3GGSA

Human purine nucleoside phosphorylase double mutant e201q,n243d complexed with 2-fluoro-2'-deoxyadenosine
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
284
structure length
284
Chain Sequence
NGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFQTVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITDKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a mutant human purine nucleoside phosphorylase with the prodrug, 2-fluoro-2'-deoxyadenosine and the cytotoxic drug, 2-fluoroadenine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase
total genus 83
structure length 284
sequence length 284
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2009-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ggsA00
3QPBA 2HSWA 4F3KA 4ECEA 4YMLA 3EMVA 2AI2A 4DABA 4EARA 4TTJA 1V4NA 3NM6B 1YQQA 1Z37A 3P0FA 2A0YA 5F77A 3EEIA 4DA8A 3PHBE 1SQ6A 1T0UA 2ISCA 1JDVA 1PW7A 4F1WA 2HWUA 3E9ZA 1LVUA 4G89A 3K8OE 3KUKA 4OGLA 1Y1SA 1NC1A 5C80A 1Z34A 1YRYE 4QFBA 1A9OA 3OOEA 4TS3A 4DAEA 4DA0A 1V2HE 1JDTA 1OV6A 3KVVA 1RXYA 1M73E 3E9RA 5F76A 1K27A 4U2KA 4PNPA 5CCDA 1RT9A 5FAKA 1V45E 1U1CA 5F78A 1YQUA 1ULBA 2QDKA 2OXFA 1TGVA 3ODGA 1YBFA 3FUCA 1Z39A 4X24A 2QTGA 3OCCA 2ON6A 4YNBA 1JE1A 1TCVA 5B7PA 5I3CA 2AC7A 4R31A 3DF9A 3UT6A 3K8QA 1JE0A 1ODJA 4LDNA 4MCIA 1N3IA 4IP0A 4G8JA 1CG6A 1U1EA 5CYFA 4H1TA 4QATA 1A9RA 1ODKA 1RXSA 1V3QE 2GUWA 1Y1RA 4M7WA 2H8GA 3FOWA 1PK9A 3GGSA 1RCTE 1TCUA 4LZWA 3NM4A 4M3NA 4D8XA 3KU4A 1OVGA 4TXNA 3UAXA 3E0QA 4L0MA 1RFGE 3OZDA 2PGAA 1RXCA 3DJFA 1Y6QA 1PKEA 4EB8A 4GMHA 1PWYE 1Z33A 3OZCA 1JDZA 3DP9A 5F7OA 2HRDA 5JPCA 2BSXA 1Z5PA 3NBQA 2P4SA 3O6VA 4GLFA 3FWPA 3OF3A 2XRFA 1PR1A 4JP5A 2Q7OE 3OOHA 3UAZA 4YO8A 1U1GA 1VMKA 1Z36A 5F7ZA 1Y1TA 4D9HA 1Z35A 4TTAA 4OJTA 5EUBA 1K9SA 1PR6A 4GLJA 1Y1QA 1NW4A 2A8YA 4QASA 3PHCA 5DK6A 4TXLA 3UAWA 1V41E 4BMYA 1OTXA 1G2OA 4TXHA 4TYMA 1JYSA 1VHWA 3OPVA 4OGKA 1PBNA 4NSNA 4QARA 5CCEA 4WKNA 5B7NA 3EUEA 4GKAA 2OC9A 1U1FA 4OEHA 4BMXA 1V48A 4I2VA 4BN0A 4L5YA 1ODLA 1B8OA 4OY3A 1I80A 4L5AA 1NC3A 4MCHA 4WKPA 3UAYA 3FNQA 4QEZA 5B7QA 4PR3A 3BGSA 1ZL2A 1CB0A 3LGSA 4M1EA 5B7GA 4L6IA 4F2PA 2QTTA 2QSUA 5EPUA 1Z38A 4E1VA 4LNHA 1A9QA 1T8WA 3ENZA 1C3XA 4LKRA 4NS1A 1ULAA 3U40A 1A9PA 2AI1A 3DDOA 1A9SA 4F3CA 1OU4A 2OC4A 5K1ZA 4OF4A 3EUFA 1Z5NA 1TGYA 2B94A 1SD1A 1Z5OA 1K3FA 4R2WA 3KHSA 4DANA 2A0WA 5ETJA 4NY1A 4DARA 3FB1A 3MB8A 1JDSA 1LV8A 4D8YA 1RXUA 1A69A 1OUMA 5CYGA 1PR5A 3O4VA 3DPSA 4WKCA 4K6OA 1JPVA 5F7XA 2I8AA 5KB3A 2HN9A 3KVRA 3NM5A 4WKOA 4BMZA 1PR4A 3P0EA 1T8YA 5IFKA 1RR6A 5F7JA 4P54A 5CXQA 4TTIA 2IQ5A 3PNSA 4QAQA 3IOMA 3MMSA 3GB9A 4WKBA 1ECPA 1Q1GA 1XE3A 3ONVA 3BSFA 3SCZA 1FXUA 5EFOA 4TXMA 1T8RA 2A0XA 1LX7A 4DA6A 1ODIA 4L5CA 5IU6A 1VFNA 1TD1A 1OTYA 1QE5A 1RYZA 1JP7A 3LBAA 3BJEA 3D1VA 4RJ2A 1JDUA 3T94A 1RSZA 4DAOA 3OZBA 3BL6A 1VHJA 1PR0A 1SJ9A 3F8WA 1PF7E 4LNAA 1PK7A 3FAZA 1PR2A 4R2XA 2QPLA 1T8SA 1YR3A 4MARA 4TXJA 4G41A 3C74A 1U1DA 1B8NA 3IEXA 2AI3A 3OZEA 4D98A 4F2WA 3PNPA 1Y6RA 3TL6A 1WTAA 4D8VA 4YJKA 5CXSA 4DA7A 4JWTA 4UC0A 4KN5A 1SD2A 4JOSA 1A9TA 2OECA 3KVYA 4TS9A 2I4TA 3LA8A 4FFSA 3UAVA 2RJ3A 5F73A 1ZOSA 3INYA
chains in the Genus database with same CATH superfamily
3LYLA 2YN0A 1L5FA 5DTJA 3RUCA 3U1VA 3THYB 2AFVA 2OOSA 4MA4A 2QVGA 3RO7A 4D4JA 2BGGA 3RS0A 1PWEA 3I52A 2NU6B 1HRDA 1R9JA 3W9BA 4P3KA 3B52X 5ICEA 1F4PA 4TYQA 3PDJA 5C1BA 1W73A 4HNRA 3U44A 3I5XA 1ECJA 2X1LA 2FEOA 5BNZA 1QQ7A 2IIBA 2QYTA 1NQTA 1YT5A 3TNJA 3W78A 4U6QA 1NIJA 3HI6A 3LC1O 3UCEA 1EFPA 1IATA 1RKQA 1YQDA 5I48A 5DLPA 1L1QA 5JTTA 3E1GA 4WLUA 4HYTA 4LQ4A 2OCKA 3PFNA 5T6MA 1JHOA 3DONA 3DNFA 3IB6A 4DR5B 1U0EA 1FW6A 2GR9A 3TLBA 2XKBA 3WL4A 1AA9A 1N7IA 1KAGA 1IY1A 3A2MA 3DTVD 4WXRA 1LY1A 4YBRA 5U4XA 3GLGE 2G8NA 3R3HA 1C0IA 3IJ5A 4HFRA 3NQ41 3NMUF 3X1MA 3JYPA 1K27A 2WD7A 4TWIA 3F3MA 4GC9A 4M98A 1XRJA 1O97C 2AN4A 4D0NA 3IPRA 1DRUA 1LBQA 4HAOA 5FPQA 2FPPB 4E88A 1WY5A 2PMKA 3PQCA 4P53A 4TROA 5F78A 1O7JA 4ER3A 3FHCB 1PJTA 4C7BA 1MXHA 3COZA 5CDSA 4BBJA 5LXTA 4YASA 2ACKA 1JQAA 2HL6A 1NG9A 4L8VA 5DVZA 1NN5A 1SKUA 4IDHA 4OSEA 3FUVA 3Q4GA 3VR6D 2WFLA 5CPFA 4C05A 2ZIAA 4V0NA 2OT3B 2ZR7A 5A5GA 3FHTA 2GESA 1R66A 4X20A 3MLAA 3AKZA 3QW4B 1YR1A 1YQTA 5I9NA 1G9XA 1M6YA 3TMAA 3H13A 1BQEA 3KKZA 4GZ5A 1VZ2A 1OREA 4IHQA 4IY1A 2O54A 2FFBA 4D92A 3C3KA 3P19A 5BWOA 2H00A 3S1SA 5C46F 4X91A 2FPKA 3TDNA 1TMOA 3OZGA 4A82A 5LJLA 3KB1A 3R40A 3TIFA 3PDUA 2ZXUA 2OEPA 3PQ6A 4AJJA 1Q3HA 3OU7A 1GR0A 1X13A 2XDYA 2M32A 4HDMB 2EHJA 3OP4A 2BKVA 1GKYA 1TFUA 3OETA 4MR8B 2ECPA 3BIJA 3BL8A 4RVGA 3QTBA 2NZUG 2C94A 3AM3A 3I73A 3WGTA 3HDGA 2HADA 3ZHCA 1FYVA 2B99A 2EF0A 1R0CA 4TMFA 1EGVB 2BBTA 4UDOA 3V4VB 2ZT6A 4TUYF 2ICAA 4W8OA 3C3YA 4KO3S 4P7BA 2H5EA 4EQ6A 3CVVA 1QTNA 5A9TA 1ISGA 3TIIA 3IALA 1WG8A 2QXUA 4BP9A 1KKMA 3HKCA 3QU4A 5HCUA 4AY3A 3BZUA 3LY5A 3IIJA 4CDMA 4URZR 4AK9A 5B4UA 4ZPXA 3I1YA 1F06A 4Q9HA 3RSZA 1AXEA 2AXEA 4M8SA 2ZKIA 1S96A 1L7QA 3KPUA 4ZXFA 4DXAA 4PNEA 4KLZA 5GJWC 2Z6VA 4ARZA 4AW9A 2AYXA 3OY2A 3RTEA 5C1OA 5JYBA 4PYIA 5SZIA 4BKOA 1D09A 4XA8A 2AHOA 3BE4A 4WZBE 3G13A 3EAGA 3IPXA 4J7AA 4EVSA 