3GGSA

Human purine nucleoside phosphorylase double mutant e201q,n243d complexed with 2-fluoro-2'-deoxyadenosine
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
284
structure length
284
Chain Sequence
NGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFQTVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITDKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a mutant human purine nucleoside phosphorylase with the prodrug, 2-fluoro-2'-deoxyadenosine and the cytotoxic drug, 2-fluoroadenine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase
total genus 83
structure length 284
sequence length 284
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2009-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ggsA00
4F1WA 4L0MA 1JE0A 1PR4A 1RCTE 1Z35A 1RXCA 4K6OA 4F3CA 5F7XA 1Z36A 3K8OE 4GLJA 2OECA 3D1VA 1V48A 1SD1A 1T0UA 5DK6A 1Y6RA 1Z5PA 4BMYA 1A9PA 3EEIA 1Z34A 4DA6A 4WKPA 4F3KA 3NBQA 3DP9A 1JDSA 4EARA 5CCEA 4IP0A 3LGSA 1C3XA 5F73A 1JYSA 4DAEA 5JPCA 4TXMA 4L5CA 1RYZA 4E1VA 4L6IA 1K9SA 3FNQA 1SQ6A 4OGKA 3O4VA 3FOWA 4OY3A 4GKAA 1Y1TA 5K1ZA 4ECEA 1SD2A 4R2WA 4GLFA 4MCIA 1B8NA 3KUKA 1PR0A 2QSUA 1A9OA 4QASA 5B7GA 1RFGE 1U1GA 2HRDA 5EFOA 2QTTA 2OC4A 3OF3A 4QEZA 4TS9A 3INYA 1JPVA 3ONVA 3UAXA 4X24A 4UC0A 4PR3A 1V4NA 4PNPA 3BL6A 3OCCA 5F7OA 3EUFA 3SCZA 3E9ZA 4JP5A 5F77A 5FAKA 1U1DA 4M1EA 1K3FA 2PGAA 5IU6A 5I3CA 4U2KA 3OZBA 2HSWA 1V45E 4DA8A 3OOHA 1ODLA 2QTGA 3FAZA 4OJTA 3DDOA 3E0QA 1TGVA 1NW4A 1G2OA 1Z5NA 1U1EA 2RJ3A 3IEXA 2BSXA 4F2WA 1ULAA 1TGYA 5F78A 4WKCA 1Z33A 1K27A 1RXSA 3QPBA 3PHCA 5C80A 3P0FA 2HN9A 3UAWA 1Y1SA 1PBNA 4YMLA 2P4SA 2I8AA 5F76A 4WKBA 4L5AA 4OF4A 3LA8A 3KU4A 3K8QA 4LKRA 4G8JA 1B8OA 3DJFA 4RJ2A 1NC1A 1JDZA 4LNHA 4M3NA 1Z38A 3MB8A 1YBFA 1Y1QA 1PF7E 1OTXA 5CXQA 3UAZA 4GMHA 1JE1A 4D8VA 1VFNA 1T8RA 1ULBA 4YNBA 4R31A 4YJKA 3OZEA 1VHJA 2IQ5A 1A9RA 4DA0A 2A0XA 2ON6A 4TTJA 1YRYE 1V3QE 2OXFA 4TS3A 1JP7A 5B7PA 4MCHA 1TCUA 1Z39A 3NM6B 4MARA 1V2HE 3OZCA 1CB0A 4DAOA 3EUEA 1VHWA 2A8YA 2AI1A 1Y1RA 3FUCA 1YQQA 4I2VA 1RSZA 3UAYA 1V41E 2QPLA 3F8WA 1ZL2A 1YR3A 1PR2A 1LVUA 1M73E 3P0EA 1A69A 4TXNA 4D8XA 1N3IA 4QATA 4BMZA 3NM4A 4M7WA 4TXHA 5ETJA 5CXSA 4D8YA 1FXUA 1TCVA 4TXJA 3OOEA 4TTIA 3EMVA 4BMXA 1PW7A 3IOMA 3NM5A 1ECPA 5B7NA 4QAQA 4JOSA 3C74A 2GUWA 1PWYE 3ODGA 1RT9A 1Y6QA 2B94A 1RXYA 3LBAA 1LV8A 3MMSA 3PNSA 1JDVA 1VMKA 4WKOA 1JDUA 5B7QA 1Z37A 4OGLA 4KN5A 4JWTA 5CCDA 4DARA 2AC7A 1RR6A 3KHSA 4TXLA 3DPSA 1OUMA 1NC3A 3BGSA 4BN0A 1RXUA 2H8GA 1PR5A 1PK7A 4WKNA 1PKEA 3KVVA 2AI3A 3PNPA 5IFKA 1YQUA 3UAVA 3U40A 5F7JA 4EB8A 1JDTA 4P54A 1T8YA 4R2XA 4G41A 4OEHA 3GGSA 1U1CA 4LDNA 4NSNA 4D98A 3KVYA 1QE5A 1PR1A 1A9TA 5EPUA 4TTAA 1U1FA 1PR6A 1CG6A 5EUBA 3TL6A 3FB1A 3KVRA 1ZOSA 1OV6A 3DF9A 4LZWA 4NS1A 3BSFA 3PHBE 2HWUA 4TYMA 1PK9A 1A9SA 4NY1A 4FFSA 4DA7A 2XRFA 4QARA 2A0WA 1I80A 2AI2A 1ODJA 5F7ZA 4LNAA 3E9RA 4D9HA 5CYFA 1ODKA 3OZDA 1LX7A 4G89A 3OPVA 3O6VA 2ISCA 5CYGA 4DABA 3FWPA 1WTAA 4DANA 1OTYA 3T94A 1A9QA 2I4TA 4F2PA 2A0YA 1XE3A 4L5YA 5KB3A 3GB9A 1TD1A 1Z5OA 1OU4A 1Q1GA 4YO8A 3UT6A 2QDKA 1T8SA 2OC9A 1T8WA 1SJ9A 3BJEA 1OVGA 3ENZA 2Q7OE 4H1TA 4QFBA 1ODIA
chains in the Genus database with same CATH superfamily
2JJ1A 1DCKA 2HH9A 1R4NB 3GLKA 2VG8A 2JH8A 4LHZA 1LI4A 2WZBA 3HCOA 3DMTA 5DB4A 5ALTA 1STOA 2BW0A 5J2TA 2ZWAA 1VTKA 4KPUA 1T29A 3LCUA 4OH1A 1MRZA 1RI5A 3DFZA 4WLOA 2OESA 1Z36A 1T1SA 3OU6A 3WBJA 2HMYB 2DHEA 4C20A 5KYGA 9ABPA 1H42A 1P1JA 4ZT5A 1KEEA 5ARDA 5DWDA 2VSNA 4DLKA 3M4ZA 1U2TA 3VI3B 4YT2A 1SOUA 2PZJA 5DHTA 1FP4B 2J08A 5CDSA 5CDHA 1G5TA 3OIFA 1AGPA 1P29A 3R6TA 1R0RE 1Z4QA 4I55F 3V4ZA 2UYHA 3GJYA 1Z0JA 2HMUA 4X1YB 1E2MA 1C9YA 1XMVA 2OWEA 3O3CA 3ZHUA 1CQJB 4RVDA 3TINA 5CVTA 4CEJB 1IE3A 3ZKWA 3RC1A 4AF8A 4EARA 3ANXA 2J7PD 1GKLA 1L7BA 4GP6A 1NV9A 3H1EA 1JKMA 2JLZA 2IU6A 3KPWA 3R9IA 3F78A 1G41A 1OH6A 5F2NA 2GHTA 3N2KA 3B1ZA 4LF6B 2VZEA 2D3WA 3NBUA 1JYEA 4YCAA 1W4ZA 4A0SA 4AQDA 4MW2A 1T36A 3PDCA 1JHVA 1JBQA 1NP6A 1SQ6A 3BTVA 4FDMA 4NPCA 2Y9MB 4N5LA 3ZZ0A 4LGYA 4BJHB 2ORED 3PU6A 4OY3A 1HO3A 4RQAA 4IS2A 1KVTA 5CM9C 3BFVA 2AN3A 2JIZD 1Z4PX 3TI7A 3S81A 2ZTVA 2DHQA 5LQAA 1CUFA 2O8EA 2IYWA 3M1AA 3W9SA 2W6ID 3FR8A 4JUAA 3VZSA 4MINA 4KRFA 2I4LA 5HMMA 4Y3UA 3JYPA 1E3LA 4LTDA 2GILA 2R751 1YRQA 3OM0A 2Q1YA 4NV1A 1TJNA 1IJEA 2EIXA 2QYSA 4K6MA 4YAWA 3U80A 2IOQA 2VDWB 4H7EA 1KQ3A 1JPVA 4D8UA 2IXTA 5M34A 3X0DA 2I1LA 4C06A 5JUWA 4A73A 5IH3A 4D2IA 3TZHA 4UU7A 3RK1A 5IEJA 3AW8A 2YV4A 3A06A 4LF4B 4A8PA 4GZMA 3BL6A 3DWGA 3NHUA 4TWJA 4C0SA 3BB1A 4GQIA 4W9NC 3E22A 1OWLA 2JH3A 2ECPA 1PUJA 3RS7A 3W9YA 1JR2A 4RA6A 1JS1X 3KQOA 4XW2A 1YR6A 2Q4BA 3Q3CA 4UNSA 4WEQA 3R5JA 4ZI5A 1VG0B 2QUHA 4QJIA 2HDOA 1UPTA 1PFQA 1KI6A 2IDZA 2X9LA 1XDGA 2XTAA 3E2MA 3MBOA 3UAGA 4PS1A 4A82A 4D9MA 3GCWA 5IU6A 1KGSA 4H1HA 1GXSB 5JY1A 4KYIB 2CCGA 2RHJA 5BUCA 3K20A 3ZTYA 5I9BA 1YB2A 1RZRA 1LDYA 4E08A 1VA5A 3WX0A 1XMSA 2IZ7A 4B40A 4DR3B 2PUCA 3Q8WA 4U0JA 4NECA 2NAFA 4N18A 5TARA 4B3FX 2WJGA 4WFKA 1G9TA 5AVTA 1JQAA 4OJTA 4OX9B 3IIEA 2JGFA 4IUBS 4MMXB 1B2RA 4KLZA 1W9HA 1YBMA 3OTIA 2VP0A 5HTOA 1DWOA 1U80A 5DCYA 1X8LA 