3GGSA

Human purine nucleoside phosphorylase double mutant e201q,n243d complexed with 2-fluoro-2'-deoxyadenosine
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
284
structure length
284
Chain Sequence
NGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFQTVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITDKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title Structure of a mutant human purine nucleoside phosphorylase with the prodrug, 2-fluoro-2'-deoxyadenosine and the cytotoxic drug, 2-fluoroadenine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 284
sequence length 284
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2009-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ggsA00
2GUWA 3DJFA 1VMKA 4LKRA 3NM6B 3BL6A 1V48A 1Z35A 3F8WA 1U1CA 3OZCA 1OUMA 3UAYA 4ECEA 4IP0A 1Y6RA 2B94A 3C74A 1ZOSA 3NM4A 4U2KA 5C80A 1B8OA 1ODLA 4MCIA 3O4VA 1Y1SA 5F76A 5K1ZA 4M1EA 5CCDA 1K27A 3PHBE 4M7WA 5F78A 5FAKA 4F3CA 1K9SA 5F7XA 3OPVA 1Z34A 5F77A 5F7ZA 2QTGA 3OF3A 4GKAA 1OTXA 3KUKA 4TXJA 5CYFA 4YJKA 4UC0A 3KU4A 1ULBA 1PK9A 3SCZA 3UAWA 1T8SA 1CG6A 5F7JA 1V2HE 4QFBA 5CXSA 2OECA 3LBAA 4L5AA 2OC9A 4G8JA 4BMYA 4L5CA 4YMLA 3INYA 1TGVA 4P54A 4TTAA 1V41E 1N3IA 1Q1GA 1Y1RA 4BMXA 1U1DA 3K8QA 4EARA 2PGAA 1NW4A 1OTYA 1FXUA 4OGKA 3BGSA 1RXCA 2HSWA 3IEXA 4DARA 3K8OE 4LDNA 2HWUA 4G41A 4RJ2A 4TXLA 1A9PA 4D98A 1PR2A 1PR1A 3KVYA 3E9ZA 3PNSA 4E1VA 2ISCA 5EFOA 1QE5A 1A69A 1PR0A 3MB8A 2I4TA 4JP5A 3IOMA 3FOWA 1VHWA 1Z5NA 4F2WA 4DA0A 2QSUA 4YO8A 2OC4A 3FAZA 1PKEA 2A8YA 1A9SA 3U40A 3BSFA 1Z38A 1ODKA 4PR3A 1RT9A 1Z37A 4BMZA 4MARA 4I2VA 5EUBA 3UAVA 1NC3A 3BJEA 4KN5A 4NY1A 1T0UA 4L0MA 2A0XA 1SD2A 1JYSA 4LNHA 1SJ9A 3PNPA 1V45E 4F1WA 5F73A 3GGSA 1A9QA 4WKCA 2A0YA 1RFGE 3UAXA 1A9RA 4NSNA 4DAOA 1PF7E 4QEZA 3OOHA 4R31A 1LV8A 4L5YA 2IQ5A 4QARA 3OZEA 5CCEA 4OGLA 1JDUA 4QASA 4PNPA 3OOEA 2RJ3A 3EEIA 1PWYE 3QPBA 1CB0A 4DA7A 4OEHA 4H1TA 5B7QA 2QDKA 1OV6A 1K3FA 1YR3A 3E0QA 1RXYA 4LNAA 1RSZA 1TCVA 4K6OA 1PR5A 3DF9A 1TD1A 5JPCA 1T8YA 2AC7A 4YNBA 1Z36A 4TTIA 3DP9A 3FNQA 3DPSA 1OVGA 1JP7A 5ETJA 1RYZA 3P0EA 4D8YA 1PK7A 2HN9A 1ECPA 2QTTA 1LVUA 4DA8A 4WKBA 1TGYA 3KVVA 1Z5OA 1B8NA 1JDZA 1V3QE 1XE3A 3DDOA 1Z33A 4OY3A 3E9RA 5B7PA 3EUFA 3MMSA 1NC1A 4WKPA 4DA6A 2ON6A 4F3KA 1Y1TA 1PR6A 1JPVA 2BSXA 3PHCA 4BN0A 3NM5A 3EMVA 1Y6QA 4TTJA 1T8WA 4TS3A 4R2WA 1YQQA 5IFKA 1TCUA 1YRYE 1M73E 3FB1A 1Z39A 3ONVA 1RR6A 5CXQA 2XRFA 4M3NA 2A0WA 2H8GA 4JOSA 5CYGA 1Z5PA 3UAZA 4F2PA 3NBQA 3FUCA 3LA8A 2AI2A 5F7OA 4TXHA 3T94A 1OU4A 4NS1A 1ODJA 1G2OA 1PW7A 4OF4A 3OCCA 1YQUA 4TS9A 3FWPA 2OXFA 1JE1A 3D1VA 1SQ6A 4TXNA 1RCTE 1RXUA 3P0FA 1U1GA 3LGSA 4D8XA 2AI1A 3O6VA 4D9HA 4DABA 4DANA 1T8RA 1PBNA 4DAEA 4L6IA 4D8VA 4QAQA 1SD1A 5EPUA 1U1FA 1VHJA 4GLFA 3GB9A 4TYMA 1I80A 4JWTA 4WKOA 3UT6A 1A9OA 1YBFA 1JDVA 4FFSA 3EUEA 5DK6A 1JDSA 4QATA 3KVRA 3TL6A 4TXMA 5B7NA 1Y1QA 1VFNA 1ODIA 2AI3A 5IU6A 4X24A 1LX7A 5KB3A 2P4SA 5B7GA 4LZWA 4R2XA 1PR4A 1ULAA 2QPLA 1RXSA 1JDTA 4G89A 3ENZA 1JE0A 1V4NA 4GMHA 3OZDA 4WKNA 2I8AA 1U1EA 2HRDA 1A9TA 4MCHA 2Q7OE 3OZBA 3ODGA 4EB8A 4OJTA 1ZL2A 1WTAA 5I3CA 4GLJA 3KHSA 1C3XA
chains in the Genus database with same CATH superfamily
5ALUA 4QSHA 5DXFA 1JB1A 1A4UA 2QL6A 4H9GA 4BBPA 4ZYTA 4A2CA 1XU7A 2FRDA 1SVKA 3VMMA 4CMIA 1M5RA 1B76A 1LPNA 2XWJI 1DFIA 5KSYA 1OPRA 3JTEA 3O9MA 3ADOA 4MR9A 4LC9A 3I62A 3N87A 1MAWA 3PL1A 1L4EA 4IL5A 4EB6A 1L5ZA 2X8BA 4IY1A 1FTWA 3BB4A 2C3MA 2VDLB 3L4BC 2ZT6A 1D0SA 3NB0A 5EJ4A 3DBRB 1N77A 1LK5A 4C7JA 1MO5A 4CKXA 2OPBA 3LQ4A 3AR4A 3M33A 1VLLA 1ADCA 1Z17A 1T2NA 1UFRA 1EK1A 3FPLA 4IXNA 4Q4HA 4X97A 1L5OA 5F64A 4OO3A 3MUFA 4CKYA 4MWCA 5DXJA 1YR8A 2YOGA 2CVQA 4MQUA 3K70D 1JGTA 2ZI7A 3NBMA 8GPBA 3ADDA 2AYYA 1M74A 2SNIE 1B16A 4B2YA 3SU8A 3GLFA 2GEVA 5F76A 5LDHA 5B53A 3D0QA 4E3WA 1XQ6A 4XDGA 1JIUA 2Z04A 3ACBA 4Q4AA 5I5GA 4D0NA 1CUXA 1WXEA 2E48A 3NVAA 1XZAA 3BJIC 2H4FA 3C85A 3QWHA 4LDQA 2XD4A 1XTRA 5LD2C 2VP4A 3PJRA 1BXRB 1YVDA 2Z2JA 1AMNA 1C8BA 5CX1B 2PNJA 3DCNA 3EOAI 3V8QA 3VQTA 1QYCA 3UMRA 1GG2A 3CZMA 3BHJA 3RS4A 1H3EA 1EXNA 4JT2A 2O2IA 3ED1A 1J21A 3SS7X 3THYB 3L8HA 2P3LA 4Z4CA 2PE5A 1JQ5A 4QOSA 5FUYA 4X1KB 4RGBA 2ZAYA 2O8NA 1B2LA 2ZRGA 1MH9A 4HAOA 1J99A 1O7JA 5KNCH 4HXFB 4QL3A 4A5SA 1VB5A 2Q5HA 4L02A 1KIFA 2P90A 2WJ3A 1TA4A 3AILA 1P80A 2I0FA 2XE8A 3GZTB 1GQQA 4U7GA 5L3QB 5KJ1A 2ZRNA 1AUPA 4MKFA 4ZV7A 3Q9UA 4BLTA 2PT6A 3AOEA 2I3BA 2OL4A 4F84A 2UKDA 4MWOA 2XWQA 5KOJB 2QQFA 2I6SA 2NW6A 4G1CA 3WIVA 4KXXA 3GLFE 2RIRA 1LZKA 4HC4A 4NE2A 4AMUA 4DMMA 1XFDA 5FR2A 5ARDA 1UIRA 3A6JA 1PYGA 1NQWA 4D02A 4WV3A 1M66A 4ODIA 3CVWA 2AMLA 1SZCA 3UEOA 5LBIA 4DB2A 5F52A 4LK2A 1QG2A 3SMVA 2YWDA 1GTRA 3GJYA 3O2SB 5EE0A 2W8BA 5EPEA 3V6LA 3E48A 3H87A 1YHZA 3ZQ6A 4JJ6A 4NJMB 3OWHA 4J1SA 3S2IA 1VCMA 1JFTA 1E2QA 4D9CA 4KPUA 2IYFA 3WNQA 3N0RA 3WK8A 4RNDB 1KNQA 3T7RA 3PL5A 1DPGA 1JIXA 1T8TA 2PKWA 4N40A 3FOAA 2CXSA 2BKAA 1RWBA 4FHEA 4CQLB 2J6CA 2R1TA 5I7WA 5FV7A 1LTQA 3ABZA 3Q9NA 1NG1A 2DETA 3P4YA 3IUSA 5FBZA 3QOFA 5EJFA 2PGAA 1G5PA 2HJRA 4M0DA 2HCJB 3LT1A 3WMXA 4AIIA 1F0KA 2P4UA 1BVHA 9LDTA 3W9UA 4BL5A 1Z7WA 5DGDA 