3GGSA

Human purine nucleoside phosphorylase double mutant e201q,n243d complexed with 2-fluoro-2'-deoxyadenosine
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
284
structure length
284
Chain Sequence
b'NGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFQTVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITDKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title Structure of a mutant human purine nucleoside phosphorylase with the prodrug, 2-fluoro-2'-deoxyadenosine and the cytotoxic drug, 2-fluoroadenine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 284
sequence length 284
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2009-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ggsA00
1Z33A 1Z34A 1ULBA 1PR6A 5B7GA 1NC1A 2AI1A 5F77A 1OV6A 1PW7A 4FFSA 4YMLA 4DANA 2H8GA 2HSWA 1V41E 1TCVA 2IQ5A 5CXQA 1U1DA 1U1FA 1B8NA 2I8AA 3KVRA 4F3KA 1V2HE 1V48A 1VHJA 1Y1QA 1VMKA 4TXHA 1JP7A 4GKAA 4QASA 3OZEA 4DAEA 1OVGA 1V4NA 1B8OA 1Z35A 1RYZA 3ONVA 1LX7A 1RXYA 1ZOSA 4LDNA 3DDOA 3FB1A 4EB8A 1PR2A 4L0MA 5F7ZA 4QFBA 2OC9A 3FAZA 4QATA 3BJEA 4G89A 1JDSA 1ZL2A 4TTIA 4JOSA 4F3CA 4GLFA 4OY3A 2PGAA 1Q1GA 2XRFA 3PNSA 2GUWA 4M3NA 4TXLA 3KU4A 1YQUA 1JE1A 1JDZA 1A9SA 3EUFA 3UAWA 4NS1A 1PR0A 4LZWA 1V3QE 3PNPA 2QSUA 2RJ3A 1RXUA 2QTGA 3OF3A 2HWUA 1VHWA 4KN5A 3ODGA 5EPUA 5CYFA 4L5CA 4D8XA 4TS3A 1ODJA 3GGSA 5IFKA 1Z38A 1T8SA 3FOWA 5CCDA 1CB0A 1TGVA 5F73A 4R2WA 1U1GA 3UAXA 4OJTA 4MCHA 1TD1A 1YQQA 3E0QA 1JE0A 1YR3A 2QPLA 1T8RA 2B94A 2P4SA 1K27A 2AI3A 4TXNA 4M1EA 4WKOA 4R2XA 5KB3A 4D98A 1I80A 3KVYA 5B7QA 2A8YA 3LA8A 1ODLA 1JDTA 3P0EA 1A9RA 4NSNA 5F7OA 3IEXA 1Y6RA 4JWTA 5K1ZA 1Y1RA 2A0YA 3NM5A 4PNPA 4D8VA 3OZDA 1U1EA 4L5YA 2QDKA 2HRDA 4QAQA 4LNAA 4DA0A 5IU6A 3OOHA 4P54A 5CXSA 3OZBA 4GLJA 4DARA 4L6IA 5I3CA 2A0XA 5B7PA 1RT9A 1C3XA 5F78A 4WKBA 3OOEA 1XE3A 3NM6B 1Z5OA 3OCCA 3F8WA 1K9SA 3UAVA 1A9PA 3UAZA 1A9QA 3SCZA 5CCEA 4YJKA 5C80A 3P0FA 1Z5NA 4U2KA 2A0WA 4F2WA 3KUKA 1QE5A 3QPBA 1SD1A 3E9ZA 1OUMA 4G8JA 1U1CA 1Z36A 1OTYA 3FNQA 1A69A 4MARA 1RR6A 3BSFA 5F7XA 3C74A 1Z37A 1T8WA 3D1VA 3LGSA 4GMHA 4UC0A 3K8QA 1T8YA 1Y6QA 4D9HA 3GB9A 1A9TA 1PK7A 1FXUA 1V45E 4TXMA 4D8YA 3DJFA 1PWYE 1WTAA 4NY1A 1PR1A 4BMYA 5ETJA 1LV8A 3FUCA 4BMXA 4WKCA 4E1VA 5EFOA 1Z5PA 1NC3A 1TGYA 3ENZA 2OECA 1ODIA 4DA6A 2HN9A 3IOMA 1Y1SA 3NBQA 1RSZA 1Y1TA 2BSXA 1RXCA 4BMZA 1SD2A 1JDVA 3E9RA 4PR3A 4TTAA 3LBAA 4TYMA 4LKRA 1ODKA 3TL6A 4QEZA 4YO8A 5EUBA 4M7WA 3DF9A 1T0UA 5CYGA 4DA8A 