3GG5A

Replacement of val3 in human thymidylate synthase affects its kinetic properties and intracellular stability
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
283
structure length
283
Chain Sequence
PPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Replacement of Val3 in human thymidylate synthase affects its kinetic properties and intracellular stability .
pubmed doi rcsb
molecule keywords Thymidylate synthase
molecule tags Transferase
source organism Homo sapiens
total genus 83
structure length 283
sequence length 283
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2009-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 3gg5A00
3EJLA 4GYHA 3B9HA 3IRNA 1AXWA 3UM6A 4IQQA 3K2HA 3IX6A 1TVVA 3KJRA 1B5EA 1TSDA 1YPVA 3QG2A 1BQ2A 1BPJA 1JTUA 1BJGA 3ED7A 3TMSA 4FOAA 4XSCA 4G6WX 3BZ0A 2AAZA 2TSCA 1CI7A 1ZPRA 2FTOX 2G86A 1JU6A 1NCEA 4O1UA 1TVUA 3HJ3A 3QJ7A 5H38A 4JEFA 3B5BA 1VZEA 1BKPA 2G89A 3BHLA 3JSUA 1LCAA 4KNZA 3EGYX 3N5EB 1TDUA 2G8XA 4FOGA 4O1XD 1JMFA 2KCEA 2OIPA 4EB4A 3I3RA 4GD7A 4KYAA 1VZDA 3V8HA 1J3KC 1NJEA 4LRRA 3UM5A 2VETA 1AIQA 2G8AA 3HB8A 4O7UA 3BNZA 5WRNA 3N5EA 1DNAA 3CLBA 3H9KA 2RDAA 3EDWX 1F4FA 1B5DA 3IRMA 4EZ8A 2H2QA 3IJZA 1F4CA 3OB7A 1NJDA 1TLSA 1TISA 3IHIA 1F28A 4EILA 5H3AA 4H0UA 2FTNA 1F4DA 1VZAA 4DPHA 2ONBA 4DQ1A 1BDUA 1AJMA 1DDUA 1NJBA 2TSRA 4IQBA 1F4EA 1TDCA 4EINA 1JG0A 1J3IC 1SYNA 2A9WA 3C06A 1NJAA 1TVWA 1F4GA 1KCEA 4PSGA 1KZJA 3INVA 1LCEA 1AOBA 4ISKA 2BBQA 3BFIA 3EAWX 5J7WA 1LCBA 1EV5A 1KZIA 1FWMA 3NRRA 4E5OA 1TSWA 1TLCA 4XSDA 3N5GA 1JMHA 1TRGA 3DL6A 4ISWA 1RTSA 1TSMA 3GH0A 3EBUA 1B02A 2RD8B 3UM8A 3KJSA 1QZFA 1TSZA 2TDMA 4ECKA 1HW4A 4GEVA 5BY6A 1TSXA 1HW3A 1TSNA 4KY4A 3C0AA 1FFLA 1TSLA 3GH2X 1BO8A 1BP6A 3DGAC 3HBBA 1EV8A 4H0RA 4H1IA 1JMGA 2RD8A 3GG5A 1TYSA 3UWLA 1TDBA 3IK1A 4E28A 3DG8C 1F4BA 2G8DA 4XSEA 1BQ1A 1QQQA 1TJSA 5H39A 1SEJA 1VZBA 4FGTA 1EVFA 1AN5A 3QGTA 4FOXA 2TDDA 3BGXA 4G2OX 4F2VA 1JTQA 3EF9A 1JUTA 1THYA 4TMSA 3CL9A 1BP0A 4UP1A 1J3JC 1BKOA 4IRRA 1TDAA 1NJCA 1BSPA 5FCTA 1BIDA 4Q0EA 3UWLB 1HZWA 1BSFA 3IK0A 1TSVA 4DP3A 3DL5A 1EVGA 1HVYA 4O1XA 5HS3A 4FQSA 4Q0DA 3BYXA 1VZCA 3BHRA 1JMIA 2FTQA 2VF0A 3KGBA 4KY8A 4KPWA 1JUJA 1TSYA 4DPDA 3EHIX 1BO7A 3IROA 1I00A 1B49A