4YJFA 1DPFA 4XQ0A 1MABB 2P77A 1U8UA 3T7CA 2I76A 2ZIUB 3ESQA 1ZGGA 4GSLA 1VI2A 3B5IA 4MGIR 4MV8A 3NBZC 1NZFA 3ZD6A 1GCGA 5IM5A 2XY4A 2YV5A 1D03A 1UXJA 3GQVA 2AN3A 1AHPA 3SFVA 3DMRA 5IAEA 3RSSA 3TD2A 2A5GA 4EPRA 1B0AA 1E92A 1O1YA 1Q84A 1T9GR 5HKLA 3ZU4A 4DC1A 5NULA 2WIGA 3EMDA 1U3FA 5E4YA 1RJ9B 3TAHA 5E2BA 4EATA 2M6RA 5LJLA 1AY0A 2FPLA 1FP2A 4R83A 5CCBA 3CVUA 2WUVA 4XW2A 1SRRA 3I5XA 4LXXA 4X84A 4UNSA 2Y2UA 1EUQA 5DW0A 4XJTA 4C2TA 3IQZA 3NXSA 5AI4A 4O2AA 1EDOA 2XHZA 3EPPA 2FEXA 3DR5A 5CJPA 3CB2A 4XB1A 1CBUA 1GAQA 1UWLA 3BC1A 3HR8A 1HDRA 1G7RA 3PWTA 4WDQA 5CEEA 3UK0A 2DHEA 4EUNA 4HEQA 2NVWA 2Q0XA 4EPXA 4QBFA 3HA2A 1F6WA 1M2VB 1MC4A 3AVOA 3ZE2B 3IXMA 3NIDB 1U3DA 4QT4A 3AF2A 1H94A 4ER7A 1KSFX 2ADMA 1XXHE 4BKRA 4JSTA 5JQGF 3RYCA 3A2MA 4F2DA 1A9SA 3LY9A 2H2FA 3ZHZA 1ISSA 1QGDA 1YB7A 3GP3A 3L5OA 3PXAA 4AF8A 5ARBA 1Y1LA 1N2EA 3VYTB 4DMFA 5IZCC 1NYRA 1WQ3A 3H0CA 5D8DA 5DP2A 2RGBA 1VPLA 3IQIX 1IB6A 3QY9A 1K75A 3C6BA 1YK0A 4FEAA 4OK3A 4AN4A 5CB6A 3NHWA 4BV2A 5C52B 4KVZA 2H5JA 2IELA 2A67A 1JIQA 4I2VA 3GRZA 4O1IA 5J40A 3T7EA 3TI9A 3TLYA 2FR8A 5LD2B 2AMVA 1I7QB 4TOIA 3A9RA 2BVNA 4WCFA 2ZYIA 1N5OX 4ESEA 5JZSA 4GEKA 2IS4A 3DF7A 1XZPA 5LC1A 1TKBA 3H97A 3A4TA 3OC0A 3PE4A 1SU6A 4XJXA 4HLDA 1KRHA 4IXDA 2PZMA 3VUEA 3D7KA 4EF6A 5HTOA 3QEAZ 2OZLA 3ZGVA 1SJ9A 1FF9A 2HBYA 2ZBRA 3I6MA 4ZA2A 3NHPA 1IIBA 4M36A 5CFPA 2C7RA 4KYTA 2Q1WA 2OV2A 5JDIC 2LIPA 4FT2A 4NBLA 1W44A 3WBFA 1FLNA 1GCUA 2VSXA 1KZ4A 3TFWA 3IULA 4RVHA 1M8GA 1S4MA 1K6EA 3NONA 1MG0A 1B0UA 1PF7E 2Z09A 1NVTA 2Z6VA 1L0BA 3BSWA 4U8GA 3MGGA 1XDUA 2WTBA 1GQSA 3F4LA 3U4AA 5AFSA 3L4JA 1CEYA 3AL3A 5C4IA 4MKRA 4MICA 1QB7A 1TJ5A 1NQVA 1K5HA 4TKZA 5DYWA 3GNLA 1I4DD 1N2JA 3OOSA 4YASA 5GPBA 5AVXA 1SURA 2V03A 3OQIA 4C22A 4EMTA 5KNBD 3KDPA 1KBOA 4BX2A 3U80A 3NWBA 4TKUB 4OGLA 5E1MA 2V98A 3JQ8B 3KR0A 1DTWB 4TRNA 3OZXA 1ZGAA 1ZM3A 3E7WA 1WY7A 3ZG6A 1Z0SA 1W34A 2OWDA 3FCSB 5AKEA 3RVRA 4K9SA 3WE7A 3QVWA 3MCAA 1NJGA 8OHMA 2FG7C 2QKYA 3I12A 2FZEA 4N3CA 3AB8A 1K7XB 4IDFA 5IXJA 1ZI6A 4WESA 3F1KA 3NO4A 5IM4F 4EJSA 4B3IA 1F8XA 4B31A 5A2GA 1RSZA 3G59A 4XX0B 5CT9A 2GZ2A 1O9GA 2IEZA 3FTFA 3DMGA 1ZO8A 3V8NA 1KC3A 4RQBA 3WGTA 2Y9PB 4ON9A 3QBJA 2XODA 5JPCA 2QX8A 2QRZA 5L7YA 4CHTA 4WNYA 4A7PA 3L6BA 1EM8B 2Z3VA 3FSEA 3T7TA 2FV8A 4X90A 1N2ZA 3HN6A 4I6GA 5FP0A 3ZS8A 2ZDQA 4FFVA 3RTGA 4ZO7A 3RWOA 4CG0A 1PK7A 3I0NA 2K2QB 3R3ZA 4TV9A 5KVQA 3KC2A 2E82A 3WJ7A 3PDWA 3P9YA 1RADA 2ONYA 2WIFA 3PQ6A 5JSZA 3CN9A 4KUGA 1CQZA 1XNHA 1J8QA 2PH7A 3QLVA 3DTVB 1V1RA 4R4JA 1QYRA 3RLFA 4BQEA 5EJ5A 2CJXA 2FPGA 1GU7A 1TGYA 3N53A 1KEEA 1XN1A 1Z6ZA 2VNIA 1KQFA 3S27A 5HA5A 5CK5A 3M4NA 4G0OA 4F1JA 4ZOLF 3HXKA 3QEMB 1E7SA 3HCEA 1OLOA 3USES 4EI9A 1J2JA 1AQUA 3BB1A 2Q46A 3GPDG 3I01A 1HDCA 5F12A 4N0EA 4OQDA 2EWVA 4KXLA 5KCMA 4B6FA 5K3OA 4LDAA 3NCTA 1M1NA 1R10A 1U28C 4RS4A 1R27A 4PZPA 2QX4A 4H17A 5DLYA 4O4IF 1XZCA 4WXPA 2VPYA 1PJLA 2JFQA 1SHJA 1MOSA 3O92A 4QGHA 1GR0A 2WP8J 4RTQA 1Y8RA 1JHPA 3ROXA 1E0DA 2VT3A 3V7FA 3DWEX 4CQMD 1AZTA 1Y5MA 2QQGA 3EIOA 1CJKC 1NPYA 3OD5A 4XLLA 4F3KA 3PHGA 4PZCA 2HCFA 2QAIA 1II8B 3M1AA 3E81A 4OJNA 1E5VA 2VSFA 3GMTA 3NYIA 5AO9A 3RTDA 3TTTA 4K03A 2BSXA 3LUDA 2FE1A 3QNUA 4N65A 5IC6A 3T9DA 4BN0A 3B70A 3O84A 1G5RA 4IQGA 4MQLA 1XJ5A 4QNNA 1E2BA 5DSXA 2RJOA 4F8EA 4D44A 4TS3A 1D4OA 3T3EA 2IHNA 2IPOA 1V5IA 3E7FA 4KE8A 1VGQA 2G5GX 3HYLA 1VKOA 4U2CA 5TQJA 3A1UA 3OEYA 2B4TO 4ZHQB 1GOTA 2XA2A 3IKMB 4H6VA 4GSYA 1A5BB 4U9HS 3IEKA 2QRJA 4HZUB 2XB2A 3LECA 1T1RA 4C0KA 3FPGA 4AP9A 5P8WA 2X1LA 2OD7A 1CR2A 3C3JA 1Z5PA 1KGDA 4ZOCA 5IVDA 4LDJA 1M6NA 1Y4UA 2I7DA 3HJFA 4FWTA 2GJAA 3F74A 2NPFA 3ULKA 1YS2X 2BZGA 2X0DA 1PL7A 5F7OA 2XCUA 2H00A 3B6EA 3DT9A 4D9KA 1KHHA 4RV5A 5CA1F 1KNXA 2XNSA 5BQXA 4B2IA 4RK4A 1DS6A 1NF3A 4P93A 1SU7A 2GPJA 2OGZA 4MUEA 3UH1A 4TT8A 1KYZA 1JW9B 2IZ6A 1THZA 3FROA 4A73A 1NOKA 1DRVA 4DJFC 1CYEA 4FE3A 2IZ0A 4HNRA 2ZATA 4IX1A 3HE3A 2AW5A 3A4VA 2EBWA 4Z9FA 1BXRA 1SHLA 2NSHA 2J9ZB 1YGYA 3G13A 4KDFA 4M9UA 1CQJB 4MRMB 3L0YA 1FDTA 2PAAA 1XMJA 4PNHA 2Q3LA 3OJFA 1QF7A 3THYA 1Z0UA 3JYHA 1TU3A 4Y2UA 5LXTB 2QOEA 5K3BA 1RWVA 4X1KA 2PWYA 2OV6A 4GDFA 3AUTA 3FH0A 5A6VA 3BCUA 1QYIA 3LY7A 3IXQA 2W2LA 2ZKLA 1H8EA 3SM3A 6Q21A 3E22B 1M1YA 3QJYA 1AUOA 3MT0A 1ULTA 3S6JA 1U0TA 2JGKA 1Q2UA 3A0UA 1ZD2P 1HDEA 4QYIB 1QNLA 3JXEA 2WYVA 4FOSA 5EPUA 3V1LA 1XF9A 5EJAA 1Q22A 1W4CA 3B1KA 3JYNA 2PRZA 3AUYA 3GX1A 1SU4A 4MVCA 4QFDA 3Q1LA 5AW8A 3LVQE 1I80A 1ITZA 3PRKE 1GP2A 5ALEA 3UXHA 1AX9A 2Q3CA 2JCGA 3CHYA 4B44A 1P7YA 4XWKA 1JL3A 5KOJA 3T1QA 1GNLA 2BJWA 3AXTA 4RE5A 4UJ5A 4X64B 1I3KA 1KJ8A 1NZDA 1XA4A 1YA4A 4MWZA 2DB3A 3SX2A 5M5BA 1SC9A 4BLRA 1OLXB 3T5MA 3U7QB 1O94D 2OXCA 3NC0C 1KKUA 1EYZA 1NWCA 4HOYA 2WDPA 2N75A 2PLRA 3KWLA 3R2JA 5MN4A 1EM6A 4GNRA 2VHEA 3WP1B 4LEIA 1KEZA 1W2HA 4LWOA 4P7FA 4D56A 1J90A 3NNDA 5L45A 4MYDA 1EFUA 1RC1A 4P92A 3KJNA 1DBVO 3KJXA 3P9ZA 3QP9A 2XGGA 5TEWA 4COKA 3CINA 4E0BA 2WA2A 3K35A 1VL0A 2V97A 3Q3HA 1TKRA 1IEXA 2C2KA 1H8HA 2GEJA 3A3NA 2VYND 4H7HA 3IKJA 1CSEE 1QV6A 1XWFA 1KVSA 2BZ1A 2HJWA 4FU0A 4WFQA 5B3LA 3CMCO 4FFPA 2VJNA 2Y92A 1M1YE 2WSMA 4CQLA 5KVCA 1RC0A 3S2YA 