1OU4A 4DAOA 1LVUA 1JPVA 1Z39A 3MB8A 3PHCA 1RFGE 1RCTE 1PK9A 1OTXA 4X24A 3OZCA 4DA7A 4TS9A 1K3FA 2ISCA 5B7NA 3BGSA 1N3IA 1PKEA 3KHSA 1RXSA 5F76A 4G41A 5JPCA 3NM4A 3O4VA 4F1WA 1YRYE 1M73E 2I4TA 3INYA 2OC4A 3EUEA 4I2VA 3MMSA 4R31A 4DABA 1SQ6A 4LNHA 1ECPA 3UAYA 3OPVA 1NW4A 1A9OA 2ON6A 4YNBA 1PR5A 1G2OA 4JP5A 1CG6A 4WKNA 1TCUA 3DPSA 3EMVA 4MCIA 2QTTA 4OEHA 4OF4A 3EEIA 3DP9A 4WKPA 3K8OE 4EARA 2Q7OE 3UT6A 1YBFA 1VFNA 4H1TA 3BL6A 3O6VA 5FAKA 4ECEA 3T94A 4OGKA 5DK6A 3FWPA 4IP0A 4TXJA 4L5AA 1ULAA 1PBNA 3PHBE 1JYSA 2OXFA 4TTJA 4K6OA 5F7JA 1PF7E 4RJ2A 4BN0A 1PR4A 3U40A 3KVVA 2AC7A 4OGLA 4F2PA 1JDUA 1SJ9A 2AI2A 4QARA
chains in the Genus database with same CATH superfamily
4L28A 5KREA 3IUQA 3VOTA 1MOZA 4G2TA 4AMBA 4BCCA 1EUQA 4MX8A 4Y9SA 1PZMA 5KTYA 3OQHA 4X1KB 3MOIA 4AWXA 3RABA 2GK4A 2SHKA 1G7SA 3DL4A 5JEDA 2PLRA 1DNPA 1A2KC 1DQSA 1VSBA 3WBKA 5JZBA 5HIIA 4TQUS 1J23A 1W5BA 3F7NA 4HYYA 3N8GA 3V4OA 1B6RA 3ZWYA 4AD8A 4DZZA 1XNRB 4B34A 3G89A 4Z4QA 2YJTD 4G4GA 3W8NA 1JPJA 2BGLA 3HB7A 2PMDA 4ICIA 3Q98A 1M2VA 2BBWA 1C29B 2VYND 3ILXA 2XQFA 3TLBA 1P4SA 3L0YA 3ZLTA 1DCKA 2FQQA 3VHXA 2HQOA 4CRWB 5LU9A 5DNVA 4UVDA 3DVAA 2Z6AA 2E18A 3KOWA 1QH8A 1XXHA 2Z3ZA 4G3XA 4J4BA 3UQYS 1I13A 3KCNA 4X63A 2P1DA 3U62A 4JT8A 3MW8A 4EUKA 1G19A 5BSFA 1EUYA 3I2HA 4CU5A 4O2BF 1U0SY 1NJ5A 2FFRA 3H42B 3QJYA 3KO8A 1Z4MA 4QBFA 3ZX5A 2Q1TA 3V8MA 1NBEA 5EESA 1JEDA 4CKCB 3GLTA 5I7HA 3KEGA 4M0KA 4Q01A 3M5WA 1AQNA 1O77A 4S2EA 3E3LA 1GZDA 2CYBA 3HUEA 3Q3CA 4MEAA 4MRRA 5HK9A 3SF0A 2J5BA 2XYGA 3O4JA 4IJVA 4B6PA 3D9QX 1OFUA 3EBPA 3F6SA 1SCNE 1X19A 4IZ6A 1R6BX 5G0WA 4JBYA 3UOWA 3RU7A 1HO3A 4J0DA 1KAMA 3LK7A 3RS5A 1WS6A 1O95D 3WKBA 2RK6A 2ZDGA 1NQTA 2VYFA 2X1MA 1TLLA 3AM3A 1ZOSA 1BXKA 1GNVA 4I66A 1G6HA 4K03A 4OQZA 4R7TA 5FFMA 3CN7A 1HG0A 2OD2A 2ZJZA 4YJ2F 1NSFA 1DDGA 3UXHA 3PC3A 2JCSA 4MR7B 3DMFA 3LX6A 4TV9A 1Z0AA 2O2HA 3P9RA 3Q1KA 4G5GA 4INJA 5CG2A 2XQGA 4OP1A 2XB6A 4FYVA 2ZBRA 4FIZA 2BEUA 1THZA 4QREA 2BBOA 3WWPA 1EB9A 3HCBA 5EXEA 2GA9A 2IKSA 1GPMA 2ACEA 3EIWA 4RJKA 4BFWA 4GC9A 1HM5A 1LDMA 4M86A 4X64B 1PX0A 1GKLA 3QVLA 3NIFB 4N65A 4NX2A 1T0HB 2RCYA 2J45A 2WWWA 4YQZA 1OV4A 1TC1A 3DOJA 1KI9A 3QFFA 5EIAA 4BLQA 1LW7A 2O7QA 5LOVB 2PKRA 4N7JA 5CAEA 2HPVA 2EARA 3SFTA 4PZCA 3A1SA 2VJLA 2V65A 4MJ7A 1JIXA 5FCDA 2PGAA 2NU7B 3H0EA 3IO3A 4IH1A 4X94A 4DMHA 1FP1D 3LC7O 4YP6A 4IGFA 1TYCA 3K32A 4NKRA 4U7GA 2B5OA 2HA5A 4BYGA 4EATA 2RFLA 2ZJYA 1FDOA 3HKDA 3DDWA 4TXLA 1Z5UA 3ZWQA 1ISJA 2OP1A 4ALMA 5IYZB 