2B37A 2VUUA 5H0IA 2QRMA 3PC8C 4RSMA 1CX9B 1GP2A 5A5FA 5B6PA 3INRA 1M72A 2BFWA 3QZUA 3H8VA 4IWYA 2V4ZA 4AMBA 3NDRA 2H1IA 1RRVA 4K6HA 4LE1A 4YJ3F 1GKYA 5D2CA 3ZIDA 1B6GA 5F78A 5C18A 1KI3A 1O94D 2ET6A 2BFFB 2J9FB 1DJPA 3A32A 4NJMB 5K8VA 3D8HA 2R2GA 2OYSA 5F64A 1F8FA 1XQWA 3BMCB 1DKOA 2C03A 1HDGO 4F12A 1ECLA 3OLYA 3N39C 1PQUA 1QHSA 1IWPB 1YRLA 1Q16A 1O87A 1PGOA 4MI3A 4BE4A 3I58A 2ECKA 2EXXA 4ZVQA 1R50A 2C00A 4HX5A 3TOXA 1BJRE 1R5OA 1RJ9B 3ICCA 2IXAA 3GAZA 4JKIA 2XCSB 4PC7A 4EY3A 1NVBA 1Q7CA 4OB8A 1L6RA 4HNHA 1YS2X 2DKOA 5DYIA 1KPGA 3WP0A 4BKQA 1UIRA 4Y2VA 5EINA 1E1YA 2PYZA 1Z8DA 2VVTA 1NNUA 1JQDA 1R5BA 3C5CA 3NJ8A 4JBWA 4JI6B 2ZKIA 1E98A 3VR0A 3E9EA 4B3JA 2XB4A 2RGXA 2VLIA 3NUZA 4OQFA 5KTYA 3DMFA 1T9GS 3FMPB 3TSCA 4L4XA 1OXUA 3ISTA 4UHBA 3DLTA 1VLZA 1PTJC 4RM2A 1HXHA 1Z28A 2HK8A 5G0SA 5G1PA 2B7CA 2ZJAA 3K0AB 4M60A 4Y9SA 4RDCA 4Q4LA 5I7FA 4Q4JA 4AX4A 4DCNA 1GTMA 4G8JA 1KEUA 4QYXA 4DJJA 1ZI8A 1EXMA 1UKCA 4GM4A 4BRUA 2O8CB 3SLGA 2ATCA 3MYRA 2IY9A 1TTHA 1ONNA 2ZYRA 1ZX1A 1ZD9A 2BFCB 1W2GA 4NC9A 3D3QA 4FMPA 1JI3A 2PAFA 2NIPA 4K9PA 4ZGWA 1OWOA 5FBKA 2W22A 1T5LA 3PSHA 1XBTA 4LYFA 2YV1A 3K0AA 3HRKA 5IH7A 3FOFC 5A3RA 4EW6A 3ROMA 2JRLA 4FN5A 2CLSA 4U7HA 3TLYA 4XRRA 3ZX5A 4F4FA 1MW9X 3HZRA 5DPMA 1N7GA 2Q07A 2WNIA 1KAMA 2ZM5A 1SA0B 1TW3A 1F3OA 1QFJA 4PWZA 1ZGCA 4Z4CA 1D2GA 2O2GA 2ZUBA 2DGDA 3OZEA 5JXHA 4MOWA 1YDWA 1ZCAA 1NRJB 3GARA 3I39X 1VJ5A 1P2TA 2PJUA 3MWGA 4B76A 2QAGB 3AZQA 4OJNA 5HFAA 5IDVA 1JMVA 3VR4A 3WQRA 1PTJA 4OHVA 1TM4E 1YRYE 1UPBA 4JZKA 2ZM6B 3L7LA 2ZSKA 4A4DA 1OGIA 2IKQA 2OXFA 3IUMA 1QFSA 4GP7A 5BN5A 2XNDA 4JBYA 4QOEA 1MGOA 2ZB4A 4XLTA 3STHA 4IO1A 2HA3A 1OZHA 5JAHA 4AUNA 4J8PA 3R1IA 1IOVA 2PVCA 1HORA 2IYFA 1IHXA 1QFZA 1TQ2A 2I6SA 3P94A 1QZTA 4QSMA 3LRXA 4HAXA 5DDIP 5CDFA 1O96B 1VBKA 3P20A 2ZROA 1SCUA 3G8BA 1DV2A 1XZJA 3LSYA 3PUXA 1OW3B 4LOLA 4MVJP 3R7FA 3R75A 3SJ7A 1I3OA 1U8CB 1JL3A 3P0IA 3WTCA 3ZCSA 2AI1A 3JAKB 3ECCA 4TLCA 2H54A 3V7FA 2FSGA 3VR5H 3SG0A 3WK9A 3KQYA 3RYHA 3FTQA 4NF2A 1Z8NA 4WZ6A 3PFKA 4Q82A 4DDVA 3MMPA 1SUSA 1SKYB 2GO7A 4HLNA 4KXMA 3WNZA 3E05A 1YR3A 4M9QA 2EQAA 4R71A 1KL7A 2J3QA 4M38A 5LC1A 4MVJF 4CEHB 3W8DA 1GQRA 2QX6A 3GC6A 1DL5A 2HLDD 1GCIA 2VJDA 4XTCS 4XX1A 1XSEA 1MDFA 3O2QB 1GSAA 4X7BA 1VYVA 4NFHA 3Q8KA 4MWTA 4XX0B 4AJHA 2IYOA 3IV7A 5C34B 3RUHA 1ND5A 4BMZA 4C5AA 1L4KA 2QX4A 1Z26A 4TTTS 1FFWA 3QVLA 3UHFA 1XK7A 4J7AA 4YTEA 3VYTB 1R74A 4HH0A 4HRYA 4TXHA 5ETJA 3OOWA 1R0XA 2YX1A 5IAKA 4ZARA 3R7SA 4NMLA 3LDFA 3G9ZA 2ROQA 4IDEA 4CMIA 1U2QA 2X9QA 3LHKA 4UU0A 1M7GA 2CFRA 4CM8B 1W5BA 2PVPA 4HDRB 1ZA2A 3SQNA 1BMFA 2NYRA 4C2TA 2LCIA 3M1LA 2HA5A 2QBYA 2ZDHA 1BX0A 3P2MA 4QGFA 1TT5A 1O6CA 1KY5A 2QTRA 2YXEA 4P8RA 3DLCA 2OO3A 1AO3A 1WOMA 5TR9A 1C3EA 2XUOA 3NEPX 1YZVA 1E62A 2X0KA 3EDMA 1XMIA 3VAZA 1YACA 3AHHA 3T3NA 2PRZA 1BEUB 1S1MA 1X9GA 4OJYA 4AUEA 1EE1A 2JVIA 2NU9A 4R7GA 4BKOA 3CZMA 2VSYA 4QYTA 3U3RA 4DMLA 1CDDA 3WLHA 3OOJA 2ZT8A 1Z7WA 1DBSA 2JEZA 4Q1BA 5KNCH 3EC1A 4U6NA 1DIOB 1E20A 1IHUA 1P18A 3ESBA 2WABA 3SQOA 3HADA 3BPSA 1K06A 4X1OA 4PN7A 2XE8A 1XTVA 3AEZA 1SM4A 1SXIA 3LF2A 5LBIA 3KLOA 1I6MA 3TE7A 4QBHA 4ZI3A 4M99A 3RVJA 4QDTA 5CPFA 3FTDA 3PNSA 2P68A 2HWKA 1EWRA 1L3BA 4I5GA 3URMA 4CDRA 1P61B 3K8ZA 4NP6A 4KFCA 4FGLA 4ASUA 4C87A 1YB7A 1Z0AA 3E8XA 5C7IO 4RFLA 4AUKA 4FZRA 3H9GA 3K9GA 5HOEA 1N33B 4YDHB 4OGLA 2O48X 4GDMA 4WKGA 2FUKA 1J0DA 5DVZA 5AXBA 1L5VA 2VBGA 2YHIB 3VPCA 2Q21A 1APBA 2HF2A 4BNHA 5A2GA 1MQSA 2BI8A 1XX6A 3NUQA 2IYUA 2EL9A 3KHSA 4H3SA 4WI1A 5DWVA 2BHTA 1FY2A 3B2QA 5BVGA 4F04A 3HU2A 1KHHA 2VHVA 2FG7C 4YT8A 4L02A 2V6JA 5AR1A 4RYDA 3SZRA 1H8EA 2GZDA 4NAHA 2MU1A 4EHFA 1PW5A 2BCJQ 2DR0A 1IEQA 1IUPA 1KU6A 1L0BA 3A9SA 5D7BA 3T9BA 3UOAB 5BW4A 5JAUA 1TIBA 4KE6A 3FM9A 3V4RA 2YXLA 3D7NA 4GUAA 5FH9A 5F33A 2R6GA 4B9AA 2VTEA 1T8UA 4JOCA 3B5EA 4NLLA 4NOMA 3ZDBA 1UC8A 2JLYA 4NBTA 3UAVA 4W9RA 4DA9A 2DJIA 1YFKA 2D8AA 4K6KA 1I8TA 3E0XA 4E5YA 2HRCA 4ZCSA 2POCA 4RH1A 3BFPA 3IESA 4PCUA 1ODFA 4I19A 3ODPA 4N3AA 3BA1A 3A26A 1LLDA 1ZLXA 3THRA 2B8JA 2JCVA 5B3AA 4OEHA 4DMUB 3IDQA 4UEWA 2QT1A 2F8MA 4QLOA 1UT8A 2PQ0A 1U1CA 3N0XA 4NSNA 1NBHA 2LVBA 5KSYA 3EGIA 2ONZA 1J2YA 1EZZA 1YI0A 1ZUNA 4XPZA 4TTAA 4FQ7A 2XMPA 1B0PA 5ARCA 3UUWA 3ZV5A 3FPBA 2X7XA 4PYNA 1U3WA 1WCIB 4RZSA 2ZTUA 1ZYUA 4I8XA 3A58B 2Y4OA 3CWZA 2J0UB 4I3FA 1ULUA 1KFBB 3ROXA 3VR4H 4Q48A 1BVHA 4BQOA 3GCDA 2BJVA 4DIEA 1Y6FA 1DVRA 3F96A 1CV2A 4BMVA 1P7CA 1MKYA 1D0VA 3NTRA 3FWZA 2JZNA 3GAMA 1OV4A 1KO1A 1OE0A 1HZZC 3NH6A 1BW9B 1GU7A 3HYSA 2NYAA 4UVGA 5JG7A 3UA3A 2YFQA 4X7MA 2BN4A 4EA8A 4ZEXA 3JWHA 1I2MA 3KU1A 2DQKA 3IRVA 4IFIA 4WDQA 3WB0A 4BB6A 4CZ2A 3F67A 4E3ZA 3S55A 1MA3A 5TQVA 1J99A 2PV0A 4IOJA 2CLCX 4P3OA 4Y6PA 1GUZA 1NXVA 1CEXA 4ML3A 1FW6A 1PK9A 1BEZA 3K0FB 1OLXB 5FL7D 2JJQA 4CTJA 4NU8X 2IYVA 2LKCA 4NE7A 5HKLA 3RSFA 3VRHA 2Q1UA 4CL0A 2HL6A 4IBOA 2QLTA 3E35A 1S9DA 4TMFA 2VPPA 2FZWA 5AHWA 4K3VA 1KO4A 2EERA 2HMTA 4J1TC 1Z5VA 2FEOA 3R0IA 1FS4A 1ZK2A 2FN4A 2XYVA 1CS0B 4GOOD 4UHHA 4WN3A 3V2HA 2CVHA 1YBHA 1XKQA 3BORA 2A5JA 3MUOA 4PTYA 4JSYA 2F00A 3T5TA 3I2JA 4OSEA 2CCJA 4UHEA 2AR7A 5EJAA 4B2PA 2BDEA 3HVUA 1G16A 