3GGCA

Human hypoxanthine-guanine phosphoribosyltransferase in complex with 9-(2-phosphonoethoxyethyl)hypoxanthine
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
214
structure length
212
Chain Sequence
SPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of hypoxanthine-guanine phosphoribosyltransferase by acyclic nucleoside phosphonates: a new class of antimalarial therapeutics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Hypoxanthine-guanine phosphoribosyltransferase
total genus 62
structure length 212
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2009-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ggcA00
2JI4A 1XZ8A 4TWBA 3KB8A 1BD4A 2JBHA 2C4KA 1IBSA 5BQPA 1NULA 3S5JA 1OPRA 3LRTA 4LYGA 1AO0A 1G9TA 1FSGA 3ACBA 2XBUA 3N2LA 1U9YA 1ZN7A 2PRZA 1PZMA 4JLSA 4RQAA 1VSTA 1A97A 4X44A 3GGCA 1MZVA 1Y0BA 3DMPA 4RHTA 4RACA 4RANA 2PS1A 1ZN9A 1A96A 1XTVA 1G2PA 2HCRA 4RABA 4LZOA 1QCDA 1QK3A 1I13A 5BSKA 1WD5A 1NONA 1DKRA 1L1RA 4RAQA 3M3HA 4P3KA 4OHCA 4RHXA 1ECCA 1BD3A 3O7MA 5EUCA 3EFHA 3MJDA 4LZNA 5IPFA 4S2UA 1HGXA 1HMPA 1JLRA 1QB7A 4M0PA 1BZYA 1QB8A 3ACCA 1TC2A 1OROA 1XTUA 2FXVA 2H08A 1P19A 4RADA 4F8EA 1OREA 1QK5A 1YFZA 4Z1OA 1JLSA 1A98A 4JITA 2IGBA 1O5OA 1CJBA 1ECFA 2AEEA 1D6NA 1R3UA 1P4AA 4RQBA 2P1ZA 1G2QA 5ESXA 1J7JA 1P18A 4QYIB 2DY0A 1XTTA 5HIAA 3DAHA 5JV5A 4LYYA 4RV4A 4P80A 1V9SA 3OZGA 1GRVA 3MBIA 1ECBA 4M0KA 4RHUA 3H83A 3OHPA 1ECJA 2JKYA 4WN3A 3LPNA 3NAGA 1QCCA 4FYMA 5KAPA 1UPFA 4WMLA 4M0UA 4QYIA 4P83A 1ZN8A 1U9ZA 2JKZA 4ZFNA 5ESWA 1QK4A 4QRIA 1A4XA 1VDMA 1GPH1 2YZKA 2PRYA 4KN6A 4PAWA 3HVUA 4RAOA 5IAOA 1DKUA 1DQPA 4P81A 4RHYA 5JSQA 1UFRA 2WNSA 3GEPA 5HKLA 1W30A 1I5EA 4IJQA 3ACDA 4PFQA 1UPUA 1DBRA 1STOA 1ECGA 3QW4B 2VFAA 2H07A 4P82A 4X45A 2E55A 2GEBA 1DQNA 1P17A 3GGJA 1O57A 3G6WA 4P86A 5BRNA 5BQOA 5E38A 1L1QA 1VCHA 1Z7GA 1A95A 5K51A 1I0LA 5KAMA 2H06A 1I14A 1LH0A 2EHJA 4P84A 1G9SA 1A3CA 3OZFA 4LZAA 4MB6A 1I0IA 1TC1A 1XZNA 3DEZA
chains in the Genus database with same CATH superfamily
1I32A 3RHZA 4G67A 5HZGA 4D26A 3GH1A 1Y3BE 4UAUA 4R2HA 1M2OB 3WY9A 1IBSA 1GCUA 5AMXA 1EDBA 2F3RA 4R2XA 2RKWA 1ZP6A 4HDOB 1ZU4A 5AUOB 4I1SA 4CLHA 3ETEA 5BWOA 4GF5A 1E4EB 4KXVA 1CERA 3E7FA 5DOZA 5SZIA 3RS3A 2UXBB 5DNUA 1M1NA 2QMZA 2Q6IA 2JLQA 3TS1A 4DLSA 2Z08A 4II2A 3OTWA 3CCCA 1Q44A 2INGX 1DZ3A 3I0ZA 1CPYA 1RHJA 2CDNA 1RQPA 2KYRA 4N82A 5ENDA 4BCBA 4DG5A 2XUPA 2PK3A 2FZCA 2VBGA 4EI7A 1CD5A 2JDIA 4NYIR 3BWEA 4LJ4A 3MLAA 4XQEA 2DPMA 2E4VA 4NLLA 4ND2A 5FTJA 3LYLA 4EUFA 2DETA 3RSFA 2O8FA 1XTRA 1FXSA 2XPCA 4C4RA 1D2HA 5K8TA 1HT2E 1YJCA 1R9JA 2XE6A 1P44A 1PTKA 3I39X 4MUIA 2XDYA 3NYWA 4ZGGA 5AW5A 4HFMA 2PFGA 3BMOB 3D7MA 5A4KA 3EYAA 2Y4NA 1JHAA 1WDMA 3K4HA 3ODGA 3KX2A 3FLAA 4MHTA 4N3BA 1CUHA 5K2OA 3KSMA 3LDHA 1GUDA 1J2RA 1FDUA 1GTSA 5EVCA 4PXSA 4EHBA 3CUSA 3FXAA 1DC3A 4RU1A 2FW7A 2C3UA 3P0EA 3RTBA 1N6NA 1E7YA 3CUWA 1G3QA 1G0OA 3EGDA 3UC5A 4LX0A 3EXHB 3V3TA 4TYNA 1SVLA 2JRLA 3S40A 3FTQA 2W70A 4EMSA 2HQ1A 4O4HA 3WAJA 1YRHA 1YRQA 3U09A 2P2NA 1LD3A 1AN9A 2R25B 1BS2A 1EX6A 2ZT7A 3KQVA 4FHCA 4KXWA 3PR3A 2PBRA 4DHEA 5C53B 1S8AA 1NBEA 2K4MA 1M54A 4OQDA 4XDZA 4CDMA 5JE8A 3PXXA 3S81A 1GKLA 2OK8A 3DF9A 5IDVA 3RRMA 2IV2X 5JQGF 3EZLA 5EWMB 4WLUA 1L4KA 4ZVLA 1P1FA 1FMTA 2IHYA 2X8JB 1KP9A 3GF4A 4UKDA 5EEHA 3RD5A 3U31A 2C7GA 1NBME 4FUQA 3ZU5A 3SYMA 1OJLA 4QECA 1RMTA 3MJSA 3HJNA 3J81k 3DA8A 3L49A 4LXQA 1G20B 5EWLB 3MJTA 4QWWA 2BE7A 5K0JA 1SVUA 3DZCA 2TECE 1XCOA 2HPZA 2ZYTX 2QX8A 3HNPA 3ILSA 3E5MA 4R7TA 2IPNA 4YRFA 3UK1A 4MQMA 3U4HA 4FOPA 5JJCA 2NWQA 1M0SA 4I5FA 4RYDA 2BN4A 1RZRD 3GRPA 4CUKA 3PVCA 2FZKA 2L19A 3F71A 4QGGA 3BORA 4CT5A 3JQ7A 2FP4A 3UFBA 1QIJA 5FWYA 5JS6A 4D9MA 1ORRA 2HD4A 4ND8A 2PQMA 3DE7X 4BNVA 3THXB 1ZNXA 4RD6A 3QEOA 1V6CA 3GMIA 2BEUA 3HDHA 4UDYX 1RWNA 1UBGA 4KX5A 3ZGXA 2R68A 2RI1A 3L4JA 4QUHA 2XW6A 2JZCA 3O8QB 4EA8A 2BI8A 5C8XA 3H04A 1W9MA 5HXAA 4ZKEA 4X00A 1UK7A 2CVZA 2UDPA 1KKMA 1VCMA 1YU6A 4FQ7A 4OU5A 1O97D 2IOFA 4Q39A 3S1LA 3H6HA 3LLUA 5LPNA 5M5BA 1ZA2A 3GA7A 3EMVA 4JT9A 3U9LA 1LF5A 2A2ZA 2CKDA 4KPUB 2ZSJA 5KVVA 1OH5A 3SPXA 4IF4A 1VBNA 2EYUA 4HMPA 3S3TA 4D9IA 1RU3A 2XE4A 4LJ5A 3THWA 5B1DA 2XUDA 2FP3A 2G40A 3SG0A 4IJUA 3ENVA 4QOSA 2CDAA 1T1JA 2RGDA 5L7WA 2NG1A 2VJBA 1ZSNA 2X3UA 3LOUA 4MWCA 2GDZA 4QSMA 4B84A 2FPXA 3OX4A 4JKOA 4ZQGA 3EXFA 3QSYA 4FZ5A 3NKVA 2MSNA 3CN7A 3W5IA 1KEWA 1YHZA 2C98A 2YZ7A 1CVLA 1B6RA 1WX1A 1NOIA 4FOLA 1W2WB 1NBMD 3JTMA 4C4YA 1ZLXA 3I9OA 3O9ZA 4EDFA 3JSXA 3UT5A 3TL2A 5CG1A 4OXKA 4RZUA 5J4VA 1U65A 2RHHA 2OCGA 3ZVMA 2Q62A 3QVXA 3C98A 4WGGA 5LOVB 3HJRA 4EB3A 1CXZA 3KM0A 4Q1FA 3O7MA 3R5XA 4DT1B 4QICA 4XWKA 4UUAA 3UANA 3EF1A 1YL6A 4JH0A 1C7IA 5JS7A 3VUEA 4PCUA 1PR5A 1EFPB 4YJHB 5DNYB 2YIVX 1SHUX 5EE5B 2DECA 2P3OA 2VATA 3GRRA 2A3RA 4FLMA 4FX5A 1QSGA 3IV6A 2IPAB 3K0CA 4UXHA 4X1KA 2OXIA 1U9IA 3VYVA 4S1VA 5LQUA 1XCLA 2EL9A 4Z8YA 4D5GA 1X39A 1DGQA 4AMYA 5CDHA 3H2KA 2YNMD 4RIFA 4H6WA 1IRIA 1AMUA 5K3EA 3F9RA 1T36B 1BIFA 3NYIA 3EOZA 1UMCB 4G0PA 4KO4S 3P19A 3WNBA 4A9AA 4AW9A 4HRAA 2JEOA 4UASA 5EVJA 1K75A 3ICWA 5FWYB 5L8VA 1RWVA 1XDWA 1YZLA 