1GQSA 4MPRA 1ULTA 2GYUA 5AUNB 5IDXA 5IZCC 2P65A 2NMVA 2DBYA 1JAHA 3UO8B 1KVQA 1KVTA 2BKUA 3CKYA 3D8RA 1PKEA 2NXCA 2Z2XA 4X1KA 3D7RA 2Q0QA 1O6CA 3RT7A 1JKMA 3T5BA 4ESHA 4ZJYA 5CHEA 1F2DA 1HF3A 2BP7A 2VP4A 2VDMB 2OBLA 1NW3A 5KYNA 4UPVA 1THMA 1G7SA 3E3AA 4CM3A 2RHGB 4CIDA 5JS8A 4CQNA 2GILA 1GQOA 1H85A 2JK1A 5FWXA 3PI6A 2WA2A 2V7XA 2VHJA 1HSOA 1R15A 2Q5JA 4YAKA 3GDOA 1CEQA 4P08A 1M6VA 4IDPA 3V3TA 3JAKA 4BNUA 1EX6A 2RI6A 2F8SA 2TS1A 4BX8A 5ICSA 2I54A 3INNA 1UBJS 2QDXA 2X6QA 2A0UA 4HD8A 5F3DA 3FDIA 1GCOA 4UDNA 3Q2OA 3SM3A 4CLXA 5BQ5A 5HQ3B 1R9MA 1L5SA 2IIVA 2YHAA 4ICIA 1K7YA 4Q5IA 3F67A 3OLQA 1JTFA 4CM9D 1RQGA 1QGUA 2JAQA 3L1KA 3ZWQA 3NBFA 1DKRA 2A4MA 2JCYA 1MNAA 4N54A 2O8EB 4JASB 1LDMA 3OUTA 3HBNA 1QF9A 1ZWLA 5CDHA 1BEEA 3HZZA 4P3OA 4EL0A 2WG0A 5TVKA 3GLKA 4RMNA 1E0AA 1LK5A 3AR9A 3WMGA 4PQRA 1TECE 1W87A 4G5YA 2Z3ZA 4JYPA 3UGQA 3FGNA 3N5KA 1V8PA 1KEPA 3AESB 2RFLA 5ADVA 1OV4A 2O0MA 4XUEA 4GPD1 4TYYA 3KC2A 4IDQA 2XTNA 1FRFS 3T15A 3PJDA 3N0RA 3IT0A 1QK5A 5BN5B 3TCXB 3DCIA 1V41E 3EDQA 4GYWA 1MO3A 4LISA 3MIIA 1U6KA 3B12A 1BNCA 1Y3IA 1G2OA 1VPDA 3K5HA 3KEFA 3OPYI 2MWMA 1U7XA 1EM8B 3PEUA 5AHWA 5ALUA 1U7DA 3DTVB 1BOFA 2WWVD 3NLLA 5BT9A 2JGRA 4EA9A 3L7OA 4NBRA 4MWOA 3CCFA 2R1ZA 2EP7A 2YXBA 3EVGA 1BJTA 3Q87B 4G0NA 3HB5X 3OU2A 3QSGA 2VWHA 3UWKA 1YRHA 3V8RA 5HW0A 1EIWA 1DINA 5AM1A 5JNLA 1J4AA 2WF9A 3RC7A 3NBUA 5MN4A 3D8BA 4B43A 1WABA 1G8PA 2H8KA 1G8SA 2X19A 1N6NA 1UXGA 1DX4A 2PKRA 5L7YA 1J33A 3SU8A 2WTNA 5KSOA 1GZDA 3AEXA 2PWBA 3LF2A 4CM4B 1RTTA 2GQ0A 4AJNA 1E1DA 4UU0A 1PJSA 1C7EA 1BWSA 2R84A 4D0RA 3K1ZA 3KZMA 5AQEA 5JAUA 5DE3A 4FBMA 1F14A 2CMGA 3GVXA 3Q3HA 2OLEA 2CFRA 4BFVA 4ROSA 5HIAA 4JC4A 2HHLA 3E0XA 3OQPA 1D1SA 3UGTA 5LQCA 1RPTA 2NP6A 1TA0A 1EP1B 3PNLA 4RL6A 2HSGA 5LA6B 3FUWA 3GH3A 5BOVA 1N8KA 2HA2A 2AK2A 4L8GA 4FT2A 4P3NA 3R5FA 1F8YA 1JWBB 2OYSA 1E3EA 1J5XA 1VJCA 4Q3BA 1H9BA 3VQTA 1FFYA 1S2LA 4C78A 4AWXA 4EHBA 1DJLA 2PLNA 2E7ZA 1Z6AA 2SBTA 2XUPA 5BQOA 1JKJB 3MELA 4PFKA 3QHPA 2ZDHA 2PUCA 4MUHA 2P3QA 2PKQO 3IA7A 4HH3C 4J7UA 3BDIA 4PNHA 3UFBA 1W88A 1VB3A 4Q1VA 4IIEA 1CZHA 4KNVA 1I7SB 2C4HA 4KVGA 3KALA 5F21A 1J22A 3HXTA 1U7WA 3AV3A 2FDXA 2OCPA 1Y0BA 2ZQZA 1JR3A 3ASYA 3IYLW 4R8VA 1A95A 3SZLA 4DBVO 4DSNA 5IXJA 1HYHA 1RWNA 3BS4A 5KDOA 3RC8A 1D5WA 1CVLA 1Z4OA 1I32A 2QUBA 1I13A 1N75A 2IEDA 1WXGA 3QX7A 4PICA 2NIPA 2MHCA 3TZ6A 3OPXA 3WYNA 1SXJE 3SXUB 2WIJA 3IE0A 3EVZA 13PKA 3L0ZA 3ENZA 4B3BA 1KFBB 2A86A 1L4UA 4DV2B 2HFJA 2HGSA 1ULAA 4LCEA 5C34B 3AEYA 1UDAA 1FBTA 3PQEA 1QX4A 3AR6A 4EQ6B 4UHJA 4YAIA 3OVMA 2I5PO 3VMFA 4RESA 1CE8A 1JFLA 3MYYA 4W7IA 4WCFC 4MYHA 2XV1A 1HLGA 1PFYA 4KQIA 4NMHA 2WR8A 3OJLA 3WA6A 3T5PA 5EMNA 2IH5A 4DDTA 2P8JA 4ZKDA 2JFFA 5K3OA 1VM6A 3LVBA 2JJ8A 4RJIA 3HPQA 3HU3A 4HC4A 4O1MA 1XRRA 4C2UA 1XMIA 3H1GA 1CZNA 1DADA 1V3VA 1Z26A 3CNEA 3DWFA 2OQRA 4YO7A 5JW6A 2CV1A 5E4TA 2ZG6A 3AHGA 1G9SA 4AMZA 4K6CA 4QEDA 3OT1B 1NL3A 3EA4A 2E9SA 3RYCA 5KAMA 2E55A 1XR3A 2F90A 1Y3AA 2WSSD 2XKAA 3DLIA 3RVLA 4B48A 2MU1A 1L9KA 4TRJA 2CDNA 2HRCA 5DBHX 3GN2A 2Z30A 1TJ5A 1IN4A 5GM1A 1EU1A 4XCXA 5C1PA 5DGIA 1X0VA 3E8MA 3DVSX 4LXTA 5TX7A 4AB1A 3CW8X 1CR6A 1X42A 4EMSA 2Q3JA 1WZNA 1L2TA 2RG1A 1FY2A 3HDTA 1M2KA 3OEEA 3OWXA 1RLJA 4OI2A 3HLKA 3ROMA 1C8BA 2O52A 2WEKA 4PCAA 1KH3A 3HCRA 4R1PA 2RHCA 2P6PA 2Q4OA 3ANYB 4RJLA 1XLTA 2X40A 3W2FA 1VI5A 2XEDA 1NXTA 1D4AA 5JANA 4RFVA 4ZVUA 5A71A 3KSAC 3GJXC 1M6VB 4L75A 3F5MA 2YHIB 4ACAA 2LBPA 3GXBA 2WAYA 1VJ0A 2F3SA 2CL0X 4QQ8A 4AZ3A 1QONA 2WF8A 4K88A 721PA 4G0WA 2ODAA 2WUDA 5ERYA 4BMVA 3TGPA 4IDAA 2ZYTX 1LDEA 1BXZA 1HV8A 4H1VA 1A98A 4M8IA 1FZQA 1GGMA 1V26A 2PAFA 1KIAA 5TPWA 1HFWA 4FOLA 4HGQA 4HH4A 4EBFA 1HEUA 3JV7A 5TEWA 3ITNA 3R6LA 3R7FA 1ISJA 3VR4H 1MX3A 3LDHA 1NI5A 1FJ2A 1U0HC 2XY4A 3AVOA 4PX2A 4Y0NA 4ZCQA 3SJ7A 1ECPA 3ZTWA 3G7NA 3RHZA 4JYBA 4Z9BA 4D4MA 3DLHA 1ORIA 3EGCA 4UQLA 3H83A 1YCHA 3QW2A 1UT5A 4LXHA 5GIOE 2PTGA 2ODPA 3DJYA 3EXEB 3PSHA 3TZBA 5ARBA 4EA6A 4X93A 1R0YA 3AW8A 4KL8S 3ZGNA 4ZZ0A 1GZSA 1QHEA 4WVFA 1SCNE 5BR8B 4TRRA 2GN4A 5HRAA 1H5QA 1ABFA 2D3TA 3CZAA 3VPSA 1L8LA 2AOTB 1W0JA 1OXBB 1V25A 2XUAA 3D2BA 5CT5A 1G6HA 3DZHA 3IJRA 3LBAA 2EG9A 3EZYA 5EUCA 4DCPA 5CM9C 3UV7A 2I3DA 4P92A 2R3SA 3LDFA 4J0EA 3T5DA 4X61A 5FNZA 1MDBA 5B1EA 2IGBA 2EKQA 2P2ZA 3EFOB 3EDCA 3FZYA 3OIVA 3ZGLA 4RTMA 1IRXA 3OZBA 4HVTA 4ZI7B 2POCA 4PO3X 3QVXA 4JU8A 3CZ5A 1ZM9A 4FCTA 4FNGA 4O4LF 4WV3A 2B0JA 3ETCA 1AGRA 1QG4A 3A6JA 3LPNA 3ZIDA 3M5DA 2X1MA 1MF7A 3IO5A 4HDMA 4WE3A 3B9RA 1RCFA 4FFMA 4PGMA 1KJIA 3W3AD 4TVSA 4M36A 1ZL0A 3RIYA 4Y6GB 3SLKA 1CEYA 1T24A 2BJHA 3DYIA 3LX8A 4K28A 7ABPA 5CA0F 3QUTA 1ICIA 2J3HA 5ITVA 3H6HA 4AKIA 5DEOA 4JLMA 4BCDA 4DZTA 3QE9Y 3NI2A 2DHEA 5C8VA 5LQDA 1MD9A 4XWAA 2D1RA 4NAHA 1PG2A 3E2MA 3UXMA 1DDGA 3P0HA 3UUEA 3QLJA 4OFZA 3P27A 1TC2A 4I1YA 1E69A 4L0QA 1F38A 2EYQA 4EW2A 2DG2A 4D56A 1UKCA 4RXUA 4BNHA 1DT5A 3UHJA 1QV7A 2J0EA 5FHQA 2K7ZA 2CHVA 2QUAA 3PRKE 2X15A 4GGPA 3GEPA 4HDAA 4LV8B 4A03A 2EDCA 5F2OA 2BFMA 2XDQA 4L9WA 1NFQA 3S27A 4B6EA 2MDTA 5LQAA 3EQ8A 1EUYA 2PUBA 2C82A 3K16A 3UCXA 3QA9A 4LXUA 4JJZA 1E9EA 1IWPB 2WHPA 1FP4A 2I76A 5I9LA 3DZFA 1BSVA 