1ODTC 1HFWA 2Q0HA 2EJWA 2EP7A 4N3AA 5F1OA 3GI1A 1C7JA 4B4DA 1JLMA 1ZMXA 4V0KA 4C4SA 2CMGA 2EX4A 4ITRC 4GUAA 3DE7X 2QUBA 4HTFA 1N33B 1LKZA 2GILA 3LRTA 2XVMA 5JJIA 3PGXA 1P7VA 1EKXA 2DXIA 3ZU5A 1FC0A 3GG9A 3I2FA 4C7JA 2IIQA 1OBFO 1G1MA 1U1IA 3C4JA 3JAWB 4IQFA 1HXHA 3OF3A 2HWUA 3SHVA 2AV6A 1YOVA 2NSDA 2JGDB 2WSBA 2ZE5A 4N3CA 3D2AA 4MA5A 2OPHA 1ISIA 3LKDA 2VPYA 1I1NA 2HWWA 3T7KA 3ER9A 1SCDA 2RARA 4D9EA 3K73O 4M38A 3PIDA 4HWKA 4LYGA 3MWKA 4YALA 3WYBA 5KCMA 3PA6A 4JIGA 3RTBA 1RNLA 2AC4A 2L69A 4M0LA 1IOWA 3MCUA 4YT4A 2GPAA 3R3UA 5J9FA 1EINA 1A4UA 2WJ3A 3HN2A 3Q5EA 3HP4A 3QJGA 1NXPA 2E5LB 1KYIA 4J7CA 3HRIA 1Z0SA 5FUXA 2OZEA 2XDWA 2XMBA 1U8TA 1CDDA 4JXJA 2VLBA 3MTDA 1EHIA 1ABEA 3K1AB 1DIRA 4HD8A 5CBKA 2OBLA 4MI6A 5DXAA 1RI5A 3D31A 3VR2D 3I9LA 3AVPA 1TVKA 1GPKA 1ECFA 2AI3A 2DJ5A 3PGKA 4D7AA 5C7IO 3T38A 4AW9A 4CV1A 5JDCA 3CEAA 3L4SO 4MVXA 1XLVA 2VDLB 3VR5D 3W7AA 1CVLA 2XVXA 1BN6A 5BOSB 2GEVA 1QK5A 4ZC1A 3N7TA 1P2SA 2A5YB 3JZDA 3RVKA 1KEEB 4FJ2A 1CIJA 3TKLA 3VQTA 2E1RA 4QEDA 2X8LA 4LCJA 3UV6A 3A6DA 5G0VA 3LA8A 1EFAA 3GHHA 4KUEA 3GRZA 4OQLA 2R62A 4FSHA 1JDTA 4GR5A 4GGPA 3UMGA 5T7BA 4ZVNA 1PT9A 3DWGA 3LXRA 4MUAA 1M76A 4O4HA 1YFJA 2PUTA 1C7RA 2F3UA 4GMKA 4H4DA 4BEBA 4PINA 5ALWA 5KUTA 1R7RA 1XUOA 3R75A 1USGA 5DK4A 1YL6A 4IHAA 4RGBA 4BQOA 5KOJB 2CVZA 3H0KA 1QDUA 1RYNA 2AJLI 3M81A 3OAAA 3PE3A 5KWVA 3RVRA 1BOFA 2IH4A 2NU8B 2XTAA 1SOMA 1ZXBA 2WHYA 4Q3OA 5IX8A 2B8NA 3LLMA 3ZHVA 5KPJA 1FUIA 5DBOA 4V03A 2FMFA 3EUWA 3K31A 4HAVA 4L5YA 2O2XA 5AKGA 5IF3A 4D9BA 1Z3CA 2O59A 4E2ZA 1RLJA 3IT3A 4WRRA 3VDNB 3RV4A 4RS4A 3KXPA 2ECQA 2G6TA 4MPPA 4CIDA 4PC6A 3U61B 2TECE 1LBSA 1RI3A 4J6FA 4QDJA 2WTUA 1FZTA 2QI9F 4XVHA 1BCSA 4QBHA 1A5BB 2O2EA 1MQSA 1R6VA 1V26A 1Z2CA 2QTLA 3FJOA 4INAA 4XFJA 2HSZA 3FNEA 3RS0A 5AVYA 2DKOA 4ND8B 5ALXA 2C59A 2CDBA 3THWA 4G8DA 4FBLA 1IHXA 3KUDA 3ZHXA 1Y7PA 4FFMA 1EFRA 1QH0A 3MCTA 4K88A 1WF6A 1E6UA 2Q9AA 1HFJA 1G66A 2AR9A 2OK7A 2ZUVA 4PS1A 3WYCA 3QELB 3OQNA 2IS1A 1NSYA 1WXQA 3A1DA 5ESWA 4EOGA 3KAQA 2G7ZA 4IRMA 5F4ZA 5A9RA 4N41A 1Q1ZA 2VF8A 1B76A 3G59A 4MP6A 5LCXA 5HR5A 3ZLUA 4RHTA 3OLVA 3BCSA 2E7ZA 2NNWB 4A6XA 3ST7A 4C6SA 2QY9A 3I6IA 4JI2B 3PFCA 5DGDA 3IRVA 1G41A 1JXOA 3SCZA 3FN4A 4HYEA 3TQOA 5BWOA 3G0HA 1G20E 4WCFC 2BY4A 1MZPA 2Q5HA 3ZOKA 2VT7A 1NXWA 3BORA 1W1UA 1EMDA 3ELUA 3NC4A 4YJDA 1CUDA 4JYZA 3K8YA 4DNPA 5JYDA 4JEMA 1OD6A 4MJ3A 3KSBC 5KTOA 2NU9A 5CGZA 4CR6A 3MRTA 4LV8B 3HFSA 3K0AA 3H05A 1ECLA 1P1FA 1RS0A 3U26A 3J7TA 1Z36A 1IN5A 3PDJA 