3DAOA 1JBQA 3G2IA 4PZDA 1WF6A 4M0LA 2IPOA 5IANA 1WDLA 1EMDA 1ZRNA 2JFOA 4QO7A 3U61B 2FW9A 5IK2D 3WAGA 3B7PA 2WLTA 4LYDA 2X8AA 1U6JA 2A59A 3B8EA 5E2IA 7ADHA 1IHOA 4I55A 1Q0ZA 4L8YA 4FXPA 1YR1A 1NPYA 3K0AB 2ZCVA 3NXSA 3PDIB 1SG9A 3TR6A 2DOKA 2FWNA 1ZOOA 4Y0NA 3OCYA 3W0LB 3HP4A 1M76A 4RD2A 2OD2A 4IIBA 1Z0DA 2ZI7A 4Q4HA 1C2TA 3GFPA 1L5WA 2P8JA 4W5JA 4D45A 1ZW1A 2PXAA 2AFVA 3GG9A 5EE1A 5KYVA 5C8ZA 2IBMA 3CW9A 1O6CA 4TYQA 4FCTA 4MWSA 3HYRA 4Q6BA 1D2RA 1W2HA 1NKVA 2WA2A 4NCKA 5LZ8A 4E5YA 1O57A 1Y3IA 2BY4A 2X1MA 1V8FA 4E14A 4KFSA 1Y4DE 3ETNA 1UP4A 3AFMA 4MRPA 3IOYA 1CQPA 3DPIA 2CBXA 2WHEA 1LLUA 5FT9A 2HMVA 3LQ4A 5ED0A 3HJGA 3P96A 3KKKA 1A3CA 2HZBA 3H5LA 3P9XA 1L7PA 1ZGBA 2H4HA 2Q0QA 2FSGA 4G07A 1GLNA 2FSFA 1QXSA 1GZUA 2HJSA 2R6R1 1Z68A 3MQFA 3U4CA 1AB5A 3PQEA 4CCAA 1OAOA 4GSLA 4R8LA 1IEXA 1BXKA 5F12A 3BB3A 4FHGA 1FTQA 1Y1TA 1BDIA 4Q9KA 2JIBA 2RDMA 4NU8X 3WYCA 5FPKA 3K8ZA 5J5VA 8ADHA 3ZEIA 1CEEA 3OPNA 2GK6A 2ILTA 1P9LA 3L8EA 3B51X 2HRBA 2KBEA 3ZBQA 5ES3A 1QH8A 2JD1A 2ZP1A 1KZ6A 1ES9A 3I1IA 1RAFA 5KNCD 3EQ7A 3FDZA 1G3RA 1INLA 1HF3A 2AKYA 2F1OA 4S1OA 2IHZA 4R16A 2ORIA 4P58A 3AI7A 1E8NA 1QRDA 1UDCA 1T0BA 1W4AA 1XMXA 2P3LA 2ZAYA 3EWIA 3PD1A 1QZZA 3N3BC 1XEXB 4TMTA 3RTGA 4RTMA 3EC7A 2TSYB 4RABA 4JI5B 3ZGOA 1WPRA 5HQJA 4ZANA 4ZZIA 2NU7B 2WJVA 3Q6IA 5TC4A 3U7QA 3CVXA 1NONA 4BC0A 4UHDA 1DJLA 1GIAA 1NRIA 1Y63A 3K0EA 3I34X 1BVRA 4CTJA 1V71A 4AJOA 4YIHA 1BKYA 4QPJC 1Q0UA 3IVRA 1VHDA 1Z45A 4B6QA 4YI5A 3KU1A 2HL6A 4AYTA 1QLJA 1K6IA 4YCBA 4KZPA 5E4YA 1KJQA 1MX5A 1S96A 4Q4AB 5DW3A 5J40A 1WB9A 1QOZA 4K87A 2J5XA 4MYDA 1JQBA 4TWIA 2PX5A 3CJRA 4NMLA 4ESEA 1VLHA 2Q3BA 3UVEA 2VZEA 4EW3A 4FHFA 1ULSA 4S1TA 4EG5A 3O3OB 3UJHA 1VPEA 3U1TA 4BV9A 2YQ4A 1GLVA 2VP3A 5IAKA 2HGZA 4BWFB 3V8PA 5FJIA 1IQRA 2F8TA 4KR6A 2D54A 5DYTA 3T4PA 4F0JA 1G20E 2ENUA 2MOKA 4KIFA 3LAWA 3OPVA 4TMWA 4ARZB 1ZHOA 1N0HA 4OX9B 3DXFA 3RS8A 3C1OA 4K2AA 2QP9X 3VX4A 2GKOA 3A6FA 1N8KA 4DS3A 4BEBA 3A9TA 5KUTA 4RLSA 5CDGA 2NZUG 5JCOA 4KO8A 3U37A 4B87A 2Q3EA 4MEAA 5B4TA 3RS9A 1B0UA 4XJVA 2GPTA 1QGYA 1GY8A 1U9CA 4R40A 3VGJA 5CU7A 4B32A 3PDCA 3KZMA 4LQ4A 4IINA 5CM2Z 4KQ6A 2PL3A 4PBTA 4HNSA 3RHSA 4IJQA 4HADA 5JYBA 4LCEA 3ANSA 3NBKA 2B8TA 2I7DA 1KIFA 1SHKA 2XKJE 3F6EX 4JUCA 5K9ZA 1UEXC 1IHUA 1G4AE 4OJNA 2GJ4A 4HQOA 4ETNA 4BASA 4EG4A 5EYPA 2XRFA 5G40A 3G9XA 3GAFA 1G21A 4BBPA 3F78A 1TIBA 1C8VB 1YWGO 2HUNA 3H2ZA 3HJUA 1A9OA 2OENG 1NR7A 3U3MA 3VHLB 4Z4QA 2B83A 1MJGM 2H54A 3TG8A 3WFZA 1UJBA 3F74A 4DYDA 1U7UA 1AQNA 3NTRA 1PYOA 1IUNA 4B34A 4OB8A 4B9EA 4KGXA 4X61A 1SK8A 3BK1A 1GL6A 3AFNA 4C0AC 5C2JB 1COWA 1PN3A 3MELA 4FBMA 2PH1A 2SBTA 1P1JA 1DTWB 4KFCA 4GW3A 5H3LA 4ZEVA 4IVPA 1YHNA 4TVOA 5KPDA 1ZS9A 2J30A 4MZDA 3BGVA 3QYAA 4ANFA 3GELA 4JT8A 3DXYA 4L8LA 4TMXA 2BCGY 4GIBA 1MC8A 4TT3A 2XGJA 1OX5A 4G4SO 1A7AA 2HEGA 1JQ5A 1HG1A 4RMIA 4UBJA 5JCPA 4F4HA 3DUWA 2IP4A 1NVXQ 2ZR7A 1HM5A 1X8KA 4G26A 5ALJA 4HX5A 5ICFA 2R0QC 1HDCA 3O9MA 4XB1A 1OLOA 2VPWA 1T1IA 3EGOA 1F2TA 1A96A 2YMQA 3D6FA 4IJ6A 4JBXA 4WN9B 3VVBA 4OKSA 4B4UA 5G2OA 2NADA 3IDAA 4KE9A 4LZOA 1XYYA 5HTOA 4D2IA 5KYGA 1ZXLA 4MP3A 4BB6A 1DX4A 4AYXA 4RTKA 4GI3A 1NVWQ 4BZWA 3FYCA 1SQFA 2WZDA 4PCVA 1O95A 4BKPA 4X8MA 4A15A 2X19A 3S4YA 3GX1A 5HIIA 1IN4A 2ZROA 4XIJA 2I87A 1IQPA 1O8CA 1N9KA 1D0IA 5C5IA 2VTKA 3E35A 4MR7A 3TQHA 5L3VA 3SJAA 1E7RA 4WVLA 1QX4A 3WWZA 1GUFA 3RKSA 4JUBA 3O91A 2HPAA 2B2CA 3EIFA 4QUKA 5JG7A 3OLQA 1E9VA 1P0MA 3EVAA 2X0JA 3FETA 3LQQA 1YU9A 3OE7D 2D59A 4GMGA 2ONCA 1RHUA 3WLHA 1KO5A 3AILA 2VBCA 2I80A 5HDQA 2C9MA 3ISTA 4RD4A 4GO1A 3L4KA 4MVJI 2HF8A 1UIMA 2QR2A 4UHEA 4F3KA 2BFFB 3VR5A 3NMUF 2P2YA 3SHFA 1TVEA 5G4LA 1Z4JA 5EFOA 5L9AA 1KIAA 4C07A 3AFHA 3DAYA 3NEYA 1JG3A 2AOTA 1T2AA 2GX6A 2A9JA 4NZNA 2JCSA 3P4UA 2MSEB 2IP1A 4M21A 4DQUA 3TZBA 2GK4A 4LZJA 4A0RA 2P91A 3R0VA 1T8PA 3FLBA 1WB5A 1QGDA 3HYLA 1YO6A 4BNHA 5JYCA 3ZBUA 3DM5A 5L3SA 1EVYA 1TYBE 2W9XA 3FHTA 4YT8A 4F7WA 1WQ4A 2WVHA 2BKVA 3N0TA 4DYVA 3DVAB 5FQNA 5FWXA 3GJTA 4QUGA 3VAYA 1JJ7A 1RYMA 2GS9A 2P9JA 2D13A 1CUFA 3OA2A 3BJRA 3VVCA 1IJFA 2NYVA 4RVOA 4HSEA 1EVLA 3UMCA 4ZHQA 5KNCA 2BGLA 3N0WA 2QWXA 3DVRX 1NI4A 5BRNA 1H05A 4EATA 3OEHA 4GKKB 2LDBA 2YYZA 2HXGA 4MXDA 2PMEA 3IEUA 3IDOA 6GPBA 4ZEWA 2O2DA 2CGEA 4KXQA 2AZXA 3H8WA 3OX1A 2Q1XA 1C2YA 2OWDA 2Q5CA 4O4LB 1GYRA 4AJIA 5HSGA 4EG3A 4ZYUA 1PVOA 2M9MA 3I9KA 3G2JA 2C20A 3DSRA 3N76A 4WIAA 4ZO7A 1GRRA 1IEWA 1QFSA 5K0BA 1DG1G 4ZARA 1DXYA 3AOEC 2HSEA 4BFTA 4W5WA 5AKGA 3KCNA 1LLCA 5CGQB 1PEDA 1K4YA 3IAM1 2IOHA 4XI9A 2R66A 3L1KA 5TQ0A 4FOOA 2CV0A 2HHJA 2X0FA 1L1EA 3VKWA 2C7PA 2R1UA 2XV1A 1Y6FA 3EGXB 3GEIA 4B3XA 1FUYB 2B25A 2GK7A 2NO1A 1A5SB 4WDQA 2D1YA 1PTJA 4FE4A 4TTJA 3GZNA 4GRAA 4IJMA 4OYLA 1ZRMA 3H97A 4HPJB 4X8HA 1SKAA 2Z4SA 1CR4A 1QH0A 4KDFA 5DBIA 3QXCA 4E6EA 4PM4A 1XJ5A 1B23P 5A05A 4OVKA 2QAJA 3I6BA 5CPFA 5BN5A 3VDRA 4MVXA 4UM7A 3IPCA 3D4IA 3R5HA 5B55A 1LK7A 3I8OA 1FY2A 2Z83A 3NJ4A 2QN7A 1E66A 4ZT4A 3MJDA 3WYAA 1KRHA 4UTPA 2ZYAA 4QJ5A 4S35A 1EFPA 3HP1A 1I3NA 2ZIXB 3LZ6A 5AOVA 9LDTA 1YKFA 1NU6A 1XTUA 2ID8A 3DR3A 4NZPA 3MB8A 3IV7A 4ZPXA 5JLJA 3U6BA 4UARA 5ELLA 4OH7A 2ONYA 