5AW4A 4R3NA 5C8DA 3EDQA 3CXRA 2FCAA 4OM8A 4Z9YA 4CV2A 3U1BA 4H18A 1BVYF 4AO7A 3EHEA 3AM1A 4BN4A 3E9RA 3OUUA 2PMDA 4I81A 4LF7B 3SXUB 1F9EA 4JC8A 4YCNA 3TMAA 4CFYA 1V96A 1HLFA 4HEHA 3IDFA 3KL2A 3WBFA 1CQJA 2FH5B 4KHZA 3HNRA 5ALRA 1O5OA 4LSGA 4PR0A 3U5TA 1SOVA 3O38A 2CJFA 2JFOA 2GHRA 4EB3A 3JQFC 2H17A 2DFVA 2Y1EA 3RV4A 1NWHA 4ZCRA 1N7IA 1XYYA 4MQEA 4P33A 3S2FA 2B5VA 3WDKA 2A5DA 3ZD9A 3TTXA 2C5BA 4CI0B 3LO8A 3OFJA 1KP3A 2JIDA 2ZRBA 3V8VA 4DIKA 3L7JA 4LWZA 4O4IA 2CFOA 3KOZA 4ND8A 2FKNA 4B4OA 1E9VA 5LP6C 3OWXA 16PKA 3AR2A 2NXCA 3KR9A 1Z5OA 1WUTA 2VHWA 4FMCF 3GJ8A 3JQ9C 1PJBA 1MJHA 2PR7A 2FK7A 2F3PA 4BV9A 1PEDA 5FA5A 5KNCA 3SS7X 3OZFA 1E8MA 2WOOA 3AT1A 4JX9A 3VSEA 1G98A 3WIDA 4QBIA 4BIMA 5CFRA 1M6EX 1U0SY 4JEUA 5JBIA 4Y7DA 1QOPB 4BKRA 3L01A 1DDIA 4IM7A 2O0HA 5AI9A 5D51S 1VLMA 4OK5A 5JO0A 3KAJA 2GH1A 4L8GA 4J0KA 3DP7A 2GMWA 1YNSA 4GZLA 4HLQB 3DCYA 4OXKA 3RE1A 2E5LB 3LHDA 2P35A 1K1EA 4NDNE 2DPYA 4BGIA 1T3SA 4K6OA 2CD9A 3GI1A 5CJJA 2Y68A 7ABPA 3GW8A 2REQB 1HM5A 1NZFA 1DO0A 1XA3A 1ZM9A 2H31A 2QLBA 4MQMA 5LNK6 3D1VA 4GS5A 1CE8A 1NQOA 2JATA 1H0RA 1O89A 2AD5A 4N65A 3DDSA 3LOQA 4Z3KA 2G07A 2A94A 5HM6A 1JEYB 3BXPA 3JATB 3PCXA 3B3AA 3WVNA 5A1JA 4RHFA 1IZ7A 4Q7QA 3GUVA 3JZAA 3NWPA 4LFAB 4J6FA 1QQ7A 4LOAA 1FXWF 3ETHA 4WCVA 4BJ5A 1MHTA 1I1NA 3FTPA 3GUUA 1HEYA 4IDGA 1DS6A 4KN8A 1VL8A 4C7MA 1I2ZA 3F49S 5BRJA 3DP9A 1JDJA 3JQ9A 4BQPA 5ADWA 4DBZA 3O83A 1RWKA 2EZUA 3KCNA 2VJOA 3I9V6 4KN6A 3LY5A 3FPJA 2OYCA 1R9NA 3PTLA 4MUNA 5GZ1A 5L7WA 3AJAA 2C4KA 2XAAA 2DUUA 2WPNA 2XV1A 4MDEA 1E3MA 1SXGA 4E1VA 1FFAA 3BT7A 3UJCA 4XIJA 4MTCA 4F6RB 1K9SA 2CD7A 3CRVA 1K3UB 2OHFA 1M8FA 4DT1A 5CFLA 3GN2A 2GCPA 4N47A 4RS4A 3WGYA 3P0HA 3U60B 1QNLA 2BDUA 2JGKA 1QWOA 4IW3B 1GA4A 3EEFA 3IVMA 4UVHA 2NGRA 5F98A 3CR3C 4G0QA 3F8TA 1ZI6A 5EPEA 3TLCA 1GTSA 3MCWA 3JR3A 4ES6A 1S2GA 2HJ9A 1RHKA 2XXAB 4LZZA 2Z2ZA 1Q83A 3HY6A 4YAIA 3ICEA 3ZWMA 1WPXA 5DT2A 4EY6A 4RLHA 3SR4A 3WLRA 3P32A 2WHPA 2FPWA 3QI7A 2D4HA 2DPHA 3HY4A 5A5VA 4GF5A 1E2FA 3ENKA 3NHWA 2RGGA 1RQNA 4EYSA 1BS2A 1C29B 3DVRX 3IBFA 4TOIA 4XYEA 1L8OA 1QLWA 3O84A 1Y6JA 3AB3A 1D2MA 1WSAA 2ZWPA 4M76B 3FHLA 4YQEA 1EB8A 2P2CA 1POXA 1K5DA 2FPGA 3KE9A 5JMPA 2ZVDA 5F7OA 2CWWA 3FUTA 4YDQA 1XCBA 4Y30A 5MF6A 1W0JA 5BW8A 2DH5A 4QGBA 2X40A 5K8JB 1R7RA 2J32A 3IAFA 4MW6A 5C53B 1P7PA 4ABYA 4F60A 4K0KB 1K5GA 2J46A 3MK31 3KSBC 2D2IA 2OHOA 5G3YA 1GOTA 2AE1A 4RHUA 1DELA 1DX4A 2EV9A 1FEZA 4N49A 4S35A 3TTVA 1BXRB 2A78A 2XKBA 2YVUA 3C3CA 3SU8A 3W4IA 3J80A 2ZBVA 2FPKA 2YFYA 2RI0A 4WY5A 5K3EA 4PG5A 1XHLA 4M8KA 3EWNA 4YMGA 3VKHA 4TWIA 3PXXA 4XLLA 3CKYA 4UZFA 4H4EA 5CAEB 4JXXA 5FFFA 1VMDA 3T9CA 1W93A 3EIWA 2ZE8A 3OKAA 3FNBA 3M5DA 4G86A 4I1RA 3K1ZA 5DP1A 1DJMA 2PQMA 1UT6A 4NFYA 1EUDB 3MIZA 3ORHA 2F8TA 4E4YA 4ARBA 2QTCA 1W4BA 4K6GA 5EP1A 3KQNA 2B1JA 4DLZA 3U3DA 1EX9A 1NLZA 3DVQX 2YZ2A 2CDAA 4MPDA 4WX2B 3ZIAD 2IPLA 5DCLA 4C4TA 4NBNA 3T1HB 5K8LA 2BKAA 3KTDA 2V0GA 2RDMA 1YBVA 3ZOZA 2NMVA 2BFBA 2CC2A 2L18A 4MWBA 2VF7A 4TMZA 5TT0A 4AU1A 4CTKA 5KSPA 1Z33A 3MMXA 3H84A 3H1FA 2QW0X 3T9FA 2W83A 3RC9A 5BUSA 1XG5A 5ALZA 5ALVA 2BKLA 4OSOA 4Q1CA 2ZIVB 2JAXA 5FBWB 4WNCA 4ZYZA 2ZAIA 4PPQA 5FUQA 5I48A 5LM3A 5I9IA 2WSSA 4LQ4A 5IJAA 5BP7A 8ATCA 5C8XA 1ZEJA 3CR8A 3M5WA 2HT6A 3P1JA 1ZUWA 1U5BA 5ICCA 4KR6A 2WF9A 4X90A 5EXSA 1ZVQA 5ITZB 5J47A 2QRVA 1Y1SA 5IDWA 2I2DA 1CR6A 2PKXA 3LK6A 2GK4A 4KOAA 4EG8A 2FN8A 1ZIXA 5IJ9B 1VFPA 1T36B 2FP4B 5C1OA 2CXSA 3EXG1 4LEIA 3BQMB 3IOEA 1YCFA 4HLCA 2WTNA 4M0MA 2P90A 3B3FA 4ICIA 1ZJ4A 4D44A 5LD2B 2EFJA 2XZOA 3AB8A 1SKYE 4RVSA 1A7KA 4P98A 3PDJA 4JQOA 1IQ0A 2E4VA 3K8QA 1SXJB 2J3JA 1U3CA 2WI8A 1YJQA 1TIKA 2BT4A 3FGOA 3Q7TA 4LRQA 2JCGA 2CE2X 5DI3B 5HDBB 4AYWA 1FP2A 3FFXA 1YMQA 2WPDD 1KYIA 3NZEA 1QQ5A 1VPWA 1NQUA 3CA8A 4ND7A 5CLIA 4TM8A 4HRAA 2P4HX 4YJFB 1E1QA 1J0CA 2ZFUA 3UMCA 3VU8A 3SJCA 3M83A 3IIIA 3SZ3A 4X8MA 2FZ5A 2YASA 4LQCA 2HJSA 1RYYA 3OIWA 5DXJA 2EFDB 5AVSA 3HG7A 2BHRA 1CJBA 3P4YA 4IIFA 2MMGA 3DVLA 4OGGA 4MDFA 5EFZA 4CG0A 2ZCVA 4CL2A 4J4TA 5KO2A 1MPXA 4JP3A 4ARAA 3QA9A 1V8ZA 3CYFA 1LJUA 5HR5A 4J1NA 5AMXA 1T8RA 5G1OA 1P4JA 5T7BA 3OICA 1ULBA 4IV5A 2J8ZA 5EZYF 4BUJA 1F5SA 4R31A 3GLHE 3OX4A 2XXJA 4BLTA 3FZYA 2BEKA 1INLA 2K5UA 2X8WA 2P9BA 3UZUA 2DCMA 1OZ0A 2P9YA 3EXHC 3VNVA 3C7DB 2IBSA 3I05A 4LDQA 1RZVA 3R8XA 1FPQA 3E9QA 2WKPA 5EESA 4CQJA 5JECA 3ZJUA 1I94B 1RPZA 1V5GA 1P5RA 1EAYA 1YI8A 2NXNA 1SIBE 3DKPA 2DHRA 5B7PA 1XVLA 2Q50A 4X00A 1NUTA 3ZVKA 3B3GA 4K9OA 2V3CC 2XTMA 4DREA 2XLBA 3JQGB 1T6XA 4QC2A 1P62B 2HMAA 4HMOA 1RVV1 2AJLI 2Y1LA 2Z08A 1N2HA 1QO0D 3H75A 1HTWA 3VTFA 1PUIA 4CIVA 4DSUA 1N77A 3OA2A 2F9FA 3PUIA 2OZVA 1Y1RA 1N2XA 1IY9A 3N75A 4REMA 2YN4A 2QRKA 4BV8A 3CBGA 4ZJZA 3QLUC 1EEHA 3R0JA 1FVXA 2VYCA 2I65A 3N0WA 4LPKA 3VR6D 1XAGA 1A5AB 4IJQA 3VR1A 4BEWA 1JNYA 1SC6A 1WXXA 4FEGA 3GHYA 5JHHB 4CW7A 2B0JA 3T7IA 3DNFA 3P0EA 1M7HA 3HXTA 4TXNA 3EWAA 4AXBA 5U9CA 1KMCA 1HT3A 4JAVC 3FPSA 3L0BA 1VP3A 3PNVA 1A2KC 3I6ZA 4M88A 2FRVA 2OEPA 1BMFD 4A0QA 4G5RA 3VR2A 2IYEA 3VYWA 2JLCA 1IM8A 1MXHA 4OLBA 1XRLA 1A88A 3ZX4A 5ICEA 3AY6A 5KVAA 2GHIA 2WHEA 1R0WA 4ND2A 4D9FA 5IG2A 2Z43A 4F8JA 3IL2A 