4IXDA 2HU2A 4HADA 1YJBA 4YRDA 5ANRB 3UHPA 5ARBA 4NZNA 1GG9A 1QHNA 1NE7A 1NVXQ 1TJPB 1XDZA 4WOPA 2YINC 2B5VA 1QMPA 1RWPA 4E5KA 4ENQA 4V0SA 4LRWA 3TJRA 5EFZA 1I6LA 4BAGA 2WKPA 2C9MA 5LA6B 2HBZA 5IM4A 2PL1A 3D6JA 4EJ6A 5DLPA 4N6NA 5F3RA 5BNWA 1Y8QA 5AVUA 3ICCA 2EX1A 5B1EA 1LDYA 2ZTSA 3K0HA 3VA7A 1J8DA 3SC2B 1DJNA 1G1AA 3V32A 4F4DA 3U4MA 5EI5A 3QEMA 4CEIB 4R68A 3AR4A 5SY6A 3IO5A 4EO4A 4ZV4A 1ORHA 1QM5A 1IULA 2B61A 2MWMA 4H7DA 4D8YA 4Y9TA 4E3WA 1WB9A 4D96A 2G72A 1G59A 1H2ZA 4ME6A 4V0LA 2C95A 2CVFA 3STHA 1LX6A 2JD2A 3AESB 2IXFA 4PXYA 4P4UA 1DOHA 2Q1SA 2IYRA 3DCYA 3R4CA 5BR4A 1EK2A 1MGPA 2VA9A 3UJ3X 3QG1A 1ISRA 3DYBA 3HADA 3DNFA 5K6AA 4NF2A 4OG2A 2HIGA 3MLAA 1BZYA 3T3EA 5FWYB 1XF1A 2IWRA 3KDAA 3W2TA 1R15A 3BQNB 4PG7A 3CVOA 3I52A 3NDIA 1U2RA 2Y99A 4MITA 5CNMA 1UK6A 4O5OA 2RGBA 5DCLA 1H4QA 4R1QA 1GQSA 1ESEA 3CH5A 4L72A 2W83A 4DA6A 3KDPA 1O94A 5C31A 3ZE7A 1ZVQA 1KGDA 3GOHA 3HO8A 4IOKA 2IHNA 2R1VA 2WP0A 4L5BA 3ZCXA 4Z1OA 1HDXA 4WXRA 1HOXA 1E5QA 2IZ7A 1ONBA 3TW6A 2VAMA 4ASUD 4S0ZA 5AVOA 4BATA 4BGVA 3C14C 3QVJA 2CMHA 2NPIA 3BXEA 3TO5A 2VJQA 1T6XA 4KQIA 3WK7A 3KSMA 2NVUB 5BT8A 4OMCA 2X9VA 3TSWA 1G60A 1GGEA 3AXSA 1DBVO 1EFHA 2PRSA 4JI3B 3UYKA 1J0AA 3SHQA 2Q5FA 5IAOA 1N0WA 1QHYA 2ZSJA 4CQNA 2QN9A 2G4VA 2Y1CA 5DEIA 3RVSA 5HDQA 3FGZA 1OVMA 5JCZA 1AV6A 1XRMA 1IN1A 4WUTA 4E09A 1BWSA 2FN8A 4MA4A 4WK4B 5LKRA 1D8AA 1RP1A 2PKXA 3OZFA 3GMSA 1RYFA 3F6EX 1DTWB 2H29A 3K0FB 4L5JA 4MWSA 3VO8A 4DE5A 3E7WA 1KHHA 1PZXA 2X8BA 4PFKA 4DAOA 5I7EA 5JI2E 4FSXA 1P1KA 3WGJA 1C9EA 3KQSA 4NBTA 1H6DA 2W71A 3LWNA 4X1KA 3HLYA 3GJ5A 1KWGA 1CJVC 1RQNA 2JS7A 4X24A 2FEKA 2JIZD 1Q0HA 2D4AA 2OV6A 1P3DA 2FZGA 1K4KA 1NBHA 1NLZA 2FZLA 1YZKA 1S3FA 2QLLA 3L0BA 1TT5B 1O9GA 3VYSB 2ISCA 3I04M 4EYQA 1ID8A 4WKGA 3CM0A 3WGGA 1ZI8A 4Y1FA 5AT1A 3WWEA 2W8BB 4ERXA 3T9CA 4A8JC 1U2QA 4WK6A 2JFWA 5DVZA 2J7PD 5FNZA 4CUZA 3UYLA 1QIGA 3ZHZA 2OMKA 3BHNA 2G06A 4B4VA 3EC7A 3NONA 1K98A 3DZIA 3QVOA 3BCHA 4O4IA 5DCYA 4YJHB 1CX9B 1UM9B 2EDAA 4F2HA 3ENNA 1A0OA 2BOVA 3MUFA 4P0TA 3WICA 4OB6A 4C14A 1W5SA 4YHBA 4KQHA 4DABA 2AOUA 4TT8A 3KQUA 1HT3A 1KQ3A 1MABA 1S01A 4JYAB 4CKCA 1ECPA 4RWEA 3WIEA 1ESDA 1O4WA 1JMVA 1NW4A 4ID3A 2Z0MA 1A9OA 1X92A 1PR5A 5BUZA 1KIAA 4E5VA 2R4QA 1A04A 3Q7TA 5B1IA 1NW9B 5IUJC 8ATCA 3H1FA 1IVNA 1G8AA 4H18A 1SZCA 5D86A 2P67A 2ODTX 2IHZA 3LQ2A 3TFQA 4CN8A 4DM3A 3VU9A 4DDTA 5I48A 1B93A 3T4EA 3GBVA 4PR0A 4MS1B 5KHLB 2CLEB 1FUEA 5IH3A 4IIUA 3T99A 2DCUA 1CZUA 1UEIA 4JR2A 1EDZA 1XNJA 3WOHA 