3OQVA 1H3EA 1JU4A 2ZI4A 3VR4H 1O6GA 4G5GA 1P6XA 2QSYA 2VA8A 3D9QX 2XUGA 3K5WA 1I5OA 2HO4A 3FNHA 3HL4A 4FZJA 2RJOA 4INPA 1HETA 4MUBA 3IVMA 2O1EA 4G9GA 5JZVA 3WIVA 4HVLA 4HGQA 4FB5A 1Z6PA 1PSZA 1ZNZA 4QDKA 2Z95A 3S44A 3A2NA 3IVCA 4BVHA 3STVA 1USUA 5ER9A 5ITSA 5C8YA 3L0DA 4HP8A 4U7GA 1FP2A 1UKBA 4DW8A 1GITA 3K92A 3ADPA 1SA0B 2UYCA 4Y2PA 2PR2A 1R10A 4E4RA 2PWYA 3WWDA 3TNLA 3L8ZA 5IEJA 1BFDA 3DLPX 4H60A 3B9BA 4PIMA 4Z8XA 1HNZB 4P81A 1SBCA 3MCWA 2I6UA 1ST3A 3O4RA 3VPBA 1KRWA 3EGEA 1ABEA 1R3DA 3W7AA 5CDYA 1HSOA 3ZWDA 1FU7A 3C5VA 2WQ7A 3F90A 1RJFA 3JD2A 4FE3A 1VMIA 1E9FA 4ZCIA 2R8XA 2FUCA 2GM4A 3AEUB 3AUKA 1FW8A 5C81A 4LMRA 3NIWA 4IYRA 3LD9A 4FTWA 1EBUA 2F1HA 3ANMA 3H9JA 4L2IB 4ZRNA 3R7SA 1RAHA 4QM7A 1NLZA 4J9UE 4MYCA 4FU0A 1Y6ZA 4PQRA 5EXXA 2W11A 1VA4A 4Q93A 3AL0C 1NI3A 1FMLA 2GRJA 2HQRA 3V1KA 3WLNA 1PSDA 4IDEA 3LP5A 3QVSA 4UVEA 4JV5B 3Q9SA 3X2SA 2FK7A 3ONWA 5H4GA 4EM6A 3IURA 1FX0A 1ORVA 1Z8FA 1EK6A 2LXNA 1KQPA 1XQYA 1CQJB 1Q2UA 3D64A 3DYBA 4HLQB 2B69A 3B36A 1ZCZA 2VF5X 1QS0B 5ILGA 5IP5A 4DLBA 3C3CA 1S3GA 4GX2A 2IZOA 3MHPA 5JNVA 3G5MA 3LBNA 3LLVA 5JH7F 3NGMA 2GK3A 1VPDA 3TTXA 2XR1A 4EENA 2UUAB 1WMEA 2J5BA 1ZOPA 2WD7A 4EITA 5A4MS 1KK2A 3K6KA 3JCZA 1ZZEA 1R6TA 3G0BA 5DIZA 4OYYA 2GLUA 2FR0A 3G02A 1RDFA 3EJ6A 2PUDA 2WJYA 3EBLA 3L8GA 2VOJA 4KXXA 4YFYA 2ZSUA 1U98A 3HBAA 1DG3A 1RWOA 1UOOA 3GA0A 4NULA 1A27A 3PF9A 1TRHA 3PXEA 4FFDA 1AQLA 2FHPA 2PG3A 3QVMA 3GP5A 1KERA 3FPBA 3BWBA 3HKBB 4PINA 1NQAO 4H7EA 1EG2A 1GTZA 4TKUA 1X0VA 1PGNA 3DC7A 3WK7A 2WR8A 3I9V1 5KNBD 4DIOA 5BVHB 4R2WA 1RYHA 1QCDA 1V6SA 2XCIA 1R8SA 4E2YA 3DZGA 3UEOA 2AI2A 4RHXA 2R4QA 4IKEA 5FOTA 3FX2A 3ENQA 3TUZC 3D4LA 1KYWA 2DEUA 4A0GA 5F7XA 1H2AS 2PEYA 4O1HA 5AQ1A 5KNBA 2ZTMA 2OG2A 2PTHA 2QTRA 4HRVA 1EVZA 4Q6WA 4DR2B 2FW8A 4DL9A 1PLJA 2JHGA 3C6YA 2R6AA 1DEKA 3LIIA 4DWJA 1VGVA 1LQTA 3HU5A 2A30A 5IKXA 5J1TB 1NJ6A 3KYCA 3QI2A 4QDJA 4RMHA 5IT9A 3H2SA 1RYYA 1OFIA 1JFLA 3A0UA 4C05A 1EEXB 3UJDA 4TLMB 1JKXA 2ZRAA 5C1PA 3W2GA 2X40A 2PBFA 1HBJA 4CUJA 3IP9A 3DOJA 1O5TA 1RC0A 5KTKA 2BGGA 1CUWA 4ZGBA 4RTJA 3EXHC 3Q3IA 5F78A 3KXPA 1E6LA 2DBRA 3VR2A 3QVUA 4NDAA 3I64A 4GQIA 1I1HA 4LMAA 2H1IA 1E2PA 5DTQA 3D4PA 1GL3A 3BSWA 4IOLA 3ME5A 3EDOA 1JYSA 3G0CA 2CYAA 3DYIA 2WHPA 1FSFA 5BRAA 2BR3A 1X1AA 4OLJA 1WXWA 3FCUB 1YOBA 5AJTA 1I51A 4Z7OB 4B47A 4PS1A 2GZSA 4H4EA 2Z8ZA 1B8UA 5TNXA 4DWVA 3JZFA 3UIEA 1N0UA 4KK3A 3KZVA 3ND9A 4BTLA 4XVQA 3S1SA 3IBYA 4HLDA 2REOA 4INOA 4EF5A 3LBYA 3MA0A 5F1YA 4CLRB 1P1HA 1JE0A 2QRVB 1IFXA 1ZRHA 4ML3A 4IV8A 3MTIA 3ZV6A 1Z2AA 2XHEA 3CF6R 3E5HA 4G56A 3W5SA 4DREA 1I2CA 3TXYA 4ZOLB 3CCBA 1B74A 1Y5LA 4IZIA 1UJMA 4YFVA 1KMCA 5TT0A 3B6KA 3OKCA 2BMEA 4MW7A 1IN8A 2RGNA 4IHJF 5L53A 5J23A 2Z5LA 3ZCRA 5KYKA 3Q8MA 3PDIA 4N48A 4IIJB 2XRYA 3UJAA 2OO7A 4AMVA 4HFNA 1PGJA 4IHKA 1TI7A 1Y8QB 2W6IA 2XEDA 3N07A 1DTWA 4UVGA 3C2QA 1OKKD 1ZC3A 2GETA 2WJWA 2ZYDA 5IC6A 1FS5A 1PK7A 1U3DA 4JIGA 2ODBA 1XKLA 2AK2A 1UXGA 2KSQA 3C5WP 4L0QA 2ONJA 2NSYA 1ZJZA 2X7XA 3I30X 4MV4A 3RROA 1QP0A 2FFAA 4MMZB 1FDTA 3V6MA 1CUGA 1TYZA 1WMBA 3SHWA 4B0OA 2I6QA 1NVVR 4HH1A 4I0WB 2QVYX 2AOVA 2HMYB 3N8DA 4TZKA 5BYJA 2PSSA 2BEJA 3OWOA 3FB1A 3GO4A 5MN6A 2IHUA 3NDPA 5JRDS 1XZGA 1NNEA 2VBFA 3FZNA 2WV7A 2IT1A 3ERCA 5DULA 4EEKA 4HDCA 3QQ5A 5A5FA 4DLTA 3HBJA 5F77A 2E6KA 2CNNA 2QB5A 2XEXA 3ASZA 4C0QC 1B8NA 3ZZNA 4GL2A 5DM4A 4ODIA 1W6RA 3EUFA 2VAWA 4AN4A 5AVQA 4AJNA 3HGMA 1XTKA 1WBDA 5M34A 1P5HA 3WC4A 2QY6A 1W34A 4U2BA 1L4BA 1KY5A 1R0LA 1BHO1 1Z5PA 2Q4BA 4MGIR 2XNJA 2ZJOA 5BOSB 1CZUA 3KQHA 2EYQA 4I55F 2QF7A 4ZVQA 3VZRA 5HW0A 1U1GA 1N9GA 3N87A 4OP1A 5B57C 1VSVA 4Z0HO 2COUA 1LPOA 5F7ZA 1FSSA 1G8PA 1SC3A 2A35A 1VE6A 1Z29A 1PZEA 1JFTA 1UANA 2Q7XA 2P65A 3VO1A 2PAAA 1SJ9A 2WWRA 3L43A 5FO0A 2DY0A 3VJRA 4I4CA 3HUDA 2WFAA 1BFKA 1XTTA 2OGSA 2CZQA 1SCDA 3CPSA 1MDFA 1MOPA 1TD1A 2G5GX 3DW3X 4FKMA 3TVYA 4YUZA 3E05A 4RGBA 1E1KA 4P80A 1WMSA 2ABWA 1ECBA 3JAKA 3V55A 2Q3DA 4YMWA 4AY6A 1EXVA 2IW3A 2XOKD 3TINA 4GX0A 3WGVA 4C4SA 5J2TF 2P9YA 3SBXA 4GUAA 4F9EA 1H23A 5HF8A 3HJAA 1V1JA 5CVDA 3WNDA 3WMWA 2GAOA 2MWMA 4QRIA 4AF8A 3VHXA 4YV2A 4OQLA 3VTAA 4EJMA 1Q0RA 1ICIA 3MCVA 1AKWA 1HT0A 4R6XA 1D8TA 4GZLA 4RCVA 3RRXA 4F6RA 3GEPA 3K3PA 1ZD8A 3LNCA 4X7BA 3NS7A 2P11A 5CYPA 4Q3BA 2FWAA 1V45E 3UC9A 4PO1A 2C9YA 5B1SA 5KX5F 4NL4H 1PJ2A 3HR8A 5FPSA 3OTOB 3NXKA 4BZPA 1E7WA 1L8XA 3K6RA 3QFHA 1UBUS 4MYRA 1QHGA 3KTDA 4HRYA 1TMYA 5AVJA 4BRSA 3LBIA 4K9PA 4DLVA 2JEZA 2IK8A 1ZESA 2EW2A 4B3DA 2QRNA 4H4CA 4OHRA 4E1BA 3V4RA 2VHEA 2ZUEA 3SFVA 1W88A 4UTVA 1YR2A 2W6PA 4X64B 4OXYA 4QOIA 5EL0A 4ENSA 3INGA 1M2HA 2HNAA 2O8FB 1GHTA 1F20A 4FMBB 1FDSA 5K0TA 4WBXC 2QDXA 4BKOA 3I6MA 1U11A 2YW2A 3ZVRA 3VBEA 1UCFA 2IPLA 4CMIA 5F2EA 2CLSA 1Q0HA 2B36A 1Z4QA 1LC3A 3M1IA 1VHJA 4D8VA 2E37A 2C31A 1AKUA 2C92A 2A33A 3SZRA 4MW9A 1DAFA 1L8AA 5DN6A 4V0LA 3KL2A 5G1PA 1U80A 1YVUA 3OEHD 3KTAA 2FMIA 2NAPA 4OGWA 4D9CA 5FJJA 2OK7A 2JAOA 2J33A 4UHFA 1IOLA 5JSYA 5KYYB 4MI1A 4EZBA 3NEPX 1H2HA 1JIJA 5JSUA 2Y68A 2P78A 5TQ0B 1A2BA 4IQ8A 2RJ3A 4PYKA 4BEJA 1RZUA 4NENB 2XADA 4JT2A 4KFTA 4ALJA 2PMFA 3PR2B 2IZ1A 2C3MA 1YGPA 2GAIA 3PFIA 