4PTZA 4F6LA 3IOBA 5ICSA 3LUHA 4I46A 2VHXA 5C0OE 4EQ6B 1H5NA 3DUWA 4DLRA 1SPBS 2PKEA 3RU3A 3ZDQA 4DLZA 4EW3A 4J1TA 2QPLA 4G26A 3BJRA 1DFGA 3ZXYA 2MU1A 3MEQA 1AB5A 3UPTA 3K94A 3WB1A 4LGMA 3NJRA 1MABA 1DNPA 1JI0A 4J7AA 4CN8A 3HJUA 4RQUA 4EPWA 3RVMA 4JFRA 3MUNA 3L0OA 4X7PA 5BQOA 4DR4B 1ETUA 1OWMA 1J2TA 1UMBB 3DDUA 3HDHA 3R74A 4CEIB 1MNAA 1XDBA 1RQPA 3P9KA 5A0VA 4BQRA 4IH1A 3PJGA 4KR9A 4ER6A 4OJTA 4D3SA 5FAXA 2HNBA 1QIEA 1L7RA 1RJ9A 3VU3A 2XTMA 1F4LA 1FFXB 4J0HA 4JOQA 1DXQA 2JEYA 4EECA 4M38A 5DJ5A 3W8RA 3DZ8A 3ZBTA 2R66A 2AR0A 2YJTD 4OKSA 4IYRA 4ZVMA 1H4VB 1KAGA 3IT0A 4OHVA 1KY4A 3VNRA 4WLVA 2G9NA 2H31A 3HMQA 2VJYA 1QH9A 3BIWA 3KD3A 3RUFA 1Q11A 1A7AA 2MHCA 3KQUA 3KALA 4OMCA 4EYOA 2IU4A 2W0SA 2XUAA 3EFBA 4PSVA 4U9UA 4Y0AA 1E1KA 3KJQA 4BO2A 1C1XB 3O8QB 3SJBA 1XL1A 3GL9A 3RVBA 2DR2A 1H3FA 3E2IA 3PXEA 2IVZA 4YP5A 1T0HB 2Q5FA 3L4BA 1WXQA 3A1NA 4YTEA 2I1VB 4G8BA 4BBAA 2P2LA 1MJGA 2E85A 1PUJA 4KQFA 1JALA 4JUFA 1O97C 4CV2A 5IBPA 3P4XA 3VYVA 2BM8A 3RC3A 3PBKA 4DM3A 4EB0A 2ZGVA 4AAYA 3WXMA 2BH9A 3SWWA 4CR6A 1GQYA 1F8UA 7REQB 1DI0A 1Y80A 3B9PA 3G6KA 4I4NA 1GEEA 4JLKA 4BGUA 3W05A 4E46A 4E5DA 3H2ZA 5LP6C 2VSQA 3JQ9C 5ITZB 1BQ4A 4RY2A 4JZYA 1O5IA 1QVAA 3D43A 3J7AC 3VRHA 1Z4PX 2CFSA 3P2EA 4TLLB 2RAVA 2Q5QA 1KVRA 2R8BA 1L5MA 2QF7A 1O6ZA 2FUKA 4GP9A 4HEA6 2QHXA 3A1CA 1YDGA 2IEIA 1ZLXA 3GH3A 5AXAA 1YZHA 3LWDA 3R3VA 2PJZA 4I9FA 4IJMA 5JSQA 3VR4A 4BJHB 1W0JD 1ZQ9A 4PGAA 2DERA 2VP2A 1ZGCA 2CLCX 3ZXUB 1IE3A 4DXHA 1UC4B 5DNAA 1O89A 2J5QA 1E9SA 2R4TA 1NHGA 5I9NA 1DKMA 5AI9A 3BXGA 5JC1A 1ULHA 1GU1A 1X1SA 4H59A 3UPUA 3ISTA 4OFXA 3Q8LA 5EP3A 4EITA 5BSUA 5L3SA 3D8SA 1QYXA 2RIPA 3L7MA 4FBLA 4H6WA 5CFZA 2PM8A 2YN0A 3EEYA 1NN0A 3PKIA 3G8DA 2GK4A 4LCJA 3KSAC 2PKQO 1VLHA 3N86A 3PPYA 1EK5A 4PSCA 4AURA 4KSYA 1SRQA 1R0WA 1TYEB 3FD8A 3QPVA 3L7NA 2BFWA 3RDPA 4TKUA 2GOYA 3TIGA 4EF5A 4URVR 1AHNA 3JQ8A 4WZBA 1DTWA 2QN9A 4RGYA 4LCBA 1SK8A 4IS3A 5GOTA 3ZIAD 1S0UA 3LBAA 4ZVSA 1BQEA 4TSFD 3WLFA 3QV1A 1J56A 4RTKA 3WJ1A 4DWOA 2EJCA 2VRCD 3P2YA 5PNTA 3SAJA 1J00A 2WTXA 3GNQA 4L5JA 4MYSA 3T3IA 4DSUA 1R6TA 1OKKA 2BGJA 2TS1A 2VRBA 2DFTA 3FDJA 1EXMA 1V41E 2PGLA 4HXEB 3RUAA 5JAUA 1N3IA 2X4GA 3KTFA 5AXBA 3ID6C 3SJZA 2E4AA 2TSYB 2OBBA 1X74A 1H6AA 2A2ZA 1IBCA 3CBQA 3ZK8A 3SNHA 3HKDB 3EDMA 2V96A 5JS8A 1KETA 2X86A 3GG2A 2FPRA 3L4SO 1QP7A 2X41A 3IV6A 4DJ5X 4WJLA 5KYKA 2N1BA 3NAZA 4C14A 1CIJA 3H8SA 4IZ6A 4ZQIA 4EZIA 4ZCPA 4YQZA 3K8OE 1T2DA 2FMTA 3KQYA 2ZUBA 1U2EA 2WJGA 4ALIA 5LA6F 3L77A 1WOYA 4D45A 4F12A 1GAXA 1OU0A 3FKSD 4QE3A 2IC5A 4JJAA 4WZBE 3ZHUA 1L7EA 3I0ZA 1M75A 3BE8A 3CF2A 3TBKA 1EXVA 4YRCA 1JVSA 1TYDE 3DAYA 1U63A 1FP4A 1TYAE 2J46A 3ZZMA 2R87A 3N8IA 1XTUA 2W93A 2F3QA 3C87A 1C1DA 1ICEA 1D2MA 4MWTA 1XMOB 1KAQA 3EGWA 4H1HA 5L51A 3DQZA 3O0TA 1HE5A 5CNJA 4PNZA 2BWJA 4DDKA 2XBUA 2AN4A 2ZJ0A 3LU1A 3MJSA 4YALA 5JEEA 4C78A 1HDIA 2I2FA 2G3YA 3C8DA 1DO2A 4FHCA 3TR6A 3AF6A 2Y3IA 3PXCX 4CIWA 3CG4A 1T3ZA 3UGKA 1LBHA 1GZ6A 2A84A 1JG7A 2RGCA 3L6EA 3MCUA 3ML1A 4UXHA 5JNLA 4KPYA 3I61A 4BMSA 1GZUA 4DJAA 3HG7A 2ST1A 3A1SA 4BE7B 2CCGA 5JS1A 4IKOA 1SVNA 5EXTA 5CM9C 4O2BF 2P9ZA 2WKQA 2IZOA 4DA0A 4YUYA 5B6JA 1N9GB 2QUAA 2XVMA 4PHTA 1NKTA 4HDSA 4MV3A 1KMCA 2R6DA 1V5FA 5CW2A 5DF1A 1ZAYA 3F9RA 1II8A 5CH8A 2LUOA 4FC7A 3OECA 1RHQA 3H2IA 1KEWA 4BO7A 3D2LA 5EKUA 2FP4B 2ONKA 2AW3A 3BK7A 3M6VA 4WQMA 4ID3A 1GLGA 2NQ8A 4JOBA 5IZCA 4DM4A 1XTTA 1RRVA 3H2BA 4P2GA 2XMBA 5SYAA 4WXYB 2VAMA 5J5CA 3H2SA 1YS4A 3TRIA 5LP6B 3NMUF 5LB2A 2NSJA 1Q57A 3OFNA 4FOTA 4OXXA 4BMZA 1HFKA 2FEWB 3AIMA 1Y89A 2DWCA 2PGOA 1TQ8A 1WP4A 3HA5A 4AXBA 4BVGA 4ZHQA 2NMVA 1WDMA 5EUBA 2P9YA 2YWBA 3ESXA 2JARA 2O20A 1JLKA 2SKEA 1UPUA 1Y0BA 1V8BA 2A88A 1W2GA 2DWQA 4HZUA 1GV0A 2ROQA 4KFSA 4V3CA 1JBKA 1XQXA 2ZR7A 1GPAA 3OLZA 4KN5A 1LDGA 3F3KA 3G0OA 3MGAA 4LZOA 4OL0A 4ZQGA 1H5QA 1QO0A 2XTAA 2G08A 4PPNA 3ZHXA 3R4VA 5EHZA 3L05A 2DRIA 3LX5A 3PNMA 3P32A 5CLGA 5DGXA 4DNXA 1C4XA 4I1VA 2NO5A 5HHTA 1E7YA 5I7AA 4CCAA 4F38A 5JDIA 2JVIA 4LX8A 1VP9A 1P5JA 2ZUWA 4IJQA 4YRKA 1FZTA 2CF6A 3Q9LA 4QPZA 4Y0VA 4NS4A 4Y9UA 4MP3A 4YUXA 1OF1A 4P3XA 4F4JA 4QUGA 4NSNA 2H16A 2W6IA 1DKRA 2DQSA 3NTOA 3QBDA 1A7UA 3JVUA 3D3EA 1CVIA 3QNWA 1MKYA 1QZXA 1YRHA 2VQEB 2XXAB 5BSTA 2P4HX 4DV4B 1YCGA 2EKDA 1WOMA 4L5YA 2D6FA 1DJLA 2IOQA 1KH3A 1G20A 4IMJB 4EBFA 1PVVA 1UXHA 3H5RA 5LXTA 1Z6GA 4UW9A 4M9SA 3QNMA 2HMSA 3H1AA 2XB6A 1JIVA 1XCPA 2R60A 3E22A 2WWGA 4TX1A 4QYIA 1X9IA 2O0HA 3GRAA 1AGPA 3PHIA 5EY5B 1FFDA 5ALMA 4MRNA 2W2MA 4Y2YA 5ESDA 2GLUA 2IOYA 5ILGA 5B7QA 2YJNA 4FZRA 1UJBA 4UZFA 1MQ9A 5GGYA 5K4HA 4WZ6A 5EMNA 3FDIA 1LNQA 2GAFA 2IP1A 4GI2A 4PLZA 4Z1MD 1EFLA 2GD2A 1ZOLA 1ADGA 4OQYA 3GJ7A 1NJ6A 4TL6A 1MO4A 1VSVA 2BE9A 4J3FA 5IDWA 2IUYA 1XIVA 3U7QA 2YJ3A 2EX4A 4YNBA 1MXHA 2X2EA 4XEHA 1K4YA 1RKQA 4LSZA 2WZCA 3TQOA 1XMPA 1GYRA 3BRQA 3R41A 4XVHA 3TMKA 2AOWA 3PUZA 4YDHB 1NXSA 2YQ4A 2WB2A 1BRMA 3BYZA 2ZQ5A 1G20E 1ORWA 1YDEA 2HRQA 4FX2A 2WEKA 5JASA 2G04A 3BFVA 1FP7A 2RI1A 4GYKA 1UFQA 4P34A 4IDBA 1ECPA 3QOXA 2X1HA 3EIUA 3HB1A 4LTDA 2QTTA 3TF5A 1Z3IX 2NSYA 3C7TA 4GBED 3EG5A 2YL2A 4MK4A 1YZFA 3IP9A 2XF8A 4B5LA 2VHYA 4BFWA 3VPHA 