2E85A 1RYNA 4L02A 4CM9A 4B33A 1T3ZA 4M0KA 1O95D 4AN4A 2NN3C 3E5HA 1WMAA 3OJXA 4QOIA 1DFGA 4RD6A 2OZEA 3UXHA 1T1GA 3KKNA 2RI0A 1L5ZA 4I9GA 2NXWA 3X1KA 4CM1A 4YAGA 1E5QA 3SJUA 5FFMA 4YRMA 4ALLA 5IMBA 1USIA 1VC2A 1Y3FE 3EOZA 1C41A 3NEJA 4FE7A 4OU5A 4RPCA 1NBOA 2YZ7A 4O33A 5HS4A 3SEQA 1I3NA 2X14A 5EGNA 1S0UA 4HDNA 4C0KA 4N49A 9ABPA 4MUKA 4HDSB 1UXOA 4UUPA 2FPOA 1Z3CA 1R5JA 3TW6A 2WWWA 2QAGB 4KE6A 1PQYA 3DEKA 1AO0A 4IRMA 2IXFA 5DGHA 2OG1A 5CURA 5HOQA 4B35A 1XF1A 3NG1A 2ZPTX 3LQFA 1ATIA 4I55A 2AB0A 3KYCA 4NCAA 1T0IA 2OV6A 4ARVA 4BTLA 3ANTA 2NG1A 3NM6B 1X7ZA 4Q9KA 1E1RD 3HKEA 1HDZA 3SC3A 4ZVOA 3MJTA 1WVMA 2O8FA 4V1CA 1R9NA 2CFTA 1OWNA 1U2SA 2YYAA 4FX2A 4DA8A 3P2OA 2PXCA 3R3ZA 2X7XA 2AMYA 4IHJB 5K0LA 3IESA 1Y81A 5K0ZA 2H63A 1DRJA 5LA6A 4GLLA 4NEHB 2W6NA 3LUFA 4U3JB 2AKEA 1YL6A 3PU6A 3ZLVA 4YUAA 3A4VA 1IXSB 2ZCJA 4R54A 1ZNXA 2OCLA 1SPXA 1MG5A 2GZDA 4ZVLA 1FVHA 4LEIA 1Y1SA 4RVOA 3K9CA 3TK1A 1NC1A 4BNJA 1XCLA 1CLUA 1U8YA 3RRMA 1HA3A 4UVEA 1WPRA 3OJCA 3SNKA 1Z2CA 5CH3A 5JSUA 1W88B 3KUXA 3RVQA 2NSDA 121PA 3BH0A 3OO0A 4OMUA 4S1NA 1N2HA 2E82A 3SC2A 2QY9A 1JJVA 4QXOA 5EWLB 1Q57A 1Y9JA 2RC5A 3O82A 1FNMA 3DTNA 4UEKA 1L5NA 3IKTA 1EAYA 2LD4A 3K09C 1GTZA 1H1TA 2Z8YM 1V45E 3BJZA 4W6QA 3X3HA 2FUEA 4GOXA 1BWQA 3G5AA 3NRBA 1SHZA 4RVHA 5CW1A 4ZVMA 4L9RA 5JPDA 5EKSA 3ZYZA 2ZM6B 1VGQA 1DE0A 2LDBA 1UH5A 5BOSA 2ST1A 3PFWO 2OXFA 4EB6A 5A4JA 4KPUA 1LDGA 2V98A 3X1WA 3A32A 3KM0A 4HX9A 5EN4A 1Z39A 1JSCA 2JI8A 3HL4A 4FFDA 5HG0A 5CB4B 4XIFA 1PQPA 4A91A 5JAMA 1SVKA 5HJ5A 2X6TA 1U2QA 3AKYA 2WI8A 3KVOA 3IAUA 1IZYA 2QTBA 1DOHA 3CX6A 3I76A 3L7YA 3GF4A 3QNWA 4FSXA 4B3XA 4R31A 2R96A 3EBOA 2C4KA 2VLBA 3H0CA 5DBIA 4E5PA 4M6WB 2HLDA 4YIKA 1ODJA 1DOAA 3WMXA 2BFEA 3D8TA 5F3WB 2ALJA 2PT5A 3N1UA 3Q88A 2JLBA 1JR3E 3BGDA 3UBMA 3BREA 3SVTA 4YRRA 4MJ3A 1E4EA 1V4VA 1C3LA 1WD7A 2QNRA 2WJAA 5CYFA 2R6CA 5KUTA 3ZGZA 3QWIA 1S02A 5JBNA 3ILHA 3DBRA 3G49A 3TW4A 4GOLD 1TYDE 1RADA 3VC3A 4EG8A 2GFQA 3A1DA 4PN3A 1EVZA 5IT0A 4C4XA 5JROA 3FVQA 4YMTA 5K7SA 1JAXA 3LH5A 3OE4A 1JIIA 1XVIA 4IOJA 4UBOA 2IUYA 5D01A 1QS0B 4GYKA 3FYDA 1XLVA 3TLZA 1Z4NA 1XP5A 2GAJA 3A05A 3AR8A 5BSMA 3VU0A 2NM0A 1E59A 1Z75A 4X00A 4ND4A 1GG9A 3MUOA 2VUTA 2DFKB 4KLCA 1MR3F 4IHAA 1P1BA 1A7AA 4BKUA 2H1FA 4AZTA 4QU9A 1XD2B 1SCBA 5E6SB 3NC1C 2WZDA 2WM2A 1G8JA 5JS6A 1RFGE 2G4VA 3O3CA 4YUYA 2OXIA 1M76A 4F72A 1N2CB 3MD9A 2OHGA 2VKTA 1BCRB 2F3PA 3NTVA 1R8QA 3ELUA 2JCVA 3MWLA 5LVAA 3FHJA 3GEMA 4HEQA 2Q6KA 4X41A 2BE9A 3OQ1A 5F9MA 3I92A 4DC9A 3DH0A 3HUFA 1ZCZA 3JZMA 1S3GA 3WIBA 3RGWS 1FRQA 4TTPA 5HS6A 2G6TA 3U4GA 1AV6A 1TQ2A 3H5OA 3DE0X 4JX8A 2HRDA 4FGKA 2PJDA 3D7KA 5F7OA 2J0UB 3EQ9A 4XUGB 2BFAA 5BSUA 1YA8A 1G9TA 2AF3C 4NEGA 3SSNA 2RHOA 3RLFA 1C4XA 2B8TA 4JEHA 2Z3VA 3VJLA 4DDHA 4A92A 4Y2XA 4GLFA 5BSEA 1KO1A 3MCVA 2C9OA 5BRAA 3PPYA 3ZHYA 3L6RA 3CX8A 5DM1A 2IF2A 3BEOA 2Q29A 4FI3C 4EG5A 2IYFA 4DNPA 2Q7OE 4PZEA 1TM5E 5KHAA 1PQWA 5DJ5A 1GA1A 2BMJA 1I2BA 2UUOA 4REQB 5F7ZA 1W36C 2CSXA 4LYJA 5L3RA 4YLEA 2C07A 4K9NA 2FZWA 1Y82A 3MQ4A 1I2CA 3ELDA 4GUDA 4LWOA 4MYTA 3U3DA 4KR7A 4Z9AA 4ED9A 1JHPA 1JLLA 3EFOA 3HYTA 4LCBA 1WNTA 3ET4A 2RBGA 3NWJA 1A9ZA 5AI8A 3BSWA 3U4AA 2R4QA 4EUKA 4ES6A 3WRVA 4K40A 2GK7A 1XN4A 3O2NA 4ZEOA 4LMAA 1RWMA 1N34B 3ROPA 4WXMA 2IKSA 4KWCA 3L1VA 3TLCA 1F7UA 1J56A 4N3BA 4UXHA 1QE0A 5H5JA 2RDMA 2EGHA 2VCHA 3D64A 5DM4A 4AMYA 2XUIA 2HLPA 4AMVA 3M82A 1E3IA 3F5SA 1ZA2A 3R7AA 2Y2UA 1BYUA 3ZHSA 1P1JA 2O2HA 3G88A 4F9GA 5FA8A 1DIAA 2PT9A 3A2KA 1ADYA 3RRBA 3L4EA 3FLBA 1JQ3A 3SX4A 4YRNA 4RK0A 1JEAA 2WWGA 4WMLA 4A2QA 2TRSB 1W0CA 2ZSUA 3D3WA 4HFJA 4PZ9A 2X9QA 4V2IA 1ZXXA 2CMHA 3ND9A 3TLXA 4PLHA 5CX4A 2WA1A 3VTKA 1GRCA 4LJ8A 1DFIA 2DVMA 2QN7A 8ADHA 1CS4C 1HG0A 2LNDA 3D8SA 3FVTA 5I4BA 1T8PA 1VIMA 3OPMA 1OX4B 2KWIA 4OMCA 4F2DA 4UTVA 2X0RA 3MTJA 1PZEA 3V6LA 3UTCA 5JAZA 1ORTA 3LCRA 4HRXA 2B21A 3H16A 4WZBA 2P2YA 1Q0ZA 4C3UA 2J7KA 2PD6A 3ZE9A 4F46A 1NP6A 3EZGA 4UMDA 3AHCA 3O0DA 4OAPA 4Y2RA 3VR5H 1VSVA 3IT2A 4AURA 3LOUA 4B84A 5IAOA 2Q5CA 1T9DA 4RH3A 3OZIA 3CU5A 3L8ZA 5ALVA 2HOQA 4X3OA 5A5DA 4HVLA 2VR1A 2BTOA 2WLTA 4XR9A 3USZA 1RLUA 5EUQB 3COJA 2P6UA 4I5EA 4U5XA 2Y2VA 3GLFE 3ZVLA 2F3TA 3BCSA 3I4CA 3ILSA 4JDPA 1CKEA 1L7PA 2HGZA 2I80A 3D7NA 2C9YA 5K09A 3QXHA 2DLDA 3FTCA 1PD1A 1S01A 4GE0A 2A2ZA 4Y2HA 1P0IA 821PA 3F8TA 1M1NA 1ZL2A 2HD4A 2I33A 2L82A 1G5TA 1XQVA 2R8BA 2FG6C 3CNOA 3IUNA 3P94A 1QORA 4H4EA 1G17A 5HJ7A 1KSJA 2YQZA 1QIFA 1TUBA 4M1EA 4MR7B 4MRAA 4EI7A 2DUMA 2J85A 3COYA 2EZ9A 2QTTA 3LC0A 4F6CA 2JAOA 1MOSA 4CNBA 1EWRA 1IWBB 1KEVA 1SGWA 1YXMA 2HY7A 3I1FA 2A5YB 3T7CA 3ZKAA 4AF8A 4BNXA 2X8JA 2PL3A 3F6SA 3FNRA 4BV9A 5AR1A 2V6JA 2XVMA 3HXOA 3HABA 1EP9A 4UW9A 2R8YA 2QLFA 3IMKA 3AVXA 5DLDA 4BIMA 2WT9A 2QBYB 4NS1A 2ADOA 2JZNA 3U3KA 2EVWX 2UVQA 2PJZA 2WU3A 4QZVA 1ZHHA 4BGEA 2G04A 1YHZA 3CRQA 2BGMA 5DN6A 4CGZA 5DF1A 3PXUA 4CQJA 4TV9A 2C59A 4Q1AA 2Y3IA 4B44A 3B1ZA 1U28C 4H7IA 2OZKA 3HVIA 1CNFA 4WOJA 3D2CA 1J8QA 4BWYA 3O74A 1HOTA 1WKBA 4O59O 5TQ2B 1OKKA 2CDCA 3OCZA 1Y8QB 1U3FA 1E0DA 4KN8A 4CV0A 5AK3A 5DRYA 1TA9A 1DRWA 4F6LA 2ANCA 2FLKA 4B31A 4DM3A 3L8YA 1LLDA 3ADBA 1K7FB 3PZBA 5K99A 