1RRFA 4ZMBA 3DEHA 1FFWA 4MGHA 2F8MA 4X1KB 4ZIRA 5EKSA 5JY6A 4C7JA 1E2GA 2OVFA 5BWCA 4CM4A 2Q5LA 4CIXA 1B2RA 3GLFE 1HQYE 1P0CA 2WKSA 1FS6A 2I99A 5CAEB 5BNTA 4HDNA 4J4BA 3HKCA 2EZ9A 3G9ZA 5DOVA 2B7CA 4GM0A 1WOMA 4PLWA 1R0ZA 1DKMA 4PTYA 5EXTA 3DAGA 1ECCA 3C3WA 2GAAA 2WAYA 1H2FA 1FUKA 4YV7A 1EM6A 5B6PA 1DFHA 3L4EA 3FSGA 2AA3A 3H3XA 1XHLA 2G25A 4KN8A 1MG5A 1BGWA 3FHLA 3U3OA 3QEBZ 3HYSA 4QUEA 3SIPA 3WLAA 5BN4A 4ABYA 1EGQA 1Z0AA 2E9SA 4N40A 1WVGA 3DCYA 4BLWA 5LVAA 4UHBA 4TXNA 3SDSA 3N8KA 3SFTA 5ICEA 1ZVJA 3CMCO 3JVVA 4M0EA 3TSWA 1FP7A 4DLLA 4ETIA 2YINC 3LDAA 5E4FA 3CBQA 1OHHA 2F3PA 3E15A 4S1NA 5A9SB 5C8DA 4MHSA 4DCJA 5K4GA 1VM6A 3T06B 3SXJA 1M74A 3K09A 4WCFA 2DULA 2MSWA 2KE5A 4HJXA 5BYBA 4BMOB 4AECA 3NVMB 3KZNA 2B3DA 5D5HA 1E79A 2ODNA 1M2NA 3I52A 3SVLA 1N32B 4P38A 1K2VN 1OI3A 1U8XX 2AMYA 4AKEA 2HJGA 3O9VA 2CWWA 3EGIA 3BAZA 4JLKA 3OPYI 1POXA 1FTSA 4K2HA 4TRRA 5DBFA 5F76A 2GYWA 3MS4A 3MJEA 4QUAA 2EJCA 1NQWA 4N0MA 4KR3A 4NX2A 2WU8A 4AZTA 3TQIA 2JJYA 5A6SA 2HU8A 5AKLA 1M6VB 1YONA 4BV3A 4Z9FA 4DXAA 4NZOA 3SEQA 1H0SA 4BB9A 4WZAB 4LISA 3G8AA 1G6Q1 3NRCA 1AVTA 2GARA 2PFKA 1SIBE 2WP8J 1MB3A 1WB6A 3PUIA 2HF9A 2IYXA 1T0PA 1ZM9A 4BFYA 3D6HA 3VPXA 2GUWA 1SO8A 4CVNA 1JXAA 1H6AA 3EXG1 1L7OA 4PZYA 1MQSA 2UZ1B 4U2DA 2UKDA 4IG9A 4IXMA 2IFTA 5WRFA 3P5BA 4O4JB 2VDWB 4PGMA 4XFKA 3WIUA 3TF5A 1RWWA 2QW1A 1KJIA 2OV6A 3A1VA 5JO0A 4PIVA 1AGNA 1UBSB 4L28A 2R7MA 1M2OA 1LH0A 3VZPA 1VG1A 1KP3A 3ZXXA 3ONVA 4CR8A 4EABA 3BRSA 1QAOA 2HMAA 1H0HA 4PG8A 3CVYA 3RSCA 4XGIA 1JX6A 4D02A 1YIDA 1YIAA 2V7EA 3P32A 2G17A 4Q9DA 3WDMA 2BCJQ 3A9WA 2FOXA 2ZYUX 1W4BA 3BUSA 5I5EA 3KQQA 5BQPA 4GE3A 4R9SA 1F1BA 4H7KA 5KSPA 1C3JA 1XALA 1QIHA 3FRJA 5A3VA 3SE7A 3B1VA 1LX7A 4TTPA 3UHPA 1CY0A 3C85A 4DR7B 2O14A 1VRWA 2D8MA 3BE6A 2Z6UA 3PU6A 3K0SA 2IXTA 1JIKA 1BJRE 3D0QA 1KR5A 4JDPA 2V1UA 4CMHA 2HA2A 1RKXA 4R84A 4TOIA 5ERGB 3HM9A 2DLDA 3MT0A 1MAUA 1NXOA 4JI7B 1RQ2A 3LHSA 5EERA 5DB4A 4BNYA 3U7IA 3FGPA 1W5FA 1TM7E 5JDCC 1VZ3A 3TOSA 4BNZA 3AGQA 5IFLA 1WXIA 3CINA 3AFOA 1ZM7A 1EINA 4FYHA 1HYQA 4WK4B 4RIHA 4ZI7B 2ZRGA 4NYJQ 1E2NA 3MTDA 1M0WA 5H8WA 1Z06A 3D0RA 4JFAA 5EP3A 2O54A 2UAGA 3AU8A 5FAKA 1AUPA 1CNEA 2WM2A 1FP4B 3OQIB 4N3CA 4H7JA 4YJGB 4DR1B 1U8YA 2XVMA 1MQAA 4OQYA 3ZBTA 3W3AH 1Z6AA 3L0SA 4Q02A 5CXXA 4M0MA 4BFZA 3W04A 1UBJS 4J0HA 3V2GA 3WHKA 1I6LA 2PL5A 2CUZA 3AVOA 4TKVA 3UBTA 1JEAA 5A1JA 4IXDA 3HVIA 1ECFA 3CVOA 3HHPA 1T1RA 3LUBA 1Z8HA 1JSLA 2R2AA 1TUGA 3ZHQA 3ZJUA 5DNCA 4CMAA 3R0QA 4MAFA 1PZGA 1M8JA 5F1KA 2VDWA 4GPTA 2ZDHA 2YBEA 2QLMA 4F2PA 3LXXA 3D4NA 2ZETA 1B73A 5JDIA 4YDHB 1W96A 4F93B 2CMHA 3W5JA 1V47A 1JDVA 1DWOA 4HN9A 1QCCA 1WKBA 5CNKA 5DPMA 3S2IA 4B6RA 1RZ3A 4DLPA 5C1BA 3LW8A 4KQ2A 2M6RA 3EVGA 4QT0A 1SVKA 2XY4A 2DP4E 1CV2A 1E9BA 1ORTA 1ZRSA 1J33A 1X7HA 3QBEA 4IDNA 2WYIA 4MUJA 3WFIA 4E09A 4QOHA 4NCAA 1CRPA 3QZUA 1QGAA 1A9YA 3F46A 4ZOEA 4XRRA 1GNPA 4B81A 1SVSA 1Q20A 4X8LA 4W9MC 3KE9A 1ZYUA 2FQQA 2O06A 4K6HA 4Y6RA 4ZJZA 3I01M 1X1DA 1KPGA 3IULA 1QLWA 1W9HA 1UZMA 4PG6A 4PWZA 5B53A 2O0HA 2ZVPX 4OQXA 3AIMA 4XE5A 2FFBA 1ISRA 4L5BA 3ROQA 1IHXA 3A6GA 2BHLA 3IIIA 3K0FB 2OO3A 3D81A 2BFPA 4RY9A 3ITNA 4YCJA 4LNUB 1FDVA 3CT4A 2X7HA 3C6MA 3AEKA 4GPZA 3WRYC 5GJWC 1FFXB 1S5PA 3PICA 2WHQA 3AR6A 3OCXA 3AHJA 4PWYA 2CDRA 1M5RA 2W6CX 5AK3A 1PG2A 1TTHA 3NWPA 3N3AC 3OC6A 4YC7A 3VV2A 4DMCA 4ZI7A 1W5BA 2H06A 1E0KA 3OQMA 4DG9A 2AI3A 1T2DA 1DRUA 2H1VA 2J3KA 2VWQA 1GTMA 5CT5A 1MG0A 1XVUA 1R6VA 2R48A 3GCWA 3UUEA 5LQAA 1F4LA 3CG0A 4F4CA 5J4HA 1RQGA 1MH9A 2CE2X 2YJ6A 4P53A 4DLUA 4PC3A 3EXG2 3STWA 4RWZA 1TYCA 2I8LA 3KD3A 4MV8A 3C7KA 1GN8A 4RGQA 4ROTA 4ZCPA 2H6EA 2J6HA 3OZBA 5HILA 3K9GA 3V4SA 3IKJA 4IQFA 2MSKA 2ZTSA 4DCVA 2Q4OA 1OLUB 4UTNA 4MGZR 1F0KA 4RTSA 1ZGAA 3FKSD 2XUAA 1I6KA 2XMPA 3AIIA 3OICA 3L8FA 5CW2A 2XNCA 3A4NA 5I9BA 2ZB2A 2ADOA 2HCTA 3VKFA 4LYHA 3IKMB 1I0ZA 2XYVA 1MZVA 1DOAA 4H7PA 3NBUA 1COWD 4L9SA 5JWHA 4OGLA 1RABA 1IVNA 1DZIA 2ID7A 1SBTA 3T5TA 2JL1A 2BH9A 1KC3A 2J07A 4QQNA 4NG5A 4S24A 1JU3A 4JJEA 3PDHA 1XRNA 2WM9B 1PVDA 5FOSA 1G3IA 4BJ5A 2OAEA 4GXNA 4CI9A 4ZOBA 4O8ZA 2CXQA 1QPGA 4IDGA 4URXR 5AW1A 5C37A 1NXPA 3ZS9A 1KQFA 4LFAB 3DD5A 2PSJA 2M2IA 1PL8A 4P5PA 3L0OA 4QJBA 2QK4A 2WD8A 3D7LA 3ZJVA 1EUDB 2AEMA 1C3LA 2QRHA 3EMBA 5B3KA 1N5OX 4TSKA 1HE8B 2C8KA 2J9FA 3RYCB 4DV1B 4EKIA 1IZ9A 1OBVA 4NSNA 3CT6A 2ESRA 2J3EA 5EYPB 4ZRMA 3IA7A 3U5TA 4BRWA 5BSEA 2V7XA 4ABTA 3ABQB 5DXJA 2IH2A 4HGRA 5ESXA 1JEYB 4MZXA 1QQ7A 1G8FA 2DAPA 4NHEA 5CVTA 5JH7A 1ETHA 1HE1C 4I55B 4NRDA 1LCIA 2V8BA 3PNSA 4FFOA 4E4YA 1UJ4A 5JLAA 1EA7A 3CF2A 1XNQB 2OHJA 1SOVA 2EFDB 1KI9A 3RAEC 1CW2B 1OPXA 4P83A 3W5DA 2O2GA 3MRXA 3KUKA 2UVQA 5CFPA 5FOQA 3REFA 4FNGA 1JNYA 3MIZA 4QPPA 4HNAA 3THSA 1XBTA 2BDTA 4CIAA 1KO8A 4GX5A 4N6GA 4XM2A 1BSVA 2RAFA 1L7DA 1P1RA 1WP9A 1J42A 5D51S 5DTMA 2D3TA 1NMZA 2DT8A 3BF7A 5DI9A 4C6TA 1YK1A 5AM3A 5CB6A 2E55A 2PAFA 3PPVA 2O59A 1Z6ZA 3CLHA 4OF4A 4H1TA 1ZGHA 1VIVA 3LIPA 4RKYA 2BLLA 4ZQEA 3D8BA 1A7KA 3DTNA 3QPVA 1YQDA 4HWSA 2CV1A 2IH5A 1Z73A 2G63A 1K6JA 2VHYA 5K7SA 1BH2A 3U2QA 3PFNA 1FXWF 1NASA 1MV8A 2VUHB 2FF5A 4KXYA 1A5AB 1GJRA 3K20A 3T8YA 