chains in the Genus database with same CATH superfamily
3EJLA 4GYHA 3B9HA 3IRNA 1AXWA 3UM6A 4IQQA 3K2HA 3IX6A 1TVVA 3KJRA 1B5EA 1TSDA 1YPVA 3QG2A 1BQ2A 1BPJA 1JTUA 1BJGA 3ED7A 3TMSA 4FOAA 4XSCA 4G6WX 3BZ0A 2AAZA 2TSCA 1CI7A 1ZPRA 2FTOX 2G86A 1JU6A 1NCEA 4O1UA 1TVUA 3HJ3A 3QJ7A 5H38A 4JEFA 3B5BA 1VZEA 1BKPA 2G89A 3BHLA 3JSUA 1LCAA 4KNZA 3EGYX 3N5EB 1TDUA 2G8XA 4FOGA 4O1XD 1JMFA 2KCEA 2OIPA 4EB4A 3I3RA 4GD7A 4KYAA 1VZDA 3V8HA 1J3KC 1NJEA 4LRRA 3UM5A 2VETA 1AIQA 2G8AA 3HB8A 4O7UA 3BNZA 5WRNA 3N5EA 1DNAA 3CLBA 3H9KA 2RDAA 3EDWX 1F4FA 1B5DA 3IRMA 4EZ8A 2H2QA 3IJZA 1F4CA 3OB7A 1NJDA 1TLSA 1TISA 3IHIA 1F28A 4EILA 5H3AA 4H0UA 2FTNA 1F4DA 1VZAA 4DPHA 2ONBA 4DQ1A 1BDUA 1AJMA 1DDUA 1NJBA 2TSRA 4IQBA 1F4EA 1TDCA 4EINA 1JG0A 1J3IC 1SYNA 2A9WA 3C06A 1NJAA 1TVWA 1F4GA 1KCEA 4PSGA 1KZJA 3INVA 1LCEA 1AOBA 4ISKA 2BBQA 3BFIA 3EAWX 5J7WA 1LCBA 1EV5A 1KZIA 1FWMA 3NRRA 4E5OA 1TSWA 1TLCA 4XSDA 3N5GA 1JMHA 1TRGA 3DL6A 4ISWA 1RTSA 1TSMA 3GH0A 3EBUA 1B02A 2RD8B 3UM8A 3KJSA 1QZFA 1TSZA 2TDMA 4ECKA 1HW4A 4GEVA 5BY6A 1TSXA 1HW3A 1TSNA 4KY4A 3C0AA 1FFLA 1TSLA 3GH2X 1BO8A 1BP6A 3DGAC 3HBBA 1EV8A 4H0RA 4H1IA 1JMGA 2RD8A 3GG5A 1TYSA 3UWLA 1TDBA 3IK1A 4E28A 3DG8C 1F4BA 2G8DA 4XSEA 1BQ1A 1QQQA 1TJSA 5H39A 1SEJA 1VZBA 4FGTA 1EVFA 1AN5A 3QGTA 4FOXA 2TDDA 3BGXA 4G2OX 4F2VA 1JTQA 3EF9A 1JUTA 1THYA 4TMSA 3CL9A 1BP0A 4UP1A 1J3JC 1BKOA 4IRRA 1TDAA 1NJCA 1BSPA 5FCTA 1BIDA 4Q0EA 3UWLB 1HZWA 1BSFA 3IK0A 1TSVA 4DP3A 3DL5A 1EVGA 1HVYA 4O1XA 5HS3A 4FQSA 4Q0DA 3BYXA 1VZCA 3BHRA 1JMIA 2FTQA 2VF0A 3KGBA 4KY8A 4KPWA 1JUJA 1TSYA 4DPDA 3EHIX 1BO7A 3IROA 1I00A 1B49A
chains in the Genus database with same CATH topology
