3GGRA

Crystal structure of the human rad9-hus1-rad1 complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
264
structure length
264
Chain Sequence
KCLVTGGNVKVLGKAVHSLSRIGDELYLEPLEDGLSLRTVNSSRSAYACFLFAPLFFQQYQAATPGQDLLRCKILMKSFLSVFRSLAMLEKTVEKCCISLNGRSSRLVVQLHCKFGVRKTHNLSFQDCESLQAVFDPASCPHMLRAPARVLGEAVLPFSPALAEVTLGIGRGRRVILRSYHEEEADSTAKAMVTEMCLGEEDFQQLQAQEGVAITFCLKEFRGLLSFAESANLNLSIHFDAPGRPAIFTIKDSLLDGHFVLATL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and functional implications of the human rad9-hus1-rad1 cell cycle checkpoint complex
pubmed doi rcsb
molecule keywords Cell cycle checkpoint control protein RAD9A
molecule tags Cell cycle
source organism Homo sapiens
total genus 39
structure length 264
sequence length 264
ec nomenclature ec 3.1.11.2: Exodeoxyribonuclease III.
pdb deposition date 2009-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04139 Rad9 Rad9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 3ggrA00
1RXZA 1B77A 4D2GA 3HI8A 2ZVMA 3HSLX 1PLRA 3F1WA 2IZOC 3AIXB 1T6LA 2ZVLA 5A6DA 5IXAA 5CFKA 1U7BA 3AIXA 3GPNA 1IZ5A 2NTIB 3I2MX 1IZ4A 1PLQA 4HK1A 3GGRC 3GGRA 1YYPA 2HIKC 5H0TA 3U60F 2IJXA 5IY4A 2IZOB 5E0UA 2AVTA 4YHRA 3U61F 4TR6A 1CZDA 2IO4B 5E0VA 5DAIA 4L6PA 2HIIA 1UL1A 5DA7A 2IO4A 2OD8A 3VKXA 2IX2C 5IWDA 4RJFA 3GGRB 2IX2A 3LX1A 3A1JC 3P91A 3P83A 2HIKB 1RXMA 2ZVKA 3AIZC 3WGWA 1GE8A 1RWZA 1DMLA 2HIKA 3TBLA 1ISQA 3GPMA 3IFVA 3G65C 4L60A 3V61B 3G65A 3V60B 2IX2B 3FDSC 3P87A 2HIIC 3A1JB 2ZVVA 2Z0LA 1AXCA 5JNED 1B8HA 1VYMA 5B7OA 1W60A 2AWAA 5AUJA 1VYJA 3A1JA 3U5ZF 1U76A 3AIZA 4ZTDA 4CS5A 3A2FB 1SXJF 3G65B 5E0TA 3K4XA 3V62B 2ZVWA 2HIIB 3FDSD 3LX2A 2NTIC 1UD9A 5HACA 2NTIA
chains in the Genus database with same CATH superfamily
1RXZA 1B77A 4D2GA 3HI8A 2ZVMA 3HSLX 1PLRA 3F1WA 2IZOC 3AIXB 1T6LA 2ZVLA 5A6DA 5IXAA 5CFKA 1U7BA 3AIXA 3GPNA 1IZ5A 2NTIB 3I2MX 1IZ4A 1PLQA 4HK1A 3GGRC 3GGRA 1YYPA 2HIKC 5H0TA 3U60F 2IJXA 5IY4A 2IZOB 5E0UA 2AVTA 4YHRA 3U61F 4TR6A 1CZDA 2IO4B 5E0VA 5DAIA 4L6PA 2HIIA 1UL1A 5DA7A 2IO4A 2OD8A 3VKXA 2IX2C 5IWDA 4RJFA 3GGRB 2IX2A 3LX1A 3A1JC 3P91A 3P83A 2HIKB 1RXMA 2ZVKA 3AIZC 3WGWA 1GE8A 1RWZA 1DMLA 2HIKA 3TBLA 1ISQA 3GPMA 3IFVA 3G65C 4L60A 3V61B 3G65A 3V60B 2IX2B 3FDSC 3P87A 2HIIC 3A1JB 2ZVVA 2Z0LA 1AXCA 5JNED 1B8HA 1VYMA 5B7OA 1W60A 2AWAA 5AUJA 1VYJA 3A1JA 3U5ZF 1U76A 3AIZA 4ZTDA 4CS5A 3A2FB 1SXJF 3G65B 5E0TA 3K4XA 3V62B 2ZVWA 2HIIB 3FDSD 3LX2A 2NTIC 1UD9A 5HACA 2NTIA