4EQ6A 2YMQA 1EZ4A 5DGCA 4IEEA 1SG6A 2V74B 2MSCB 5BWOA 1RE0A 1V95A 2BKXA 4RCYA 5DHFA 4HN9A 2J4FA 5AW4A 3KEGA 1XE3A 3FTCA 4V1CA 1ZRMA 2HSJA 3E9RA 3QMPA 4OY3A 4B45A 1NVGA 4CDGA 4EF4A 5B7PA 3PEYA 3DVRX 4EM6A 2PUDA 3W5DA 4XH9B 1CVRA 1DAIA 1GADO 13PKA 1UMBA 2JIPA 2PGJA 4LOLA 3U3OA 4CLHA 3ICEA 2NO4A 3PHJA 3QKUA 1GPUA 3AESB 4Q6BA 4NV1A 4UAUA 2C84A 2NP6A 1TVKB 2ZJFA 4B6GA 1ZCBA 5DNDA 1ODCA 5ALGA 1UXOA 3FBGA 5FBKA 1FFXA 3OJ0A 4DTIA 3UMBA 3EWSA 1W49A 1DG1G 3LHFA 2Q5CA 3RYFA 3WNDA 2CZGA 2VBCA 4RMIA 4W1SA 1IB0A 3G85A 1INLA 2C9MA 4S0ZA 2AV6A 5LQAA 1H2BA 4Y6SA 4Q3LA 4EG4A 2WYWA 1TCUA 4L7VA 5CTJA 4ZOAA 1E1NA 1NLMA 1JTFA 1Y33E 3WYBA 4BQIA 3KD2A 4EEKA 1T1JA 1S7GA 2D74A 1Z39A 4D9MA 1X80B 1C1XA 1T5BA 1VL2A 2C0PA 2YS7A 3O93A 5KYYB 1G38A 2JLAA 4I1IA 1S8OA 3LLUA 3P5SA 4Q3OA 4GOND 1IPFA 2ACKA 2NUBA 4WPGA 2H8GA 1HFWA 2GH1A 1UR5A 2BRUC 2GCNA 4L73A 2I2CA 4N6NA 1US8B 2DY0A 3EVGA 2UYCA 1DFHA 5DBFA 1ICIA 2ZJYA 1OPXA 3C7DB 2Y6UA 3COVA 4M37A 4AIRA 4DXAA 2V5VA 5ITWA 5TMEA 7REQA 2VBFA 3IAEA 1RRGA 1M5TA 3QPAA 4ZVRA 3L7LA 4GUDA 1L7AA 2NU9B 1UJ6A 3CRW1 4ENTA 2X22A 2D13A 3WWOA 3KV1A 1BX0A 5ITZA 1XROA 4O3FA 4NCKA 3S2GA 4JODA 3URMA 4DN6A 4IXTA 1SQ0A 1PW7A 2E4VA 3CZ9A 1JHOA 3KSRA 3OCCA 2XCSB 4LOIA 1JE1A 1T5SA 2MSDB 1N36B 1NUSA 1XYVA 2WA1A 3E5NA 4JUBA 4H18A 5DSZA 1ZEMA 3S8MA 1VRVA 5I48A 3MJCA 1ENPA 2FW7A 4BX0A 1N6RA 2O3TA 3P0FA 1IVYA 2E4YA 2Q0SA 3LGSA 4PQFA 1CRWG 5D1NA 4GM1A 4X20B 3RIEA 1ISIA 2XYQA 4TQAA 4WK0B 2OBMA 4IGKA 4NU6A 4X8HA 2HZBA 4Y6RA 5BSRA 3NHJA 3U7JA 4ZJZA 2BF4A 3ECSA 4J9UE 1A50B 3AZQA 1CY1A 2QVXX 4NWIA 4BP9A 5KSOA 3SVTA 4NMXB 5CM8B 4XSVA 1UBJS 1FXWF 1GITA 4L9WA 1LK7A 4RO0A 1RP1A 3ORYA 5IAAA 3O94A 1BW9B 1FQOA 4HJRA 2BHTA 1OA0A 2VAPA 5LLTA 3K92A 3CLRD 2B25A 3S81A 3IP3A 1M2OB 1Z12A 3OLYA 3E9EA 3U81A 1BVYF 1TRHA 2G67A 3BERA 3N2KA 2VK1A 5IKOA 3ZHTA 1EE2A 1W35A 4P32A 3UT6A 3QVLA 4L50A 2O3SA 4P82A 1NNI1 2C4TA 1AKMA 1H9BA 3HVRA 2XVAA 4KX3A 2C7OA 4OQQA 4RPGA 5TXGA 1GM5A 3GUYA 5A5VA 4MRSA 2JFFA 2DF8A 3JPWA 2M6SA 4FWBA 4XASA 1E2UA 3I2IA 1G4UR 3HDTA 3LYAA 3E7PA 1DUSA 1RBMA 3MLBA 4HDNA 2VTKA 1V3VA 5IG2A 3C4VA 3KVRA 4RE6A 3IUNA 3PVZA 2V6FA 2WIBA 4MW7A 5JOQA 3WAKA 1UEJA 3QXCA 5BUQA 2D06A 4DC0A 4FNOA 2YNMC 1XD9A 2J9XB 3F6RA 2X9GA 1YB6A 1OBVA 5T4EA 3WGVA 1ZM9A 3MWJA 3DKIA 4BXOA 4IOMA 4NEGA 4B0PA 1YQXA 3NWEA 3W5SA 5ITSA 2Y1XA 2XTZA 3O2QB 5AMXA 3ENVA 1SEVA 3FMGA 3W3ZB 5F2NA 2LGJA 5EINA 2ACWA 1WY5A 4O4LB 3HKDA 4ARCA 2R8PA 3RS5A 4DRYA 4C6TA 5TVGA 2NU8A 5M29A 1NQXA 2C9OA 1YACA 2VUTA 5DYTA 3BA1A 4KWEA 4BGVA 5JXJA 1JE0A 1YDMA 4QHYA 2PKXA 3QHPA 3T8YA 1JMYA 2J3KA 4ZEMA 5AJUA 1FNCA 1F7UA 3GGOA 1XMSA 4RHCA 3OWXA 4RZ2A 3OT5A 1NJSA 3HL0A 1Z4QA 2FZ5A 1S96A 4ROTA 3ODGA 1NUQA 2QTLA 3P9QA 5E2AA 4BNZA 3KAPA 4OHFA 4R1SA 1T2UA 3IUQA 4NABA 2CE2X 3K1AB 4ETMA 1GFIA 1VIVA 4FKZA 3RAEC 3U6KA 5EJ7A 1WTAA 2APJA 5HKKA 4AJ9A 4MR8B 1A8IA 2WVHA 1D1QA 3NI2A 1YS7A 1C3XA 3PHHA 1S2OA 4JT8A 4JJ8A 4MW6A 4DZTA 1KP2A 4IHAA 1LH0A 1U2ZA 1T6BY 1Z35A 2BKLA 1O95D 1OBHA 3AQ4A 2R6AA 5AVTA 5JZMA 5LDDC 2V3WA 1U1CA 2HSZA 3OZCA 4Q3EA 5BMVF 2C07A 3PUIA 1AC5A 2WU4A 5AKZA 5KOHB 4H0NA 4PHHA 5AJHA 3A3PA 5JAOA 1RYBA 5A5EA 1N9GA 3UW3A 2GKGA 4FBMA 4EKNB 5LOVA 2CSXA 3UJAA 1KGSA 1W6UA 3O03A 3D6MA 5K03A 1AQNA 4B6JA 3UKJA 2VZ8A 4M54A 3WGHA 3ER9A 1QZTA 2LV8A 3IOYA 3KE8A 4JIMA 3PQFA 4GYYA 4B81A 2BIFA 4BMNA 4Z86A 1IYZA 1Q14A 2YW2A 4ZAWA 4FZVA 4XXHA 1ABEA 2IYYA 5LP1A 1NNLA 3BGWA 1P74A 3OZVA 1NFRA 2PGNA 1IN5A 2ZIGA 3FR8A 3O4VA 3O8OB 3JQ9A 3OUZA 3EZ2A 3BX1A 4IMPA 5DTMA 5JCJA 3ZV4A 4F71A 2X8LA 1X39A 2QMUA 1T35A 3LQKA 1IMJA 3MJDA 3NKVA 3IE1A 1TLLA 2BR5A 2QTVB 4ZREA 4QOJA 5MDHA 2PUVA 1NIJA 3KB2A 2DH6A 1GQFA 3HHPA 2ZIAA 3USCS 5CEFA 2GFQA 3RAJA 3ZEAA 5IUJC 1YA6A 5G4KA 3GWGA 1OILA 3L46A 4ZYYA 1GV1A 1PJ8A 1H2XA 1TLTA 3DM5A 4ZAYA 5G0SA 3TSCA 4NPCA 4X91A 3OF3A 3ZJTA 4QBKA 1G6HA 2ZRHA 3DEYX 3NRBA 1TW2A 5COBA 3ZQKA 1BMQA 1SBZA 5EZYA 2W43A 3HEBA 3JWEA 1L7XA 4P36A 1W75A 4R8KA 4DC9A 1T4GA 2VJCA 4MKZA 4F6RA 2G36A 1OYWA 3MIZA 2GSDA 1YIDA 3IOCA 2Q1SA 3VHQA 1RI4A 3WMWA 4B3SB 2PQ6A 4HP8A 3ZBQA 1FUEA 1VLJA 1VZ3A 5JAHA 1JYEA 2P6UA 3RS9A 5FKJA 4BX8A 4RZUA 3P97A 1ECBA 2Q3JA 1T8SA 3P71T 5DTRA 3TIVA 2EZUA 4CN9A 4BGDA 3ZGZA 1D4AA 2BCEA 4KVGA 4OBBA 3DC7A 3GRFA 4Q16A 1CS0A 1UDWA 1ZAKA 4P4LA 4LG1A 2OCLA 2P0AA 4P7JA 4KO3S 1Z0FA 4KQEA 3LYUA 4O02B 5D5HA 5G0TA 3EZLA 2AKEA 5LU9A 3KT8A 1T0IA 3STTA 3ICQB 3H7AA 3OY2A 3FZEA 1W5FA 1O5OA 5IAGA 2QMOA 3C6MA 2NUPB 3ZDCA 3T9AA 5K9ZA 2Z58A 1TJ3A 3N0WA 1V9CA 3HJBA 5I51A 5JEDA 1DTEA 1U9CA 2OV1A 3WBKA 2H07A 3QQ5A 1NJFA 3IR7A 4PHCA 3JR3A 3Q6IA 2B83A 2ZYGA 3IIIA 2J6IA 3CPHA 4XARA 3IDAA 1GN9A 4CFSA 2JAWA 4TS1A 4BQPA 1E2PA 3KR2A 1PG2A 2IHYA 3VZDA 4DZRA 2ZXUA 7ADHA 1XVAA 4MIYA 2FN7A 4JITA 2Q4EA 3AF0A 1XGKA 4OMFG 1L9KA 2PPVA 4FLEA 3RJ9A 4LI0A 5ELLA 3UHAA 2WWRA 1NFQA 4ZYZA 1QP4A 1WDWB 3CE9A 4PRYA 3WB9A 3E9NA 5KKNB 1J4AA 2V6GA 4R69A 2NAPA 1NW4A 2VYCA 4V0MA 1FXUA 1CZUA 2HDHA 3GAZA 4U7HA 2YKGA 2EYQA 3FSJX 4MGZR 2QMQA 4EZEA 4JU9A 3N0XA 4ZKDA 5IVKA 4OXQA 5FOVA 3RVLA 4LF9B 5KQLA 2WHEA 3HV2A 2KM1A 3SXJA 4BV9A 4L78A 3D59A 4P84A 1K8QA 3IAXA 2O2YA 2BEUA 2H1WA 2RONA 4QPPA 5C7IO 