3UJ6A 2K7ZA 1QK3A 1W4RA 1RWNA 2H63A 1TCVA 2FFHA 3KVNA 3IP8A 4RX1A 4BFYA 5JYDA 3QVUA 2QZ4A 2RGAA 2X8JA 3LUGA 1ZD5A 4JKOA 4X20A 2N46A 3SNHA 4YIKA 3ETJA 5K0SA 5KYNA 5GVSA 1YCHA 1NVWQ 4P84A 2Y71A 3BA6A 2PPVA 3ST7A 1GTZA 2YNMA 1OB5A 2NVUB 4YRSA 4HT3B 2G8LA 3AHCA 3IOMA 1Y5LA 5TC4A 4B80A 3UXMA 1H6CA 2XMGA 4EIWA 3GYGA 2G1KA 3QFRA 1FRNA 1UKYA 1AF4A 1PZHA 1Q1NA 3U37A 2JNWA 4PAWA 1PFKA 4L8LA 1E7MA 2UUAB 2J3KA 3ANSA 3KFXA 5EAIA 4M0PA 3UC9A 1XZDA 1U1IA 3GOQA 1FJGB 2E4AA 2WG0A 3ORYA 1HOTA 3GG2A 4PFJA 4WNAB 5TQ0A 4JI3B 1G8SA 3B1JA 3VR5D 3PVCA 4ZYTA 2VKQA 4MO9A 2Q3EA 3DZ8A 3QOXA 4LJYA 1FQJA 3HSYA 5ISMA 1YJ5A 3B8EA 3R0ZA 3RTCA 5I9LA 3KQUA 4MGYR 3QE2A 4LC1A 4YJDA 1E9CA 1W96A 3KYCB 5JISA 2NO6A 5BQPA 2JD0A 3EAQA 1ECCA 1N5DA 3HBNA 1XTJA 3DWFA 4JWTA 3ZW8A 3LPCA 5C2JB 3LUAA 1BQEA 1M6VA 2J41A 3FROA 3AUYA 2WWIA 1BGVA 2QL6A 5IC5A 3N0RA 3RFVA 1YWGO 2G4VA 3V00A 5KTMA 3Q9UA 3PHLA 3NDPA 1M7BA 4OA8A 1L5LA 2RAFA 2P4QA 1W1UA 3ANYB 4G9GA 1JDNA 3M6MD 1V2GA 1YO6A 1J33A 3I04M 1JALA 3ZWKA 3SE0A 3S6JA 2JJYA 4LVCA 1YT5A 1C30A 4BYMA 3DTTA 4Y7CA 1SCUB 2OWDA 4BLPA 2WJ4A 5C7YA 5H59A 1A96A 4IH4A 1HE5A 4CMEA 4Q4CA 2R62A 3QYAA 1SXPA 4OK3A 3UV7A 4QUIA 1N6NA 4O1HA 5DEOA 5IFKA 2H1WA 3DXYA 4IG4A 2YQ4A 5EMLA 4U7TB 4Z0HO 2I2BA 3WWOA 5ARBA 4FFPA 3I5XA 221PA 2O57A 2X7JA 4IJUA 2XWSA 4N0QA 1Y89A 4NK5A 5FWAA 3V8PA 4EVSA 4KWEA 2IH2A 1CIJA 2FMXA 1K68A 3VZPA 1D3AA 1TEXA 2AF3C 2GD0A 1W25A 4KSBA 1K5PA 1JHDA 4EI9A 1ZN8A 3GCGA 4LF5B 5F5XA 4BZWA 5EHNA 3PTAA 1FTSA 3EGXA 4PZ9A 1VE9A 2G3YA 2H9YA 3NRBA 4KIUA 4R4JA 3SGLA 1ISIA 1G4UR 4MPRA 5GM2A 1J6UA 5EJMA 3IDSA 5JVDA 3P9KA 3E3AA 3N6RA 3OJEA 3U7RA 2DQYA 3GD5A 4BX3A 1D9ZA 1NXTA 3QKSB 4WV3A 1M5TA 5B4VA 1E3WB 3T1YB 5AW1A 3DC2A 5JWHA 5JI2E 1B2LA 1CR1A 3TB6A 4F4JA 2C8JA 3EFEA 4QBFA 4ZV7A 3U9SA 5CITA 3QVSA 4ON9A 4X93A 1ZA1A 4MA4A 3PRYA 2P1DA 1PS8A 3WYAA 4BFLA 2A92A 4AICA 4D0SA 4JLSA 2VSFA 2GK6A 3HCDA 3VYVA 4ER6A 2ZJ4A 2XMCA 2VZ0A 2YV5A 3WC4A 4RULA 1FTQA 2DMRA 3ILSA 3OX1A 1SOMA 2K6GA 4BB5A 1OMOA 4RDXA 4Q1AA 3CZCA 3OAAA 3OHSX 5L40A 2XZLA 2ZUWA 4IPTA 2JLAA 3S8MA 3VI4B 2YVLA 3L1KA 3UJNA 1YZLA 2YBDA 3VGJA 2YV2A 3WHIA 1TTTA 4UE2A 1D4AA 1XMJA 2SKCA 4I4NA 3W6OA 4XVRA 1HLGA 2GSDA 5KNBH 3CQ9A 5BVHB 2JD2A 4D26A 1SNYA 1D1QA 1JKIA 1V7ZA 1I2DA 1VOTA 2DLDA 2XAUA 4C6TA 1AK9A 2PH7A 4WOPA 4NARA 4DS3A 2R6ZA 1RLUA 2IZ1A 3DOEA 2XRFA 3KLBA 3IQEA 2EARA 4NHEA 4MYHA 5I7EA 3TSAA 4LXIA 4HPXB 4QYSA 5BSWA 2HJVA 4Y9DA 3DO5A 3E5HA 4O5OA 4QQRA 3EEOA 4OQPA 4ROSA 4QVIA 3DJYA 1A5SB 3W0LB 5J3JA 2FMKA 3LCJA 4HWTA 2UAGA 3R44A 1QG6A 5LDGA 2KW5A 3LVRE 1BGXT 3ZWBA 1K4YA 5F1KA 4BLVA 1ODJA 3AKCA 3UPUA 2X7HA 1XVTA 5EXDA 3PNYA 2V03A 4II3A 3QYFA 3JQEA 2C54A 2EF0A 3CX3A 4MVJD 2YH2A 4KR0A 4LMBA 4TLDA 1QB7A 4UEKA 2X8LA 1P1KA 3ZK9A 1IATA 4HR7A 2B1GA 3KX2A 1U8EA 1CZLA 3TW0A 3UK2A 3W05A 4D9CA 1AZTA 3EZXA 2ID7A 1DTEA 3C16C 3O4FA 5HXAA 2R6R1 1KDPA 1A9QA 2VYND 3OTWA 3RT1A 1R4ZA 5ICSA 5KDLA 4WLEA 2CFCA 3ZY6A 2ZI5A 1J70A 1K6EA 5CLLA 1MTZA 3QE9Y 4PICA 5BSTA 4Q3AA 5B2FA 3O8NA 1G5QA 7AT1A 1ZR4A 1C8BA 3AQIA 4GZ5A 3MJDA 4MVJG 1JV2B 4LBYA 1U0HC 5A5EA 5LD2C 1KO5A 1U2GA 3BHMA 3JR7A 4R69A 1QX4A 2A5FA 1Y5IA 4QL3A 4TQUS 5ECWA 1FNSA 4FSDA 5CBKA 4AF6A 4JB2A 1FVFA 2XB8A 2Q5QA 4LW8A 4TMWA 1JJIA 2DF8A 5HS6A 2WRZA 3L41A 5JYBA 4PQFA 1L1QA 5BPFA 1JFRA 3WS7A 5CB8A 4RHXA 3OCJA 3JALB 1BDJA 3K8YA 4QA9A 3MT9A 1P2VA 1ZNQO 1DSSG 3L0IB 4X7RA 5KNDH 4ZOCA 1Z12A 1UEXC 5JJ5A 3MMZA 1QOZA 3LPDA 1N1GA 1AXEA 4L0MA 4C1NA 3U7HB 1Z6PA 4L8FA 1CUIA 3F5FA 2RG7A 5CD9A 1NUUA 4ZVKA 3OKCA 1EHYA 4AMGA 1JLLB 4C4XA 4RVCA 5FOVA 3TZEA 4K81B 3RSCA 1I9GA 1CZHA 3D4BA 3RIYA 2QMOA 4EQ6A 1GILA 2V59A 2ZOSA 4Q16A 5KAMA 3N7TA 2X3FA 4IIUA 1EJ0A 3H5IA 2P9JA 1SN7A 1Z5PA 3VX4A 1NBIA 4PCLA 3PC2A 1E1CA 4F97A 2HSEA 1V8BA 1MPTA 3AH8A 4LFCB 5F1OA 1Y8CA 3N7UA 1XTSA 4PLTA 3D0RA 5BSEA 4BX0A 1DKPA 5B4TA 1NF8A 1Q91A 3KE8A 5LP6A 4H1UA 5A0VA 3DTVB 2B78A 2OQRA 5KCZA 1R88A 3D31A 4F6CA 5CCEA 2AYXA 4FZJA 1C3XA 4Z7NB 5F73A 3QU9A 3BERA 2H9AA 3SVZA 1NVAA 5A9RA 5EZYA 3SWWA 1TYDE 5DHQA 2RARA 2OV2A 3QVTA 3K0CA 3MCAA 5REQA 1FYFA 2OM6A 1CXZA 1I0ZA 1QUEA 1R0ZA 2LZ0A 2W6PA 3L18A 3PJDA 1YA6A 2JFNA 1QCYA 2QTFA 4OGKA 3AUFA 4XYMA 4NR0A 1SB9A 1E64A 2F59A 3O92A 4EGJA 4HDCA 2IXFA 4HP8A 3H3JA 4B4KA 3DEFA 4B3XA 1YQEA 4DVJA 4ZZ0A 3JQRA 2YKGA 2QUKA 2IHNA 4AULA 1KZYC 2R7MA 5BQOA 1PSZA 4E31A 3OEEA 5CEJA 4ZVSA 2GCIA 3OC0A 4P3XA 1J5PA 1PR0A 2GF9A 2QI9C 3PJGA 4BQEA 1OZGA 1YCDA 2CJWA 3OD1A 4E5KA 1IM5A 2GDZA 3ETLA 4P7FA 5ALSA 2Y27A 4QJBA 5JNLA 1XRNA 4AWAA 1XNQB 3RS3A 1GA6A 3BGWA 4EG4A 3BB4A 3HDGA 5EIBC 4P93A 3GLGA 3LBHA 1SBIA 3SKVA 4L2IA 3BIJA 4BNXA 2YIDA 3M81A 3W6UA 1MGPA 1JIQA 4N5MA 1LK5A 4P3PA 3AUKA 4RE5A 1I4TD 1X7ZA 3DOCA 2JANA 1ABEA 4C0WA 1CF4A 2YXDA 1CC1S 1EK6A 4HC4A 3VYSB 2TMYA 2ZE7A 4L7QA 4PZYA 4ZO8A 1Z4JA 1BXKA 3ZHRA 3Q6NA 4KPUB 1AO0A 3MRTA 1NF3A 2EJUA 1Z29A 1A5BB 4OYLA 3VVCA 3HUDA 2BR4A 3N8IA 3Q5GA 2JF0A 1JAIA 2RGBA 4CMHA 5AM5A 4QDKA 3QFCA 4OKSA 3MTAA 4GH5A 2B1RA 1DRUA 4FINA 5CLGA 1QS0B 2CUNA 5BT8A 2Q1SA 1U0JA 3G7UA 1H5UA 1NVUQ 2WHPB 5A5DA 3L4EA 3K6RA 2OFFA 3H9JA 1QGYA 4ZT4A 2ZUVA 5J4KA 1OD6A 1S8AA 2GXQA 2JHPA 3WP1B 4NG5A 