4EYOA 5L4SA 2WWTA 4A8JB 4BFSA 4LDQA 4U3JB 4UUPA 3HL0A 1FQOA 3RVRA 3VR6H 1CHDA 1Y3DE 1H5NA 4UXJA 1ECLA 3OCJA 5BNFA 4NYMR 3EX7C 1P8JA 5C3UA 3DMHA 4QTXA 2C7OA 3SLGA 1T3GA 1PEYA 4IFIA 3IR6A 1AXEA 2DBQA 3RVQA 1KZ1A 2XOKA 5TF0A 1X92A 4L0MA 2BKEA 1JR3E 2VAVA 3JYHA 3TSAA 1KYZA 2VTVA 2XKKA 1A8PA 4KVFA 3CZCA 3DDSA 2ZBUA 3WRXC 1QF9A 1RFGE 5HZKA 4BQPA 3JWIA 1Q19A 4WXEA 2QRVA 2Z5GA 1Z5WA 1WUYA 1UZLA 2L0XA 4A0FA 1YRAA 1TKAA 1V2GA 2BLNA 3PQ4A 4KQJA 4JVNA 4JHLA 2I4MA 4HB2A 2O5RA 5AW2A 2VDRB 5ARCA 2J5RA 3N0XA 2IL1A 4KAJA 5TVKA 3JR3A 1Z5NA 3K9NA 1EUZA 3QYPA 1ZGZA 4AULA 2OKGA 2X5KO 2FPLA 2CZCA 4FWTA 3FCXA 3F3KA 2Q6LA 1V5WA 1NP6A 5D5QA 5IM4A 3L6BA 2FN4A 3M3DA 3W5UA 4J7AA 2EKZA 2WJJA 4B3BA 3PP8A 1A9XA 4BMCA 4YPOA 3LX6A 3P9KA 2C3YA 3GAAA 4JYBA 4NEGA 1IAVA 5TQJA 2IUUA 4BNMA 1YS2X 3E22B 4LKRA 1QLHA 4BVAA 3CEMA 2DQKA 3NHAA 4JCCA 2PKYX 1EVKA 2V58A 4BLQA 3GLVA 2OHHA 2PSEA 1MC5A 4J49A 4RMJA 2HQSA 1LDNA 5ERXA 4TTRA 1AKNA 1ZJWA 1L5FA 2VTEA 4ZV7A 5J58A 3FZEA 5ARDA 1YOVA 3DOHA 3T5AA 1N3LA 1VL2A 3M4XA 1J8YF 1MIHA 3EEYA 1S2NA 1E2BA 3H4VA 1U3CA 2GNPA 3B60A 1W44A 2H5EA 4PLZA 5B3LA 5JZOA 2G0TA 3EDQA 1T91A 1G7CA 2QN8A 4BJHB 4YDQA 2JAHA 2RE8A 4E46A 4NJEB 4ECEA 2NYUA 2OILA 1EVJA 3WQRA 3COJA 2RGRA 4PAQA 1N5DA 4K6OA 4XWYA 2G09A 4C08A 3H0KA 1JEQA 1HWYA 1X13A 4RZSA 3NM6B 5EHZA 1TKBA 2P0AA 3AHGA 1GPUA 1Q91A 1VIDA 2PD6A 3ZDQA 4AI6A 5HG0A 1PR1A 3BXEA 4OTZA 4R31A 3RF7A 2DHEA 4JB0A 1G66A 4RL4A 4Q4JA 5DRTA 1PD0A 2ENWA 2FZGA 3QKIA 3WK9A 2DQSA 1OYOA 3HCCA 4G5QA 4AUKA 3ZWWA 4WH0A 1T13A 2IOFK 3A31A 3K1JA 4FGSA 4FGZA 1I3LA 1UXIA 3F5DA 2MTBA 3C7AA 1OA0A 3DDZX 4KODA 1T35A 2O6HA 1RI2A 4POAA 2V8OA 4WY8A 5L40A 1CJKC 3C3KA 3UGJA 1XAGA 4J16A 4NPAA 2OFFA 2OE2A 4HNHA 2IUYA 5FTMA 3A06A 1WCIB 1XVLA 3OFVA 5EAIA 3DE4X 3TPFA 3WYBA 3ZWBA 2OB2A 3CCFA 3H11A 2HFKA 3X3HA 3I05A 3PXGA 4G1BA 3TMYA 2GPJA 4MPPA 4CYMA 3TG2A 4LJKA 5E2AA 5BV2P 3HCRA 4KJZA 5CX1A 3DLBA 1RKUA 1G9SA 1YZHA 3IBTA 3SE0A 3IVAA 4HTFB 5JJLA 1FE8A 4QYSA 2NU6B 4D3SA 1QHYA 4EQ6A 1KMIY 2BFWA 1OA1A 2XUZA 1Z37A 3DW1X 5CD9A 2H7XA 1KORA 1XCBA 1S2DA 3WK4A 1PKXA 3NP9A 1FB5A 1Z0KA 1Z9BA 4IUDS 3R20A 4FKBA 1TPZA 5LBTA 3OZSA 4RIIA 3TZ6A 1DQZA 2IYLD 1BDBA 3GI1A 4RF2A 3VNQA 4GOKA 4MCIA 2EV9A 2IJGX 2FRDA 1QYDA 2PD4A 4II7A 4D3ZA 3M7IA 4XIYA 4JFRA 1E9DA 1QUEA 1Z75A 1G8SA 5DHFA 4LF7B 2XOXA 3N8HA 4G8DA 4CEIA 3FJ1A 1KDTA 4XX0A 3WBBA 5I7SA 3WYEA 4Q34A 4G24A 1H4SA 2BUCA 1RAIA 5T4EA 1GPMA 4MTLA 5DNWA 4EG8A 4P7FA 3O8RA 4YI3A 4IKPA 1SKMA 2QTZA 1GZHB 3F6BX 4WV3A 1UOEA 1QBGA 3EMKA 4IG4A 1TQ8A 4UQOA 5BMOA 1WKVA 1G9XA 3PQ7A 3FR8A 1IY0A 1IDOA 3DS8A 4IQ0A 4CMEA 3DBLB 3FCYA 2QLNA 3J7AC 1DRJA 1ABFA 1V43A 1MNAA 3NC0C 3O3CA 2FKAA 3TYXA 1U3FA 4F2DA 3GLIA 3U4QA 1BW9A 4P8RA 1OBCA 1SWWA 1JVSA 1YKGA 3GT4A 4MH0R 4H0NA 2D06A 1A72A 5EWJA 1UPAA 1PFUA 4TZ6A 3PQ2A 4DV4B 2HCFA 5K3DA 2DUMA 3EFOB 3KELA 5T41A 4F8EA 5REQB 4UZSA 3WGOA 1ZD2P 2KS6A 3T0FA 1QU3A 4ZOCA 2XVXA 3JASA 4G65A 3T4EA 2JIRA 5KTPA 5B3JA 1IIRA 5KVAA 2RIRA 3O92A 2HW8A 1R6AA 2H29A 5TPZD 1FMFA 1Z6YA 2BC9A 5D7BA 2DG2A 2AG0A 2DBZA 1UEIA 3PLRA 2FPUA 2OHFA 3MTEA 3D6UA 2ODAA 2V3WA 3AM3A 4NAHA 1THMA 3UXHA 1L5VA 4R8MA 1ZI6A 5IG2A 1RM5A 3BMQB 2QL6A 4FWIB 1E62A 1R4MB 3FBWA 2GJKA 3MMPA 5TS3A 3IV9A 4MVJE 4RAOA 3RC7A 2TRSB 3C15C 4Q7KA 5DYGA 5LOVF 5FLYA 5BOVA 3HDYA 4OKNA 4BMSA 5DN6D 4EYEA 5EMLA 3X0DA 4CCWA 2AOTB 4H6PA 3LUKA 5F4ZA 5DYWA 3TO5A 5ARBA 1VZ2A 4XQGA 4CKYA 1QHXA 4PZEA 2VJKA 1DC5A 2HTFA 2QXYA 2VH5R 1L5LA 5MGNA 2AG1A 4BFLA 1QGUA 4HAXA 2O8DA 3MWDB 2QTGA 3PI6A 3WJ7A 4F85A 5HE9A 3HWX1 2PH5A 1ESNA 2HU2A 5BV8A 2UZAA 4W6QA 3LP6A 5K3OA 5F2OA 2X5OA 3GLHB 1NQ5A 4PANA 3KOMA 1N2JA 2XWQA 2V4MA 1LDYA 1D1QA 4I46A 3SN6A 4DIFA 1N7IA 1O4VA 4KOEC 4F6LA 2FPSA 4IH9A 2CFIA 3JWEA 4WK6A 1XAJA 1I4OA 1G7TA 4DJDC 1C9DB 1ZNYA 2O2HA 3O93A 1B2LA 2JW5A 1RYBA 2OGZA 3PWTA 1X1TA 4MVJG 1B8PA 3G82C 4UCQA 5IJ9A 3L01A 3PR1A 4YBRA 3U7FB 5BR7A 2BEWA 2NSHA 4BZXA 2VR1A 2ACWA 4ER3A 1P1BA 3NASA 4IICA 3L7KA 3N2GA 4EYQA 4M0FA 3E53A 4W6ZA 4CQLA 3PENA 3JATB 1UK6A 2BM1A 3VYTB 1GNRA 4MJXA 5JIBA 2AMFA 4F3RA 1SEPA 1F12A 2AN1A 3E2IA 1FFGA 3OZUA 3K35A 3M6VA 2VJMB 1BG6A 1N9GB 2BKLA 2ZK7A 3ELYA 4KCGA 4OY3A 1IZZA 5EZYA 4ZU3A 1Z8NA 5JAHA 1U8CB 1VYTA 1JQ3A 3PNQA 2P9TA 1C4OA 4IJVA 2ZB7A 3H05A 1YZGA 3LS2A 3DTVD 2AVNA 1ETUA 2CW5A 4GVLA 4AZWA 2MJLA 3C74A 2F9MA 2CSXA 1KTVA 3VNUA 1WD5A 3ZCVA 2AX3A 2RHBA 2ZRMA 3TKLA 1YQEA 3X43A 1JS1X 5HCIA 2D0OB 2LZ0A 5SYMA 4BPRA 5I9IA 5BXYA 1RFLA 1A88A 2A5YB 2Z3ZA 2MINB 5FTKA 5GMOA 4XDGA 1RKQA 1VJ5A 3K4QA 5GPBA 5IPFA 3DONA 3U3ZA 5JALA 3BBPA 1LBEA 3JR7A 1KZHA 5D86A 2WMYA 3IOEA 3OJOA 5L95A 1H22A 1BXRA 3UHJA 1RLOA 2WBLC 3F5QA 4AN1A 2EBUA 1ULZA 3M83A 2QMYA 2FJPA 4U7DA 1RZRA 1JMVA 5IF3A 4EHIA 4MS4B 3DO5A 5E0KB 1DXHA 2P4SA 3RTAA 3N9IA 3U80A 4XJTA 1LSJA 5LP6F 1IY1A 2POQX 5F3WB 5T8KA 5EKUA 1UM9A 5FOWA 4YQEA 1SUIA 1QR6A 3LCMA 1MJNA 2XXAA 2V98A 2Q50A 2CV2A 2N47A 3C3XA 1CEYA 2ZEJA 4IL5A 7ABPA 1G21E 1VPWA 3DL4A 3DCIA 4MGEA 4YCMA 3PTAA 1QYVA 4FZVA 4DUPA 1JFFB 3H7IA 2IU3A 2ATCA 2XZPA 1Z74A 4WOJA 2GD2A 1R0CA 3DMFA 5KPJA 1NYTA 4JQYA 1U28C 1YQWA 1G5HA 3PQ6A 3EZ7A 2BEUB 4W1RA 3TD2A 