chains in the Genus database with same CATH topology
1RXZA 1B77A 4D2GA 3HI8A 2ZVMA 3HSLX 1PLRA 3F1WA 2IZOC 3AIXB 1T6LA 2ZVLA 5A6DA 5IXAA 5CFKA 1U7BA 3AIXA 3GPNA 1IZ5A 2NTIB 3I2MX 1IZ4A 1PLQA 4HK1A 3GGRC 3GGRA 1YYPA 2HIKC 5H0TA 3U60F 2IJXA 5IY4A 2IZOB 5E0UA 2AVTA 4YHRA 3U61F 4TR6A 1CZDA 2IO4B 5E0VA 5DAIA 4L6PA 2HIIA 1UL1A 5DA7A 2IO4A 2OD8A 3VKXA 2IX2C 5IWDA 4RJFA 3GGRB 2IX2A 3LX1A 3A1JC 3P91A 3P83A 2HIKB 1RXMA 2ZVKA 3AIZC 3WGWA 1GE8A 1RWZA 1DMLA 2HIKA 3TBLA 1ISQA 3GPMA 3IFVA 3G65C 4L60A 3V61B 3G65A 3V60B 2IX2B 3FDSC 3P87A 2HIIC 3A1JB 2ZVVA 2Z0LA 1AXCA 5JNED 1B8HA 1VYMA 5B7OA 1W60A 2AWAA 5AUJA 1VYJA 3A1JA 3U5ZF 1U76A 3AIZA 4ZTDA 4CS5A 3A2FB 1SXJF 3G65B 5E0TA 3K4XA 3V62B 2ZVWA 2HIIB 3FDSD 3LX2A 2NTIC 1UD9A 5HACA 2NTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RXZ A;  1B77 A;  4D2G A;  3HI8 A;  2ZVM A;  3HSL X;  1PLR A;  3F1W A;  2IZO C;  3AIX B;  1T6L A;  2ZVL A;  5A6D A;  5IXA A;  5CFK A;  1U7B A;  3AIX A;  3GPN A;  1IZ5 A;  2NTI B;  3I2M X;  1IZ4 A;  1PLQ A;  4HK1 A;  3GGR C;  3GGR A;  1YYP A;  2HIK C;  5H0T A;  3U60 F;  2IJX A;  5IY4 A;  2IZO B;  5E0U A;  2AVT A;  4YHR A;  3U61 F;  4TR6 A;  1CZD A;  2IO4 B;  5E0V A;  5DAI A;  4L6P A;  2HII A;  1UL1 A;  5DA7 A;  2IO4 A;  2OD8 A;  3VKX A;  2IX2 C;  5IWD A;  4RJF A;  3GGR B;  2IX2 A;  3LX1 A;  3A1J C;  3P91 A;  3P83 A;  2HIK B;  1RXM A;  2ZVK A;  3AIZ C;  3WGW A;  1GE8 A;  1RWZ A;  1DML A;  2HIK A;  3TBL A;  1ISQ A;  3GPM A;  3IFV A;  3G65 C;  4L60 A;  3V61 B;  3G65 A;  3V60 B;  2IX2 B;  3FDS C;  3P87 A;  2HII C;  3A1J B;  2ZVV A;  2Z0L A;  1AXC A;  5JNE D;  1B8H A;  1VYM A;  5B7O A;  1W60 A;  2AWA A;  5AUJ A;  1VYJ A;  3A1J A;  3U5Z F;  1U76 A;  3AIZ A;  4ZTD A;  4CS5 A;  3A2F B;  1SXJ F;  3G65 B;  5E0T A;  3K4X A;  3V62 B;  2ZVW A;  2HII B;  3FDS D;  3LX2 A;  2NTI C;  1UD9 A;  5HAC A;  2NTI A; 
#chains in the Genus database with same CATH topology