3O3MB 4RDHA 3LFHA 2PJDA 5CFQA 1LCIA 3SHWA 3ZBUA 4URYR 4RHXA 2PZ8A 4HMOA 2WHEA 4Y2GA 3LY8A 3ILVA 1OIWA 2IPXA 3NWBA 4P1ZA 2BN4A 3OT4A 3OPYI 4UPVA 1NJ2A 4NH0A 4U63A 3V1KA 4D99A 5EZYA 2DUUA 3LO8A 5G1OA 3CVUA 2GKSA 5SYMA 4YAOA 2ZU6A 1JA9A 1I51A 3W5UA 1P80A 5K0JA 3P9ZA 1Z9BA 1LPNA 3RTCA 4ERNA 4MIEA 2PUBA 2X0IA 4OL0A 1K8RA 1KKUA 4B4UA 3DM9B 8GPBA 5G4KA 3DC7A 3VPHA 4RJ2A 4F38A 4Z7OB 3GEEA 5EJ6A 2IYOA 4KN9S 3PZBA 1ZSVA 3DZKA 1U8UA 2NU7A 7AT1A 1H2BA 1JWAB 3KWFA 1UT5A 2ZUCA 3Q3HA 3SIWA 1JKFA 3AK4A 5FOSA 1HYHA 4TMKA 2B8EA 2FPIB 4LIPD 4BKRA 2P90A 5FBLB 1II8A 4UAVA 4RY2A 4QTXA 2A9OA 3GCZA 5CA1B 3B60A 1CIPA 1GV1A 5DXJA 2ZBGA 2P68A 3KLPX 4FGKA 4Q9JA 2O8VA 2PXCA 2QG4A 1B8UA 3KL2A 4IG9A 3GLGE 1QF6A 3IQZA 1MW9X 1J8VA 1YCGA 4EI9A 3ZV6A 1YI0A 1ZHOA 1NVBA 2WFLB 1WCIB 2JJ8A 1MG5A 3H4MA 4AMYA 3C5HA 2R8YA 4MB2A 1V7PC 3EZFA 1XVUA 4P3OA 1OAOA 2XVZA 1AZSC 3SE7A 1DUIA 2VRNA 3JAWA 3TRKA 5FFFA 4KMRA 4L22A 1ORTA 4QUEA 4BFZA 1KKMA 1Y7HA 3QTLA 2JGDA 4RD0A 5DYNA 4QM7A 3R9IA 3WTBA 1M1UA 2QK4A 3AHIA 4MUYA 4XDYA 1LC0A 3K0KA 2D2IA 3QV1A 3U60B 4HWSA 4RK6A 3L43A 4C6TA 3QP9A 3UATA 1XI2A 1XU9A 2GYYA 3BYZA 1KKLA 5IBQA 1U3TA 3NU1A 3TNYA 4MLDA 1PBTA 2H2AA 3WB2A 1R9JA 3ZX4A 2PBRA 2KPOA 2E89A 4QXRA 5TGTA 3N0XA 3L01A 3LC0A 5AK3A 5T8KA 1HTWA 1GTVA 4XYGA 2ZIGA 3AR3A 3QE2A 5LP6C 2IS4A 1PT5A 3K1AA 4AYWA 4GDFA 1JHOA 1WZNA 3JQGB 2O6HA 4M49A 4LK2A 4KSCA 3RH0A 1IBMB 1R3UA 2N0SA 3QG5A 1A96A 5ALDA 4AS1A 2CZGA 5AM5A 4MB0A 3I01A 1PQWA 2AN3A 2CNOA 2Y1KA 3RNOA 3D0RA 1Q50A 4KVGA 1NQVA 1UKCA 4PG6A 1Y6FA 3V6LA 2JARA 4BJ1A 5TMDA 4FFVA 2ZUUA 3HR7A 4UDNA 1GAEO 2IEYA 3E2IA 1TKAA 3NP9A 1NMQA 2CLDX 1XQYA 3RIYA 1YMQA 4XIJA 4MQEB 5GZ1A 1NPDA 4L0MA 3V4LA 5JYEA 2GM3A 5EG5A 4FYXA 4A16A 2P9FA 1H94A 2FW8A 2C07A 2POCA 5DOZA 2E48A 5EHXA 1YR7A 4HVTA 1KXJA 3N3AC 1YS9A 2CWDA 5AD1A 1ZMBA 4JL6A 1E3LA 3NUZA 2GM9A 2Q6OA 2XF8A 4EHDA 2HF7A 2VK8A 2VHYA 4OJKA 2RHRA 5E4JA 1D2RA 1PL8A 3LUBA 5DF1A 5E6RA 5CDFA 3TQTA 1J0CA 1SXJA 2XOKA 2CK3D 3G85A 3Q9LA 4RMIA 1KYTA 1VPLA 2CJYA 2G08A 1BYUA 4CLOA 1JXQA 1AK9A 3OLYA 2NU8A 3KYDB 1T1JA 1PLJA 2W2XA 1Z7GA 4MYTA 3E03A 3KTAB 2VWPA 3JZAA 1KDPA 1WOMA 1SVUA 2CZQA 4M46A 2C54A 5J63A 1J2JA 4MQ6A 3B3QA 3RK4A 1GU7A 3DE5X 2BAGA 2P30A 1JDZA 5FA5A 2XIQA 3HUDA 1T9BA 2HMVA 2LWIA 1A82A 4OHYA 3CEJA 2QMYA 1JH8A 1QLJA 4L8VA 3AI7A 3CPEA 3GFFA 5KNDD 1G9SA 4O3MA 1IG0A 1H05A 1SOAA 1RMQA 2FUG1 2GEKA 5COBA 2X0RA 1I94B 3C5WP 2F3RA 4ND8A 4NS1A 5ENDA 3NTUA 1L8QA 2NPOA 3HXTA 4QBKA 2JB9A 5LXTA 2XX3A 2F3PA 3RNLA 