3V4PB 3R5JA 4EWLA 4HAUA 1SOUA 5L6LB 4FB4A 3P9RA 4FYXA 3U48A 2P62A 3KVRA 1IK6A 5SY4A 3VC3A 3T1OA 2XOEA 2RB4A 3B2EA 2M1ZA 3H5RA 4FFBA 1P45A 4MDHA 3WI7A 1E63A 3RIXA 4B82A 2QPTA 2ASEA 3UGKA 3D8SA 3HVKA 1YRWA 4MP8A 4Y1RB 3C4VA 2VJPA 4UM5A 3NT5A 1CUUA 4LY0A 1YK0A 4IV0A 2E4WA 1RM0A 2JEYA 3QSGA 1G6HA 1ESZA 2QTNA 3ZPXA 2NUAB 4K28A 2Y6VA 2PX8A 4UTXA 2EHJA 5EXEA 4BAZA 1A9TA 2GYVA 2WTBA 3W6OA 3GEEA 4KXMA 5I7FA 3RU7A 3UMVA 2VNSA 2V5UA 3QTBA 3OY7A 5EP2A 3GH3A 2G72A 1N25A 1R8XA 2OL4A 2GXSA 4M76B 4FYVA 1OH6A 3OLYA 2BFDA 2EBHX 1YVEI 1U0EA 3EZXA 3OUZA 3OEEA 4TZTA 4BGEA 4N1AA 1W59A 1PL7A 4IS3A 1ISMA 4J7CA 4Y2JA 4N5NA 3NDIA 1D2MA 5AUQA 3UMFA 3GT0A 1WY5A 4MUFA 4N0PA 1XEWX 1ZG3A 5U4QA 3W6NA 4EGCB 3KL4A 3ZXIA 1ML4A 1ULUA 1WQ1R 2FWMX 4M1QA 2WABA 1LW6E 3CH5A 1QKKA 3SXUB 2B1QA 1HEUA 3IKVA 4EIWA 2PLAA 5KOIA 1GR1A 2ZQZA 1X80B 3URKA 3DE6X 4DBVO 1P33A 3ZE9A 5JANA 4C14A 3KEMA 4M9ZA 2J6BA 5TGDA 1KFBB 4XGQA 4NCNA 4V0QA 3I04M 4KK4A 4Q47A 4HWRA 4JT4A 2QMQA 3F96A 3HWWA 5NLLA 2OBBA 2VHUA 4RFLA 3CLSD 4JU9A 3HXQA 5E3JA 3C14C 3KLBA 1UDBA 3CWCA 4I36A 2ZM6B 2CFOA 1FYDA 2MYTA 2VDLB 3ZH2A 3OCVA 4V1CB 3BJZA 3WMXA 4DAEA 4KV7A 4ZALA 1DHRA 3GJ8A 3BL6A 3TDMA 1T9HA 4ZC8A 2A9KA 4QDOA 2HDNB 3RWMB 2PNJA 2A0KA 2QMHA 4TV9F 4W1PA 4DV3B 1DRKA 1EHYA 1FQJA 3W06A 1E4OA 2IXFA 2NVUA 5AJHA 4B4OA 2C2KA 4IS2A 1ZIYA 1UWCA 1WP4A 4BBZA 1J99A 4BAUA 2AXPA 2XD9A 3LDFA 5ALNA 4D3XA 1TCAA 4YCDA 1FYWA 2C78A 3MYRA 3S68A 5BV0A 3WWOA 1LBSA 1IMJA 2X1VA 4BO8A 3PZBA 4U00A 3UUGA 5L7TA 2FSIA 1IN7A 2K7FA 1D5WA 1UXHA 1XU9A 1Y6JA 1DRWA 2QSZA 5KNDA 2VUTA 1OH8A 2IXDA 3H3FA 1J6UA 3GDHA 4BMDA 2JGJA 4UUOA 1II8A 4TS4A 3HI4A 3L1JA 3DC2A 4X90A 5AJVB 4AB1A 3TOVA 4ASUD 4FVTA 3IESA 1RJDA 4HCJA 2B7LA 1I3OA 3KR1A 1AGXA 1XJQA 3WB1A 3A2KA 1A4XA 2OFXA 2R5WA 4BLVA 3IPRA 4U9HS 2WSSA 3HC7A 3R8XA 4AJPA 1XTJA 2GFQA 3KV3O 4MVJF 3SSOA 2BSQA 5K3FA 4UEOA 2A1TR 3DKRA 4KDCA 4RL6A 4Z49A 1SCIA 1JWBB 2K7ZA 1E6EA 1R9GA 3M9LA 2IF2A 3A7EA 1T2FA 3A4LA 4ZIRB 4EPTA 3CR8A 3N75A 2WJIA 4GPIB 5FBKA 2A8YA 3MMZA 4P3PA 2YDYA 2PZGA 3GJZA 3H4TA 3Q41A 3QUQA 4S1WA 5LQMA 1AGPA 3IALA 4YWJA 3PNVA 2HMTA 4XPIA 3LY9A 3W9BA 4BN4A 4EDHA 3FYUB 1JYFA 2GOYA 5COBA 5AHWA 1F2VA 1Y3HA 3IVGA 1JA1A 5FEMA 1NWHA 2G9RA 3KDSE 4C0SA 2GM9A 1U0LA 1N6PA 4I4NA 4JNCA 3WADA 2H2WA 3FCAA 2QRMA 5TVGA 2FX5A 3DLIA 5CW1A 2JI4A 3BQ9A 3DVAA 3QPCA 5F9MA 2V6GA 5AVKA 3CEJA 3SDZA 4DLWA 4WERA 1PGPA 1C9YA 3DE0X 4TWBA 2X22A 3QE0A 4LOAA 2ZWAA 2QQFA 2RHRA 2V4ZA 3EPHA 2X76A 3U3RA 3NTQA 3T5BA 2C84A 2H4FA 1G60A 2XNDD 1BMTA 3ZBPA 2V7UA 2Y1EA 4G63A 1HTTA 1QMGA 1PFQA 3WA7A 3P9ZA 3O2SB 5FV7A 2KB0A 4KPGA 5LU9A 5AKEA 1TLFA 2IYAA 1Z5OA 4P4LA 1TJPB 2WVGA 4DVGA 1PJ8A 4RPHA 2W2MA 2XUOA 1JQEA 5KYXA 5ER6A 4CNQA 2ZUCA 1ADFA 1J2JA 2E21A 1U2TA 1UMKA 2JBAA 3EC2A 1OVMA 3QELA 4JJ8A 3RE1A 4ZYWA 3IUJA 3OJEA 4ADSG 4FIZA 5G1NA 3VKGA 3EN0A 3R3HA 1DVRA 5L3RA 4YR9A 2GVZC 2KPOA 4CM5A 3ZHTA 3DCJA 2Q28A 2CFRA 2I8AA 3F5SA 3NBQA 3T95A 4HQKA 5FTWA 3EEBA 3S70A 5FBHA 4B2IA 1PV4A 1SOAA 4CQMD 4YONB 2HSWA 3HXKA 4TMVA 2AS0A 4GI5A 1G21B 2A0FA 2WKQA 5DV9A 2UVPA 3ISJA 3DOEA 3QY0A 3R9XB 2J32A 3WLOA 4KPEC 3HR4A 3AY0A 3GLKA 1Z2OX 4Q1BA 1N2SA 4IIDA 1K5DA 3A4VA 3JY6A 4EHAA 5JECA 1P19A 821PA 5LB2A 4MR9A 3QF4B 2DFTA 2HV9A 4EX6A 3QBVA 1ESDA 3BA1A 3Q3CA 4PLHA 2OESA 3V3KA 2VRCD 5DXAA 3GP8A 1YASA 2VP0A 3VHQA 3WL5A 2H4ZA 4BQQA 1K98A 3ER6A 4DQLA 6LDHA 3QKSB 1QG2A 4QA9A 5HFAA 1CJUC 3T3NA 1UXKA 5CLLA 2Z58A 4P31A 5A9TA 4C3VA 4C7VA 3H3JA 2PGOA 3WIEA 4B71A 1GGHA 4A6PA 1CSEE 2PKWA 3OKFA 3QW2A 5J2UF 2B92A 4ZRDA 2V97A 2YXNA 1FBTA 3EEIA 1ZN8A 4I1RA 1UFOA 2BGUA 4J90A 3ROZA 2HBZA 3L6CA 3T7JA 4B3HA 2H1RA 1ZJJA 3ENZA 1SZPA 3KUXA 3OY2A 4KSYA 2HDWA 3B9QA 4YT4A 3SKYA 1U63A 1RE0A 4HWOA 2X8WA 1SBIA 2B4RO 4I9FA 3HEBA 4INAA 5ITWA 4AP6A 4AKSA 5IN4A 2YY5A 3B6MA 2Z56A 4XDYA 3ZZUA 3AOEA 3GHHA 3GJ3A 2RC6A 5DLEA 3RBVA 2PL1A 4DDWA 1V8BA 3UA4A 2GLXA 2PHZA 3A0RB 2XT6A 3KOWA 4HZUA 3RF6A 5J5CA 3TRIA 2BELA 2IIBA 4XB2A 1OV4A 4XM0A 1WL8A 1DAIA 1SCUB 2WM8A 2OV1A 3QUCA 1EB8A 4JBHA 1KJ9A 2XUFA 3DWIA 3ZJ4A 1EDDA 3HY6A 2C7QA 2YV5A 2FLWA 2QPLA 2QKYA 3OC0A 4OQFA 4DIEA 1OB5A 3K6SB 1QRUA 2MYUA 2FTKE 2IOQA 1NOJA 3IIMA 3DQQA 2LBPA 3I42A 4JVSB 2RBEA 1EE2A 1NV9A 1ENZA 2O7SA 2ZT8A 2XDWA 3DLCA 4G4IA 3W3AA 4MKIA 3UF0A 1HZJA 2YXPX 1P2SA 4QFBA 2CLOB 4PYQA 3NR2A 3UAVA 3UUFA 1MEEA 3SCZA 1W0KA 5KSWB 3ML1A 1Y7HA 2R6DA 3WRXA 3LQ2A 4HXEB 3ANYB 5EKDA 3A70A 1SUCA 4ILEA 1J1ZA 2BGTA 3AHFA 3ECSA 4EPWA 2WIFA 4BP8A 1TM1E 4PYOA 2IHKA 4QREA 5IK2A 5KTRA 2CD9A 1T4CA 2D2IA 3ABZA 5FL7D 5LQJA 3SI7A 4Z3OA 2QUIA 2R8OA 4HYTA 3PHCA 8GPBA 1T2NA 3ROFA 1ZGGA 1QP7A 5JPIA 2EDCA 1P29A 1R0KA 3QKTA 1XQXA 4JC5A 4B6OA 2H52A 5JAZA 1Q5PA 2AL7A 1NKTA 2QP4A 3JYNA 4MYUA 2IU0A 3RRBA 2P9GA 5A62A 2GPWA 3QIAA 5ALIA 4M1ZA 3ZUGA 4AKHA 1RLUA 2RHCA 4UE3S 2DHCA 3R0JA 3ETDA 3KVYA 3FTFA 4H7FA 3OIGA 4I1IA 2WJPA 2PMCA 4TROA 5DMXA 4QXPA 1KI3A 3RODA 3THOA 2YFQA 3KYJB 3II6X 3OU2A 3Q7RA 1W4CA 3BE8A 5E1BA 3W1EA 4ZZ3A 1D1PA 4LKOA 1OFTA 5IULC 4WZBB 4QSHA 1Z2EA 1P7PA 2HLDD 3HY4A 4V0KA 4YDSA 5UKDA 2WD7B 2NTYC 1UMBA 2BI7A 3ELUA 3CX6A 3RTCA 1P2VA 1KL7A 1FS4A 4OGFA 3A58B 4JC4A 1GPYA 