3GLHE 4Q3OA 2HXSA 3KNZA 3P9XA 2I6UA 4IDGA 1N1GA 5EE5B 4J29A 1EVLA 2W2KB 4RD4A 1FP7A 1VHLA 2F59A 3FB1A 2HO5A 3G1TA 3ZJ4A 1K5PA 3WAJA 2I2WA 3BWXA 4C0SA 4DEXA 4KVAA 3MT8A 1OBFO 3QWHA 4YJFB 2FEAA 3H9QA 4IOMA 1XPJA 2AEJA 4CIBA 1D7OA 4LOIA 1AOXA 2G5GX 1Z4IA 1NBEA 2GI4A 1UBMS 3O8NA 2H85A 3VJMA 4FNOA 1I9CA 1R0XA 4WKCA 2QMUA 1FP1D 2XE8A 2AUNA 1P39A 2UVPA 1Z0UA 3OQBA 2QN3A 3DOFA 3PD1A 3QPCA 4YJ2B 4B4VA 1X7ZB 4GPAA 1U3WA 2R00A 3K9BA 3UANA 5KJ6A 1UBUS 4M88A 4ZZ3A 4BWFB 4WEQA 4KW7A 1YU9A 3LLUA 3ZDAA 1ZKMA 5HCIA 2PUAA 1RR6A 2OKGA 3KTFA 5BVHA 4MQBA 3GLHA 3LKZA 4B3FX 3OM0A 2GZ3A 1L9XA 2WSMA 5FOQA 5AJZA 3U4QA 1FFXB 3ZZ1A 4BWVA 3KQNA 2ZI5A 1R5OA 2EFYA 4MV8A 5TQ0B 1BH2A 2JL1A 4L78A 2PSFA 3DHVA 3IPYA 1H22A 4R9RA 2D5CA 5EWLA 2GS9A 4EA7A 4EL5A 1O0CA 1YJCA 1R0SA 3C8UA 2J9FA 4Q3CA 1TQ8A 3D6MA 1WCIA 2E5FA 3L7JA 4B2YA 4QNRA 3ESDA 3PNBA 1VFPA 1NLMA 2UZ0A 3AUUA 4JYMA 4KG7A 1CUWA 4OBXA 1JHMA 1GLVA 1QG0A 1L7MA 2OB2A 1M1UA 3HKDA 5LYJB 3TLAA 1NVTA 2WYVA 1F4VA 3LYUA 1M66A 5FCDA 4QYWA 5IKOA 3JXEA 1RLMA 1XRQA 2EKZA 3AV0B 1E3JA 1XU4A 4BDTA 1ZU5A 5E4JA 2N42A 4TTSA 1CUSA 4IX9A 4R16A 4I9UA 3VAYA 4JDUA 5EE9A 5L45A 3OWHA 4BMDA 1XTTA 3WJ1A 1E2QA 3WNZA 2OE2A 2QNIA 3JQ9C 4JSRA 3WKAA 4DSTA 1LB1B 3RYFB 3M6UA 4B4OA 7REQB 3GEGA 1FFCA 2YR0A 4KLRA 3WQSB 4I0WB 4XOIA 1XZHA 3E3MA 4C4SA 1MX5A 1VYUA 2HSJA 4B79A 4YRPA 3JZAA 5KQLA 1PWXA 4GH5A 2GM4A 4MMZB 2H65A 4KYVA 1T8TA 1UPTA 3K0KA 3FMOB 4Q9NA 3GPCA 2V1UA 3OIUA 3OBBA 4D6PA 2AKYA 1UZMA 2VDWB 3UAGA 3LDAA 1DKPA 2FN9A 2KMLA 4BXOA 5HFJA 1TMKA 4TLEA 2D5BA 1VE3A 2QD1A 4MUBA 2Q8QA 3S1AB 4EMBA 1Z6XA 2XBLA 2QA5A 2Z56A 4RYLA 4CHTA 1YR3A 4JIGA 4QTTB 1G2IA 3RYTC 3LIIA 2PZGA 2BEKA 4AZSA 5JCZA 4BKPA 3EE6A 3DTYA 4DG8A 1YR8A 2OFXA 2ZJ4A 4IUYA 2O2CA 3DHWC 2P0AA 5T4BA 1U2GA 4E5UA 3SOZA 3BERA 2IUTA 3PEVA 4HNGA 3EF0A 1Z8NA 5KOIA 1VLVA 2XB4A 1MW8X 3CS3A 1FS5A 3VHXA 2H48A 4X66B 3INTA 4YN3A 1B8NA 1UBFA 3LLCA 4U7WA 3MT0A 5B1DA 2HBZA 2WW8A 3ROGA 4ZIRB 4BEWA 3GJ6A 1GHTA 5F5LA 4QYIB 5K51A 3A1UA 1IQRA 1XMSA 1NW9B 3LBIA 2YNMD 3ZXXA 2DAPA 2JEZA 3HA3A 1NV9A 3OWOA 5AHRA 3DR3A 4F2WA 1XMVA 5EZYB 5AVSA 3HSYA 4UM5A 3DFFA 1JHYA 3WB0A 1SKBA 2O50A 3DG9A 5D3MB 2JIZD 3RIHA 4HXEB 5C8YB 3QX9A 3VTFA 3AIKA 1DEAA 3B82A 2JNWA 3FRJA 4M9QA 1VBKA 3KE8A 2X22A 1J8VA 2H4HA 3GGJA 3LO8A 3VAZA 4IZ6A 2YJ6A 4XW2A 3W5DA 3WYCA 2BR5A 1WXEA 2TMGA 4J0IA 4CKYA 5HK9A 2KB0A 3BSYA 4DV4B 3HBMA 1B8UA 3NETA 2P9QA 3JRNA 2GPAA 4IIJB 5JI2E 5C4GB 1R6XA 4DSAA 4BFUA 4K1LA 1XZNA 2CJXA 2JC3A 3ZHOA 2QAIA 4YGYA 4FHCA 2HSWA 4PEVA 2BZ1A 1KYQA 4X7MA 1LGYA 3W3AH 1TTHA 3AX6A 3QKSA 1U8FO 2PSHA 3IDZA 1XYGA 5KNBA 1XHLA 2PZFA 4G1BA 2EFGA 4OLAA 1ADCA 4WVLA 5DI3A 1P18A 4QM7A 5B2ZA 3ZIAD 1Z8FA 4M87A 3I64A 1G21B 3WGGA 4KSYA 1RWOA 4RHTA 4DDVA 3FFWA 5A3VA 3H05A 2MYNA 4FKBA 1Q6ZA 3R9KA 3HB9A 1JDVA 4QDJA 4XWYA 3HVHA 1YIDA 1EK5A 2JVJA 3DKPA 1NTOA 4CF7A 3VGPA 3VH4A 3EDMA 3GEHA 3PGA1 2I6TA 3TR0A 2WKWA 5A04A 1XRPA 1KI4A 3OFND 1RYEA 3GLQA 4FMDB 3ODPA 1VSQA 2PK3A 3UMFA 1T36A 3HH8A 4F6RA 1O5OA 1KYIA 1SG9A 3N5CA 4PPQA 1ZGAA 3FUTA 4QOEA 4YJFA 1YVUA 4UHEA 3VZDA 4TS3A 4HDOB 3CVXA 1SQFA 1YZ3A 4LHEA 2QN6A 1TUGA 1XYVA 5THQA 4JC8A 3R5HA 1R0WA 1RP7A 3ZE7A 2WZCA 5L53A 4UZSA 4X97A 1WB9A 2IT1A 4C5CA 3ABZA 1UMDB 3JZFA 3QWBA 3MUNA 1VMAA 1KH2A 1NJGA 4C30A 3SD7A 1C9NA 1VL6A 2OBBA 2QDKA 3Q5DA 1UC8A 4KO8A 1RJ9A 3SIPA 3ZG6A 4B1FA 5HQ3A 1PVOA 4PZZA 1F3LA 1O94D 1C3OB 4Y2SA 4KJZA 2HNKA 4RTOA 2BSQA 1TEVA 3LBHA 1K5DA 4H77A 4MIEA 3V1UA 1FS4A 3ER9A 3AIIA 1QHHB 2NVWA 4JLVA 4LVNA 4RO0A 1VSUA 3BRWA 5K6RA 1FMCA 1TC1A 4U7HA 3KT3A 3RRZA 2I22A 4DWJA 4DY4A 4M86A 4F9FA 1RWXA 1W4CA 3CR3C 4FOPA 5FADA 1P33A 4RD1A 2IC5A 5K0TA 5ECWA 4FLFA 2CLOB 2DBVO 2R65A 4YDSA 5PNTA 2XOEA 2PSSA 3HRHA 2PYDA 3KAPA 3WX0A 3QNMA 5B7PA 4OFBA 3KEQA 2GNPA 4DMFA 3QVJA 1IN7A 1K6MA 1A4XA 4OGFA 3U6KA 2JCXA 4BO2A 2P6RA 4GC5A 2RK6A 4QAJA 1EFVB 2GN6A 3UYKA 2OCAA 1QGDA 4FUTA 1B7GO 1DHTA 5B55A 4FE4A 1NFRA 1SU8A 3OQNA 4FW9A 1EXMA 4MCJA 2VK4A 3OTIA 1W4BA 2AN9A 1YNOA 4KDFA 2AZDA 2IWRA 5FYQA 1UJCA 5TMBA 1GL3A 1YCFA 2JIZA 1GAWA 4JJFA 1NT2A 3JYHA 1FRVA 3ANSA 3VC7A 3P8ZA 4DV0B 4Y6PA 3O8CA 2UYCA 3EXIB 1CV2A 4F5WA 2DPHA 2NU7B 3BGVA 5JRJA 2IUEA 2QSYA 3AOEA 3DV2A 4MKZA 4OQZA 4Q00A 1RCTE 4LFBB 1JR2A 1TVKB 2O4CA 4CUZA 1OXUA 2DR0A 4X1IA 1MFPA 1PV4A 4ER5A 2RH5A 2XZLA 2P35A 4IMRA 2NU9A 4OL0A 2AR0A 3FBTA 4P82A 2QENA 3P9QA 3VHRA 3K6SB 3DYBA 1LBSA 3ZR4B 2BZ0A 1MOPA 3WR5A 1P44A 4NHEA 2PZKA 2QUIA 1M72A 4M0EA 3DV0B 4DLLA 1DGQA 2VEOA 1T34A 5L4LA 3ZNOA 1FVFA 1YZHA 2PH7A 4FPXA 2VRCD 4Z7NB 4S35A 5AOCA 2XGMA 4P3XA 3RFUA 5K8LA 2I67A 3KZNA 2W71A 3LT2A 4N03A 1L4EA 4BVAA 2XSZA 5IYZA 1H8HD 1QIJA 3VYSB 1A3CA 3QG5A 1Q16A 1ID1A 2CFIA 2VTDA 4UFOA 3G9ZA 1H0SA 3QVMA 3ZN2A 2B37A 4FMCF 5D2CA 2BL4A 2M9MA 3OIWA 3S70A 1K68A 1HWYA 4KH0A 3RPEA 4KR6A 1R0BA 1IXZA 4CG3A 2CE7A 2JFVA 1TT5B 2FN4A 2YHUA 3CW9A 2J9FB 3CA8A 2VDVE 4GW3A 3EIEA 5HQTA 2IL1A 2RARA 2ZQ5A 3IR6A 4G67A 5EWJB 1EVYA 2CEKA 2ZTHA 4LF6B 2ZIVB 1PS0A 3GL9A 1PR9A 3H86A 4DIEA 1LQUA 1T2VA 2Z95A 6GPBA 1M34E 1ZO8A 2ENWA 1TK9A 3S4YA 1Z6PA 3T3DA 4A0SA 3G8BA 3ZZ0A 1V16A 1E18A 1ITZA 1XDBA 5A9RA 2MOKA 1LPPA 2ZBPA 2Q3LA 