4TRRA 1CIVA 5LQSA 5D86A 4O4HF 1L5NA 1FRQA 1WEHA 2YN2A 2XMSA 1H6CA 3SQMA 4FNAA 4Y2GA 3KR9A 3E9ZA 1Y48E 4BZQA 3IXLA 1EJ0A 3ANSA 4M1KA 3GAFA 4PGFA 4Q7EA 3BILA 3K6RA 3WRYC 5A3RA 5A03A 4IGIA 2NTJA 1D2AA 3KK0A 3SNKA 3G2IA 4QXPA 2XQGA 3QELA 3OCJA 1VHQA 1VE7A 3RR2A 4C9BA 4E07A 4KDCA 5IPFA 1BEEA 1E4EB 3LA6A 4DF3A 4JP5A 3GW8A 3VNAA 4YK7A 3RRZA 4TKLA 1CZKA 4C0JA 2GYYA 2FR1A 1OGIA 1N6LA 3L01A 1SEPA 5CJJA 3BRCA 2ZWIA 1S3IA 4BYMA 4ER3A 4V0ME 1DJPA 2H2IA 2QD4A 2R8RA 3GA0A 5E7QA 3ESYA 1KP3A 1HQCA 2CYCA 4EELA 1XMIA 4V0KA 3OFKA 1BZYA 2OC4A 1IFXA 4OA8A 1ZH2A 1SVWA 3E35A 2HMYB 2EBUA 3FTPA 2ZSAA 5KNBH 5C4GB 4IINA 3SE7A 3OE5A 2ZM6B 2LKCA 4WBXC 4ZGBA 4RMGA 4F8YA 3JAWB 2PMWB 2XLCA 1DIHA 5HG0A 3OY7A 4EYQA 5JCZA 2PRIA 4RWZA 5EMHA 2XGOA 2R1UA 2PSEA 3WQQA 3LUGA 5D3MA 2YHUA 4D41A 4BKOA 2X9LA 1DBPA 4JI1B 3KL4A 2WKWA 1XLVA 3EBLA 4FDVA 2NYAA 3OZ7A 3IDOA 3HB9A 4D82A 1A8SA 2ORYA 5A7FA 5JQGB 2CXQA 1CW2B 2FFAA 4C3UA 5KYYA 5AW2A 3QXJA 4B6EA 4UOQA 1V6SA 3MMPA 1Q77A 2FVXA 4Q1AA 4D4IA 2OXIA 3JAKA 1WW3A 3F6CA 1A7JA 1RRMA 1ZD5A 1HGXA 1N2OA 1ZI8A 2HWKA 4WNAB 5AVVA 2BBWA 2QW1A 4IUYA 4NY1A 5H80A 2QSJA 1CUHA 2A0XA 3F7MA 4E32A 1US8A 3DGFC 4UOZA 3ANXA 3QI7A 2SICE 1P2GA 3PNPA 4WEQA 4YUVA 2D59A 2NU9A 4ZDWA 5BR8B 1WBDA 3S68A 1XALA 2JL1A 3E3NA 4LJ6A 2XXBA 1HQKA 4CG3A 5AUNB 5JWOA 5CIYA 2A0YA 3M4ZA 4ECAA 3QXGA 3VO1A 3OM0A 2AMFA 3CO0S 3FYDA 5JZ9A 3KQNA 3IBCA 4GH5A 3FKQA 1GDHA 5G4LA 4A0SA 3BQMB 4OHOA 3CXUA 1JV2B 1WHTB 5B30A 1DBIA 2XZDA 3IV9A 3RYHB 4F11A 3PQ8A 3JASB 4WACA 5TJ9A 4E5YA 2FSUA 1DOHA 2QTAA 2O0LA 4UVDA 2ATEA 4DEYA 3THOA 1GKKA 4JI3B 5ITVA 3NIFB 4QIHA 3OOEA 5TLSA 2BSQA 2A9JA 3NDJA 3LWZA 4AUNA 4PONA 3GT7A 1BW9A 1HY3A 1I1OA 3NHMA 2BM9A 4DQVA 1WABA 3DOHA 4B4DA 5ADVA 1TK2A 1YE5A 4BFTA 3GGCA 1N7JA 2YVLA 3PIDA 3WGGA 2P6PA 4F4FA 6ABPA 4S05A 3QYJA 2XF2A 1ECCA 2XUOA 1DG9A 4I4IA 3VZQA 1CRZA 1EHCA 1K3FA 1SCJA 2H2DA 3AVQA 4E3ZA 1Y7PA 5ELXA 2V7VA 3I53A 3L8GA 2P2DA 4FCCA 1HDZA 2WD7B 2ZYAA 3TRFA 2B4AA 4B85A 2PUJA 3H6KA 3NOOA 2J0UB 1CUJA 3ZVKA 5FRDA 3FR7A 4KPEC 2W71A 4KQCA 1G5FA 1MJGM 4IIHA 3CH7A 4J07A 3Q7TA 2UU9B 3DEZA 1H65A 2EDAA 4EKYA 2DHQA 2NPOA 1CJCA 2PMFA 3GU3A 1N4DA 3I6ZA 3O7MA 1P1KA 3S4YA 4OLBA 2XX3A 1O08A 4OQZA 4R2JA 2H57A 2RGYA 5JNRA 3K16A 4QYSA 3WZ2A 5CNIA 2VJQA 1N5JA 2Q9UA 2H1IA 3I2JA 4JI5B 3WQSB 5HZKA 2X2PA 3WR5A 3NKFA 4R68A 5BWLA 1FQKA 3QVGB 3QWBA 1JAXA 1U8ZA 3QBEA 4J6FA 4R2MA 5EIBC 3CA8A 5JO9A 4F4HA 1WMSA 3IJPA 3ZVMA 2HMTA 4WUTA 3S1LA 5H83A 3EPRA 2IEYA 1MRZA 1Y5RA 4PTLA 3H7IA 3UJBA 5JCPA 4O4LA 3QKSA 3OPNA 4LZNA 4J4BA 4Z0NA 4QYMA 2HT1A 1E9FA 2I29A 2I7VA 4OV6B 1TLFA 2G5TA 3PICA 3ZQUA 1P5RA 1DCTA 3PVCA 3MUEA 2FN3A 2WVJA 4GQIA 2XNDD 2WPDD 2GEUA 1J23A 2A5YB 2DPLA 1QIKA 2OCDA 1OW3B 4WX2B 1WV1A 1RM0A 3KNZA 3ZUGA 1ZNZA 4UQOA 2R79A 4UD2A 1RC8A 5I7EA 4WKPA 1HFEL 2XUZA 4JUIA 4II2A 1E8DA 1KI4A 3IJRA 3U26A 3QE9Y 1CEXA 3N7TA 1T10A 1ZMXA 1YTLA 4F4CA 4J2TA 1EHIA 4ZOLB 1JJVA 4NZNA 1SXQA 3K1AA 2DFNA 3GNTA 3ILSA 4XGKA 1G3IA 3SLRA 2ZVPX 3WS7A 1BC5A 3TW6A 1OFIA 1L6RA 1GFSA 3AP3A 4KO2S 4PGHA 4MR8A 1W96A 4Q66C 4RZHA 4UFPA 1HXHA 1ZVQA 2YYAA 1PS9A 2ZE8A 4TTJA 1J20A 5JE8A 1W94A 4M1SA 4R3NA 4YJ3F 4S1WA 1IVSA 1BMDA 3U4DA 2VSNA 1K97A 3T7DA 3ZU3A 3BWEA 5LZ7A 3PIIA 4JDUA 3IGFA 1YRYE 2R11A 4YJDA 1NTOA 2JLRA 5AHOA 2IZZA 4V2UA 4X63A 4BNDB 1S8AA 1TZMA 3ONNA 3WQRA 1W30A 1P6QA 3QI2A 3NT5A 5CHYA 1TVEA 4FONA 4H1WA 4L0DA 1QFXA 3T95A 3SYTA 1MZPA 3EG9B 5JZOA 3RVQA 2C04A 2BRUA 1VGRA 2ZJ7A 4AN1A 1GAEO 3P0JA 2IXDA 2P9GA 3VJLA 5K4GA 5LQMA 3NBQA 4IO0A 3BGVA 1A8HA 3BREA 5ICEA 3ZJ5A 1H93A 3NH6A 1N7GA 1OAAA 4LWQA 2DP4E 4EEZA 1YDFA 2RHDA 3G9TA 3T94A 1U9JA 3O8OA 4O8CA 2RI6A 4REMA 5TQ0B 2FSSA 1I7NA 4TVKA 4KDRA 3OCZA 2FQXA 2AZTA 1SFRA 3OEEA 3FW1A 5CVEA 3GLIB 1P5FA 3M6FA 4AFNA 2H85A 4ZVVA 2GX6A 2HLPA 4I9UA 4JVSB 4OI2A 2O2EA 1ZVKA 1WULS 5K45A 3A36A 3LT5A 5CDHA 1YI8A 2EW1A 3WIBA 3HYRA 1TOAA 4JB8A 4NYIR 2IIBA 5DRTA 5CA1B 2VTBB 5EGSA 2JFOA 3DNFA 2D0PB 4B87A 2Q62A 4TLAA 1RZ3A 2V9PA 1M34B 1YMVA 2AA3A 2NPIA 2O7SA 2VXCA 1L8AA 4HQFA 5A9SA 4KK4A 5ECWA 1LY1A 4AY5A 1RQNA 2ODQA 3GB9A 3LOUA 2BFDA 4G0MA 2Z5FA 1KMNA 3BH7A 3HJRA 4B83A 1CUWA 3HUUA 5B6IA 1A9OA 1LDYA 5FUVA 3D2BA 2OOKA 4JNCA 3GVXA 4PHGA 5JD6A 4ND5A 3NTUA 2PGDA 3R0IA 1IDN1 4PX5A 3CGWA 3AR2A 5BYKA 5ADHA 3L84A 5LMNB 3T12A 4HMOA 4B6PA 3RV4A 1F51E 4XIJA 3UVEA 1LJUA 4PXSA 2NUPA 2XE4A 3WLIA 1USWA 5MF6A 2P2GA 4KMMA 2YWJA 1RYNA 3SXUB 5HUJA 2ZZNA 1F2TB 2J9FB 4JL5A 2PSDA 1JSZA 5EP1A 1TVMA 1TIPA 1V1MB 2INGX 2ZSFA 3FWYA 3B53X 2XAAA 2I2AA 3D5QA 4LXUA 1J5XA 4MPPA 4HQNA 1BFUA 4Q3KA 3PJDA 2EATA 3QTBA 3NV9A 3GC6A 4X00A 4XWTA 1Z2DA 2BFNA 2Q5OA 4WRRA 3EH1A 1MRSA 4QO7A 2FF5A 3TN7A 3GLGB 1X94A 2ZJ1A 3NWJA 2Q4BA 5HIAA 4QT0A 4B3HA 1TQ4A 3AUXA 2ZIXB 4YMHA 1XPOA 3AFGA 1LNSA 3LRTA 4AS2A 1Z7YA 3CISA 4RUKA 4URZR 3U3XA 3IIJA 1P8AA 1Z6AA 4UTZA 3AFNA 2RK3A 2P8JA 1JDTA 1GL9B 1CHDA 2E1PA 2GRAA 4FMBB 4BNFA 1M6WA 1MDFA 3ZWXA 4HY3A 5IBCA 1A2KC 4HYEA 5F23A 3EF3A 5DTQA 5BOSB 2IHTA 4M1MA 4PYMA 1W1UA 3BL8A 3OZBA 4HL6A 1FBNA 2JKYA 2GD0A 2BR4A 2GESA 2W2OA 4JXKA 4CKBB 4RIIA 1SKAA 4IGAA 3SJUA 4S1OA 1N8KA 1NDHA 1D6MA 1O5TA 1VE5A 2ZUDA 3L7KA 2TMDA 