1T8SA 2MR5A 2OGTA 1X87A 3R2JA 1R8JA 2ZQ5A 3OX2A 3R6WA 4R3WA 5EA2A 5LD2C 1M2EA 2HNBA 3OP1A 2W7TA 3G8DA 2O48X 1Z4KA 2QENA 2G9ZA 4B7XA 4RPLA 4B2YA 2O5VA 1TAGA 2I1QA 5CM8B 1V3VA 3AM5A 1GPNA 2QGFA 3KPVA 1REQB 4JOSA 2QJWA 3L8CA 3WFJA 5CG2A 1P5FA 5TPWB 1JAZA 2XDQB 1CQXA 4EB8A 1WABA 3P45A 2R97A 2C3PA 4U9IS 3UKDA 3WGKA 1BN6A 3ILYA 1V11A 1YBAA 1YZNA 4GI7A 5JY1A 2ACKA 4WZAE 4ENQA 1ORHA 2A0XA 4WT7A 2CXNA 3FRHA 3F7NA 2PUWA 4JP2A 1VFNA 1PQWA 4ARZA 4RTLA 3O26A 4L85A 4FSHA 2YRWA 1I24A 4HYYA 3HXOA 1GL9B 4W7HA 2OHXA 2O4UX 2FG5A 4F1KA 4DARA 5CH3A 3K0HA 2XF8A 1S4QA 1SRQA 2EVWX 3DL2A 3TUIC 3P2OA 1LZKA 1WG8A 4N54A 2BEVA 4LJ9A 1OTYA 3INRA 3ZVLA 3R5FA 4RS4A 4ZQFA 1ANKA 3LBHA 5EE3A 2W58A 4DUGD 5IU6A 1HLPA 4D46A 4YP1A 3UYLA 7YASA 5LLTA 2I66A 2R6ZA 2B9VA 1TOAA 3EFBA 4GBGA 1DBIA 1UBMS 1UT5A 1Z7BA 3SIRA 4ZTUB 1SZCA 1NUUA 4KVZA 1NATA 3JQDA 4HWGA 4AXXA 2BYTA 3L0IB 1B3BA 4DF3A 3O94A 4TMKA 4AKTA 4EEXA 3O1LA 5E9WA 2PO5A 4FNOA 3DCNA 4HUJA 3A3YA 3O74A 2FFJA 2NV0A 4ZYVA 2J46A 1JAYA 1SKBA 5AXCA 3TW0A 1RJEA 1QTQA 4KQFA 3CLTC 4PSCA 2PUAA 3JASB 1XA0A 3OZFA 2UZ1A 3A6KA 4EB6A 3QOWA 4ZVSA 4GOJA 2HR1A 1XROA 1ST2A 4N5MA 5BV7A 4KWIA 4CODB 5CLGA 4ENTA 2EGHA 1DAMA 2HMSA 3SJUA 2VK1A 2RHGB 2WU4A 5BN5B 2C58A 4U5XA 3L7IA 3QEMB 4FINA 4JUFA 4NE7A 3QEJA 4L4SA 3ZQKA 5JPDA 3GLIE 4FDAA 3T9CA 4DA6A 5EIFA 5C31A 2YJNA 4LW8A 1LPAB 3I9JA 5DCUA 2DTDA 1NGSA 2YRFA 1I5RA 4IOJA 4GZ6A 5K8VA 2C2GA 1DELA 1NN5A 2QTVA 3RYHA 4D3FA 5A4DA 2V65A 3I3OA 4JR2A 3PL5A 3L2OB 4AURA 2OCKA 4OI2A 3SIXA 3AB3A 4F3YA 1ZX1A 1Y8QA 2E4ZA 2R1TB 3Q0EA 4LHWA 3TRDA 3GMSA 3K15A 3NHLA 2C04A 4KPFC 5JZ9A 4K26A 1T4GA 3DPSA 2JGIA 3ZR4B 1O94A 2VWHA 4G4GA 4O1MA 5B6IA 3BXOA 3M5PA 3ILVA 3CRW1 3E9EA 2IZ5A 2PQ2A 4OJYA 1JECA 3NDJA 1SULA 5LP6C 4JKYA 2RI6A 2BZGA 4B83A 3D1VA 5JEDA 1MB4A 4Y6QA 3AEZA 4BY9E 1JIUA 2OCIA 4DQ0A 3NHFA 4UAJA 4ZYXA 4O4IA 4GP6A 4DMFA 1J25A 3KHTA 3SHVA 3ZI4A 3AVUA 2YJ5A 1KAHA 1NUTA 3IUMA 3PX3A 4HDMA 3OZIA 3IP1A 1KYVA 1N6LA 4BATA 3T35A 2TS1A 3ZDEA 4EB0A 3ZX4A 4OFZA 4LF6B 4EKYA 3ZOZA 3NOOA 1ZMBA 1BVYF 2EATA 3MAGA 2QTCA 4P6VF 1NMSA 3DZIA 5LOVA 2ATIA 2QROA 1WU7A 1P2TA 2H18A 4P7BA 5K6TA 2W22A 2QHXA 3VSEA 4ZICA 3LPAA 4K46A 3EHEA 3QU5A 2JCVA 3HA7A 4L8WB 3ROGA 5JMPA 1DC6A 1PK9A 3IXLA 3P2EA 1I7LA 1WE2A 1RWMA 1W1UA 4HQ6A 4KE7A 4W63A 2FN9A 5GM1A 1HG0A 1E0JA 1E5VA 1HURA 1M34A 4US2R 1E1QA 3ZH9B 4CQMB 4OMFG 1D4FA 3W8EA 3BRQA 3LF1A 3UWDA 5JNLA 5KC8A 2DHDA 2FSHA 4YBZA 4TXHA 3R7DA 4JSRA 4F4FA 2JGDA 4C3UA 3AOGA 3UK6A 2CEAA 1IBKB 1X77A 3L1HA 4WUVA 1PRYA 1I2AA 3CZMA 3PFBA 4LSZA 4UPDA 4MV9A 4ZCMA 5KKCA 2ZYWX 4FI3F 2CLDX 4O5AA 3K70D 1PT9A 4LHZA 1ODIA 2RH9B 3TLJA 3BTVA 4YJ2A 2HNKA 5B1EA 2ZGVA 1XRMA 2OHOA 2VNHA 3BIJA 3G5AA 4I3HA 1D2EA 1QYCA 2H07A 1B6GA 3DHEA 5BSMA 4ZCQA 3TL3A 5IT0A 4KHPB 2IYZA 3D7KA 4E5VA 2IPXA 3B1KA 4DKXA 3E7WA 4GGOA 1JLMA 3TQOA 5KVSA 1KY4A 1IPHA 4ZMSA 4WNAB 1KU0A 3H4MA 4KI7A 4LNHA 4L73A 4GZ3A 5FF9A 1J09A 4DNFA 2IV7A 4IH1A 3UKOA 2GM3A 5G0VA 1P73A 3G5TA 1OBFO 3KS9A 3EYWA 1ML3A 3MGKA 1Z38A 2JLBA 2V7QD 2F1RA 5JARA 4UU0A 3VPDA 4G8CA 4MW4A 1KWGA 4CI0B 5E7MA 1G19A 3M6UA 4E2ZA 1IU9A 4AG6A 3FF4A 4Z54A 1DAEA 3OQ6A 3CO5A 4TWJA 4FZRA 4PGHA 5JEEA 2C9ZA 4XH9B 3ILHA 3ZD7A 3QNMA 3NDBB 2PU5A 1KEKA 4QOFA 5BVGB 3WGIA 2O2YA 1UBNA 4NBVA 1C8BA 3PB3A 3AR7A 5LYJB 2XAUA 3MG9A 4M88A 4EPRA 4UFPA 2O8EA 2Q9CA 4ZVVA 1N0WA 4K86A 4TN5A 3TLYA 4CR7A 4MIOA 4NZ9A 3ZDZB 3FGNA 1OCEA 2CF5A 4FNAA 4ZYTA 1I7DA 4ZEOA 3SLKA 3U6KA 4LOJA 3BFXA 3TAHA 1BJTA 2N42A 1J0DA 1EQ2A 1T6NA 2D1RA 3E9DA 2G8LA 1VB5A 1SBNE 2CNKA 4C1NA 2P41A 3DUFA 1VKRA 4FGJA 3ND5A 4M36A 4XGNA 3TTVA 1RWBA 2PKCA 1C1XA 1Y8AA 3PC8A 4KMSA 3A25A 3PXCX 2ZANA 3NTXA 3Q7QA 1DWQA 1RACA 4Y1RA 4A03A 4A5OA 1QV6A 4QVIA 5KDLA 3TWOA 1NP3A 3KKMA 3HK2A 1E7SA 2GCOA 2G7ZA 2OYSA 2RH4A 1JR3A 4LNAA 1II9A 4PN7A 3OFNA 2I7XA 2H8GA 5CYGA 1KDPA 1RWKA 2EWMA 1NZFA 4TTTS 3K53A 1E98A 4Y2YA 3NIFB 3ZWCA 1R74A 1W0JD 5DASA 1OE0A 1EK0A 2E6UX 1IY9A 3G1UA 3O4IA 4LXGA 3UMSA 5CITA 3D8RA 3ADOA 4G85A 4Q9AA 1HE4A 1YI0A 2OQRA 5C4GB 2IYQA 1AZTA 4Z3KA 2Q5OA 1RE1A 3G3EA 3H87A 1QH8B 3KYBA 4UHKA 1XRSB 2WJ3A 4JKIA 1XVVA 1J5EB 1QYWA 3UJ3X 3UV6A 4WKCA 1WPQA 3KT6A 4IILA 4K9MA 4ME6A 4Y1GA 4E7PA 4C2TA 1LI7A 1V9SA 1EWYA 1MTZA 1CDOA 2AVDA 3I9V6 1J0EA 2BW0A 3Q12A 3RVMA 3W2TA 4DDUA 3IBFA 1VJCA 3WGGA 1E2DA 1C4XA 4V1CA 4PF1A 4EARA 1E4VA 1ULBA 2JVJA 3L05A 1XPRA 1DJMA 2JKZA 3H17A 3MTQA 4K40A 1QQTA 1V3TA 4QUDA 4CV3A 1D2NA 2DMRA 2WNIA 3M4NA 1ZM2A 3A3NA 3OF3A 5IT4A 1S3IA 2EIHA 3TBKA 2TMKA 3DLHA 1VBFA 3A1EA 3O3MB 5D3MB 4WBNA 4OJKA 4UMVA 5SICE 3I6YA 4F97A 1JBKA 3QI7A 1OXKB 4QPDA 3E7PA 1P91A 2F3TA 4P08A 5IJ9B 3A1NA 3T5PA 1ZMOA 4MA5A 3TJMA 2GCEA 3EY9A 4ZAVA 1LK5A 5IZCA 4QYMA 1T6BY 3TIVA 1ZMXA 2O50A 2PXXA 4KH1A 4A8JA 4EHHA 2CMGA 3DLTA 4CEJB 3R4VA 3LTNC 1R4AA 2P2LA 4XJSA 4YAJA 2HIHA 2X2EA 3RANA 3V48A 1FVXA 2QG9A 3V80A 4NEHB 3E3AA 2BGNA 4ZCSA 3N8IA 1EX1A 3JYQA 3OCWA 4LZAA 5DO9A 4CR6A 4I50F 1T29A 1KHTA 2I4NA 3OOSA 4HMQA 1DL5A 1YE5A 4ACBA 2WU0A 4XUCA 3H5AA 3DJYA 4GMDA 1LVGA 4ESVA 5H59A 2HLPA 3THWB 4TS1A 1SQGA 3U19A 1XFAA 5ICSA 3LCCA 2XUIA 4PZPA 4DSTA 1B8VA 1ZIPA 2BFOA 4J0CA 2GCPA 2QBYB 