4IKEA 3QVJA 2PFKA 2BFEA 4IX1A 1G8PA 3UMSA 1W44A 3NJ4A 3TAUA 4GX5A 3WK4A 2EWWA 3HO1A 2D0IA 3JD3A 4UU8A 3C5VA 3HJUA 3RWMB 1G2OA 1OFVA 4IMPA 1O4WA 2UDPA 3ZW9A 4NBVA 2AWNA 4GGOA 3U0BA 4F9EA 1TK2A 3L0PA 2ZTHA 1U4NA 4KNVA 4ER7A 4MIYA 4MV8A 2XB9A 3IT2A 2VK8A 4CQMA 4I50A 5A4IS 1B0UA 4IDQA 3BRSA 2QZZA 2O2DA 3UAOA 4RE6A 3FX2A 1BTOA 4ZU3A 4AN1A 4RZHA 1ULHA 5KSWB 1JH9A 1A82A 5TJ9A 2VPZA 3EVNA 3DM5A 3ZDQA 2J87A 4DBLC 5I9NA 1EUYA 4GVXA 2WVJA 3KUCA 2BONA 2GJ9A 4D9KA 4Q15A 4E7OA 2OBFA 3NIGB 4UCQA 4I50F 3W1WA 5BV8A 3Q8MA 1VYHA 4BDSA 3JSAA 4B3TB 4J16C 1E9RA 5FA8A 2R1VA 1FC0A 4PLWA 1SUFA 4P4TA 2ZRPA 3F7MA 3JASA 1YK0A 2CLDX 1NXSA 2ETXA 2GA8A 3R0VA 4GRDA 4B6RA 3FKJA 2DQ4A 1TCAA 1HC7A 1EGHA 5FOTA 2W0MA 1PBNA 3QF4B 4IO0A 1A5ZA 4EG6A 3C1AA 3NHAA 5KTRA 2NXJA 5E0KB 1DQNA 2AUNA 4FHGA 3RGWS 4ZAXA 2WSBA 5DM60 1ZK1A 2OTCA 5IKOA 4KQIA 5IZCA 3FOBA 1TK9A 4U9HS 3LDAA 4FOTA 1DCTA 1QRUA 2Y99A 4BRZA 1S9HA 1SVUA 4EJMA 4RJ2A 2Q6VA 1ZOPA 1NN5A 3PDUA 4XIYA 2MIIA 3RS8A 2XITA 2BBTA 3THYB 3GRYA 4Z4HA 1DAPA 1NMSA 2HF9A 2FN3A 3SEQA 2BISA 3KBBA 4S3MA 4CVNA 4FHDA 5JATA 4JVMA 3WHKA 4K7JA 4R8LA 2XQKA 4JLNA 4MZXA 1EMDA 1I3MA 3W5DA 1THZA 2R4UA 2C7RA 1QGDA 3MUNA 5FOXA 1NQWA 2Z6UA 3FDFA 1VPDA 1T35A 5GJCA 3RT7A 5AM3A 4AJ4A 4O4IB 2HKIA 3M4YA 3UN1A 2J4CA 2VNAA 3IB3A 2TMKA 4D8VA 3PJFA 3DE6X 4EKIA 1AUQA 2ZRFA 3A7EA 4OHZA 3OCXA 3AI3A 2BWJA 1KYZA 2EJWA 1D2NA 1DEKA 3W5BA 2FF7A 5FPKA 1DRWA 2J5QA 2ZRHA 3AIKA 4CMJA 1QU3A 2PBZA 5ESXA 2F3QA 1IZ9A 2UUPA 4LGMA 3UJDA 4WPGA 3ZZTA 2J3IA 4AJJA 3PIDA 4NPHA 4TKUA 1R16A 5CVJA 1E0DA 3RVRA 2ZIXA 1XTBA 1DG3A 3GRUA 3OLVA 4N7RA 2ON6A 3ABQB 1L7MA 3FCOA 3KZ1E 3IPRA 3RVKA 2BE9A 4Z7JA 3EXIB 3EPKA 4YMIA 4AUMA 3FPEA 4JUIA 4TS3A 3KYBA 1UMKA 3IILA 3LFTA 4YCCA 1XTZA 4R1LA 4ZAGA 4JHLA 1PN3A 1Z16A 3PPXA 1Q0SA 1VHQA 5E8JA 4DSOA 2O2YA 1WZNA 4J1TA 2YWEA 1Z39A 2NO4A 4ZD6A 4HD8A 4KIFA 3HSSA 5EGNA 3IMEA 2JARA 3USES 3R0XA 2FPPA 3QLVA 4X84A 2WUEA 2O8FB 1M6WA 1HDEA 3KD3A 1NQTA 2CNWA 3UUEA 4NEQA 1QU2A 1CJTC 5CDGA 1U04A 3H5AA 3LG2A 1JZTA 3OTGA 3R3JA 5E2IA 4A2WA 2A1IA 3ND8A 4JQYA 2N42A 1W5TA 4ZOAA 3SX2A 2RHHA 3QX8A 5KKCA 4Z4EA 2TSYB 3RRYA 1JG2A 4LV8B 4KAJA 1LVUA 3CWQA 3ASZA 2XUHA 3NHFA 4HEJA 3L6BA 4R0MA 4F1KA 1Q0UA 5DTIA 3PJEA 3BBPA 2GRJA 5DLQC 2GKSA 2ZWMA 4WH0A 1N3IA 3CKLA 2BEVB 3FAKA 2JKYA 2Q3MA 2R86A 2X2PA 3MCUA 2WD7A 2OAP1 1JEJA 3INGA 4R41A 1ODTC 4ZVNA 4E2XA 4YJ2A 4RTJA 2YCLA 4QNMA 1RC1A 3O90A 4HRXA 1Z0ZA 4M7WA 1HSZA 3Q3IA 1B93A 4DQLA 3THWA 3M8KA 4ITUA 3LZCA 3OQNA 1NA5A 1OAOC 3L8FA 2BMEA 4O08A 1X8JA 2DAPA 2ZYGA 4BO4A 5A71A 4EHKA 2QAJA 2QTVB 1GFSA 4LFBB 4WBNB 4IIHA 1ESZA 2DPMA 1Y7IA 2PGXA 1SBCA 2HD4A 3NHJA 3EGXB 5IRCD 4Q1VA 1QKKA 1Q19A 3AESB 4V0QA 3H1BA 2V7QA 1M33A 2VC2B 4UTOA 4HV4A 3QBJA 4NJOA 2QRZA 5SZJA 5KIAA 1U9IA 3CGGA 5GIPE 3QWBA 5MFZA 2A9PA 3DC7A 1TXGA 1KO7A 4JOSA 4OYRA 2EX1A 3GXOA 3GLRA 4N0MA 3RUEA 3RUIA 4HNUA 3R6GA 3GFGA 1QVRA 1TAGA 2WAMA 2Z9DA 3HRHA 3BAZA 1BS1A 3EG9B 5DX1A 1JWBB 1M9NA 3KEMA 2V7PA 3ZCXA 2RMKA 2OCDA 5CB4F 4Q6WA 3H9CA 4FVTA 2C2KA 2WUWE 1Z17A 5IT9A 4D3XA 3ZYZA 1JDBB 4MR8A 1OQAA 4H1VA 1J1IA 3GRKA 1XTTA 3AU9A 5IC6A 5IHXA 2CV0A 3CE6A 3H7IA 2PEYA 1Z7YA 2FTKE 5DRYA 1Y3BE 1J2TA 2XVYA 3H8SA 2WJZB 5SV2A 3GFSA 1AQIA 2KHZA 4RD3A 2GCOA 3IBCA 1II8A 2BBOA 2E18A 4XUGB 1PZFA 2CBGA 4QDJA 4M1WA 4C21A 1UMBB 2XVAA 3AETB 5BN5B 5IABA 4HZUB 2X5OA 1MAVA 1IBRA 2CHQA 2CZQA 4MRPA 4N5DA 4CT4B 3C1UA 4DVGA 2WWYA 4Y2SA 4P08A 4YUYA 4H35A 2XSZD 1Y8ZA 1D6MA 4IQ8A 1G8AA 2I76A 3F4KA 1BXRA 1I5RA 4O4JA 1WZUA 1RMQA 3VNUA 2WYIA 1XCPA 2B9VA 3SFZA 1N57A 5CCXA 1CYDA 1BN7A 1DFGA 1KOLA 4EQZA 1G42A 1HZZA 2QN8A 3HEMA 4MYSA 3WE7A 5HIMA 5IEBA 2UZ4A 1FLAA 1SPBS 5FBVB 2ZITA 4GLOA 2FJPA 1SU7A 5GOZA 2AGVA 3TLZA 4XYLA 4EA6A 8LDHA 2A2ZA 1F2VA 4PNEA 5J1TB 3U40A 3NAMA 3I4FA 4QUGA 4IEIA 3HCPA 4X64B 3R3VA 1FL9A 1CZOA 4P92A 2B8EA 4YECA 1PG0A 2PXXA 3FDIA 3KB8A 5JS6A 1KMNA 1VPEA 2H4WA 2JBAA 1EKXA 2WKSA 4KXVA 5AI0A 3FNIA 1DIRA 4EI2A 3GGSA 1TT5B 1O03A 2C97A 1GPDG 4L28A 1DKMA 5KNLA 1PYGA 2CXTA 2VQ3A 3ND9A 5K0EA 1M2WA 5DM0A 3CCFA 4C3VA 3DNPA 5EKTA 1AQYA 2H4FA 1CTQA 3H99A 1R6BX 2ZJBA 3N28A 3F4BA 3TH5A 2VFAA 4DYHA 3RS4A 4BFCA 2Q5HA 3WQQA 1SVNA 4RFSA 2O2SA 3VOSA 5JD6A 3IUQA 1P9NA 3ANNA 3ZHYA 4U4AA 3GLFE 1QFMA 4FW8A 1RJGA 2R6JA 3FPCA 1QGZA 2II6A 3GJZA 3IHWA 1CVLA 2XW6A 1K88A 5EJFA 1X7YA 2NYVA 1CQZA 3H7AA 3KOMA 3NIBA 2O2HA 4LZWA 5LWQA 1WB4A 3LUBA 2ADFA 5B5SA 3IMFA 4V0OA 3AKYA 3I5UA 1LBIA 3TJZA 2CVPA 1XGKA 4NZZA 3THYA 1A3CA 2MTBA 3KSDO 3H65A 5FOQA 3MRXA 4JJZA 4GI5A 4KGZA 1TJ4A 4XARA 4Z51A 5HKBA 1Y33E 4UBIA 3C6ZA 1Z0UA 1QG2A 1XLTA 4YUXA 3GOHA 2QQ5A 5FUYA 4QGAA 2DUJA 2YOFA 2ZJOA 2PY6A 1PFUA 3GU3A 1G4AE 1H65A 3CF0A 4CMIB 3CKKA 4J3NA 2F43A 4DHWA 5HMLA 4CQMB 2HCFA 3IMCA 4FM9A 5JLJA 2QE6A 3MELA 2AMJA 2AVDA 4C78A 5IJ0A 1GNVA 3MTDA 3CVXA 1J0XO 2DWOA 4KE8A 3PX2A 2SECE 2VJPA 4HNAB 5B4UA 4HDSA 2J3HA 3WGUA 3WZ2A 1KZGB 3O1HB 5KYUB 3DE5X 4UMDA 4A10A 4DXHA 3R74A 2AUTA 4N4AA 1VJTA 3LCRA 1TF5A 1EX1A 1XK6A 3UHOA 3LO5A 1X38A 3L4SO 4ZREA 4CLHA 4DJTA 5HKKA 3I61A 2B82A 1C9EA 1BD3A 4OFZA 4FLFA 3RS5A 4LNUA 4RGBA 1FZTA 3I5MA 4LSZA 3ORFA 5ENVA 4UXIA 3R8CA 9LDTA 5EJ6A 1QV6A 