3EJLA 4GYHA 3B9HA 3IRNA 1AXWA 3UM6A 4IQQA 3K2HA 3IX6A 1TVVA 3KJRA 1B5EA 1TSDA 1YPVA 3QG2A 1BQ2A 1BPJA 1JTUA 1BJGA 3ED7A 3TMSA 4FOAA 4XSCA 4G6WX 3BZ0A 2AAZA 2TSCA 1CI7A 1ZPRA 2FTOX 2G86A 1JU6A 1NCEA 4O1UA 1TVUA 3HJ3A 3QJ7A 5H38A 4JEFA 3B5BA 1VZEA 1BKPA 2G89A 3BHLA 3JSUA 1LCAA 4KNZA 3EGYX 3N5EB 1TDUA 2G8XA 4FOGA 4O1XD 1JMFA 2KCEA 2OIPA 4EB4A 3I3RA 4GD7A 4KYAA 1VZDA 3V8HA 1J3KC 1NJEA 4LRRA 3UM5A 2VETA 1AIQA 2G8AA 3HB8A 4O7UA 3BNZA 5WRNA 3N5EA 1DNAA 3CLBA 3H9KA 2RDAA 3EDWX 1F4FA 1B5DA 3IRMA 4EZ8A 2H2QA 3IJZA 1F4CA 3OB7A 1NJDA 1TLSA 1TISA 3IHIA 1F28A 4EILA 5H3AA 4H0UA 2FTNA 1F4DA 1VZAA 4DPHA 2ONBA 4DQ1A 1BDUA 1AJMA 1DDUA 1NJBA 2TSRA 4IQBA 1F4EA 1TDCA 4EINA 1JG0A 1J3IC 1SYNA 2A9WA 3C06A 1NJAA 1TVWA 1F4GA 1KCEA 4PSGA 1KZJA 3INVA 1LCEA 1AOBA 4ISKA 2BBQA 3BFIA 3EAWX 5J7WA 1LCBA 1EV5A 1KZIA 1FWMA 3NRRA 4E5OA 1TSWA 1TLCA 4XSDA 3N5GA 1JMHA 1TRGA 3DL6A 4ISWA 1RTSA 1TSMA 3GH0A 3EBUA 1B02A 2RD8B 3UM8A 3KJSA 1QZFA 1TSZA 2TDMA 4ECKA 1HW4A 4GEVA 5BY6A 1TSXA 1HW3A 1TSNA 4KY4A 3C0AA 1FFLA 1TSLA 3GH2X 1BO8A 1BP6A 3DGAC 3HBBA 1EV8A 4H0RA 4H1IA 1JMGA 2RD8A 3GG5A 1TYSA 3UWLA 1TDBA 3IK1A 4E28A 3DG8C 1F4BA 2G8DA 4XSEA 1BQ1A 1QQQA 1TJSA 5H39A 1SEJA 1VZBA 4FGTA 1EVFA 1AN5A 3QGTA 4FOXA 2TDDA 3BGXA 4G2OX 4F2VA 1JTQA 3EF9A 1JUTA 1THYA 4TMSA 3CL9A 1BP0A 4UP1A 1J3JC 1BKOA 4IRRA 1TDAA 1NJCA 1BSPA 5FCTA 1BIDA 4Q0EA 3UWLB 1HZWA 1BSFA 3IK0A 1TSVA 4DP3A 3DL5A 1EVGA 1HVYA 4O1XA 5HS3A 4FQSA 4Q0DA 3BYXA 1VZCA 3BHRA 1JMIA 2FTQA 2VF0A 3KGBA 4KY8A 4KPWA 1JUJA 1TSYA 4DPDA 3EHIX 1BO7A 3IROA 1I00A 1B49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EJL A;  4GYH A;  3B9H A;  3IRN A;  1AXW A;  3UM6 A;  4IQQ A;  3K2H A;  3IX6 A;  1TVV A;  3KJR A;  1B5E A;  1TSD A;  1YPV A;  3QG2 A;  1BQ2 A;  1BPJ A;  1JTU A;  1BJG A;  3ED7 A;  3TMS A;  4FOA A;  4XSC A;  4G6W X;  3BZ0 A;  2AAZ A;  2TSC A;  1CI7 A;  1ZPR A;  2FTO X;  2G86 A;  1JU6 A;  1NCE A;  4O1U A;  1TVU A;  3HJ3 A;  3QJ7 A;  5H38 A;  4JEF A;  3B5B A;  1VZE A;  1BKP A;  2G89 A;  3BHL A;  3JSU A;  1LCA A;  4KNZ A;  3EGY X;  3N5E B;  1TDU A;  2G8X A;  4FOG A;  4O1X D;  1JMF A;  2KCE A;  2OIP A;  4EB4 A;  3I3R A;  4GD7 A;  4KYA A;  1VZD A;  3V8H A;  1J3K C;  1NJE A;  4LRR A;  3UM5 A;  2VET A;  1AIQ A;  2G8A A;  3HB8 A;  4O7U A;  3BNZ A;  5WRN A;  3N5E A;  1DNA A;  3CLB A;  3H9K A;  2RDA A;  3EDW X;  1F4F A;  1B5D A;  3IRM A;  4EZ8 A;  2H2Q A;  3IJZ A;  1F4C A;  3OB7 A;  