1JWLA 3OQPA 3ZTYA 4NJMB 4U4AA 3TZBA 4B82A 2NW6A 2Y1XA 1RXUA 1ZNXA 4XJVA 3DA8A 3W5CA 1CR1A 3B3AA 1E3SA 3QELA 2J6IA 3NUQA 2DQYA 4L5CA 5HOQA 3HN6A 2FPXA 4HWRA 3SOZA 3SQWA 1VGQA 1HG1A 1VLHA 2KLHA 3QE3A 5TR9A 3M6AA 1EYZA 3NT5A 3FDIA 3OCWA 4CLHA 3D3EA 1N4AA 5D8DA 4Q6BA 5TT1A 5BUQA 1DS6A 1K7CA 1MJ5A 2X8WA 4HLUA 2KJQA 4C5CA 1G7CA 4R9VA 2REBA 5JH7F 2RH5A 5ITVA 3ELYA 3I5MA 1JNYA 1XWIA 3R09A 4AROA 4ZU1X 1I2MA 1QRSA 5E1BA 2YYZA 3NHKA 1BW9B 1QP8A 4LJYA 3DXFA 1JB1A 1POXA 1V1JA 3N59A 5BYKA 2XWJI 4M9RA 2FW7A 4J94A 3VU8A 2WG0A 4AL4A 2Y1EA 2IT1A 2WWFA 1KI1A 2J32A 5AWFC 4B74A 5U9CA 3V9PA 2IPAB 2ARKA 1GFWA 2WU8A 3CX6A 1KMMA 2CNBA 5BSUA 1CUJA 3KVYA 4BXOB 1W0JA 1FFEA 2NZUG 3OLWA 1XO1A 3AW9A 3BRWD 4MKZA 2Z3VA 1N1EA 1WHSA 4ZAYA 4Y2VA 4RYLA 1Z0KA 4NV3A 1OXKB 4L4YA 4RDXA 2IU3A 3A3NA 2C84A 3P0EA 2IYTA 5KAMA 2KSQA 3CZ5A 1RJWA 4F71A 4Q66C 4OI0A 1GT91 1N7HA 2RHDA 1RJGA 3LQRA 2Q3DA 4ZAFA 4LOKA 1O5OA 2VZLA 1O54A 1PJ3A 1OXUA 3LLVA 4CEIA 1ZUWA 1Y5NA 1SU6A 2TMDA 3CUYA 4ALJA 2ZZKA 4DCNA 1ZJ5A 4I50A 1E69A 3SXJA 1ZY2A 1XN4A 1LRKA 3N05A 1JI3A 2GFQA 1L5YA 2QX8A 3C6ZA 3NM5A 4XARA 3RRBA 4E12A 5MGBA 4B3GA 5IVKA 4TKUB 2LKCA 3AESA 3V42A 5FOWA 1Z62A 2XLCA 4H9GA 2C2ZA 4M7PA 4IVRA 4RGQA 1JQKA 4DW8A 1K6MA 1M7GA 4K87A 1QKKA 2OPBA 4MVYA 6REQB 1C8LA 4ARIA 4P35A 1YC5A 4P82A 5AI0A 3COYA 4HUJA 2WJYA 4GBMA 4H4CA 3RASA 3RIGA 4DN6A 4F04A 1B43A 5F33A 5FWYA 2JIMA 1GGKA 1VKZA 2CBZA 3DAGA 2PQ6A 1FOEB 1FFWA 3OP1A 2QG9A 5AIBA 1SUDA 5FV7A 2FETA 3J80A 1FJGB 1DJQA 1E9CA 3PX3A 5EWLA 3QH4A 1WW3A 4WY8A 4LPSA 2YHBA 5H3LA 3HZHA 5JXIA 2ESRA 2FK8A 1EX1A 4AC9A 4CZ2A 2OSVA 1V8PA 3WGVA 3LKBA 1KFBB 3RIHA 3CLTD 4ENSA 1R10A 5JE8A 1DFIA 2BPOA 4KQCA 2GN2A 4JJKA 1GUZA 2H2IA 1X0VA 2AVDA 2YL2A 3F8WA 3HP1A 4PAOA 5JATA 4YRSA 2ZAMA 4ZCRA 1XMVA 3TRDA 3F8SA 3CKYA 3ZYZA 1ENYA 4DSNA 1IOZA 2V9PA 2ODWA 2DQKA 1OBCA 3WNQA 1OU0A 2UZ4A 1SOVA 4AX8A 2VRBA 3JVIA 2O8CB 3QFCA 3IOEA 4M87A 1V95A 2PX5A 3RFFA 5FEUA 5JJ5A 2REXB 4X6XA 5IM4F 4YEDA 1M83A 1T3LA 2C5HA 2HC9A 1ZD3A 3C0KA 3R3WA 4X6LA 1PSWA 3RVJA 1JU9A 4LOIA 3TIFA 2QVBA 3P0FA 4CMEA 1C9MA 1E4YA 2B25A 3ESXA 3IX7A 3P8ZA 4L08A 3VR4D 2CJWB 2V6GA 3ORFA 5CEFA 1YA6A 1OZ0A 2VDNB 1GEEA 3VFDA 4ZOBA 1NTRA 3PG5A 1MRZA 3D3QA 4R1MA 4C3ZA 4QQRA 2FRVA 4QM6A 5G1PA 1S8NA 1SO8A 3FBGA 5FLEX 2DB3A 5DM60 3ESYA 2ZIVB 3GW8A 1MLDA 4LWOA 4GGMX 4HAIA 2YWCA 3U17A 1Q15A 4Z9AA 1FXWA 5DDIP 1AKRA 1FFSA 3FNQA 2VHQA 3B53X 4V1CI 3CJTA 4IWYA 1A98A 2BTQB 1B73A 3AKEA 4Y6LA 4BNGA 4WSOA 1T91A 2Z43A 4HXEB 4EFNA 4YAKA 