2AXQA 4DIDA 4UKDA 1P1JA 1JMKC 3OT1A 4ZGWA 4JLUA 2UVQA 2QVYX 3O3MB 2ZDHA 4UUAA 3RWMB 1R0CA 1JR6A 2QN7A 1J6UA 1E4EA 1QFZA 1CJBA 1GA4A 4JAVC 4JJEA 4UJ3A 3UYKA 5LNK6 4P53A 3I2FA 1FJGB 1X70A 2WMNB 2ZYWX 5K3SA 3RVJA 3GF4A 3N8GA 3VZCA 1JRLA 1JLRA 1Y7TA 1ZSNA 1JPUA 3W9YA 2VHQA 1JEOA 4F92B 4IUCS 4MHOA 3NDPA 5AKJA 3COZA 4UATA 5IJ0A 5JHHB 1XTBA 1Z8NA 2OGTA 1I4WA 2V7BA 3F4KA 5I4BA 1L7PA 1U8YA 1E77A 2EZ4A 2XCLA 5EIFA 2I99A 2VC2B 5CGZA 5HWSA 2QORA 3AUAA 4DCMA 2YWXA 2WMOB 4NXMB 3R0QA 4YV7A 1B23P 4OOEA 4ZN6A 1YAJA 2BP7B 1XEWY 2OBXA 3LQQA 1MQAA 4E31A 3ZW7A 4WLFA 1Q1BA 4MUAA 3SI7A 4B2PA 1XPUA 1EFPB 1P7PA 4HBZA 2VATA 3F67A 4MCIA 4A6EA 1FYXA 2CNDA 4H6PA 1DDGA 4N9QA 5KINB 2BEJA 4D4KA 1E9RA 1YI0A 3D4NA 5DBGA 1Z0IA 2O8FB 5E38A 5JQGA 4OREX 2EC5A 2CYAA 1XQ9A 3TUIC 3GJ5A 4ALKA 3IILA 2C0CA 2VRNA 4I1YA 4JLDA 4X8MA 5FBHA 4WOCA 2IYUA 1YBVA 4WNAA 4BYGA 3HACA 4ZXPA 1VJTA 1Z34A 1ZH4A 1F5NA 1KMIY 1WF3A 3Q3EA 4QQFA 5CFOA 4M1OA 1LBQA 2EWWA 2ODWA 3BD6A 1ESMA 4FT4A 4TSKA 4BAZA 2P5SA 3GJQA 1QR6A 2I22A 3BK1A 1FDRA 3PU6A 4UHKA 5HQJA 4FFNA 3MAJA 3NHZA 2G6BA 5KDDA 1GG9A 1R0XA 3OPYA 2F9LA 3OJLA 3WLNA 4MEJA 1NG9A 3ROMA 5HS4A 1TC1A 3HMKA 5CAEB 4BLWA 1JBQA 3BK2A 5I7SA 1FFYA 4EAQA 1L1EA 1E3EA 1YUNA 1QKIA 1YZTA 5LZ4A 3QLTA 1VKRA 5FUMA 2OLEA 4DA4A 2IU0A 1H05A 1VMEA 3EVNA 2CSUA 2Y68A 2QZJA 2L82A 1F7VA 1S5PA 1BGXT 1MMFB 4TL8A 2GPNA 5SY6A 3RYHA 3LHIA 4OH7A 4WZAB 1DXHA 1LPOA 3KEOA 3JASA 3LC0A 3ONDA 4OP2A 5AI0A 5DSTA 3VR6D 1U11A 1LV7A 3KPVA 1GTZA 2G7MC 2G9UA 3B9BA 3IAAA 5BXQC 1NLFA 4LW8A 3TXAA 1SO8A 1B3BA 2Z8XA 3ZE1B 2PUWA 4FDMA 2VOEA 4BN4A 1BX1A 4ZOQI 1XNQB 4BLPA 5FL7A 4QGFA 2V1XA 1IY0A 4DHEA 3AIOA 3COPA 3I32A 4EL0A 1BDIA 3Q72A 3ROFA 4J7CA 1QXSA 1EG7A 3G89A 3ON5A 1SAYA 4JLWA 3GFPA 3ZGXA 4HRXA 1N8TA 1GAJA 4R8MA 4RDCA 2BKUA 3O83A 4U7JA 2YY6A 2BFMA 2AZMA 2J0UA 1Y1RA 1AGYA 1KFEB 2FWPA 3GCWA 1JILA 1G5QA 1L7MA 1U2GC 3IODA 2ORED 3LXXA 5DCUA 4M8NE 4TLEA 4RTJA 1TTHA 2GERA 3OIUA 4UEOA 2JJ1D 4RADA 3TLCA 4FUQA 1UODA 4GP7A 5ESRA 1PS8A 4OATA 5T6MA 5DNWA 3AP1A 1ZCFA 2ZRBA 5HZGA 3T3GA 5IM4A 5EHQA 1N5IA 1QH8B 4YRRA 1QU3A 3M3DA 2HWUA 3V4RA 3WAJA 3ORFA 4JB3A 2RH8A 2I62A 3VKHA 4JBXA 2JGFA 4F72A 3WDLA 1JWBB 1DEOA 1PT8A 3QW2A 5KKCA 4G5RA 1RJDA 4TGLA 2JG3A 4MVJM 4L9SA 2H18A 2KSQA 2JPDA 3CU5A 3WL4A 4X3PA 4EYGA 1TKAA 1WPQA 4NTZA 5DM0A 1D2RA 3DHVA 1E3MA 1JR2A 3IP5A 1Z4NA 1W47A 2PKCA 2ODTX 3D3WB 4ZXFA 1Z2OX 3DSRA 1PFUA 2PUAA 1OBOA 1PR0A 1U81A 2B6HA 2PH3A 5LA6B 3U3DA 4I55F 2I4TA 5F1YA 4B76A 4ZPJA 4NMMA 1QB8A 2HTFA 2X1VA 3CM0A 2VDKB 3GHHA 1FUUA 5A9TA 3ZC3A 1HNNA 5CW1A 1L8OA 4F2WA 5B4TA 2AX3A 2FZVA 3U4CA 1Z07A 1NNSA 2AZ4A 3A1EA 1IRXA 4JB0A 4PC3A 2QSUA 2JAQA 3K4QA 3GPCA 4RACA 4ZOLA 3T5PA 1UEIA 1EFVB 2X15A 5I9TA 4MI1A 2FZ4A 1TYBE 2FNAA 2FZCA 2PEYA 3FHCB 1DAGA 2WC1A 4IX9A 3G23A 5DW3A 2HO4A 2GN8A 2EXXA 1EFDN 3U5ZB 5KSZA 3OJXA 3ZKWB 4W5JA 4DLWA 3AVUA 1G63A 3BSFA 1LRJA 5KDOA 1K4KA 1ODKA 2JH3A 2ZT7A 3B1XA 4INAA 2RHRA 1U31A 1JEJA 3FF1A 3HBFA 1QAOA 3AM4A 1ELOA 4LN1A 3SBEA 2VBGA 2GVDC 4BNDA 4D74A 5IHXA 2BHSA 1YJ8A 3B5JA 3JX9A 5G0UA 1E9BA 4H35A 1IMOA 2JJ8A 3G02A 3VYUB 3KT3A 2POCA 3B3AA 4JS0A 3UAVA 1B2RA 1I5EA 3RARA 2BPOA 1NC3A 3JQ7B 3EG9A 4V0QA 3N70A 3GVCA 3GFSA 4HSEA 5J4HA 3U37A 4TL7A 3VO2A 2X5XA 4HH4A 3U4HA 4E94A 4PWZA 4U3JB 4XEUA 2CK3A 4HDRA 2FDCA 1JYSA 3R7BA 2VNKA 5CNKA 3O75A 4J0FA 5GM1A 5F2OA 2Z30A 2QG9A 1HYEA 3L0IB 4C5BA 4MW9A 4AU1A 2GCEA 1X9HA 2JGLA 5B1YA 4CQNA 2YHIB 4MINA 2VQFB 1L4UA 4IVRA 2BGMA 2HHJA 1HEIA 4Z9XA 4YRJA 2O14A 1I3LA 4LVOA 1G55A 4WKCA 2JFBA 1KJNA 4P5DA 2RGDA 3GLIA 4BO0A 2JAPA 3GRYA 2H1CA 4QEZA 1YQTA 4E03A 3WKAA 3RVPA 3AVXA 1UBTS 3OKFA 3FPEA 2WB4A 3HTXA 3OHMA 3LVFO 2LDXA 1X8LA 3PXGA 3DE6X 1KERA 3IJ5A 4BNYA 5JS7A 3H5OA 2D2EA 3W6PA 5CA1A 3JD3A 4GAEA 2C94A 3F98A 2EKPA 1BJRE 1J0AA 4XFDA 1LWOA 1J0CA 2QRMA 1M2NA 4LOJA 4NU8X 5G3ZA 2R6GA 2C4VA 4I4CA 5KVVA 1P81A 5GP1A 1CJTC 3BS4A 1ULUA 2MMCA 1QHHB 4FKMA 3A25A 1AQYA 4KXVA 2AYZA 2Y1GA 5FQNA 2GA9A 1M54A 4Q4LA 4LY0A 2B7CA 5EZ6B 4QODA 2PDAA 3L0PA 3FMIA 1PJ4A 5REQA 1QRDA 2CLKB 5DB4A 1YL7A 3I9LA 5GONF 4YROA 2VH2A 1HMPA 2Z08A 2OAQ1 2JLYA 4RD6A 4ZGGA 2RE8A 1YR3A 3E0QA 3OIWA 2PYZA 1UK8A 1ZUD1 4G0PA 5H81A 2DPMA 3A6HA 1QDEA 3WFZA 2IYNA 3H18A 1NLUA 3OQMA 2QTZA 4FOOA 4C0HA 2AMYA 1PK8A 1T8YA 1UK9A 1T1SA 3NATA 4MPTA 3VR5A 1YZLA 4CLRA 1TAGA 2F1HA 5AW6A 3UPDA 4X1YB 1IAVA 3WWZA 3CTMA 3R3UA 5KNDD 3SXUA 2H5IA 4ZVTA 3OOWA 1Q0ZA 2VNHA 5J2TF 2LBPA 3O5AA 3P27A 4XSGA 5AI6A 3TEJA 4RZ3A 1RQ2A 4YFVA 4YAJA 5FADA 1Q5PA 2W11A 2XOKD 3OCUA 4KL8S 3LP5A 2W5UA 3NDIA 4I4TB 3OZTA 5IW8A 1C9MA 1PV2A 1YB2A 4WY5A 3U4GA 3BZBA 3K9FC 4H0FA 1WM1A 4PBTA 3VH4A 4B33A 2GDJA 4CMEA 3GJTA 2WWFA 3DW3X 3EQ6A 5DBOA 5G1PA 4AYXA 5BWCA 2NXJA 5CG1A 3GLGA 2P7IA 2I2WA 3RH0A 4PQGA 4A2QA 2ZUSA 4E15A 2X7XA 4YYEA 3AYZB 1AZWA 3OZGA 3WMGA 5EIXA 3TFQA 1Z9BA 821PA 4YP7A 1ND5A 3SZRA 5FPKA 3QRWA 3CWQA 2C5HA 1TO2E 3GLTA 1GGJA 4UVIA 2H1VA 1IPEA 3EUFA 4NZOA 1OLUB 1ETHA 2FAXA 4C4AA 4XQEA 5BOSA 1W36D 4CF6A 3D7LA 3HQ4O 4E2ZA 9ABPA 2EF0A 2I4OA 2JK0A 5TGZA 1JFFB 3W5BA 3DE3X 3CKYA 2PRKA 1V8OA 3ORRA 5C5CA 2HQSA 1Z56C 4CF7A 1QG6A 2R62A 4K8OA 4N49A 3U9TA 1N5LA 