2O1EA 2MINA 3T94A 5ABPA 2XCOA 4NU0A 5IK2D 1JVNA 1VRCA 3EBLA 3WFIA 1GZ5A 2A0YA 2BGLA 5DLEA 1B14A 4NOJA 4FOOA 1JTVA 3B9RA 1W0CA 4FYYA 5JS7A 4L5YA 3HUEA 4EMUA 2AG8A 1J8DA 1JHPA 2YHAA 2P9TA 3ND6A 4J0EA 1QXSA 3AG6A 1RRGA 2AC4A 2AOXA 1LC3A 3G7SA 3G0IA 1JKXA 4CQLA 2Z0MA 1QUFA 3GP5A 1VGVA 3UT6A 5JXJA 2XDQA 1QYXA 2VH1A 4RQUA 1K0FA 1DARA 1G291 4OHBA 2ZRMA 3NNNA 1TEHA 2XUAA 3OZXA 1E5LA 4OL9A 1Q0ZA 3RQSA 3K0CC 5KTNA 1MVNA 3BMXA 1SJ9A 4IWXA 1WB6A 3ENVA 2LIPA 1NG9A 2ZIEA 3A6GA 3MF4A 3FVWA 2XCUA 3PFCA 4JYBA 1TTQB 4HVAA 1M1YB 4JJKA 3UWMA 1ZO8A 5JHGB 2QTVA 1C41A 5ADHA 2MYPA 1OJLA 2QV7A 5JSYA 1D9XA 1VJ1A 4JV5B 3R5KA 3RQIA 2AZDA 2YJ3A 3RT9A 4YEDA 1FCJA 4MDYA 1NMEA 1VE6A 3NALA 4EGAA 5F7XA 4Y2TA 1S2MA 4GEGA 2VDVE 3UKOA 5P21A 2AJCA 2OZEA 3H8JA 3LX6A 2QVXX 1TZ2A 4GOXA 4KUEA 3ZNQA 3QFTA 1VMEA 3K2QA 3O03A 3OJCA 4O5AA 1V48A 1SD1A 1EM6A 4MULA 2BTQB 1QJCA 5IDQA 1FX0B 1Z0KA 2NVWA 5J2TF 3AR8A 4YV2A 4U2BA 2GXAA 5A3VA 2Q41A 2YHUA 1EWVA 4G0VA 2XADA 2ZWOA 4WN9A 3NBQA 4F7WA 3GJ5A 2PGOA 4DC0A 4J3FA 5B1IA 1JQKA 5FEMA 4D3DA 4A5OA 1Z06A 1N5IA 3M82A 4X1YA 4BZQA 1JYSA 1Z73A 1PJ8A 4IQGA 1QJ4A 3ZJYA 5JPCA 5TNXA 4BC0A 5EEHA 1C7QA 4FGJA 5IJXA 2XUDA 4LJKA 4Y6LA 5FO1A 3TQOA 4WUTA 4AKSA 2PG3A 3GH3A 1KRXA 4BWVA 4YV0A 3EOAI 1T9BA 3S1SA 3K0SA 3N2GB 4PVDA 1ZJWA 4HLUC 1NJ1A 4U6SA 4P2BA 2NT3A 1I4OA 3CX4A 1NUHA 3N2KB 3NBXX 4F3NA 3FG9A 1LBSA 1TL7C 1VL0A 1XZBA 2FZCA 3IMGA 3ZGZA 3SQDA 2W4QA 3PFHA 1WBBA 1MD9A 2IH4A 2YWDA 4Z2AA 4CM9A 4ZMBA 3EC7A 1NJSA 1B8NA 3HKEB 5FV4A 2AFIA 2NZWA 2OBBA 4E5SA 2V8OA 1RYEA 4BO1A 3I9MA 2C99A 2W98A 2OK8A 3ASVA 1A9OA 1Y4DE 2NUPA 2Z4TA 3L93A 4A9AA 3OZIA 5HE8A 1L5SA 3RYFA 4RWZA 5BR4A 2PZMA 1DB3A 3BC1A 4DV3B 3SZUA 4E30A 2XNKA 1UDCA 1T9GR 4HF7A 1E1KA 4YI5A 2OCAA 4X24A 4DQDA 3CLSD 4PM4A 1UJCA 3SMVA 4BBAA 3I72A 4ZI7A 4MUKA 1X1RA 2Z8YM 4RQBA 4DCCA 2H2GA 1MT3A 1Y7LA 3NTLA 1L7VC 1G1MA 2QTHA 4WFIA 4FOSA 4G97A 4J94A 4CR6A 2XSZA 4DC1A 5JJIA 2DETA 2R7KA 2AK2A 3ONNA 3P26A 3JQ8B 2HV8A 3EQ8A 2CUTA 3DDWA 3IUBA 3Q7IA 3ZZUA 1EFVB 4MV9A 1UR5A 2DBRA 2VWGA 3ABSB 1N9GB 1OSNA 1R4NA 3GV0A 2R47A 1NLYA 3PB3A 1SZPA 1DXQA 4IJ5A 2Q3LA 4UUQA 5K3FB 1EXWA 4A5SA 4EKYA 3QU7A 5IKPA 1S4QA 1VBMA 4ID3A 4WVFA 521PA 3IVXA 2F6RA 1V45E 2I6TA 3EDRA 4G37A 1V9LA 2EOAA 3GJ7A 3WGLA 1KI6B 1N6IA 2WMOB 4JI7B 2DWQA 3ID6C 1SUBA 3FSGA 3ILYA 3LZ6A 1SOWA 5F3RA 4YJ3A 4KVGA 3DDOA 4PHHA 4MV4A 3BG5A 3WGJA 2QZ9A 5K6AA 1NW4A 4JLMA 8AT1A 1Y48E 2I2WA 5EIAA 1Q0RA 2BGNA 4IJMA 3STTA 3VZCA 1A4IA 3R3YA 3TW6A 4CIDA 5EJ4A 2C4TA 4XEHA 1HX7A 4QHYA 1VHLA 1MH9A 3A2KA 3SSMA 4NKRA 3KQTA 4HATA 3U7EB 1DAGA 3COWA 4LZPA 3TQTA 3U4CA 3WNBA 2QNIA 3NAQA 5JS8A 1G21E 2XYPA 4WKCA 2WQZA 3SIWA 3KFVA 3HE3A 4A0FA 3T35A 5IBRA 4CKYA 5BWOA 3L7BA 5JAMA 1RP7A 1NTRA 2R8OA 2R6FA 3IUYA 1QYIA 2VPYA 1A9YA 2DQZA 5EQTA 5ILOA 4G4SP 1M76A 1OT3A 4DLSA 2CXRA 4DZZA 1WBJB 2C2WA 1ZH0A 3T1NA 3NGMA 1JMYA 2NO9A 3QRWA 4EG5A 3HKEA 4RIFA 3TMYA 4Z49A 4PAMA 3L82B 4ZVRA 3O82A 4NYMQ 2Q2QA 2JFZA 1M75A 1ISGA 3KHUA 4BQSA 3FCYA 3OE5A 1W36B 5CW2A 2RHBA 4ONEA 3SF8B 1CB7A 1JILA 1N6PA 3E15A 3K7EA 4EG0A 4PQEA 3ACBA 1W5AA 2FN7A 3K1TA 4HAUA 1E9EA 1U7UA 2VHUA 3BSSA 2R87A 3B89A 4UHDA 4RPGA 5A0FA 2JLXA 5AM0A 4CGYA 3SS9X 3VC1A 3VU3A 1VA4A 3LK7A 1H2EA 1JLSA 1A8UA 4YCMA 4W4TA 1I30A 3OIUA 1GYRA 3II6X 3AGPA 2MR6A 1SBQA 1M2EA 1I7LA 2FEXA 1RD4A 4QXAA 3T4UA 3V4FA 2BFNA 5IDXA 4BVEA 3CVVA 1PJAA 3EXHB 4Z54A 4MS1A 5IFLA 4GBED 1C50A 3MFQA 1UZLA 1MORA 4OQNA 4RGYA 5GONF 3RR2A 2IDKA 3AOEA 3E61A 2AHOA 4HAZA 1OBHA 1J24A 2J0QA 3EBOA 3QKRA 1SUIA 5EIOA 1OTXA 1PZGA 1RHJA 1RM4A 2CSUA 3MAJA 3TLKA 4BGEA 1ZLYA 5CK4A 1D5WA 4KWHA 1E9DA 2HV9A 4KV7A 2VJKA 5ITWA 3TW8A 4XIFA 2OQIA 3OZUA 3H11A 1XZIA 2NTEA 1VKJA 3E48A 3LLMA 4IZIA 4LDJA 4RVUA 3IAUA 4B3HA 2W11A 2EQBA 3EZ6A 3OZSA 2X4LA 4JFRA 4JASB 4P3KA 4XM0A 2BGGA 1Z08A 2G72A 4MA5A 1X7DA 2HLPA 5JBNA 5AKHA 2PUDA 1WRBA 3EXFB 2PH1A 2PXCA 1QVZA 2H08A 1KI9A 3KZMA 1PJ3A 4MLPA 5CH8A 3JQPA 2IJGX 2RKWA 4LRWA 3ZQ4A 2NO7A 4LJ7A 2ZDQA 3CRW1 2UUCB 3O1IC 1DKUA 2GCEA 4BMSA 1J06A 3AM5A 2M32A 2W43A 1BCSA 2X14A 4I1UA 1DQPA 3OSZA 2RIPA 4IDFA 4D4LA 5IKXA 1E6MA 1E2KA 1TVMA 3IJ5A 4A6XA 1LZLA 1FYVA 5DNYB 2ZTLA 3TYXA 2QAGA 3DL2A 1HETA 2I9PA 1DBQA 2QUIA 2QT0A 3AF4A 1P9RA 4LTMA 2PPLA 1OFGA 1QO7A 3GJSA 4QECA 1ZC4A 3U6KA 2ODWA 4YPOA 3JYOA 3NM6B 1RKBA 2RKBA 5AI5A 1XF9A 1W0KD 4F11A 5HJ5A 2CSXA 3VTZA 2ZAOA 4TS1A 4AQ7A 4DAOA 4L0CA 4KFUA 1YVRA 1VC2A 1KZ7B 2YY6A 1TUGA 4PX5A 4KU4A 3NONA 4N6NA 3PX7A 2XNSA 1E9SA 1IYZA 3HXOA 1OLXA 3OM1A 2W6CX 1P7ZA 3LQFA 1DKNA 3L8CA 1R12A 1IONA 1DLJA 4H59A 4KI0A 4R2JA 3V1LA 4BTEA 3E84A 1KH3A 2BELA 4I9HA 4OYHA 1KJ8A 1KRWA 1P4SA 3KJFA 1X8XA 4QU0A 1EXDA 3S27A 4N82A 4LKOA 2HM7A 5A9TA 4OQEA 5G02A 2AOTA 3IERA 4W1SA 1ZXLA 2PX4A 1ODSA 4ZYLA 3HKCA 3NBZC 4INAA 1HOXA 4CMCA 5KOIA 4WJKB 1E0JA 3WWDA 1PO7A 3OUZA 1DC7A 2C31A 3IQZA 1T0PA 3F71A 3PQDA 3M4XA 4BMNA 1PYOA 3D8NA 4DXAA 5CXSA 4D9NA 3O2JA 1PJTA 4JQCA 2C61A 2ZRIA 3A28A 1RQRA 3OECA 2PZLA 1IXSB 3UW3A 2OM2A 2D5AA 3EAGA 4M9UA 3TFQA 2ZSIA 1P2DA 4MIEA 4LRTB 4HMQA 3TW4A 4Z4FA 5H70A 2QMUA 1MV8A 4A8JC 2V7XA 2E4WA 4LN1A 2X6TA 2VJBA 4S0XA 3A9UA 4A2CA 2Z04A 3PZRA 3QKRB 4CCYB 