3B51X 4B4KA 2WPDD 4QO8A 1X7DA 5H3CA 3CZQA 3GZ4A 3GAAA 4PZ0A 1OYOA 1R5JA 5DN9A 1LZLA 2AF3C 3NVMB 1KY2A 4WMLA 3T1OA 3T95A 4N40A 2PX3A 3MHTA 1BCRB 1SOWA 1F8GA 2BT4A 1AGNA 4YAEA 2UYOA 1VRCA 1Y8RB 1RADA 3X2SA 1VLLA 2OVBA 2IY8A 4IEEA 1EFPB 2XOEA 3WNVA 5CB6A 1NU8A 1V45E 4YUAA 2XXAA 3C15C 4GKJB 3GU3A 3EXHB 3IBYA 1B00A 4Z8YA 3AV3A 4IJQA 2HO4A 3DTNA 3EAQA 3PQ4A 1WMDA 1MAHA 1PG2A 2ATIA 3AU8A 4ZV9A 4ZC8A 4DMLA 3UTDA 4QOHA 2OKCA 3DLTA 2V1XA 1NA5A 2Z5LA 3JQAB 4DKXA 3CTPA 4TTPA 3LQKA 1QR2A 3L6BA 1Q0LA 3PQFA 4RD6A 4DQKA 2NGRA 3VPGA 4EKEA 4OKNA 4Y6QA 1FUUA 1N32B 2X14A 5HJEA 4L9AA 1Z5PA 3V4FA 2GAOA 3OPYB 1JFTA 1P2FA 3U19A 5CRIA 2NZ2A 3FPGA 5JADA 4AIIA 3UFBA 3E81A 4AN0A 3OPNA 5IJ0B 3OPQA 4ZT7A 4EVIA 1A9ZA 1I32A 3F5MA 4B17A 4DR2B 4FWTA 2NO1A 4M54A 4Q5IA 2BHTA 4GH5A 3IOMA 1HSOA 4N7MA 1K6IA 1TYDE 3BRQA 3LXUX 4ND2A 3U3OA 1K8QA 4DQLA 1QRTA 4A92A 2E3JA 2QZSA 2ZI4A 2O1SA 4CM8B 1FYWA 1Z2DA 3LX5A 2OXRA 4WIAA 1C3LA 1L7OA 2OBYA 3E5NA 1KS9A 3MRVA 1G3MA 3GJ4A 3TH5A 5LQRA 3T9FA 1C7EA 1G7TA 5F23A 2H0RA 2YRXA 1ILEA 4IDEA 5BQOA 2I34A 4ZZIA 3ZY4A 2C5EA 5JAHA 4W4TA 1LI5A 1U7ZA 2DRIA 3EGIA 5IAKA 2VSXA 4QPJC 5TVKA 1PZFA 4ZI3A 5JTUA 3HI6A 3RT7A 3WGUA 5AVXA 3ZDYB 4TS4A 2CBGA 3PS9A 5L3SB 3FROA 3OEHD 2Z5FA 1R0KA 3AY6A 3DF9A 3QLJA 5C4GB 3W5DA 2BI4A 2X4GA 4PC3A 5IVIA 3DUWA 1OU4A 1BHO1 4P5EA 3DFZA 1IWOA 1DKMA 2XGGA 4GAEA 3ZZ1A 1WIWA 4ENWA 1SKYE 1EESA 4DHEA 5IJZA 1JPVA 2QTWB 4GT1A 2OCPA 1TNDA 1HZJA 4H7KA 3D8SA 2I3ZA 3PUHA 4M36A 1KU6A 2PGLA 3IDAA 5DHUA 4DYDA 1RFGE 1EVIA 4II7A 3ONEA 3BH6A 4E2FA 3U3DA 4R1UA 1DIAA 1US8B 4PLVA 4X1YB 2WFLA 2ZITA 4HDSB 3HEAA 4BFYA 1P31A 1X7XB 4J0IA 3AB3A 1N6PA 2E55A 4OHCA 5FPYA 1BQ3A 1VCNA 1V1RB 1F5SA 1QB7A 4DBVO 3QVVA 5I45A 3AVVA 3W4IA 1WUIS 3KSDO 1U11A 3AYZB 1IQPA 3KT6A 3UM9A 1IL0A 1OFHA 4NBVA 2YOGA 2C9DA 2ZKLA 3WLKX 1DDIA 1J70A 4NEHB 3INYA 1T36A 3NHRA 2COEA 1AF7A 1JFVA 1LLFA 2P9ZA 3WLNA 5IH7A 1DT3A 4HNSA 3TLZA 5DHTA 5KWSA 1NWCA 2GR9A 4H7HA 3IDQA 4MPJA 1EK1A 4O4JB 1P8JA 2ZZNA 2YZNA 3TQCA 3PC4A 2BUBA 1C1YA 3GZNB 4MO2A 4JJAA 3V4ZA 4UZFA 1U65A 3VDQA 2Q9UA 4AJHA 4DCCA 2VQ3A 4OQNA 1SVMA 3D2BA 1LPBB 2NAFA 1DARA 4NARA 4Q9KA 3ZWMA 2CLHB 5LOVF 4FHFA 5EZ5A 1MJGM 1XTIA 2FWAA 2WRZA 3BWDD 3IVAA 4XPIB 4O25A 4Z99A 3AKZA 1EBBA 2D74A 3MFQA 4GOXA 2DETA 1SURA 2XF2A 1WY7A 2Q45A 2P2SA 4RTKA 1M5RA 1VL2A 4FYIA 5FL7D 4MI9A 1XF9A 2GAFA 3ZJ4A 5I9LA 1XOIA 4LUCA 1XVTA 4AF7A 3CH6A 3VSAA 3BE6A 5IYZF 5FAKA 1Z07A 2X23A 4FGLA 4RZ3A 3JU3A 4ZTBA 4BQIA 1NDQA 5CFNA 3UK0A 3G5AA 