3E7XA 3OOHA 4G4SP 4PTZA 1FNNA 1JQKA 3A6HA 3MWYW 3E5RA 4DBLE 1MMFB 2PUFA 1VPVA 1UBHS 4H6PA 2F9LA 5ED0A 5IM4A 4JHXA 1GZ4A 3IBTA 1O94C 4MYRA 4OJYA 2Q1TA 5CHYA 3SZ3A 5HF8A 2IOFK 4D9EA 4L6CA 5G0WA 4XFKA 1KXJA 3FZGA 4ALNA 3Q8WA 1VLQA 5C7IO 4KRGA 3KLBA 4G36A 4UBKA 2JLWA 2J1LA 3LHIA 4CQMB 1C29B 2V97A 5D84A 3ICWA 4MHTA 4MRRA 1U8TA 1J6UA 3UN1A 3R5TA 3G0BA 3HXMA 2Q4BA 1IB6A 3AF1A 3MTAA 2B5VA 3OCXA 4YT8A 1KE2A 2WNIA 1CK4A 2XNJA 1Z68A 5KAPA 4PG4A 4YRBA 5K03A 3I8OA 3SQLA 2YWXA 1BD4A 1YGPA 2F6RA 2AZ4A 3ETEA 4TSKA 4CM6A 3QLUA 2C84A 3C7CB 4JLDA 1X19A 2AR7A 2VDRB 4HP8A 2QMZA 3EMKA 4DMLA 3M33A 2QJRA 3TTVA 3L46A 1KJYA 3C1TA 3HWWA 5C51B 1K66A 2L18A 2HU2A 2PSDA 1VHWA 1K8XB 1NQVA 2ADFA 3DXZA 4D3SA 1TVEA 1BU8A 3V4ZA 3LBNA 3PGVA 2V1XA 4GBJA 4TMZA 1CUJA 4NSNA 2MSEB 4C4PA 1NVMB 4EHJA 1PEYA 3BX1A 3QFHA 1U8UA 4HEA6 5AJWA 4BC1A 1IM2A 1Z7WA 1YBHA 1ISIA 2BAGA 3TQQA 4BTVA 3OJFA 3RSSA 2VHTA 2BFPA 1U0SY 4BEVA 3EXHC 3HR7A 4N9QA 3SNHA 4FEYA 4IHJF 3PG5A 2VHZA 3SYMA 3TKYA 4BNDA 3TLKA 4MVJI 3U09A 1I6MA 1XZQA 1A2KC 2O2IA 1UXJA 2ZK7A 4IDNA 4P58A 3QX8A 5AUQA 1Z7YA 5FI1B 4FJ2A 4IJWA 4Z54A 4HLCA 1G21E 1SXJA 3GIDA 4WT7A 2XE7A 1FUEA 3IULA 5C4MA 2J09A 2BH2A 4M1SA 2PQ6A 3RSQA 1ODLA 5E4FA 3FPAA 3SYTA 1CY1A 1L7EA 1H5NA 2BTQA 3B3GA 4I46A 5JOQA 1I80A 2I8LA 4HQ0A 3VSAA 2JFQA 4DCCA 4I1OA 3A1SA 3CLRC 5HOEA 4XTCS 4W9MC 621PA 2C03A 4B87A 4BQSA 3T0FA 3RRNA 4MUFA 1BXRA 1T4DA 1U9CA 5ALQA 3H87A 5JD3A 2WTXA 2B1JA 4AP6A 5ICCA 1P8JA 2B61A 2KM1A 1ZAKA 3O2SB 1CFZA 2XUKA 3NTXA 4FNAA 1XQXA 4IWXA 4NQZA 1SCAA 3JTMA 4JKIA 1TUEA 1FP2A 1TZJA 3M6FA 3N7UA 4RV5A 1T6ZA 1GZ6A 2A9JA 2IYTA 2PWPA 4LPSA 2XJ9A 2J0SA 1GG2A 2A57A 4WA7A 4OVKA 1CYEA 3H2YA 5EQTA 1X1DA 5EL0A 1JAYA 1GPYA 2Z9DA 3H7IA 4N7MA 4W9NA 5E6UA 5LB2A 2NU6A 1D1TA 4CIAA 2Q5IA 2QSUA 5DZSA 2QQ5A 4E22A 1YRBA 3AJ9A 5CVCA 4YWHA 1XDGA 4BFCA 1PNRA 1ECFA 2R66A 1E9SA 1E7QA 4CHGA 4KX5A 1KL7A 4P5DA 5HDQA 4RLHA 1QFYA 1AHNA 3G5TA 4JBYA 4M1KA 3RTAA 1T8WA 4LGYA 2GCOA 3VR0A 1C3XA 2BEWA 5BV0A 2QX7A 3HFRA 1EQUA 4ZIRA 3H2JA 1QHIA 3PXDA 2NO4A 2CXOA 4IS3A 4UCXA 4FR0A 3SDSA 3IEPA 1NNLA 3ZWPA 4EK9A 2V7UA 2JD0A 1Y4ZA 3CVYA 2MR6A 5TXGA 3SF0A 4JLNA 1Q7GA 1SULA 2HXGA 2B4RO 2GBIA 2OSVA 1GIAA 2ZUCA 1AZSC 1JJBA 1OGYA 3C6BA 4UKDA 3VPAA 2O14A 1X8XA 2GHQA 3FVVA 3JSXA 5KJ1A 1JWLA 2DY0A 4QJ5A 2HNBA 1FDSA 3L9WA 1RAAA 3SXJA 4ABTA 2GZMA 4OMDA 4TMXA 5CT8A 1VGRA 3VYRB 4YCMA 1G6KA 2PUDA 1I5EA 1XDWA 3NHKA 3ET5A 4L4SA 1U3DA 2VDKB 3A4LA 4OHRA 2WY2D 3T3PB 3K0FA 3I6ZA 5TIIA 4DY6A 4JQSA 2SCUA 2BYTA 3UAOA 3ZCVA 3LT0A 2OZLA 3G02A 1EJBA 4GI7A 5CA1F 3VPCA 1T0BA 4I9FA 4DOMA 2DEUA 1QV9A 1GPBA 3C8HA 1DCFA 1WL8A 3HEMA 1YONA 3KXPA 3D8HA 1SKYE 1SBYA 5BRJA 3RTGA 1U4NA 4OU4A 5CGQB 2CKDA 4R40A 3LY9A 3DMNA 2M1ZA 3MYRA 1OFTA 2QORA 5EEHA 2G25A 2V0GA 8OHMA 4ZHQF 1DEKA 4F2HA 3NTRA 4UHHA 1M67A 1DJNA 2XA1A 1FOEB 1U9YA 4MUNA 2V7TA 4Q4JB 1G3UA 3L6BA 4KR9A 3U48A 2J8ZA 3CYFA 4OOFA 2CNNA 1VSTA 2GKSA 2EEPA 1D3AA 2GMWA 2GJKA 4FHFA 3JQ7B 2B7CA 1MUUA 1ZITA 3LCMA 1IZ8A 3ZX5A 4EF5A 1AF4A 3VO2A 2HN9A 5IBPA 1FJHA 3K8YA 3KVRA 4MTLA 4ZAVA 2B20A 2ET6A 3TQTA 1LNZA 1E1YA 3HACA 3OMXA 2QN1A 2VSXA 4JODA 3PF9A 3IDAA 2QR5A 1Z28A 1IIRA 4BP3A 3B8EA 3JR3A 5KU7A 2JKZA 3H18A 4PS0A 3KV3O 1NNSA 5KVSA 3L49A 1PLJA 4IWYA 2NYUA 4RX1A 1VYHA 1VXOA 3NC4A 5I5EA 1OXXK 5JHHB 5LU9A 2WZQA 5ALLA 1W4RA 1XTRA 2Y0EA 3ACDA 3RUIA 5JQWA 2WKSA 1OU0A 5AKEA 3ITKA 4QPZA 3NKFA 1K6JA 1SC1A 4I50A 4XDZA 2G0TA 3NCHA 4F7DA 1G8YA 1YR2A 4D9GA 2ISQA 3QBDA 5T6BA 3CPJB 2X0IA 2P9HA 3GZ4A 6AT1A 2V7GA 3K35A 3LAWA 3NBXX 4UUAA 1QANA 3KWMA 3VPGA 4BNVA 1U0BB 1ORRA 3IUMA 2NZVG 4YP5A 3KXDA 1T4MA 1GT6A 3RU3A 1FFAA 1TD1A 5AVTA 4U4AA 2GPWA 2QQFA 3WHLA 2VDPB 1PJAA 4ME6A 1EJ0A 1CIJA 1PG5A 1T3LA 2Q4TA 2A35A 3AY3A 5K8TA 2BPOA 4H7HA 4BVBA 2FETA 4ZAYA 1EMDA 2V3WA 1OH8A 2FFAA 3HYRA 4FWBA 2CXHA 4LZNA 2Y1EA 3L7IA 5JCXA 2P3OA 1J70A 5F23A 5DOZA 1P5ZB 3EIWA 4W1QA 5HUJA 3EC7A 4KQ9A 4FKZA 3PNQA 1DWPA 3E9YA 2QRQA 5CVVA 2PUTA 2M2IA 2QKYA 1H8HA 2ATCA 3E5NA 3NALA 4CETA 2BBOA 2OFFA 2CXUA 2ZW9A 3C4VA 5CG2A 4G0ZA 5BN4B 2GNOA 1QH1A 3H1PA 4UOQA 2BY4A 4KAJA 4R2XA 2REQB 1E6MA 3HXPA 4R9VA 4WIAA 2ATXA 1V2GA 3D3JA 1HYGA 1SZDA 1S5PA 3CN7A 5HF6A 4ZHQA 3KSBC 3DR5A 2OZLB 1Q12A 3K0EA 1QQAA 3LUBA 1HH4A 2UZ1B 2Q9AA 4GSYA 2YJGA 2WUVA 3IAAA 4RPLA 5K3BA 3IIKA 1WZ2A 2QT9A 4LYYA 3RQSA 2SKCA 3CO5A 1ST2A 4KPUB 4KGDA 3LQYA 4PYKA 4P3PA 4TZTA 3T3GA 1GU1A 1MAAA 3CIOA 4XUDA 3QY0A 2XCUA 4K46A 4KYUA 1C2YA 1K4MA 3KD3A 2DWQA 3MPUA 4UE2A 5DBOA 3RHFA 1OPXA 3R9XA 4CV3A 4IDEA 1C81A 2WM9B 3E7DA 1OFUX 3HM9A 4S3MA 3L9XA 3HCOA 3TTWA 5K9ZA 3SIRA 1IBSA 2GHTA 1ISRA 4H35A 3NAGA 4ZOLF 4JI6B 1GUBA 1K2WA 4XH9B 2YV3A 4NECA 4COOA 2RGBA 1YBMA 3GGPA 5A9SB 2B36A 3OHPA 3PQFA 5I3ZA 4JWKA 2WVJA 2CJPA 4C5BA 1M2OB 2F8LA 4C7XA 1Z3IX 3Q40A 4JAVC 5JCPA 4KTVE 3FA2A 5BQPA 1L5HA 3IL2A 2BM1A 1EHYA 3TRFA 3TZEA 5C35A 3ZCSA 1CJSA 3R77A 3UUFA 2Q1YA 2FLWA 1EXWA 1O9GA 2Q0SA 5TE9A 1CF4A 3F9RA 1J0EA 4RETA 4EZIA 2C4VA 2R97A 4Q47A 3HFGA 3ZXSA 1GNTA 3TLGA 2VTEA 4WN9B 3PGXA 3ADDA 3C3AA 4W1RA 3W6ZA 4MI1A 4MA0A 1MJFA 3E23A 1NYQA 2XUOA 5HM8A 2HF9A 3N76A 5DTMA 3EOBI 2VYND 3IKJA 3OZXA 3IGFA 5BWMA 1IOLA 1VE9A 