4KQ9A 1USIA 5T5QA 5K0CA 4WE3A 1IZ9A 2AVDA 3JQEA 4HN4B 2JB9A 3QEBZ 1PLJA 1DO8A 1HE2A 5LP6F 2MYUA 3V1KA 1LQTA 4YT5A 4Q9IA 3AQIA 2Q8QA 3U9LA 4RKRA 3L04A 2DH5A 5AVQA 5LYJF 5B57C 3GLGE 3RWBA 1P45A 2ZRFA 2VZEA 2C20A 2Z2ZA 2GJSA 4TMWA 4C7XA 2XQIA 2FUNB 5BV8A 4M89A 1N2IA 1O4WA 2A3RA 2X5NA 2JLCA 3KAQA 1DVRA 2HBRA 1LTHR 3ZLTA 4COOA 2GPBA 1NYLA 3CR8A 4BKUA 1RAIA 4ZAZA 1KFCB 1UBMS 1F2UB 2CMKA 2G82A 2OKCA 2AXPA 4NVRA 4BQOA 4F5EA 1MIOB 1OI4A 1IN1A 4CMKA 3A11A 5CXUA 2BP7A 3CKMA 1QGOA 2GBLA 3EQ2A 1BFKA 1MBZA 1QHXA 4KBGA 4KZPA 1QGZA 3N8KA 5B3JC 1EFPA 1CQWA 3Q5DA 1NV8A 1OX5A 3I28A 1JFVA 4HDKB 5F1PA 5B3KA 4MB0A 2AFVA 2OCIA 4OQNA 3VH2A 2XEXA 3E1GA 3TZLA 1G2OA 2YHSA 3IUEA 3SKXA 2A7XA 2JGMA 3HBAA 4CTMA 4EGJA 2V7PA 3RAGA 3UQYS 5BWMA 3D6HA 4PTYA 4QLAA 1CFZA 2AN1A 4DNQA 1IN7A 1FSZA 1G8HA 3F7OA 1A1VA 3VPFA 2CL0X 4EJ0A 4TXNA 2V9ZA 3ZXXA 2C4MA 1RCTE 3P26A 1RXUA 3NBKA 3B51X 1H2RS 1U1GA 3KSMA 3L1IA 4IDDA 1P4GA 1SVSA 1WZCA 2CWWA 3SS9X 3ENWA 2JA1A 4ND4A 3ZYZA 3W06A 1R9MA 1Z4KA 2EP8A 2XA9A 4C7MA 1VGVA 4ZCTA 2QLFA 5EHNA 3NGMA 3IBTA 5AVJA 2IXBA 4RAQA 3CQ9A 1ZZEA 3R9WA 1E1QD 1ZH6A 2PMKA 4DANA 2PGXA 1Y3BE 4W82A 2GTIA 4BZWA 1I4TD 4QDKA 1FMFA 2BELA 5KHLB 2EDCA 4FFBB 2QA5A 1D8TA 4BV8A 2W37A 4FFOA 3L1JA 3R8XA 4JJGA 3UMVA 1FJXA 4UZEA 1QTRA 4RH3A 1KZ9A 2CV1A 3DDZX 4U7TB 4JWTA 3VBEA 3QYFA 4D43A 2BFOA 4UPDA 3MTIA 4XOUA 2WKSA 4YRGA 4LGCA 4G5HA 4NMHA 3Q8WA 1F12A 4J0IA 4PV7A 4BUJA 1HQDA 5AVYA 2QG4A 3PXBA 3WI7A 1OOEA 3IFSA 4P08A 2BLLA 4H27A 4BMVA 3RTAA 1Z6XA 2MSWA 3S3TA 2PX6A 5K4AA 2MINB 1QC5B 4DIMA 2ENWA 3TXXA 1JDSA 2H7VA 3A0RB 3BRSA 3FPFA 4EUEA 5FLXA 1QCZA 1TMGE 1RNLA 2EG5A 3GIWA 4NBSA 2EGHA 3P9CA 3EZFA 2NZUG 2Q9AA 4J16C 4TXMA 3PZRA 2ZQYA 3A9SA 1THTA 2DLCX 1GCAA 1F0YA 4P80A 2QP4A 1OXXK 4GM0A 2FA9A 4PBSA 3SF8B 3R3JA 4MTLA 2B1IA 4PFKA 3UT5B 2BKVA 2JGDB 2FRVA 2CFIA 2OQ2A 3MJRA 1LVGA 2LIVA 5J43A 3LCMA 3RNLA 2QD5A 3VGJA 1LX7A 3I2HA 2A94A 1W1WA 4NEHB 3SYLA 2X40A 1FYVA 1MGOA 2AF4C 4WXRA 3M6AA 1ZHFA 3T9FA 3CLVA 3A4IA 3U7GA 2Z95A 3MJFA 5I45A 1HM5A 2HC9A 4ZPXA 1JWLA 3W5VA 3QVXA 1DHTA 3UV6A 1PR4A 3I3OA 1PS0A 1KJWA 2QLJA 4BO8A 3JVVA 4S1NA 4BNLA 1Y5LA 3UK2A 1T5LA 3T5AA 2A35A 1SULA 3PFNA 4M8LA 1K88A 1QH8A 5EJIA 1TM4E 4GMHA 2C92A 4X7BA 3D3JA 4YO7A 1V6CA 1DE0A 1JEDA 4LA4A 3PWZA 4BKMA 1JR4A 5LMCA 1JHVA 1E2MA 3RABA 3PLRA 2Q29A 4TVOA 2I4RA 3QX9A 4OBXA 5A4MS 1KY2A 3CUSA 1K3UB 2XCOA 3PX3A 2WTEA 3CF4A 5EUQB 4YXWA 3TW8B 5TGDA 1SUBA 5B2ZA 2PO5A 4KQ2A 3C3PA 1S2LA 4JP3A 3IO3A 3G0DA 1CQIB 2WAMA 2I33A 3MWEB 3PI7A 5GJCA 2ONJA 2A9KA 4JA2A 1X8XA 2C9ZA 4LYDA 1YRQA 4NYIQ 5JNTA 5LA6A 3H1PA 3H1FA 2JLVA 1RWWA 1FMLA 1YFKA 4P5PA 5ALDA 3KQOA 2VUUA 4IIYA 5C35A 4QFMA 3PE6A 3SG0A 4M7RA 3HK2A 3RS3A 4BCCA 5FNZA 5HQTA 2O19A 3C7CB 3FUWA 3MRXA 2DGDA 1QK5A 1KYYA 3M5CA 6REQA 1GSOA 5NLLA 3AKCA 3JVIA 2N0SA 4OMUA 3JD2A 1EFVA 4MLCA 1S9DA 1BG6A 3D3QA 4ARZB 5C1BA 3U7RA 3RSCA 5M7EA 2PLNA 5IULC 4ZYLA 4ICIA 3EZNA 1WWKA 3UC5A 5BMVB 1B43A 4JENA 4ARUA 1J1IA 2Q1TA 3CRZA 2HLDD 1B41A 5G02A 5KNLA 3SHTA 3DMYA 2NZ8A 1K8YB 3JQPA 1HZJA 3MIIA 4CKZA 5LCXA 1MJ5A 4FGUA 5CU7A 3O4FA 5ALJA 5U4QA 3K8ZA 1G6OA 4MAAA 1C0KA 3JRWA 2CHEA 2ZWVA 1GNPA 4EPTA 3TQQA 4NMLA 5FHRA 5H1YA 2QRVB 2LDBA 1RJWA 5M04A 3HNPA 1OH8A 3FM9A 3JQ7A 4N47A 1UL1X 1OWNA 2QX9A 3OJOA 1LDNA 4L5BA 3SHOA 1E3QA 4WFIA 3LK6A 3QBVA 4D79A 1JAHA 2WJJA 1YKSA 2NZVG 3FAKA 2J32A 1GSIA 2OV4A 2CJWA 4ACBA 4HX2A 4QUBA 2HEIA 3HDGA 4OB7A 5C46F 1GRNA 1KF0A 2YHIA 5AD1A 1QE0A 4GM4A 5KKAA 2WP0A 2B2CA 3RS2A 1ZJWA 1BQ3A 2Y05A 1EA7A 2IY7A 3RK4A 2A78A 2R6ZA 2C7PA 2NXCA 2BC9A 4MIKA 3A4YA 4TXJA 3FUXA 2Y66A 4LXIA 2BCGY 2YXEA 5CGQB 4KFTA 3PPIA 1IONA 3RC8A 3GDHA 4LRQA 4JYBA 2X14A 4IJUA 3MLAA 2R7KA 2HJSA 1Y4DE 3FSGD 5LM3A 1G5HA 1D4ZA 2ZJ8A 4OQFA 4EYSA 4ZOBA 4JBNA 2O5RA 1G8KA 1XTJA 3JW8A 1F6DA 3ZZ0A 2OLKA 2OZPA 5CXSA 1YGPA 2AH5A 1QHHA 3RASA 5F51A 5DK4A 3TDNA 5ABPA 1YVEI 2Q49A 1A9YA 3THWB 4LJ8A 1COWD 3ZDZB 1X1AA 2A9RA 3VM6A 4W5QA 1B15A 1Y81A 4P3KA 5K8IA 3BTOA 4AS3A 3BG5A 2JLQA 5ENVA 2O23A 5F4BA 1OB2A 2VP5A 5JARA 2A1TS 4BMDA 2HY7A 4GZ5A 1G8GA 1Q20A 2H1FA 3KYCB 2G07A 2YS6A 4I08A 3U17A 1PSZA 2RSLA 3I09A 2M98A 3DEJA 4L4ZA 4YCAA 3O0DA 1U2GA 3VYRB 4Z49A 4DJJA 2IW1A 1EFTA 3T41A 1E66A 1KOLA 3RBZA 2RGXA 3CT6A 5CITA 2P40A 3TG2A 1E79A 1KJIA 2P8SA 4BNUA 2FWIA 1GRCA 2HSGA 1PZNA 4G8CA 2X9NA 4IZHA 1HFJA 5BQFA 1V7PC 3WLTA 3DQPA 4DLXA 1OFUX 2GN0A 1PWHA 2HSWA 2HWXA 4JBLA 4N0QA 4C7OA 1M3SA 4RA9B 2QNRA 3DWIA 1GDTA 1ZN8A 2P9EA 3BRWA 4I4TA 4W5RA 3ZCVA 4DIFA 1NX9A 3PVSA 3A6ZA 3N2YA 3I6YA 4O2AF 4PLVA 2LCIA 4AECA 2RHBA 3ISJA 3LO5A 4XIYA 1GPYA 2IUFA 1GCIA 5MGNA 3L6OO 3F46A 1NJ8A 2ZPAA 3A6LA 1CZLA 3KVYA 4JX8A 3OPXA 3UICA 3ZHBA 3E2MA 1Y6JA 1HV8A 2XECA 4R71A 1FQJA 3MT9A 3CWCA 1TZ2A 2PGIA 2SECE 5H70A 1IH8A 1QE5A 1GYQA 2DLDA 2H3HA 3E5RA 3M1IA 1W4AA 3Q3CA 1CDZA 4G65A 4WXEA 2F1OA 3I83A 3V1MA 3H05A 3Q7PA 4KJZA 4B82A 3QQPA 1PJRA 3PFKA 4DWVA 2Q6LA 4NZPA 3NJ4A 1EBFA 1RW4A 4O4HB 5AVUA 1NAHA 1L3IA 5L40A 3FOWA 4OHUA 4RM2A 3A2NA 3E58A 3KHKA 4HAUA 2QVCA 4YI5A 2E6KA 2PSJA 4EY8A 1O4VA 4G2NA 1JFFA 3GUUA 3ORQA 2QVBA 2W6ZA 2ZRAA 2GZHA 2D1QA 3W7VA 2SKCA 3H3XA 4EA6A 4F3RA 3JQGB 2G1PA 2AR7A 