1U7XA 2AIRA 1UK7A 2QPOA 2R7LA 3ZLUA 1CUUA 2UZ3A 2QX8A 2B9EA 4GLLA 2XE4A 2XQJA 3F5QA 2X1LA 1PW7A 4A16A 3X1KA 3ONDA 1U3VA 2JCBA 4GVPA 1CULC 1GRCA 4W7SA 2OKCA 4Q7KA 1BRTA 5IT5A 5ALEA 4GYKA 4MCAA 1UAAA 2P30A 5EN4A 1U98A 2EKBA 2WU0A 4A15A 3M4NA 2AMFA 3OO1A 3GVIA 3H2GA 5HHTA 4BNKA 2P1ZA 4BNTA 3L3BA 1DUVG 5K6TA 4G0XA 5B3KA 1SOAA 2IOYA 2WAAA 5AW9A 3U49A 3FUVA 3HTXA 1NXQA 5CNIA 4IXTA 4DDMA 3DMRA 2BKVA 1MFPA 4J90A 3OLZA 1G0NA 1HK7A 3BCRA 3RTEA 1FFXA 2FWAA 1F3LA 5MDHA 3KKPA 3E3OA 1R5NA 2WJIA 2IPXA 5CJPA 4AWBA 1ZZGA 5J4HA 4F7DA 1NM5A 3H1PA 3TIIA 4DR1B 3SXUA 2VHQA 5CCDA 5JCJD 1AB6A 1VKHA 4JC5A 2XGGA 3C39A 4MVJH 4F4CA 4O0LA 1NI3A 4CCSA 1KQPA 4ZHQF 5EXTA 2AC7A 4DLTA 5BN3A 1RKXA 3EX7C 3BWEA 3TLXA 3ISVA 3OPMA 1NATA 2I7XA 1J2RA 4P9NA 4NJMA 1Z6XA 1TKRA 1EI9A 3U9TA 5BNFA 2PUJA 1OXSC 1BDBA 3BGSA 4OXQA 4QU8A 5C1BA 5JCPA 1Q3HA 3QX9A 4BOYA 3ND7A 3WL6A 2FX5A 2IUEA 1ORHA 2O3TA 3EVBA 3AF5A 4KR9A 1G59A 2C5GA 2I2FA 1PKEA 4NAUA 2R6HA 5CDTA 1Y80A 3T3OA 2JFWA 3NG1A 3WIEA 4NBRA 5TVKA 3E4CA 5J5VA 2H7VA 4IIXA 5DSXA 4DNXA 5JXIA 2AD1A 5AQEA 3WGVA 1J2EA 1YQUA 2HTFA 1DG9A 2N1MA 4G3XA 5I4BA 2V1XA 4LHYA 4Z0NA 4B31A 2H16A 4M83A 2BMDA 5EJ9A 4L4ZA 3X3HA 2W00A 4LSMA 3DXZA 5DYGA 5CYOA 5DXFA 3CJQA 4ZOEA 2EFYA 3PVSA 4IDCA 2O05A 2HYDA 1NX6A 1P2GA 1NW5A 1O6FA 2WU8A 4UCXA 2BZ1A 2VQFB 1COZA 3IVCA 5I4CA 4TN5A 2XH8A 1E3EA 1E96A 3FFAA 5DJ5A 2PGJA 3K9LA 4IDBA 1MQ9A 1R00A 1YB5A 2NZ2A 3A6EA 3HGMA 3KDAA 3LXMA 3DDCA 4FSHA 4QD3A 4CM8A 4WBNA 1SMKA 2Q3BA 2XODA 1PR1A 4MUGA 2GJ8A 5B30A 3L7CA 6YASA 4AY2A 4BX9A 1TJ5A 1EK5A 2QVZX 2BM8A 1HDRA 4YCLA 3G6WA 5IF9A 8MHTA 4MB2A 1OWNA 1WPQA 1D4FA 1X8KA 3JD4A 1OYOA 3DEHA 1FFEA 2NOAA 4HQLA 4IHKA 1TO1E 4LDRA 3ZEAA 5LYYA 1NQAO 4PSDA 3H2JA 5A3JA 4QHTA 1U81A 4GKJB 3AEQB 1GGEA 2BCGY 2PX0A 4DRXA 4G6ZA 4HXFB 1AF7A 4J1SA 3PNMA 5FI5A 4MVWA 2HI0A 4N12A 5EIBD 4A8HA 4NIMA 3GGGA 4CM4A 1PQYA 5HS4A 1K8ZB 3HN7A 4AC9A 4NV3A 2KLBA 3T7AA 2GN8A 3D3KA 1X1SA 4PRYA 4JGIA 1WW3A 4EHHA 3MLAA 2OXIA 2O59A 5DMXA 1OT5A 1KVSA 5BXYA 5KQRA 2H1FA 5H7XA 4PHFA 1GPAA 4JY7A 1ZP6A 4K2AA 4HVLA 5ILQA 1AUPA 2V5AA 5JAPA 3USZA 2WB4A 1MC8A 2XUGA 1G3QA 1L7QA 3FN4A 1OX4B 3QV1A 1XI2A 2A0WA 2VXBA 4FDUA 4R1NA 2H4JA 5ERXA 2QY6A 1EH5A 3TR0A 1E3QA 3WJ7A 5KVCA 3TFWA 2QJWA 2WLSA 3E3MA 3PQ5A 5DYNA 3TTWA 2HU8A 1V5FA 4YCDA 2VYQA 5AJHA 1GYPA 4ZPJA 1GQ2A 1B41A 1RLIA 2CWDA 5CYFA 1E9FA 3WA6A 4CBVA 4ZCQA 4M46A 1OI7A 4ARIA 5G3ZA 1XL0A 3TLBA 3V4LA 2RHOA 1HLPA 2IEYA 3H5RA 3RBXA 3CZRA 3AVQA 3GXBA 2YICA 3PPWA 4EHJA 1N8NA 4QTYA 5JQGF 4ZTUB 4WZBB 4KAAA 4HOYA 4W5HA 3M6VA 4E6PA 2P9FA 3F4LA 3P9PA 2BTQA 1TF2A 4L95C 2I4TA 4WASA 5TV2A 4REOA 3U44A 2QU8A 4XFJA 1GTL1 2EDAA 2YIJA 1QQBA 4XFKA 4UUAA 1DQYA 3DKRA 1X80A 3GF4A 5A02A 1XRSB 2WT8A 2OBLA 3VU9B 2WWWA 2IV3A 3EGCA 3PIIA 3OZTA 2QVGA 4Q9JA 1MB0A 4BNNA 4NXNB 4F3YA 2JDID 3BXEA 1G6OA 3QWIA 4NYJR 2H4XA 4AZSA 5C3MA 4B4UA 3QIVA 3R9KA 4E3WA 4XJSA 1KKMA 5AVOA 4BTLA 4DV5B 5T57A 4EJSA 4V2UA 3HJFA 3HZZA 4KO4S 5JY6A 3MWYW 1CERA 2H85A 2RJOA 1DT3A 4HWPA 4JD5A 2IW3A 2O8VA 3L5KA 3O5AA 3QBVA 4NATA 5BSFA 3OG9A 3H18A 1BN6A 3QJ5A 3MJSA 1HBJA 3UATA 3WKAA 3ZK7A 1LSOA 2G36A 4HDMA 4M8LA 4C4ZA 2BR3A 1U2ZA 4IOKA 3LVBA 4BLOA 4C4SA 3M1YA 4Z3DA 2IHKA 2HSGA 3GDFA 3RYCB 4KLCA 1P0PA 3I8SA 2GQ0A 3VKFA 1T3HA 2Q46A 3K9CA 4L3VA 4DTCA 4ZK2A 4W5RA 4FYVA 1TLLA 3DGFC 1P3JA 2EZ9A 3DMPA 4MGHA 1CNFA 5BR7A 4UASA 1DNPA 2FLKA 3K8OE 3A1EA 2Q9AA 3HB4X 3G2NA 2QV0A 3T3PB 1GZ4A 1J00A 3DT9A 4AJEA 4LXYA 3CNQS 4MVJA 3C2QA 4LYDA 2VJCA 1TM5E 3OE7A 5C8YA 1NYTA 3S8EA 1UKEA 2ZTSA 1KMQA 4N40A 5INTA 2FVXA 2P69A 3E82A 1A50B 3WK6A 2HRBA 4NONA 2IF0A 1DDGA 1CNMA 4MV1A 1HZJA 3UMRA 4IXDA 3IVRA 2C9OA 2EKLA 3LX5A 2XDYA 1PGJA 3N53A 1A2OA 3GEEA 4B3DA 3ZDDA 5L6MB 2FP3A 4H3HB 4QUAA 4WY2A 3TD6A 4FT2A 2R2AA 2JAQA 5CT8A 5KOHA 3EGWA 5LA6B 2W37A 2WTMA 3G89A 4L07A 2AFVA 2AK3A 3AWIA 3F6EX 4FBMA 2X5KO 3C24A 5H9VA 1C2TA 1BWSA 3I9FA 3U4MA 2ZEJA 5DISB 4ZWNA 4D6YA 3S2SA 5LU8A 4FUTA 3QFHA 5TDHA 5KS2A 1ZD8A 3IAAA 4LHWA 2BJHA 1GA1A 1G21B 2PS9A 5AXDA 4EYOA 3OT4A 2KBFA 1IY8A 4QUDA 1B23P 5E9QA 5CGQB 1DZIA 4JYZA 3WGQA 2SCUA 5EWMB 3OPQA 3FDZA 3KQWA 2AFIE 3PGJA 2O3UA 2G63A 4G56A 3N1UA 2QSUA 4Q3BA 5HIKA 2VJYA 3L92A 3A2MA 4J0FA 4QASA 4XCXA 4XI9A 2H48A 5HEKA 2RGNC 1QM5A 4OFXA 5IM4F 3F3YA 4MWOA 2C2XA 1QPZA 4YMHA 3THXB 3ONVA 2H57A 5IYZB 4GXTA 4EUSA 3I5YA 1VHDA 5C51B 4DQXA 3HWWA 3ULKA 3NFYA 3O4HA 2PS0A 2VR1A 3EE6A 1NW7A 4RZIA 2ZJ2A 3ZDCA 1KDRA 2LCQA 1OBCA 3FH0A 4WADA 3UUGA 1JLMA 3C3JA 1M5RA 2ATXA 3DB1A 3LP5A 2Z98A 4TRNA 4YP0A 3SCZA 1GNTA 1WY7A 1XQ6A 3DBRA 4LYEA 1Z6ZA 2V5UA 3V7YA 2TS1A 3ZZMA 5CCBA 1U1DA 3CLHA 1VHTA 4KBGA 3A2LA 5K8UA 1L4MA 5C1PA 3E8MA 3KQSA 1T4GA 1M8PA 1Z7BA 3FVTA 3Q41A 1YIOA 1POWA 4S12A 4ZTZB 3PEVA 1X7WB 4A7PA 3EZNA 3SD7A 2FKAA 4L5IA 3T0GA 4CHGA 2J3MA 4YHHB 4MS3B 1CEQA 1YS7A 2GGSA 1ZCFA 1ZU4A 3CZ9A 4MWEA 4BJ6A 4BVLA 2GNOA 3UCXA 5IULC 3ZDRA 4YQYA 5BQXA 3ZI0A 4E2FA 2ZYVX 3AC0A 4RIGA 5JDIA 1QGUA 4JI8B 2JPDA 1QONA 1W87A 4KLNA 3VPFA 3IIMA 3ZE7A 1X80B 2GM3A 2HFJA 2C0PA 1C1XA 1B8UA 4OQLA 2BSXA 2C9DA 5CBPA 1XZNA 2CGEA 3T5PA 5K99A 3NTVA 4AQYB 1IJKA 3W6PA 1LTHR 4BMPB 1OC2A 4NDAA 3K70B 3RLFA 