1ZGHA 1UKYA 1N2SA 3QPBA 1RAEA 4UTPA 1NKTA 4ECEA 1G5PA 4UCFA 3L77A 1I94B 5GONA 4I50B 5AKXA 4ZALA 3MOSA 1I4TD 2Q8PA 4OQDA 3GLGA 4PAMA 2GDZA 3DB2A 3IAHA 5JARA 3OG9A 3MQ2A 3MFQA 3RC9A 4GAEA 1RLOA 4PX5A 1JNYA 1SIOA 1U4OA 2ZJBA 2VPPA 3TCNA 3UJNA 1W4LA 1EX1A 3UICA 5FTJA 4TS1A 1A5SB 4NABA 5EJMA 1EFPB 4TT3A 4CCSA 4GXRA 1IULA 5JNSA 3F3KA 4TWBA 4FGUA 2UYQA 1VIDA 3M4YA 1LVUA 1C8KA 2JF0A 4HZUB 5A62A 4MVJD 3K8OE 4HDSA 3ZI7A 5CVDA 3B89A 2IDMA 3VH2A 2XVZA 4ZCMA 1CJBA 5CX1A 1A8QA 1Q44A 3TTYA 3ZWXA 2UXBB 4QFBA 2XHEA 3FIJA 3QFCA 1S89A 5FDFA 2P6OA 3G8AA 5IPFA 3O47A 2GJAA 1M2GA 3G23A 1KZ4A 2ZJ8A 2AJCA 2QAJA 1P2UA 1P6UA 2WLSA 3R0VA 4LUCA 3WK5A 1WXHA 3ZGYA 4E31A 5F76A 2YWEA 5GZ1A 1HO3A 3NDIA 1PJ4A 1U3VA 2X8WA 1NBHA 3AEZA 1H1LA 2X0NA 1WUTA 2JARA 2TMDA 1CRWG 2Z98A 5BWLA 3HY3A 2Y66A 3LHFA 4DUGA 5JAOA 1A8PA 1YI8A 2XT6A 3Q0EA 2EKBA 4AMUA 4XKJA 3R3JA 1XP8A 1XEWX 3T52A 4KPYA 1Y42X 1V39A 4LJ5A 3O8OA 1AXGA 3DE3X 1Z5ZA 1P2VA 2WD9A 1LSSA 4JB3A 4S1PA 3R7LA 4AROA 1EAMA 3H4MA 2BLNA 1BGWA 1P45A 3JY6A 3MWEA 4IH1A 4OQLA 1ZQ1A 4XGNA 1VG8A 5ER9A 1NT4A 1QPZA 2ZU6A 4AKSA 4XGRA 1R37A 4LQCA 5H9VA 4MOWA 1S4QA 2IOFA 1FQOA 3MTEA 1DC3A 4EX6A 3RVBA 2FUNB 3EXEA 4A16A 5DNEA 3WIEA 3RFVA 3TDMA 1WQ4A 3RG8A 3TH5A 4C4RA 5FUQA 4TQAA 1WETA 1TKRA 5IJXA 1JE0A 1XMXA 1YULA 3IOBA 4BTEA 3K31A 4ZDIA 1P7CA 2ZYSA 2D7DA 4GDMA 3AL3A 1M8FA 2PX2A 1AJEA 4KMMA 4XD7D 3CBGA 3WIOA 2P2LA 4MW0A 1ZJ5A 2CYBA 2FMIA 2GA9A 2ODBA 2P2SA 3GDGA 3TD2A 4QATA 3WJAA 1EI9A 1KETA 4R7ZA 5LZ4A 1DMRA 4U63A 4C21A 1FFWA 1ODKA 4UNSA 5K3FB 3TNYA 1V3UA 1JYEA 1O95A 1VL1A 4I1SA 3H11A 4FR5A 3BMQB 4M7WA 1WPXA 5HBGA 1B1AA 3QFRA 5F33A 3RUEA 5B36A 5ENZA 4S2EA 1O0SA 3H6KA 3MJCA 3UH0A 3DZGA 5FO1A 2D5AA 3UATA 3O1LA 1P60A 2D00A 3AUAA 4TYWA 3BWVA 3SOPA 3CWZA 1SURA 3PBKA 5MDHA 4ZYTA 2I4IA 4EWLA 4O8CA 1CY4A 4PG5A 3GRYA 3SE7A 2LW7A 3A7EA 3QKUA 2JCBA 1JVNA 3ZE8A 2FZ5A 2R11A 1NHGA 4L16A 2ZSAA 4ZI7F 1CZUA 1D07A 3GLTA 3KCNA 1GILA 3GJQA 1JIKA 3N9IA 4M38A 4UREA 3W6NA 4G4GA 2FPXA 4Z1OA 4WCFA 4JROA 1MEJA 2P9YA 3IDFA 5FA6A 2PT6A 5JBQA 1LI7A 3ZS8A 2X86A 1DG3A 3OKPA 4CCWA 3TF5A 3WGZA 4G6ZA 1E9CA 5KJEA 1E5DA 5KTYA 3DJFA 4QVIA 1E1RA 2W8ZA 2DR3A 2OY0A 2VHQA 2ZUBA 3U3XA 3E53A 4UZEA 4AXXA 2YWHA 2Z5LA 5JYCA 3PX7A 4ER0A 1TJPB 2JGFA 4N8DA 4J90A 2VYFA 4BLPA 5GY7A 2BF4A 1WB4A 3T1VA 1SKQA 4KIGA 4O1IA 5LM3A 3TVDA 5IBQA 1PEDA 1MAWA 3CFYA 2XZPA 3SX2A 4WFIA 1VYVA 2IU3A 2J0QA 3HR8A 1YQGA 2HWWA 2R7KA 2ZOSA 4LYGA 2IP1A 5BURA 2C3MA 16PKA 2PHZA 3QFTA 5IZ4A 5GINE 3T0GA 3JQAA 3SYLA 5CG1A 2GKOA 1PSDA 2A9KA 3GP5A 3N2LA 3L0IB 4RPIA 3JAWB 4LW8A 1RI4A 4PZYA 2BGTA 1WIWA 4FHZA 3S44A 5AW6A 4R9UC 4YGXB 3B2QA 1Y1TA 3S8MA 4EDHA 1SHLA 5CVEA 4J49A 1WJGA 3GT4A 3RFCA 3BCUA 1LVGA 1NDUA 1QV6A 1ZXBA 2EFCB 3V2UA 2VZ0A 4B71A 1V37A 2VIIA 1VE1A 4G8DA 4NYJQ 5ADUS 4CR7A 3P2EA 1GYPA 1YC2A 4IHKA 2JCGA 3UV6A 1KMNA 1RXEA 1H93A 2JAHA 3CUKA 3PHCA 2AQ8A 2QRGA 1G0NA 5ES3A 5KMGB 1ZWKA 3TQHA 2VS1A 2CK3D 4HK4A 1T9GR 1V8FA 5BN4A 2PKQP 3PL5A 2G1KA 1T3SA 1WDLA 3VNUA 3UK6A 3ZD7A 1U80A 2JAUA 4B80A 5I9TA 3ZXUB 1F9AA 2ZM5A 2HWYA 2H9YA 4MUGA 2RIRA 2ZITA 1A5ZA 3TMKA 4JEIA 4N3CA 1B6SA 2FR8C 4L8YA 3H2KA 4WOBA 2IU6A 2I66A 3R6WA 4AYTA 5B2EA 3URKA 1NW5A 3IQZA 3ZY3A 3G8YA 1P72A 3P2IA 4Y6OA 1OIWA 2G07A 1T2EA 2B1GA 2IU0A 3A10A 3PRJA 4XM2A 3KJIA 3KO8A 5DYNA 2XZTA 4G26A 5AW1A 4WKNA 1XJQA 2P75A 1K8QA 2X9LA 4GM4A 4JR1A 4G0PA 4NZ9A 3FWKA 4PE5B 2JLQA 4LN1A 4EABA 3N2KA 1W25A 3SDZA 1FFSA 4QYTA 4PLVA 2DZDA 2XITA 3WLHA 3X2SA 5ALSA 2V7BA 3KQMA 4Z86A 3SI7A 2VBFA 2WMYA 4M1TA 3I83A 4RJTA 4I5FA 2DECA 1H1LB 1OBVA 1ZZEA 1YRWA 1YWGO 4AO8A 4H60A 1RHKA 1KAOA 1M1YE 1M2OA 4Y2QA 1N2IA 5DM70 1B3RA 4WGGA 5DB4A 1QLJA 4BJ6A 2GM3A 3BQNB 3PFCA 4TYNA 1D2MA 1E79A 4BQPA 3BG5A 3Q15C 2O3JA 4IQ4A 3VC1A 2J5XA 1VYTA 2WT4A 4MDYA 4B6QA 4XPIA 2PIAA 3AERA 4S1VA 1Y4UA 2ZIUB 4PZDA 5TC4A 5JZSA 3VUFA 2FPGA 4U2GA 5ELXA 4W5NA 3PFIA 4G5RA 3JQBC 4MRPA 3DOHA 5D8DA 4DL9A 3RAGA 4CLHA 2D8MA 4CGYA 1L6RA 3EHDA 5F4BA 3DPUA 2IBSA 1P1HA 1QMGA 3CRNA 3G0HA 4DA9A 1W19A 4TS4A 2PS9A 3RUAA 2H16A 4LRUA 5DM0A 2GB4A 4A3SA 3OU6A 1JV2B 3ST7A 3MMXA 1GPH1 3CUEF 2D06A 2ZWIA 5FX2A 3LGSA 4HLUA 2VJNA 1LDYA 3O95A 3G59A 3GXOA 2XOXA 4WKGA 1XTBA 2NO7A 2YZKA 1YRQA 3K7EA 5TQ2A 1JZSA 3SICE 1A97A 1D2GA 4I81A 2QUKA 4RIGA 4XYLA 4GDFA 2O2GA 3OF2A 2VYNA 1VL5A 2F1JA 4NV1A 1NWHA 1O5IA 4URYR 4DJDC 2ZWOA 1E3LA 3W7BA 1JHXA 1YJXA 2ZPUA 4Q4HB 5K01A 4WECA 1QRDA 4Q48A 4QSHA 1OXTA 3PWTA 4DLSA 2QLLA 3K2BA 4C6SA 4KFSA 4RH1A 1GUFA 2H59A 2R4TA 4OB6A 4EPRA 3OIGA 5AFSA 4A2WA 1AQYA 2OZVA 1GV1A 2QAGC 2Q5HA 3RAFC 4I14A 3ON5A 3OT5A 2OO5C 4BQNA 1CRLA 3ADCA 3AR4A 2ORIA 3UFXA 2D5LA 2FX3A 1VL0A 2BV3A 1GZHB 2VHXA 3A1EA 5B6JA 3UMJA 4CM5A 1ZJ6A 3DWEX 3TSAA 1U31A 1YB5A 3PTAA 3HU5A 3K20A 3CKMA 3CG4A 3RYCB 3NHBA 3WFJA 3VU3A 1OLXB 1TGYA 3MCUA 4WLNA 4AICA 2G82A 3O4JA 4EJMA 4B45A 2VJAA 3ESQA 5TMPA 4U5QA 3C3CA 3QXCA 4TUYA 4G37A 2R1TB 1GNLA 2WSLA 4NZPA 1UFVA 2G1PA 1Y9DA 5DW3A 2HZBA 3RREA 1QYXA 1U1IA 2V4UA 2C88A 3GAFA 4CMIA 1I4WA 5LP6A 4OGGA 2FP4A 4IGAA 1L1RA 3H04A 2RHTA 1OB2A 4AY6A 2WWRA 3OPNA 4O4IA 5K5EA 1GPNA 4NY1A 2WG1A 1TDJA 2ZFUA 2E0IA 1WHTB 4WOCA 3QJ5A 4CU5A 5EG5A 