1NJD A;  1TLS A;  1TIS A;  3IHI A;  1F28 A;  4EIL A;  5H3A A;  4H0U A;  2FTN A;  1F4D A;  1VZA A;  4DPH A;  2ONB A;  4DQ1 A;  1BDU A;  1AJM A;  1DDU A;  1NJB A;  2TSR A;  4IQB A;  1F4E A;  1TDC A;  4EIN A;  1JG0 A;  1J3I C;  1SYN A;  2A9W A;  3C06 A;  1NJA A;  1TVW A;  1F4G A;  1KCE A;  4PSG A;  1KZJ A;  3INV A;  1LCE A;  1AOB A;  4ISK A;  2BBQ A;  3BFI A;  3EAW X;  5J7W A;  1LCB A;  1EV5 A;  1KZI A;  1FWM A;  3NRR A;  4E5O A;  1TSW A;  1TLC A;  4XSD A;  3N5G A;  1JMH A;  1TRG A;  3DL6 A;  4ISW A;  1RTS A;  1TSM A;  3GH0 A;  3EBU A;  1B02 A;  2RD8 B;  3UM8 A;  3KJS A;  1QZF A;  1TSZ A;  2TDM A;  4ECK A;  1HW4 A;  4GEV A;  5BY6 A;  1TSX A;  1HW3 A;  1TSN A;  4KY4 A;  3C0A A;  1FFL A;  1TSL A;  3GH2 X;  1BO8 A;  1BP6 A;  3DGA C;  3HBB A;  1EV8 A;  4H0R A;  4H1I A;  1JMG A;  2RD8 A;  3GG5 A;  1TYS A;  3UWL A;  1TDB A;  3IK1 A;  4E28 A;  3DG8 C;  1F4B A;  2G8D A;  4XSE A;  1BQ1 A;  1QQQ A;  1TJS A;  5H39 A;  1SEJ A;  1VZB A;  4FGT A;  1EVF A;  1AN5 A;  3QGT A;  4FOX A;  2TDD A;  3BGX A;  4G2O X;  4F2V A;  1JTQ A;  3EF9 A;  1JUT A;  1THY A;  4TMS A;  3CL9 A;  1BP0 A;  4UP1 A;  1J3J C;  1BKO A;  4IRR A;  1TDA A;  1NJC A;  1BSP A;  5FCT A;  1BID A;  4Q0E A;  3UWL B;  1HZW A;  1BSF A;  3IK0 A;  1TSV A;  4DP3 A;  3DL5 A;  1EVG A;  1HVY A;  4O1X A;  5HS3 A;  4FQS A;  4Q0D A;  3BYX A;  1VZC A;  3BHR A;  1JMI A;  2FTQ A;  2VF0 A;  3KGB A;  4KY8 A;  4KPW A;  1JUJ A;  1TSY A;  4DPD A;  3EHI X;  1BO7 A;  3IRO A;  1I00 A;  1B49 A; 
#chains in the Genus database with same CATH topology
 3EJL A;  4GYH A;  3B9H A;  3IRN A;  1AXW A;  3UM6 A;  4IQQ A;  3K2H A;  3IX6 A;  1TVV A;  3KJR A;  1B5E A;  1TSD A;  1YPV A;  3QG2 A;  1BQ2 A;  1BPJ A;  1JTU A;  1BJG A;  3ED7 A;  3TMS A;  4FOA A;  4XSC A;  4G6W X;  3BZ0 A;  2AAZ A;  2TSC A;  1CI7 A;  1ZPR A;  2FTO X;  2G86 A;  1JU6 A;  1NCE A;  4O1U A;  1TVU A;  3HJ3 A;  3QJ7 A;  5H38 A;  4JEF A;  3B5B A;  1VZE A;  1BKP A;  2G89 A;  3BHL A;  3JSU A;  1LCA A;  4KNZ A;  3EGY X;  3N5E B;  1TDU A;  2G8X A;  4FOG A;  4O1X D;  1JMF A;  2KCE A;  2OIP A;  4EB4 A;  3I3R