3A4PA 2BAKA 3BGZA 3HA8A 3W2CA 4B0GA 5ETFA 3OWPA 3I5ZA 3ANRA 4FZAB 3BQRA 4RWIA 5E92A 2A1AB 4J99A 4G3FA 5BMMA 3LFEA 5J9ZA 3DK7A 3MH3A 5DGZA 5DIAA 4XG4A 1F5QA 3V8SA 2VO0A 3H9RA 2OK1A 2I1MA 3CPCA 3LJ0A 3SAYA 4D4SA 4WNPA 2C6IA 4F63A 4IE9A 3F6XA 3EFWA 4FTMA 4O7RA 1XO2B 4HNIA 3COIA 3QC4A 4IDTA 2I0EA 5CF5A 5IQAA 3NUAA 2GS7A 3LM5A 3QZFA 5DOSA 4IB5A 3RAKA 4Z55A 4A9UA 3IPHA 5AIKA 2R3RA 3HL7A 4HVHA 3NR9A 4DHZA 4LRKA 5ACKA 1FVRA 3TNPC 4CFMA 3KXXA 4NKAA 3IK3A 3QD2B 3PFQA 5IUHA 3V5QA 3EN5A 1UA2A 4D1SA 4O7NA 2A2AA 4D28A 3E87A 2YAKA 1VJYA 3PG3A 2AYPA 2PSQA 4ZJIA 3UDBA 5KKRB 4KINA 2RSVA 2O8YA 3P5KA 1URCA 3UOLA 5DT4A 2UVXA 2WQEA 2W1CA 3PY0A 2YABA 3P7AA 4RX5A 3DXPA 1TQMA 4BJJA 2VWVA 4O4EA 2I0VA 4BGHA 1H26A 3AC2A 4GU9A 4UN0C 5CAPA 2C5YA 5BVFA 4FUYA 2NYAA 4FV4A 5JT2A 4EBWA 3DA6A 2WTDA 2FB8A 2Y6MA 4FKLA 4I94A 1YWRA 5B7VA 1R78A 4DGGA 4EEVA 4RQKA 4F0GA 4LV7A 1V0PA 1H25A 1WBSA 3LXLA 3I6UA 3H9OA 3PY3A 1OGYA 3NW5A 2V7OA 2IZSA 2OXYA 3ZO4A 3R00A 1FGIA 3NNUA 3RK9A 2BAQA 2X1NA 3A8WA 2C3IB 1Y8YA 4CFVA 4DGOA 2EU9A 2OJGA 4LDTA 4EH5A 1H1WA 2P3GX 3QUDA 4AOTA 5CX9A 2F2UA 4XRJA 4LUDA 4NKSA 4I5MA 4ANMA 3AC8A 2YIYA 4BWPA 4XYFA 4RBLA 4CV9A 3F7ZA 3LCDA 4DHJA 3QHRA 4IAAA 3R2BA 3G51A 4DF3A 2B55A 3DKFA 3R1YA 4J52A 4AW1A 2VO7A 4A06A 1XKKA 3S00A 1G3NA 2A4LA 3C4EA 4GFOA 3FI3A 5I9WA 4FNYA 4PMTA 4PL5A 4NZWB 4CZUA 3P23A 3IDPA 4D9UA 2B7AA 4BCQA 1WAKA