3ICPA 3L8YA 4QOIA 3I73A 3X1DA 1A8PA 5LOVB 5JXGA 3AK4A 1VBNA 2DLCX 1OKKD 2NO5A 1MC1A 3PHCA 5FI0B 4GE0A 2Z8ZA 5EKDA 4OXRA 3MEQA 4QODA 4OAOA 3GPIA 2EDCA 2HN9A 3ZGOA 3UT5A 1G64A 2L69A 4ZC8A 2WJVA 4J3JA 2QTMA 1WL8A 1U63A 4YP9A 1HMYA 1UXIA 2IU0A 4EY5A 4KK4A 4L08A 5B1EA 2P77A 5EJ7A 5B1HA 3KPJA 3MXOA 1YGYA 3K5IA 3AXTA 5EQJB 2XX3A 4BFSA 4Z53A 5EZ6B 4PLCA 4N8SA 621PA 2QRGA 2C20A 4LHEA 4DIOA 2VKTA 1ZNWA 4CKWA 2FQQA 1OH7A 3S7ZA 2QGZA 1YQXA 2P9CA 4OF4A 2RD2A 1ID1A 3U26A 4CM5A 4F84A 5LQUA 1E77A 1LS6A 1QP7A 3MHTA 4OLHA 2GNPA 4PQRA 4PPGA 2RAUA 2ACKA 2QP4A 2O7RA 4QYWA 1JQ5A 3E7FA 2NYUA 5JZ9A 5FNVB 2JI6A 2PGNA 4MW4A 4GQAA 2O1SA 4OXNA 1DMRA 3RODA 1Z38A 2QD2A 4FHEA 5K4GA 2X13A 1M2OB 3CUEF 1L9XA 4PRLA 3ZWOA 1HKUA 2PUWA 3NBAA 3QVXA 2AQKA 2C1EA 4KQXA 5DM2A 4DEYA 4YCJA 2DWPA 1KFJB 2I6FA 2WAXA 3EVZA 2P27A 2VK1A 1EYZA 5JSQA 5F3WB 1MJGM 3EODA 1Z13A 1TZMA 2OK7A 2QGFA 3W5HA 2X42A 3QMVA 1QHGA 2IIBA 1U2EA 2C88A 4LAFA 1VFNA 2OP1A 1LVHA 4YR7A 5LQRA 1ZZEA 2FLVA 3NORA 1EIZA 4EX6A 3EVEA 2BVNA 3OURA 2ASVA 3SYNA 4BMCA 1GZ7A 3KQPA 1YHZA 4Z9BA 4ROTA 2IXEA 4MUJA 2ZANA 2J9XB 3QG1A 2F1JA 1TADA 4PSCA 5I47A 2M6RA 1DKQA 1GLNA 3EJWA 3G68A 4UTVA 5M7EA 3OTOB 1IU9A 1F6BA 3GMIA 5L7TA 4L0QA 3HBFA 2VK2A 4YRRA 2IHVA 3FLAA 3DW3X 2Q4OA 3G0CA 2NXWA 2LR0A 1K4MA 1W73A 4A1FA 4TYWA 4X60A 3DE1X 1LJLA 2BAGA 1CU1A 2J30A 1FLDA 3IPLA 5DN6A 1O95D 4WK4B 3UB4A 4D4HA 3PD0A 1GG9A 3CEMA 2JW5A 4MVJM 4PC3A 3U7QA 4BB0A 1KP9A 4YYZA 5GPBA 2PX5A 3RF6A 1O6ZA 3FPFA 2FV8A 3AIMA 5IARA 2Y92A 1SY7A 3DE2X 4OHFA 4KP7A 5DYWA 1I1QB 1YS6A 4UM8B 3NAZA 5JC8A 1DE0A 1GJRA 1HTBA 5D6NA 5FNZA 3KB6A 2LE0A 1SZDA 3L06A 4HNRA 3DHYA 1D0SA 5BSRA 4AYXA 5L3VA 4Q9AA 3ZC3A 1ETHA 1TQHA 2GJKA 3BK1A 4H7FA 4Y2GA 1EG7A 5AI4A 1KARA 1QH1A 4I2VA 1L5FA 1RS0A 2P2ZA 3HGTA 3A2NA 3CX8A 2WIGA 4K9KA 5TPWB 1D1PA 3GVPA 5GTDA 5JNSA 2DH6A 2QPLA 4HTAA 1IZ0A 1KJNA 4JR0A 5HCUA 2PA3A 3RVLA 3I62A 3IBTA 4PLGA 1I51A 3GPCA 3WJ1A 3VZRA 1UPXA 3O9VA 3G3EA 3HCRA 1ZD3A 1IDN1 3ZCVA 3TEMA 5FX2A 5F1YA 2AFHB 2OGTA 3ZIAA 1ILEA 1SRQA 2D1RA 3OIVA 3HKBB 3WIBA 3UNXA 4JA2A 4MVJI 5JD5A 4JNCA 1F12A 2G06A 3GEIA 4P38A 4US0R 3NM4A 4JLOA 4Y67A 1YH3A 4DE5A 1FRQA 1KYQA 2P2SA 4B3RB 4GI1A 3SJAA 2V7WA 1C0LA 3G9TA 1DUSA 4BNVA 3O0DA 1EXNA 2GZMA 1QIFA 4DL9A 3NVMB 5FFMA 2OXTA 1JI0A 1RZRD 1S01A 3ITNA 4MS4A 3D6MA 5DE3A 5FWXA 3IULA 1RJFA 1V5EA 5AK5A 1CEYA 4BP3A 2VAWA 3IBSA 4N76A 4OGFA 2AYYA 1LXCA 1ATIA 1DRJA 3HWRA 4LJLA 4DDHA 1IN4A 4Q3OA 5KHAA 3VOTA 1S3IA 2Q1TA 2PT5A 4M87A 5TX7A 2IP1A 1E99A 1PJ2A 1XVUA 2DUWA 1VKOA 4QEDA 3DWIA 1MQ8B 4CG3A 3IP1A 5KJCA 4NZMA 2JGRA 4B3BA 3I45A 3T3GA 3N86A 4ZZ3A 1C8KA 2CYBA 2GUWA 3L8HA 3OCVA 4JC0A 4MI1A 4IF4A 1OHHD 2ZKLA 4AG6A 4BRSA 2UYQA 4QJ5A 4RZ3A 4QWWA 3D6FA 1MLDA 3BGDA 1NXPA 3A4IA 1ZBDA 2PZGA 1XU4A 2BBWA 3BGVA 1RT9A 3G5UA 3V1TC 2VIIA 1AUXA 2Q4TA 2YYAA 4Q3EA 2CV1A 3K1YA 1W8DA 2C7VA 3IKVA 1GPNA 2O8BA 1UBSB 3N59A 1S7GA 3AP3A 1M0TA 3MMSA 2R1TA 1BE8A 4RADA 4XM1A 3U17A 4YRGA 4N0PA 3HKCB 4BQIA 2JIRA 1JR3A 4IKOA 5JZVA 1KIFA 3MMNA 3NX4A 4G8BA 4JWKA 2CMKA 4WFQA 4CU5A 2BHLA 1QG4A 4L4SA 4EI8A 6NULA 3IHLA 4QRHA 1CY2A 2I62A 3I01A 1RBMA 1G20A 4XH9B 4F4UA 3CURA 1BCSB 4YRBA 4S24A 2H4YA 1FZQA 2QYTA 2X2OA 4DARA 1IG0A 1TYZA 4URXR 1URPA 4JVSB 5ANRB 1CEEA 4KMOA 5HGXA 1ENPA 1XMXA 1O0BA 5CA1A 4QLBA 4I9NA 1J07A 5EJEA 3ASUA 4FYKA 1OXMA 3MJ4A 4BLUA 1RI1A 2BUAA 2XQVA 1E4OA 4MKIA 1PK7A 3PBKA 4YRTA 3A70A 1FP6A 3D7MA 2JH9A 2UYCA 1REQB 2C94A 2GN1A 2NPIA 4MKZA 1EINA 2CZGA 2C78A 3MN1A 4RO0A 5ALHA 4ENQA 3SYRA 1OVMA 4ACBA 2AKEA 1G8KA 1X1QA 4CIAA 3L6RA 3L8DA 2DFTA 4NABA 1Q3TA 5ALIA 4XVCA 3QELB 4X0EA 1Q44A 4WZAB 3T12A 1K0UA 4NOLA 2XECA 4LUCA 1DC8A 4NQRA 2ZE6A 1FDSA 1JDTA 2MCFA 1FS6A 4XOIA 5ALOA 4G4IA 4TMKA 4OLAA 1XQYA 1DXOA 3IEKA 1Y82A 1LQ2A 3LUCA 4P54A 5HBGA 1NJGA 5L95A 5A2QA 4Z7QB 1Z4MA 3VKVA 1ZIYA 1UH5A 2OO5A 3NHBA 3T8YA 4WIAA 2W6ZA 2GZ2A 2PR2A 4HN2A 1XQ1A 1C9DB 4IGIA 4OP3A 3CC8A 1F06A 1WHTA 1V3VA 3NH9A 4OREX 5FYQA 4BNDA 1PDWA 4C7OA 1Z68A 4RPCA 3KVYA 1GNRA 1BS9A 5JS1A 3IQWA 1GAEO 1KK0A 3V8MA 1PL7A 1XDDA 4ED9A 3IRUA 3OQIA 1YQDA 2NTVA 3MWEA 3RU2A 4PZUA 2GM9A 1UPUA 3OHMA 1Z56C 3NHLA 1LLQA 4XLZA 2R8YA 1DJOA 5G0VA 1UWLA 2J6CA 3V80A 3PDHA 1ZOSA 1P5ZB 2V45A 1V0JA 2E55A 3ZYCA 2KI5A 2YVKA 3AP2A 3L1HA 4KIGA 3GAFA 4TKVB 3PXCX 3R9XA 1UK9A 3I2KA 4IKPA 3M9XA 3U7FB 1J49A 3KAPA 1IJBA 2EL7A 2E85A 2DHCA 5HNKA 1H9CA 1T2EA 3STWA 5GY7A 3LW7A 5AKZA 2NSHA 1IDOA 3JWJA 3TJRA 3TLMA 2A1UB 2FR1A 3LVFO 3ZWCA 5CW1A 2P9QA 3KYIB 1IBMB 3RU3A 1WZCA 4D4KA 4YY3B 2FX3A 2WMNB 3G23A 3I01M 2OBYA 4R54A 5CX4A 3QV2A 3V3TA 3VAAA 4UOEA 3DONA 2HJWA 1UANA 3NTOA 3R6LA 1G7SA 4I5EA 3ZWPA 4MKXA 2CLIB 2K2WA 1MO3A 3EMBA 1OOEA 3FMFA 1ZM3A 1T24A 4OUDB 4JUBA 3U16A 4N3CA 2ZYAA 4CKCA 1G3RA 1M74A 5JRDS 2RGEA 3KLNA 3PGLA 1NXXA 3KKLA 5JDCA 3M4JA 2IUTA 3HUTA 4RK5A 3AERA 2WBLC 3EF0A 2RK4A 4CETA 1QPBA 2X0EA 2R6CA 2WG2A 1JKFA 1JXMA 3WGOA 5A7FA 3K1JA 1UXGA 3DV0B 3V7WA 1M1NA 1Q0HA 2X8BA 1EFPA 4R5MA 2YMQA 1ORRA 4ZO9A 2WJWA 4HAOA 4XM2A 1G1AA 1UOQA 4M2LA 5ER9A 4BMDA 3KXPA 4C3OB 1SUAA 1LX7A 1J1UA 5DCWA 5DNDA 1O95C 1XNHA 4UXJA 2ISCA 3O8QB 2GCOB 4IIJF 4DKXA 3HP1A 2R6DA 2BFDB 3GIWA 3OAAD