A;  4GD7 A;  4KYA A;  1VZD A;  3V8H A;  1J3K C;  1NJE A;  4LRR A;  3UM5 A;  2VET A;  1AIQ A;  2G8A A;  3HB8 A;  4O7U A;  3BNZ A;  5WRN A;  3N5E A;  1DNA A;  3CLB A;  3H9K A;  2RDA A;  3EDW X;  1F4F A;  1B5D A;  3IRM A;  4EZ8 A;  2H2Q A;  3IJZ A;  1F4C A;  3OB7 A;  1NJD A;  1TLS A;  1TIS A;  3IHI A;  1F28 A;  4EIL A;  5H3A A;  4H0U A;  2FTN A;  1F4D A;  1VZA A;  4DPH A;  2ONB A;  4DQ1 A;  1BDU A;  1AJM A;  1DDU A;  1NJB A;  2TSR A;  4IQB A;  1F4E A;  1TDC A;  4EIN A;  1JG0 A;  1J3I C;  1SYN A;  2A9W A;  3C06 A;  1NJA A;  1TVW A;  1F4G A;  1KCE A;  4PSG A;  1KZJ A;  3INV A;  1LCE A;  1AOB A;  4ISK A;  2BBQ A;  3BFI A;  3EAW X;  5J7W A;  1LCB A;  1EV5 A;  1KZI A;  1FWM A;  3NRR A;  4E5O A;  1TSW A;  1TLC A;  4XSD A;  3N5G A;  1JMH A;  1TRG A;  3DL6 A;  4ISW A;  1RTS A;  1TSM A;  3GH0 A;  3EBU A;  1B02 A;  2RD8 B;  3UM8 A;  3KJS A;  1QZF A;  1TSZ A;  2TDM A;  4ECK A;  1HW4 A;  4GEV A;  5BY6 A;  1TSX A;  1HW3 A;  1TSN A;  4KY4 A;  3C0A A;  1FFL A;  1TSL A;  3GH2 X;  1BO8 A;  1BP6 A;  3DGA C;  3HBB A;  1EV8 A;  4H0R A;  4H1I A;  1JMG A;  2RD8 A;  3GG5 A;  1TYS A;  3UWL A;  1TDB A;  3IK1 A;  4E28 A;  3DG8 C;  1F4B A;  2G8D A;  4XSE A;  1BQ1 A;  1QQQ A;  1TJS A;  5H39 A;  1SEJ A;  1VZB A;  4FGT A;  1EVF A;  1AN5 A;  3QGT A;  4FOX A;  2TDD A;  3BGX A;  4G2O X;  4F2V A;  1JTQ A;  3EF9 A;  1JUT A;  1THY A;  4TMS A;  3CL9 A;  1BP0 A;  4UP1 A;  1J3J C;  1BKO A;  4IRR A;  1TDA A;  1NJC A;  1BSP A;  5FCT A;  1BID A;  4Q0E A;  3UWL B;  1HZW A;  1BSF A;  3IK0 A;  1TSV A;  4DP3 A;  3DL5 A;  1EVG A;  1HVY A;  4O1X A;  5HS3 A;  4FQS A;  4Q0D A;  3BYX A;  1VZC A;  3BHR A;  1JMI A;  2FTQ A;  2VF0 A;  3KGB A;  4KY8 A;  4KPW A;  1JUJ A;  1TSY A;  4DPD A;  3EHI X;  1BO7 A;  3IRO A;  1I00 A;  1B49 A; 
#chains in the Genus database with same CATH homology