3WYEA 3G8CA 5EJ6A 2LR0A 4K9DA 4V03A 1EB8A 2GETA 3OE4A 3RBVA 2E49A 1X0VA 1T3TA 1KTIA 4RK0A 1THMA 4CTOA 4UBKA 1PGPA 2ZZMA 2BEVB 5G1NA 1PX0A 4F9FA 2IS2A 4YAOA 5C2JB 1PZMA 3TMAA 2UYOA 1SCIA 4B74A 5ADWA 2QNIA 2RKWA 3PE3A 4R1NA 4RJJA 2V8BA 4ZT5A 2JDIA 3K1ZA 4MARA 2RHMA 2WF8A 2DEUA 3L8CA 2AHRA 3RRYA 3IPCA 1DDIA 3LG2A 3P7MA 3ORHA 3JD0A 4Q24A 5DT2A 1WCYA 2G4CA 4JEUA 4MKXA 1EKXA 4CV1A 3HKBA 2JFNA 4DV2B 1PWEA 1MIOA 1KH2A 1M6VA 3T1NA 2JRCA 1O2DA 1T0UA 4ABYA 2ZYHA 1DEAA 2PVSA 3W1WA 3QJ5A 3R7DA 5CLHA 1JHUA 1EE9A 4RX1A 4ZQHA 3A32A 3L8FA 2XKKA 1UOPA 3WAGA 2P9JA 2HJ9A 3E3OA 4YQFA 4IOLA 4Q7MB 1Y1PA 2CMHA 2JAHA 2H51A 4IIJF 3SOPA 4EJFA 5CFQA 2P0YA 3ABOB 3HLTA 5GAJA 3UBTA 4W8GA 1YIOA 1GD1O 2KMLA 3CZRA 4XPIA 3KKOA 3KVNA 1IUPA 2GNOA 3LQRA 4IGFA 5EHIA 1RFGE 5K99A 2B37A 1CJMA 2KX7A 1EVQA 1EVEA 3TIXB 5M2QA 4YJGB 2XQKA 4R31A 4UXJA 1WMBA 3UN1A 1H4SA 4BIIA 5A1TA 2QAGC 1OMOA 4PBRA 1V5EA 2ECQA 4CJXA 4EI2A 1NNUA 2EFJA 3U19A 4GI1A 1OV4A 3K0CC 3CNHA 3LQFA 4X95A 5LB4A 3E84A 4HNAB 1QP0A 3ESRA 1QDLB 3L93A 4ILEA 3A3KA 4L3VA 1LVHA 1L6IA 1Z6YA 2OILA 3KOXA 4PRLA 1KYIA 3EEIA 3EVCA 1YZYA 2OHFA 5LQKA 1Y6FA 3AWIA 4FFBA 1J97A 1HNZB 1K5PA 4Q03A 1F9EA 3V7YA 3WP0A 4WZZA 1V2GA 3CNEA 1KK2A 3VC3A 2J07A 3GZ4A 3IAS6 1MHTA 4ZVKA 1OXSC 3D6NB 3PV0A 4Q82A 2X3YA 3TK1A 3NG1A 2Q6TA 2BUBA 1JEEA 1L3CA 4QXRA 1BDJA 2J87A 4XQ9A 2Z5GA 5L4LA 3S99A 3Q2KA 4CCYB 2RHCA 3DTYA 4J91A 4II3A 4TZ0A 4TV9F 1MX9A 4BE9A 1FXWA 3D4IA 4FC6A 3AVPA 4CDMA 3MWLA 3ZWMA 2FK8A 2CHGA 3MAGA 1U7OA 2ZS7A 3ENQA 1JHDA 3EYAA 5DHUA 2DXIA 5E8JA 1Z36A 5IDVA 2PMCA 4FEGA 2D2FA 1OWOA 5FB3A 3U4QB 4LISA 3CLTD 1H0RA 3LT4A 4IIUA 4IVNA 4R2KA 4A6DA 2ZITA 1WA5A 5AIAA 4L4YA 3AEUB 3AU8A 4LMRA 3VVLA 3ETJA 4ZMBA 5AW3A 4PGGA 1DXOA 3CWZA 2JGDA 5EJ2A 5ES3A 5GV8A 1WNFA 2QD1A 5DM2A 1PNVA 2FSPA 3M9XA 3PQDA 2A58A 5DRYA 5JWHA 1QR2A 1EZ1A 2C4UA 2H65A 3FIUA 4JJIA 1Q0TA 1MTOA 1BWRA 2JBAA 1L4LA 1N2CB 2C2GA 3ND5A 3KVVA 3RU9A 3V42A 2Z2YA 1ZP6A 1ZYUA 3LFTA 4IHJF 3TWOA 1XKTA 2HHCA 3GBSA 3NT2A 1RXEA 2K4MA 3TQHA 1SQFA 4NZMA 2HV8A 2SHKA 2IPLA 3G8BA 3Q7QA 2PX8A 4LJRA 4HGPA 3C7KA 4B3DA 5DOVA 3UWOA 4C2UA 1CUDA 2AUMA 1PV1A 2R7NA 1O9BA 2XUKA 5BYBA 3FCCA 1AGNA 4MROA 3HH8A 3WRWA 4D2IA 5K8LA 4GKJB 1U04A 4GKVA 3P8ZA 4IR7A 2CEKA 3GR6A 4ITUA 3GT3A 4B80A 2XVXA 5ALVA 2NYUA 4AN0A 1WB5A 2C2OA 2IXTA 4L8VA 2Y1LA 3P45A 3AUJB 3QKRB 4ALLA 2NV6A 1QAQA 4E70A 5LLDA 1H4QA 3W2GA 1QTQA 2BMWA 3UNXA 4UM5A 5GVSA 3HBMA 3IIMA 4HH0A 2EBHX 5IKEA 2YC2C 3UOAB 4F5DA 1U8AA 4AJJA 1DX9A 4KMSA 3ZV6A 4MEAA 2I66A 3L1HA 1T8WA 4FGWA 3WKCA 1VC2A 4C3ZA 1NI4A 4KXYA 1RACA 2QB5A 1AZSC 5I7OA 3OMWA 5LUAA 3KOYA 4LQDA 3EIHA 4ZI3A 3OE7D 4PRKA 1ZBDA 3DZGA 4FJ1A 2XRFA 1JU4A 4GOOD 4NEQA 1C2TA 4P7BA 4KBFA 4RQTA 2XUIA 2A0UA 1LD3A 2F9MA 3G68A 2Y0DA 2J7KA 1Q3TA 1H9CA 1IUOA 4ARZA 2Q8PA 2BGIA 4BRZA 5IANA 4RA6B 4LC0A 2I1WA 3HZZA 4YJ3B 1KRWA 3WA6A 3UMSA 1QHGA 1KU0A 4X1OA 4NX2A 4TS4A 3NWOA 3S8YA 4XKJA 1IEQA 1XAHA 3FYHA 3JQAB 2VO1A 4FLMA 4JC4A 5FOSA 1XEAA 5B3JA 4AZ3A 4C06A 5AK3A 5DEIA 4KHZA 1MVLA 2C00A 2HD4A 2GJ8A 3N2EA 3QVUA 2CW5A 2FE4A 1OU4A 1G4AE 3EH2A 3CEJA 2IUUA 2I9KA 4ZVOA 2O52A 2Z3WA 5FBRB 2O4CA 4LVUA 1PBTA 2WIAA 3P9PA 4EQZA 4YIKA 1P62B 4YRSA 2AZXA 1YQUA 2DOKA 1T2AA 3NBXX 3P20A 2QRVA 3EVAA 3IOEA 1BHSA 2ZTLA 2C5LA 2Q9CA 3E9DA 3GJXC 4KU4A 3W79A 4DG8A 4EUHA 2QAGB 2WPNA 3PFWO 5BV7A 3G0IA 3JQFA 1IXRC 1G3MA 2Y99A 3CLSD 2EZ9A 3KZXA 1X7ZB 3LM8A 4KMOA 1YR1A 1GZVA 3PQ7A 2F3TA 4K40A 3M0EA 4K9PA 4D9GA 5DP1A 3FETA 4FDLA 3BBLA 2BMDA 3CC8A 3IVGA 3Q5EA 1SWWA 4KYVA 4UAJA 4W9NA 1U5BA 4ZCQA 1RYYA 4XCXA 2HRCA 3RQSA 4MKHA 2FMHA 3CCBA 4HGYA 5DN9A 4I5IA 3W5HA 4CMBA 2CT8A 4I2NA 3REQB 1MCZA 3OQJA 4EJ6A 2AG5A 1P7CA 3FX2A 3SJ7A 1FRVA 4XWWA 1RWOA 3D8HA 2I34A 2VJMB 3RSQA 4E5UA 3D0OA 1OE0A 1QOPB 3MMNA 4RJIA 4WGGA 3BAFA 5FUWA 5BSGA 1Z2AA 4PC6A 5C53B 4RSMA 4XM1A 2F3RA 2QJTA 3HCRA 3QXSA 4X3CA 3IIEA 3FYTA 1RWXA 4LSGA 2XRZA 4F6CA 3MWDA 5FNVA 3A31A 5AVZA 1G6Q1 3L1VA 3R77A 5IHPA 3THWA 2E55A 2VR1A 2VXYA 2QLLA 4J0EA 2VYVD 1YE3A 1K2VN 2XMDA 1N3BA 1QPBA 1W88B 3HJTA 3DLAA 3HCAA 3KFLA 1IN4A 4JZKA 1RJGA 5TS3A 3TBHA 4FYKA 5EKXA 9GPBA 5K2OA 1UH5A 3BD7A 2GZRA 1CUZA 4MB6A 5TR9A 1X1QA 3V55A 1BCSB 2AS0A 3B9RA 2DHCA 2ZPTX 1UM8A 3KYCA 4A0RA 3L6UA 4NG5A 3TKLA 3H8JA 2WJYA 3H5WA 4JUAA 3U7HB 4JYPA 3IQHX 4XIIA 1IC6A 3IVRA 3ZZUA 3P0RA 2Z2IA 4BVKA 2AF3C 3D7SA 4NPHA 5COQA 2O1EA 2YHAA 3F7NA 4ZT6A 3KTOA 1OI2A 5B2EA 5FFFA 1KY3A 2EJWA 2OD9A 2PRJA 1MC1A 3EIFA 3PQ3A 1SA0B 5TJHA 1Z7GA 3E53A 3G1WA 2FN9A 4UCWA 5KNCD 3CUKA 4CKWA 1WSAA 4RA9A 1WUTA 3ZWQA 3FNEA 3X2FA 1V9LA 2GXSA 3C0KA 2H11A 4R7ZA 1WUJS 4CYMA 4ZYUA 3BMQB 1C9NA 2HDWA 3HY6A 1QX3A 1BGVA 3PZBA 4HNTA 4TWIA 1SGWA 1CY8A 4WLNA 4JCOA 5E9QA 3BOSA 3JVEA 1Q16A 1U3CA 2HBQA 4E1BA 2PVCA 2XJ4A 4UVGA 5WRFA 2NG1A 2HRBA 2PWAA 3EFOB 3FB4A 4RKYA 4G01B 3C97A 3SSNA 3ZOKA 2W2PA 4DIEA 5DHQA 1PEAA 4GZMA 2ZIZA 2ZIFA 2PBRA 3GMDA 1NBIA 1O94C 1G9SA 2VRWA 5JSYA 1RZRA 3RS7A 4A2WA 1R6XA 1Z25A 3ETLA 3IDSA 4RPKA 4IJKA 3THRA 4AJNA 3UMFA 5CDTA 1DELA 4FFRA 1VE1A 2PXAA 4LKRA 3TE6A 3HCWA 3FCYA 2W2LD 1ZIOA 1H8ED 1E62A 1T6ZA 4O4HA 1GPKA 4JMPA 4RVCA 4UBOA 3TL3A 4AS1A 2CXNA 3RKUA 1A96A