 1RXZ A;  1B77 A;  4D2G A;  3HI8 A;  2ZVM A;  3HSL X;  1PLR A;  3F1W A;  2IZO C;  3AIX B;  1T6L A;  2ZVL A;  5A6D A;  5IXA A;  5CFK A;  1U7B A;  3AIX A;  3GPN A;  1IZ5 A;  2NTI B;  3I2M X;  1IZ4 A;  1PLQ A;  4HK1 A;  3GGR C;  3GGR A;  1YYP A;  2HIK C;  5H0T A;  3U60 F;  2IJX A;  5IY4 A;  2IZO B;  5E0U A;  2AVT A;  4YHR A;  3U61 F;  4TR6 A;  1CZD A;  2IO4 B;  5E0V A;  5DAI A;  4L6P A;  2HII A;  1UL1 A;  5DA7 A;  2IO4 A;  2OD8 A;  3VKX A;  2IX2 C;  5IWD A;  4RJF A;  3GGR B;  2IX2 A;  3LX1 A;  3A1J C;  3P91 A;  3P83 A;  2HIK B;  1RXM A;  2ZVK A;  3AIZ C;  3WGW A;  1GE8 A;  1RWZ A;  1DML A;  2HIK A;  3TBL A;  1ISQ A;  3GPM A;  3IFV A;  3G65 C;  4L60 A;  3V61 B;  3G65 A;  3V60 B;  2IX2 B;  3FDS C;  3P87 A;  2HII C;  3A1J B;  2ZVV A;  2Z0L A;  1AXC A;  5JNE D;  1B8H A;  1VYM A;  5B7O A;  1W60 A;  2AWA A;  5AUJ A;  1VYJ A;  3A1J A;  3U5Z F;  1U76 A;  3AIZ A;  4ZTD A;  4CS5 A;  3A2F B;  1SXJ F;  3G65 B;  5E0T A;  3K4X A;  3V62 B;  2ZVW A;  2HII B;  3FDS D;  3LX2 A;  2NTI C;  1UD9 A;  5HAC A;  2NTI A; 
#chains in the Genus database with same CATH homology
 1RXZ A;  1B77 A;  4D2G A;  3HI8 A;  2ZVM A;  3HSL X;  1PLR A;  3F1W A;  2IZO C;  3AIX B;  1T6L A;  2ZVL A;  5A6D A;  5IXA A;  5CFK A;  1U7B A;  3AIX A;  3GPN A;  1IZ5 A;  2NTI B;  3I2M X;  1IZ4 A;  1PLQ A;  4HK1 A;  3GGR C;  3GGR A;  1YYP A;  2HIK C;  5H0T A;  3U60 F;  2IJX A;  5IY4 A;  2IZO B;  5E0U A;  2AVT A;  4YHR A;  3U61 F;  4TR6 A;  1CZD A;  2IO4 B;  5E0V A;  5DAI A;  4L6P A;  2HII A;  1UL1 A;  5DA7 A;  2IO4 A;  2OD8 A;  3VKX A;  2IX2 C;  5IWD A;  4RJF A;  3GGR B;  2IX2 A;  3LX1 A;  3A1J C;  3P91 A;  3P83 A;  2HIK B;  1RXM A;  2ZVK A;  3AIZ C;  3WGW A;  1GE8 A;  1RWZ A;  1DML A;  2HIK A;  3TBL A;  1ISQ A;  3GPM A;  3IFV A;  3G65 C;  4L60 A;  3V61 B;  3G65 A;  3V60 B;  2IX2 B;  3FDS C;  3P87 A;  2HII C;  3A1J B;  2ZVV A;  2Z0L A;  1AXC A;  5JNE D;  1B8H A;  1VYM A;  5B7O A;  1W60 A;  2AWA A;  5AUJ A;  1VYJ A;  3A1J A;  3U5Z F;  1U76 A;  3AIZ A;  4ZTD A;  4CS5 A;  3A2F B;  1SXJ F;  3G65 B;  5E0T A;  3K4X A;  3V62 B;  2ZVW A;  2HII B;  3FDS D;  3LX2 A;  2NTI C;  1UD9 A;  5HAC A;  2NTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...