3DOCA 4JLVA 3GEGA 3MZ0A 3SR3A 3TLBA 3ZWAA 3NG1A 1LBQA 2AR7A 2AXNA 4BO2A 1X14A 3N2LA 1QE5A 5EPOA 4QARA 4Q1DA 3K96A 2AXEA 1AF7A 2O0KA 1UC8A 2NZWA 4ITRC 2QR5A 4PLCA 4DC0A 1RC1A 4UATA 1ZJYA 2SKEA 3BGWA 3VNSA 2RMKA 4JYZA 3PC4A 1PNTA 1KVTA 4JJ6A 1KE1A 5KU1A 3K0FA 5LL6P 1EHIA 4LBVA 2BWJA 4CL2A 3F5FA 2VRBA 2NZYA 3AR8A 2C5EA 2Z4TA 5DCWA 3VR0A 4PYIA 1JG1A 3G17A 3M4JA 4NYMQ 1L0BA 3OZEA 1RVV1 2POCA 1EYZA 3GLRA 1L1RA 3ZHUA 4BNUA 1Z5GA 1RLMA 1O87A 1BVHA 2JFZA 3NYQA 2A86A 3LFTA 2CHVA 4F12A 2PX2A 3ORSA 1YDEA 2J08A 2WFZA 5FFMA 5K45A 3UMYA 1B1CA 3NEAA 2HDHA 3A9RA 3KEOA 4BP1A 1O8BA 4HGNA 1TYAE 1NAHA 3PIIA 2YOGA 5DGCA 4E33A 4D43A 4D4JA 1CS0A 3LCUA 5TE9A 4U5QA 3ZDAA 2O8VA 3CS3A 3CTPA 3DP9A 1TK9A 2B2NA 3RREA 2E82A 1R0WA 1AXRA 3B1XA 3CM0A 2YV2A 3QBTA 4W7SA 5EZQA 1JVNA 5HS4A 4QELA 3L0CA 1O96B 4FFSA 2C9BA 3RVBA 3L7DA 4NPHA 5D7NA 3VISA 4IGFA 4XYLA 4EECA 2WMNB 3P0FA 4WA7A 4P34A 1F8UA 2NV6A 1B15A 1CNMA 1QGOA 2XNDA 4HY3A 4J6FA 2FQXA 4KIWA 1AGYA 1V9CA 4G1CA 3TTWA 4WKOA 5JXJA 1ID8A 1F2TB 1X1BA 3R5KA 3AR5A 1Z13A 3GROA 1ODLA 3LPCA 2UVPB 4QYIA 4X84A 2EX4A 2GHIA 4Z9XA 2FN7A 3CSSA 4NJEA 3N1UA 2GZMA 5TS2A 1GXSA 3LT0A 1IBLB 3ICQB 4EGFA 5BUZA 2OBFA 1R8QA 1H69A 2Z8YA 3C8UA 4O0LA 4BYMA 3GLFA 2JBAB 3QELB 1ICEA 5CCXA 2Y0CA 5FKJA 4LXYA 3DMYA 3WZMA 3UPDA 4DANA 2W37A 1UBEA 4IDCA 3C16C 3DMTC 4BNXA 1BQ3A 1UC4B 4LPKA 2YXDA 3NUGA 3QBJA 2YV3A 1M5UA 4UBOA 1CDEA 5JYEA 3KYIB 3CISA 4K6FA 4XYGA 1ESEA 4LAFA 2D7JA 2CFSA 2GDJA 2X2OA 3LYHA 2WU3A 3HU2A 4J0KA 4LTNA 5DNEA 4WDRA 3WQQA 4ENVA 1PSWA 3R5TA 3GMTA 1YJXA 1FTGA 3ITDA 3PSHA 1SXJC 4WE3A 3SJBA 3SQMA 4MAAA 3V1UA 1M83A 3U4GA 4N0DA 1Q0QA 1NUSA 4U7TB 4R9NA 1FVOA 1SD2A 3I5YA 3LNTA 2Z6VA 2WPDD 4IX1A 4P84A 4EPYA 1J9ZA 4INZA 4H3HB 1Z26A 4ZHQB 2PRKA 2VA9A 2X9GA 5INTA 3C1UA 1KGDA 2G5TA 2JCXA 1UBKS 2NU9A 1P74A 2QT9A 5D6NA 1G5TA 2YHSA 3EA5A 2REBA 3H9GA 4XQCA 3ZV5A 4AQDA 4DCCA 3SS8A 4TZ0A 3LC1O 1I9GA 2EKDA 1OPRA 4C4AA 4EMBA 1YA8A 4AICA 4TS9A 3DO6A 5FA5A 5JQWA 3CFYA 5MGBA 3AVYA 2JA1A 4R2MA 1DEHA 4F1JA 2QVBA 1T1SA 4RTRA 2Y99A 4J94A 5HEKA 2FUKA 3QU4A 5I9MA 3AVTA 1P0PA 3ZD9A 1CIPA 2NTEA 4WSOA 5AW7A 1OB2A 2J3MA 4IUCS 2GTHA 2UVDA 5LQNA 1US8B 3MAAC 4Z3DA 5H4HA 3QG5A 4B3FX 5BYKA 1OIWA 4IIHA 5I6DA 2LCQA 4QXRA 4RPGA 3GLIB 4Z2AA 3WISA 4W9RA 5L51A 5JAIA 1TQHA 1PX2A 1U8ZA 4TM8A 1I13A 4BNGA 1E20A 2OGWA 4L7QA 1DPFA 1ONPA 3OCUA 5K4HA 1PR3A 3HFSA 1XNHA 1XEWY 121PA 3SHTA 1WTAA 1KI4A 1T4CB 1E1DA 1MMFB 2EQBA 4KO2S 1F5NA 2DWCA 3KT0A 4TSFA 1HH4A 4GOND 4Z2YA 2EQ5A 4YMGA 5I9NA 3AR9A 3TH5A 4LECA 4ZAZA 1V2HE 2JFUA 2Y1FA 3LY5A 3R9IA 1SKUA 4LSGA 4AJ9A 4C29A 1ISIA 4JJ7A 3KKLA 1YDWA 2CNWA 3GUCA 3MCZA 2ERYA 1Y33E 1PGOA 4FOSA 3JRXA 3TIGA 3SZGA 3CR3C 4GRIA 3D7RA 2D5AA 3HJHA 2VPPA 2NO7A 4HX9A 3AEQB 2WQZA 1E3QA 2EBWA 3JWGA 1J22A 3FW1A 5EIWA 2O5EA 5GJBA 1BOOA 5CLHA 5REQA 5DM0A 2CVPA 1C3OA 2CUNA 2VF2A 3KWFA 4URYR 5K6AA 5IDYA 4KSBA 3H9QA 1MAWA 2G8NA 4DIKA 5CFOA 4REOA 3KHKA 2A57A 2CY0A 3K71B 1V5FA 5SV2A 4FMPA 3M70A 4CM8B 1F0PA 3HLTA 4I9HA 5H3HA 2KW5A 1YR7A 2ZBVA 3ESZA 3ETLA 1E99A 3GLHE 2GLTA 4J3FA 2CLFB 5HMLA 3QEAZ 2R62A 4IDAA 4QDUA 3HO8A 2V7GA 2KLBA 2Z2ZA 1M75A 3MXOA 1MQ9A 3RVPA 3RYIB 1REQA 4KWTA 1HA3A 1BOFA 2WRZA 3HDGA 3IRVA 3KJEA 4Z7JA 5JNUA 1QBKC 3OQBA 3TECE 1UDRA 4DEXA 3GOHA 5E8JA 4AZ3A 3ZCXA 4CLOA 4L0CA 1M8FA 1ZOLA 5DEIA 4A6DA 2WUWE 3OO1A 1ZBQA 3O83A 4DNPA 1MPTA 1QYXA 1X8LA 2A58A 2QL5A 3G68A 5FHRA 5BN3B 1MB0A 2H9IA 5FHQA 5E9QA 3BD7A 2CYCA 3A1SA 2BFBA 3DVSX 3LA8A 4RIEA 1K8XB 1L7BA 1SAYA 4LDRA 5D00A 5CEJA 3K1YA 1P39A 1Z7GA 3VSBA 3I4CA 4MQUA 2O1XA 3X2FA 1E3IA 1U3TA 2P5YA 3BMNB 5AK5A 3JARB 4ZCTA 5EIAA 4L07A 4L76A 1NIJA 4I9GA 1OZGA 2XQGA 4MW1A 4TT8A 4XD7D 2HC9A 2F6RA 1LPMA 3DTTA 3MNFA 4UEQA 4MQEB 5F5LA 3V1LA 4AY3A 2W93A 2W42A 4ROSA 2QLTA 4QU5A 4ARBA 1K3FA 4LXXA 1MAHA 5D3QA 4KIGA 2WTUA 4XFJA 4IFTA 3DH0A 1DBVO 1SU4A 5AJXA 5JASA 4XWTA 4ZAFA 4P5DA 2DH5A 4TXLA 4ZPJA 1GV0A 2XYHA 3HR7A 1CRZA 3VU9B 4HO1X 2HYDA 4AG3A 4MCAA 3UK0A 3WGLA 1MEJA 1Q3KA 4L6CA 4JUDX 4YUWA 4PGAA 2NO4A 3WWYA 3RUDA 4J6EA 1ZGCA 2VXOA 5JADA 5EJGA 1NX6A 1II8B 3HVJA 5BSRA 3C7CB 3RPEA 1QRSA 4J4HA 3FTPA 1E69A 1ZU5A 2P2SA 4XCQA 2RIPA 3RASA 1KSFX 2ECFA 4HC4A 1GUAA 4GLJA 1L6RA 3F3MA 1DKRA 4YP5A 5EP4A 3MS2A 3WLMA 3VNVA 5B1HA 2ZVDA 4FX2A 1FK8A 2QE7D 4U2KA 1V4NA 1BA3A 2F17A 2I2BA 3HKBA 4IO0A 4KQIA 2FDXA 3HCFA 2F1JA 3E61A 4KQHA 3FH0A 4QEKA 1XZQA 4JR0A 4NECA 5MF6A 3DOUA 2D5LA 2PV0A 3ONFA 5CIYA 3MT9A 3JALB 2ETVA 2GZ2A 5IJAA 4PG7A 1KJ8A 3RK4A 4AZ3B 2QLBA 4KN5A 4H31A 2O7RA 4L6IA 4O4LF 3U49A 2WE8A 5ABPA 4LWOA 2AEEA 1Q1ZA 2B9EA 3PEEA 1G4HA 4RY0A 1T3SA 5AI9A 3SU8A 4BCCA 2X9QA 4IMIB 4LMPA 3CPHA 3IDSA 4MMYB 1GN9A 5H9WA 2GCIA 3EEQA 1NYQA 3Q3EA 2NLOA 4LX8A 3LQFA 3VGPA 1A71A 3L77A 3LU1A 1ECJA 3OLWA 3I9LA 4WMLA 4ZOLF 2QOEA 2XNHA 3IR7A 4H3SA 4DB4A 2C5HA 3JQGB 1BH6A 1ZVVA 2NUBA 4HXYA 4O59O 3WQSB 3K6SA 3QKRB 4W5NA 2YDXA 2JVIA 4Y0AA 2ZW9A 3IA2A 2J85A 3DBVO 3K5IA 4LWQA 1Z39A 1CR6A 5ECWA 1CC1S 1JJFA 5HK9A 4TL8A 2H2HA 4FGKA 3OTGA 4KBGA 3KVOA 4WNYA 1M2KA 2DCUA 4CGYA 1QKJA 3QX8A 1RP7A 4O6VA 4KE6A 5K5EA 3ICEA 4YHHB 2GCGA 2BBTA 3IOMA 4L16A 5LBUA 5JS2A 1M66A 2XZLA 1C9NA