 3EJL A;  4GYH A;  3B9H A;  3IRN A;  1AXW A;  3UM6 A;  4IQQ A;  3K2H A;  3IX6 A;  1TVV A;  3KJR A;  1B5E A;  1TSD A;  1YPV A;  3QG2 A;  1BQ2 A;  1BPJ A;  1JTU A;  1BJG A;  3ED7 A;  3TMS A;  4FOA A;  4XSC A;  4G6W X;  3BZ0 A;  2AAZ A;  2TSC A;  1CI7 A;  1ZPR A;  2FTO X;  2G86 A;  1JU6 A;  1NCE A;  4O1U A;  1TVU A;  3HJ3 A;  3QJ7 A;  5H38 A;  4JEF A;  3B5B A;  1VZE A;  1BKP A;  2G89 A;  3BHL A;  3JSU A;  1LCA A;  4KNZ A;  3EGY X;  3N5E B;  1TDU A;  2G8X A;  4FOG A;  4O1X D;  1JMF A;  2KCE A;  2OIP A;  4EB4 A;  3I3R A;  4GD7 A;  4KYA A;  1VZD A;  3V8H A;  1J3K C;  1NJE A;  4LRR A;  3UM5 A;  2VET A;  1AIQ A;  2G8A A;  3HB8 A;  4O7U A;  3BNZ A;  5WRN A;  3N5E A;  1DNA A;  3CLB A;  3H9K A;  2RDA A;  3EDW X;  1F4F A;  1B5D A;  3IRM A;  4EZ8 A;  2H2Q A;  3IJZ A;  1F4C A;  3OB7 A;  1NJD A;  1TLS A;  1TIS A;  3IHI A;  1F28 A;  4EIL A;  5H3A A;  4H0U A;  2FTN A;  1F4D A;  1VZA A;  4DPH A;  2ONB A;  4DQ1 A;  1BDU A;  1AJM A;  1DDU A;  1NJB A;  2TSR A;  4IQB A;  1F4E A;  1TDC A;  4EIN A;  1JG0 A;  1J3I C;  1SYN A;  2A9W A;  3C06 A;  1NJA A;  1TVW A;  1F4G A;  1KCE A;  4PSG A;  1KZJ A;  3INV A;  1LCE A;  1AOB A;  4ISK A;  2BBQ A;  3BFI A;  3EAW X;  5J7W A;  1LCB A;  1EV5 A;  1KZI A;  1FWM A;  3NRR A;  4E5O A;  1TSW A;  1TLC A;  4XSD A;  3N5G A;  1JMH A;  1TRG A;  3DL6 A;  4ISW A;  1RTS A;  1TSM A;  3GH0 A;  3EBU A;  1B02 A;  2RD8 B;  3UM8 A;  3KJS A;  1QZF A;  1TSZ A;  2TDM A;  4ECK A;  1HW4 A;  4GEV A;  5BY6 A;  1TSX A;  1HW3 A;  1TSN A;  4KY4 A;  3C0A A;  1FFL A;  1TSL A;  3GH2 X;  1BO8 A;  1BP6 A;  3DGA C;  3HBB A;  1EV8 A;  4H0R A;  4H1I A;  1JMG A;  2RD8 A;  3GG5 A;  1TYS A;  3UWL A;  1TDB A;  3IK1 A;  4E28 A;  3DG8 C;  1F4B A;  2G8D A;  4XSE A;  1BQ1 A;  1QQQ A;  1TJS A;  5H39 A;  1SEJ A;  1VZB A;  4FGT A;  1EVF A;  1AN5 A;  3QGT A;  4FOX A;  2TDD A;  3BGX A;  4G2O X;  4F2V A;  1JTQ A;  3EF9 A;  1JUT A;  1THY A;  4TMS A;  3CL9 A;  1BP0 A;  4UP1 A;  1J3J C;  1BKO A;  4IRR A;  1TDA A;  1NJC A;  1BSP A;  5FCT A;  1BID A;  4Q0E A;  3UWL B;  1HZW A;  1BSF A;  3IK0 A;  1TSV A;  4DP3 A;  3DL5 A;  1EVG A;  1HVY A;  4O1X A;  5HS3 A;  4FQS A;  4Q0D A;  3BYX A;  1VZC A;  3BHR A;  1JMI A;  2FTQ A;  2VF0 A;  3KGB A;  4KY8 A;  4KPW A;  1JUJ A;  1TSY A;  4DPD A;  3EHI X;  1BO7 A;  3IRO A;  1I00 A;  1B49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...