1LRJA 2H4XA 3IP8A 5JNRA 2ANBA 3CR8A 3AG6A 1BEZA 3MJ4A 5JQGA 4ENVA 1UDCA 2CNDA 2J3LA 2XMCA 1QH8B 3M5WA 4C6HA 1OUMA 3A6FA 2R6DA 4K9SA 2QVCA 5TMEA 3U61B 3T4XA 1J90A 3B1FA 2RHDA 4JBLA 4ITRC 3FYUA 3JRXA 1X8KA 3JD0A 1AIPA 4OATA 2ZJ7A 1PEAA 3I2FA 3BQ9A 1WLYA 3E81A 3ZIUA 4CM8A 3UY4A 3NM5A 4Z1MD 5KB3A 4F91B 2YMPA 2B30A 4E5NA 1QWOA 3G3EA 2DU8A 1W9MA 4YT5A 1SCQA 4GPZA 4M1YA 1XZBA 3AF4A 4CL8A 3E7WA 3L6OO 5IVDA 1GTJ1 3ZQUA 3IVMA 3O8QB 4YCJA 3FTDA 3LD9A 3H5AA 4MRMA 4UCQA 5DX1A 1IBMB 1X80B 2WJIA 1YMUA 3KQSA 2HMYB 4PGGA 3IOMA 5EXSA 3NVDA 4ZT2A 1GU7A 2X3FA 3EIOA 1ZCFA 3KTDA 7ADHA 3EAFA 5KWJA 1X77A 2H4ZA 2EX1A 2C0PA 1LWNA 2IDKA 2QX6A 2O5VA 2WJZB 3YASA 2CSUA 2X2EA 4BFYA 1NQ5A 1QH0A 1NA5A 2QZSA 3BBLA 3VVCA 4RELA 5JSYA 5EJ4A 1CDDA 1ORVA 1V11B 2FRVA 3KKPA 4L6AA 3QNUA 4P34A 1FBNA 1OJLA 4LWQA 1GM5A 2H18A 3PEFA 4M0CA 1U7UA 1C1HA 1ESZA 3OEYA 5HUQA 2A0XA 4FMBB 4PC3A 1AM4D 2DQ4A 2Y93A 4WERA 1ODIA 1Z12A 2YYZA 5EZ5A 1XNRB 2ZJYA 4IIXA 1ZM4A 5F9FA 1U0JA 1LBIA 3AKCA 3MWEB 3OZVA 3Q11A 3C16C 4X7RA 1WDKA 3Q98A 2RD2A 1QDLB 2BH9A 3IXQA 4QWWA 4FOOA 4ZI7A 1FXWF 5C37A 1C3VA 3MB5A 3D6NB 4LF5B 1L5RA 3QMVA 4J7XA 4CG2A 3BWBA 2P5TB 1J5EB 2BRUA 2F43A 3FPFA 1OC4A 3JRWA 2VT2A 5EKDA 4C76A 2B5WA 4XCVA 3ZV3A 3WHKA 5B1HA 1XAGA 1EFRD 3ZWKA 1SOVA 5I5GA 3UT5B 1QKIA 5D3QA 3T5MA 4BY9E 1EG7A 1CQJA 5EUMA 3C41J 1ZA1A 2J4FA 4LECA 2JBWA 4N5NA 5LDDC 2RGUA 2J3DA 1V1JA 3FY4A 4MB6A 4JI0B 1U8XX 3OKAA 1NG1A 3FAZA 4OQQA 1XJ5A 5HUHA 5EMJA 3I34X 4YK7A 5BN5A 4GPIB 3DAOA 5K3SA 3WLFA 1G8FA 3HVJA 4G5HA 1ZQ9A 2AOUA 2ZUDA 2UAGA 2VK8A 1R8JA 4B3DA 1JQDA 3QPDA 3OMWA 1QX3A 3BTSA 3IV9A 3G17A 4MS3A 1P9WA 5A4AA 4QXRA 4KGZA 5GV7A 1PCXA 1QCDA 1EZ1A 3H2SA 5FWYB 3LKVA 4FU0A 1L8AA 1WULS 4AG5A 2EZUA 4JP3A 1Z5VA 5LMUB 1KJZA 1PGOA 3L8GA 5AVWA 2EZ8A 4G2TA 4ZD6A 3PS9A 5MN6A 4YUWA 3R9WA 1HURA 1UDWA 1RRMA 3C7AA 2X2PA 4P36A 1RI1A 1Y8CA 2AUTA 2JDID 3KR2A 4L7VA 2Y1XA 1EFDN 4C7KA 3AZPA 5D7NA 2IHVA 3RI3A 1XK6A 1WUKS 3QKRA 2V7PA 5CB0A 4HFMA 4PRYA 4Q7QA 4OQEA 2VDLB 4RY8A 3Q5EA 2GTPA 4MYUA 2GHIA 1IONA 1ESMA 2NUTB 2QTCA 3UWSA 2IH4A 3VOSA 2QE7A 3PQ7A 2AG1A 2VVTA 5AD1A 3FNGA 3HQ4O 3VZQA 1KEEB 1VTKA 2X41A 3IUPA 1UK9A 3MHPA 5CITA 1P91A 2OECA 1X7HA 2QPOA 4LGVA 3IEMA 2I4TA 2ZSEA 3IX7A 2XJ4A 4Z0HO 3WYEA 1OB5A 1FW8A 2RJ3A 2QG9A 3KR9A 3ABQB 4GP6A 5DT2A 4PO8A 2IOQA 3GT7A 1BEUB 3OPYA 1PUJA 2AOVA 4C0WA 3V7NA 4MGHA 3FCUB 3VMMA 4TKVA 4XWOA 1Z5GA 2VJQA 4EFNA 4IUBS 1LKZA 4A5SA 3QK7A 1OOEA 1X7YB 2NADA 4L9SA 4B4UA 1S1MA 3IUYA 3PD7A 4J1SA 4URHA 4CRWB 4EJ6A 2ZEJA 1YRAA 2BDEA 1RI5A 4R7TA 1DG9A 3WGKA 5IEJA 1PDVA 5JS2A 1H5UA 3L7DA 3WDKA 2C2GA 3WBJA 1DTWA 1PE0A 1EXNA 4FGWA 4MZXA 1QLWA 1MABB 1PQUA 4U3JA 1SXQA 2GWHA 1QOQB 1DELA 1THGA 3FFXA 3ZU5A 5JXHA 4M22A 1FDIA 1H2XA 3PGKA 1RJ9B 4LQDA 5KYUA 3ZCXA 3VJKA 1TW3A 1LLCA 2WYIA 2CEAA 2QQEA 3WICA 3X1XA 1ZH6A 4RJJA 2HEIA 1RXVA 4Q16A 1WZEA 4LYHA 1TYAE 3CUWA 1QQTA 2IEYA 4UTOA 3OOSA 3NT5A 3NS7A 4D3FA 2IV3A 2W42A 4R83A 2D2FA 3B36A 5LKAA 1T6XA 5KMGA 4Z53A 3KJGA 1HMPA 4F4HA 2GCPA 3AHIA 2BEUA 1FFHA 1QJCA 3G82C 3QUQA 1GAQA 1LPSA 1D7AA 2DUWA 3BTOA 2R1UA 1PGJA 4P4NA 1JIXA 1CXZA 1FSGA 1DEOA 3KVNA 2PBZA 3E9RA 1CS0A 3EMDA 3MZ0A 4O2AA 1TTPB 2UUPA 3UMRA 1ZCAA 1ZH4A 3BAFA 2EBFX 2OXTA 3RYIB 4I8IA 6ADHA 3K6KA 4IXDA 5IKEA 3QLUC 2P68A 2C20A 2H7CA 2FK7A 4MAMA 2QR3A 2VAXA 2DPYA 1P4SA 1A4IA 1M2VB 1J2EA 2WPDA 4LBWA 4ZVNA 2J67A 1PLKA 2GK6A 1NR7A 3OY7A 4NE2A 5KQPA 5L7TA 3L8HA 3MNFA 1NVVR 4ZO9A 4N47A 3TZKA 5I7UA 1QK3A 4PQEA 1ZNWA 3L93A 3GQBB 2I2DA 3DM9B 2OBNA 3B1KA 3IMCA 2RB4A 4KQEA 4K87A 2Q6LA 3EF3A 4AULA 3GWGA 1FX0A 2P62A 3GNLA 2WICA 2G80A 2XD9A 4DM7A 1DAOA 2Q07A 4YAEA 1DAGA 1HMYA 1FFBA 1N5MA 2OV8A 2OHVA 4OREX 1MJ5A 3UCFA 5A0VA 2AC7A 3Q5GA 2NU9B 2HCTA 4LK3A 2QP9X 5IC6A 5HJ2A 1CIVA 5SY9A 5F52A 2O8NA 4IIHA 5BORA 4TRNA 3LL4A 4UNQA 1E3MA 4ARUA 1Y5IA 4O6VA 4H1TA 4AN0A 1SRRA 1VIYA 3AR7A 3IPCA 3AUYA 1HX7A 1E1CB 1NXQA 4INOA 3R23A 2FOIA 3O1IC 4KSBA 1KZ7B 1U5BA 2XQJA 4R68A 4ZYVA 1HGXA 2ZRMA 1NNEA 2V5VA 4CF6A 1FU7A 1PK9A 1Q7CA 3GJSA 3K05A 1RPZA 3RVRA 2R4UA 4CCYA 2DWCA 2QGZA 2AFIA 3LHDA 2DUUA 3FZQA 4C2TA 3M34A 4WRRA 1D5CA 1JSXA 2NTNA 3NJ8A 4ESOA 1TCUA 3SQDA 2AMVA 1X38A 5A5EA 3PYLA 1JDPA 2HJ9A 3CH4B 3K6RA 3KAJA 1OVGA 1E6UA 2X0JA 3RSFA 3FTNA 1YDFA 1DC7A 4EYSA 1DIRA 4EUEA 2KW5A 1FTQA 3W2TA 3HKBB 3T7JA 4RK4A 5K3AA 5AUOB 1SOWA 3VDXA 3RLIA 5L3QA 3BMOB 4RZXA 4TLMB 4P93A 4ZJPA 4POAA 1FDTA 4QU0A 1CR2A 5HYVA 4U7JA 5LZ8A 1A77A 5HKKD 4PW0A 2BFWA 4EF4A 4EY4A 3LRTA 1MVOA 1C9MA 5IJ9A 4GMHA 1ORDA 3MWDB 5BW6B 2CLCX 4EW3A 2AGVA 3H0KA 3M6AA 1H0HA 1BZYA 4LJ7A 4GX0A 3OC6A 1F60A 521PA 1BKYA 3R76A 3RGGA 2W8BA 4CMKA 5BXYA 2CMDA 4ZVKA 4HQNA 4PYOA 2O3UA 1BE0A 1CBUA 1XNJA 3VOBA 3EFEA 2LKCA 2QD4A 1ZJYA 4KPEC 2IS1A 3BH6A 4NZNA 4Q9LA 5BVGB 1WSDA 1G8AA 4I8DA 2P4SA 1U2DA 1HT3A 1IDN1 3U3JA 1OFHA 2PD4A 2XUGA 4YMSA 5CD9A 5JDCA 2G9ZA 5IUJC 1XAJA 1C7RA 3DZJA 3ZHXA 3BMCB 3FWPA 1D2CA 4ZYWA 1YQEA 3HC7A 3MLEA 2AG0A 4IMJB 4CKCB 2JIDA 1KZGB 1GCUA 2X5OA 4G0QA 2P78A 3C4JA 3UAZA 2JI7A 3B6JA 1PT9A 3T38A 5K20A 2JEOA 3PFKA 1ONOA 3MBOA 4I4TF 3JWGA 1UQTA 3E18A 1H65A 3T7DA 1K9SA 2YRXA 1TF7A 1E2NA 4E5YA 1IXRC 4YA6A 1PTJC 1LSJA 3FWZA 4CWAA 2IUUA 3MINB 4GLJA 1GEEA 1S3SA 1DKUA 2QRPA 4RZ3A 1JNXX 4P9NA 4TKVB 4L50A 2EX4A 4G4IA 5FUWA 1KVUA 4B8WA 5BP7A 3FYUB 4GOND 3SX0A 1VKOA 2XHZA 1OYVA 3C2QA 3LP6A 1DRVA 3F74A 4V0RA 5ALHA 5ECGC 1A76A 2Y4OA 3U13A 3VDNB 3NHUA 2ZJ5A 1HR0B 2PV0A 3B7PA 3IIMA 5I9MA 2BJVA 4FHGA 2GD6A 4BEJA 3ORHA 3DL7A 3O0TA 3I9FA 5HF5A 3KJQA 1UEIA 4HWPA 3ZZUA 3R8FA 3I04M 3ZTYA 5AJUA 2QVYX 2YIDA 1IVSA 1QB8A 2RK4A 2QS9A 5AI4A 2PX5A 1CQIA 3KFLA 5DX0A 1JFFA 3AFMA 3RJMA 5BW8A 2P7HA 1EUQA 4K3UA 2Y76A 2ZRQA 1U5BB 3EGXB 3HB4X 5CAEB 5CJ2A 1SFRA 4UHCA 4OH1A 2XIJA 3AJRA 5CLJA 5KTMA 5JJIA 4PBTA 3BJIC 3GOQA 3KPWA 2DF8A 2BKXA 2V0CA 2WD7B 3DXXA 4HUJA 4HXGA 3ZUGA 3DLPX 2BC9A 1OWOA 1O77A 2WF6A 4QU5A 3WNBA 1Q22A 3DMPA 3VPXA 3MHTA 2J33A 1WHSB 5D3MA 4OHYA 5P21A 2JA2A 3LUAA 4HN4B 2ZR0A 4LGMA 1E7SA 2FPPA 3DMHA 4K9RA 3ZNQA 2J9GA 4M8KA 1I7PA 4BN0A 1GFWA 3CR7A 4FT4A 1E62A 4C3VA 1N5OX 2CY0A 5LZ2A 3HMKA 3KTAA 4QELA 2VQSA 3K0CC 1S2DA 4R0VA 1B8OA 4B6OA 1U8ZA 4DIDA 4DLVA 4RNDB 2EKPA 2QTNA 3ACCA 4RCYA 4BZZA 4CDNA 4ZV7A 5IG2A 2EJVA 3WO1A 4M9SA 1KTVA 4NV0A 2GEJA 4WFJA 3FPEA 4DCGA 2H1WA 4CFSA 2QM7A 1URPA 2CV2A 5K0SA 1VIVA 1INLA 2XWPA 3FOZA 3INGA 1FX0B 1DBIA 3W2GA 3WQQA 2GZSA 3THRA 1Y3BE 3BN3A 4OB8A 1SC6A 1JXQA 1LU9A 2RSLA 3R9XB 4N7JA 2LZ0A 1W8DA 3CRVA 4AU1A 1UP6A 2DFNA 4PYLA 3C48A 3L8CA 3CTPA 1OBCA 1UJ4A 3WLMA 4DZRA 1G2QA 3JQAD 2W2QA 4GXNA 4F3NA 5EXPA 2HFKA 3PNKA 2FPMA 1OD6A 3RVPA 3AC0A 3KWFA 3VSBA 3FCOA 2HI0A 1TZ2A 1Z73A 1KAEA 4BKQA 1A9QA 5HEKA 2N1MA 5JLAA 3IHKA 2FUG1 3HJFA 1E3SA 1YTLA 4II2A 4Q9IA 1F5SA 3JSAA 3AH8A 3UMYA 1GADO 2SKDA 3PXCX 2VDNB 6PFKA 2HLNA 5AJTA 1A9PA 1IOZA 1XBTA 1ZUNA 3FX2A 3LGXA 1JMKC 1YJBA 3KJZA 3QIAA 4JUCA 5EESA 3WZLA 3ZDFA 5JISA 3GLFA 5ALIA 3TNLA 3ADOA 1W6RA 1MOZA 4JBHA 1L7DA 4LJ4A 1R6BX 4UMFA 4OJQA 4YXWA 4BFLA 1QVVA 2FZKA 2R6R1 1JN0A 1PVDA 2YINC 3DZIA 4ZEXA 2BGJA 3WE7A 1Q83A 3BA6A 4IQ0A 3BXXA 3G1WA 1XZJA 2XMBA 2YWRA 4HQ6A 4Q1EA 4YJHB 3JQ8A 4L74A 4YTEA 2CK3A 3RHSA 1JEJA 2I34A 3ZDCA 2JVIA 2A59A 1QUEA 3T8YA 3I61A 1G59A 4HYYA 1QE3A 3TRDA 1C4KA 3BM5A 4GL4A 1XA4A 1TF5A 4JYAB 1VCHA 5LN1A 3AO0B 2GEKA 2Z58A 3D1LA 1W5SA 2COKA 1SC4A 2L19A 2H1VA 2BZSA 3DTVA 4R2WA 1IZZA 3CWQA 2C3OA 3H2BA 4D57A 4EMTA 1N2ZA 2V4ZA 4X92A 5THXA 5ETJA 2CC2A 1TNDA 1G7TA 3MWDA 4O4HA 4OP2A 4EHHA 3B1WA 2ZAOA 2OR3A 3TSYA 4H9GA 2XCOA 2Q3CA 4FGSA 2LV8A 4MKFA 1JDSA 1JQJC 1ZJJA 1HKHA 1OW3B 3MAAC 3EXFA 4JXKA 3GDHA 3CLKA 1KTIA 2IY7A 5KYGA 4BYMA 5KX5F 5BT8A 4L2IA 5A4MS 1CX9B 1UP7A 1NUSA 3JYNA 4RFSB 2WJYA 2JLCA 4DSUA 2NSHA 2PEYA 2I8AA 2J9RA 1J99A 3AT1A 4PLWA 1XWFA 5LQNA 2W6PA 3OOYA 3P0EA 2XUJA 3O9ZA 2QJWA 1CPYA 3W7VA 2NSJA 4S12A 2XGJA 4HNAA 4P54A 1Z0AA 4K03A 3U44B 2ZP1A 1ZHOA 2RAUA 2A5DA 1U99A 4KLNA 3STVA 3A4NA 1SRQA 2DT8A 2GCIA 1LZKA 1WY7A 1JHUA 3SFTA 4HYEA 3ZWMA 2NTJA 2IXTA 5K45A 3I62A 4HGNA 4QPDA 1J20A 3I9OA 1Y3CE 2FQWA 1GLNA 1KY2A 2B2NA 3L05A 4CL0A 5EJ8A 2HCFA 4KKXB 1R50A 1JWAB 4FFOA 1B6RA 2HRRA 3DB1A 4E30A 3MS7A 4QDUA 1UWKA 2GXUA 4YFVA 4UXIA 1TAQA 3L0SA 3O38A 3OA2A 4IIJF 4UATA 3HCCA 5A05A 5EERA 5F2NA 4NAVA 1U7HA 2YHIA 4ZC8A 1FXWA 4QQNA 3TUZC 1E1QA 2EBWA 3SQWA 1C8LA 2C57A 2G3YA 2OENG 4J0JA 3PITA 1XZEA 2G1AA 2PGLA 1AS0A 3OTGA 5DYGA 4NJEB 4C7OB 4DA6A 1VFNA 5KTKA 4J0GA 3SIXA 2ATVA 1EZZA 2IS2A 4IV0A 3LW7A 3G9TA 1QE5A 1QOZA 3Q8XB 3AEUA 2OFWA 4ZU1X 5GAJA 3WL3A 4YCNA 2CUZA 3DA8A 2HJGA 5CYPA 1NYTA 1NMSA 1HK7A 2A78A 1ESEA 2I65A 3S2YA 4W5OA 1O54A 3QELB 1KI6B 2HBQA 4GM0A 1S4MA 2OFOA 3EG9B 3VNVA 2H2DA 1LPBB 3TO5A 5IBCA 1I0ZA 2O4UX 4JITA 3CRZA 2FSPA 3DQQA 2FQXA 3GEEA 4JU9A 4UU7A 2GOYA 3RNOA 1ZIDA 3EVDA 3I9KA 5BY2A 4ZV4A 1RWBA 3B9PA 3LMKA 2PRKA 2W2TA 3A6KA 1HDYA 5WRFA 4G3XA 1DX9A 1K98A 1KOFA 3PVZA 3CF4A 2LCQA 4HUTA 2R8PA 4MVJF 2GCEA 3EULA 4GX1A 1OLUB 3DSRA 2OO5A 1LPAB 4D44A 1N0HA 2M6SA 3UPDA 2XYQA 1F0YA 2XQGA 2QLMA 3SPXA 2O2EA 3UYLA 3G2PA 1DKQA 1IHYA 3N7AA 3RWBA 3ZWVA 1XVAA 4FOTA 3R1IA 3A1TA 3DF7A 2R68A 4DIMA 1SBNE 4G1CA 3UEOA 4DQVA 2I3GA 4A6EA 5E0OA 1X94A 2ATIA 4N8EA 4Q7KA 5J5VA 1W5EA 4ESEA 4D98A 3TQRA 2XUQA 1A04A 3O8DA 2JFXA 2GCGA 1TL7C 2RHHA 4PFJA 5EZ6B 4NU0A 4P0TA 2EW2A 2W37A 1EE1A 5AOBA 3SY8A 2YOFA 2Q50A 3DEFA 5JY1A 2H1IA 4W1PA 3K9FC 1LPNA 3GO4A 3EY9A 3GPBA 1NRJB 3J7TA 1L0BA 3H75A 2YH2A 5G2OA 1EWTA 3HXLA 1H2AS 1JUDA 2BEWB 2CNWD 3A70A 4E4TA 5ABPA 4MGZR 5CTAA 2X3YA 4DLWA 2QT0A 3I6YA 3R44A 4AJHA 2JJ2A 3SXUA 4EI8A 3GCXA 4IOKA 1SD2A 2DFDA 1QRRA 4NCBA 2YW9A 1XZAA 2VC2B 3HU2A 4J43A 1E0SA 3VSCA 1SQGA 4IJ6A 2QZPA 3CJTA 3C3JA 1BRTA 3DZCA 4TQUS 3ZY5A 2P5YA 3CEAA 2OCDA 7MDHA 4BOYA 1KQOA 1N5DA 5AVOA 5LJIA 4IDBA 5EXEA 5JLJA 4UAVA 1RQ7A 4RSMA 3S2UA 1I1NA 1XFAA 1NLFA 1PZHA 1KRWA 4YLYA 3QUSA 1N7GA 2OVBA 3D2LA 1NSFA 4BL5A 5CBKA 1H4VB 4DDWA 3CVUA 4A8JC 3HV2A 4XDYA 2F9MA 2X9GA 1SZJG 3DAPA 3NX4A 3Q6MA 2X9NA 4HMOA 3UJHA 4O5AA 3U7FB 1U28A 3A11A 2UUAB 4QBFA 4TSRA 5I7VA 4PLGA 2ISCA 1UWVA 1QTQA 3OLZA 1PFGA 4P0QB 4UVDA 2MINB 3WWCA 2PWYA 4WINA 4EPWA 2QL5A 4ZFNA 1MN6A 1CW2B 3A26A 3COPA 3LPCA 4I36A 4J2HA 3DFUA 4XQGA 1XTVA 3DZ8A 1SXJD 5FNVF 1UCFA 3BXOA 3HJGA 1OX6A 3PA8A 4QJ4A 4DR7B 1M7HA 1H4TA 1GGEA 2C77A 5C32A 2VDQB 1C30A 4JOCA 5HHTA 3EZ7A 2XQIA 1T36B 3I0ZA