3LUPA 2G9QA 4QGFA 1NFRA 1UR5A 2B78A 1ADFA 2V6FA 3IAHA 4IP0A 4DIUA 3QKRB 2DKNA 5JS7A 4F4IA 2YXNA 4A03A 3N87A 3GIDA 1GP2A 5A7HA 1QTIA 5H4HA 2YRFA 3DZGA 2PGXA 4KFTA 1XDBA 3U3RA 3CSSA 3FM9A 1ZC3A 3GLFE 4LF4B 4JLNA 4YRLA 5FPPA 5J2TA 2FPOA 4CTKA 4YP7A 3WLTA 1W4ZA 5LDHA 4Q39A 1SXJE 4MVJG 3RJTA 1L4EA 4P0PB 1JDUA 1KQPA 4ZCLA 1U6IA 4XWTA 1V6CA 2D5AA 4NU0A 2QLFA 3NGLA 2ECPA 3QTBA 1FNNA 1VHLA 1PDOA 1PR6A 3KXKA 3A2KA 3QWBA 3HYLA 3PDWA 3A9WA 3M4NA 2H9AA 3CNEA 3UGTA 1QIDA 2NVWA 4CWAA 1GV0A 3PJDA 4AJOA 4JGBA 5M5BA 4R1TA 1ZICA 1Y81A 1LVHA 4KBFA 4EEXA 4Q34A 4URUR 2JASA 2ZJ8A 3N8HA 1RHQA 2EHDA 2RHBA 3N8KA 2ZRLA 3ZXYA 5FFNA 2HCBA 3K71B 3Q0IA 4HK4A 2E85A 1FRNA 1MD9A 3C3AA 4NDZA 2RJNA 2F67A 4P4NA 3R74A 4RTSA 3ZVKA 1GNQA 1VLVA 5AW2A 4B6FA 2YQ4A 4YDSA 3VR6H 3C8HA 3Q2IA 4PLGA 4HQKA 3GLGB 5FTNA 1KR5A 1Y7LA 2J48A 3IAUA 3C3KA 3K1YA 3TRFA 5I4IA 1UOEA 4KXVA 3K92A 3DVRX 2Y0BA 3T1VA 1P0QA 3B2NA 1M8GA 4WE3A 3K35A 4NICA 5JC1A 1H8ED 1A8HA 3DE4X 3C98A 1X74A 1TQHA 2JATA 1FNBA 2FCAA 1XZGA 3MTJA 3NHAA 5CB8A 1QU3A 3OZEA 1WXHA 3KKZA 3UY4A 4EUNA 3A1EA 3TD9A 3PWZA 1BW9A 1YU6A 3ZE1B 4CN9A 1SEPA 4CM9D 3O3CA 1TXGA 1Y37A 3EWSA 4L74A 5EJAA 1NI3A 4GWKA 5MN5A 3AP1A 3KOUA 2Q6TA 1ZOIA 1IWPB 1NBOA 2OENG 3Q87B 2VUSA 2CFSA 1ICIA 1BX3A 1Y7TA 3JALB 5CU7A 2QNIA 1O6CA 4BXOA 4IVQA 2CV2A 2OA0A 3CCBA 2XYRA 2KLBA 1DMRA 1E89A 3CLHA 1YB4A 3GAFA 1VG0B 2C5LA 3QPVA 4JV5B 3HVKA 3NHSA 2F8MA 5E4YA 5I51A 2VPIA 3KPYA 5F7ZA 4ZI7A 5KC9A 1MFPA 1O6ZA 2OC9A 2B7BA 1P7YA 5IJXA 1B6GA 1HQDA 1N3BA 5IAGA 5EKUA 4YUVA 4RU1A 2JI9A 1KJQA 4KVZA 2DR0A 2EZ9A 2XLBA 4NCJA 3SD7A 5I8PA 5ICEA 1KMCA 3FZGA 3DYIA 4DLAA 4RK5A 3IV6A 4S0XA 2WB2A 1ZQ1A 1SFRA 5GINE 3VBCA 2XUHA 3MJSA 1WU8A 3G0BA 4UBLA 1U2DC 1KAHA 4AUKA 5KTNA 4TKUA 2W2OA 3H87A 3LO5A 4TV8F 4C2TA 2XRFA 3D7NA 2EV9A 2PX2A 3CVVA 2VDPB 3PNSA 2BBTA 3E22A 2DCMA 3TQIA 4ZKDA 3UH0A 1FVOA 5CVJA 3W1EA 2AYYA 1OWLA 4RA6A 1R12A 3B6MA 3EHDA 3U4DA 1ELOA 4NCXA 1F8XA 4AJKA 5IJ9B 1M67A 3E48A 1G6Q1 2Z2YA 4LDQA 5F64A 5EZQA 2GZMA 3G2IA 2YY7A 2FPPA 3T3NA 4JGGA 2XMRA 3HZRA 4WEOA 3ADDA 2IEBA 1MOSA 3CRQA 1CVIA 4IJWA 4JQZA 2J3QA 1CB7A 3NUGA 2A9VA 3DXYA 4BRSA 3HNOA 2XUGA 4M9CA 1AH2A 2DSTA 4LY3A 2YC2C 1Z25A 4DR4B 2YVQA 2D0IA 4J0KA 5K0NA 1JRLA 2H51A 3HYRA 4HEHA 1NIJA 1YZGA 4IOJA 4J9VA 4QJBA 1VIVA 5L95A 3THXB 2J9FA 4U7PB 2PEYA 4F86A 1NOKA 1SCUB 2NMVA 2FSVA 1ENOA 4Q4JB 1LUAA 1GZ4A 1P3JA 3NEJA 3L6DA 1FX0B 2F1IA 3MJVA 5ALQA 4R54A 1GGMA 2PH1A 3VVCA 5A1TA 1S2OA 3C2QA 5KTRA 1ONNA 2PS1A 5LA6F 5GZ3A 3WHIA 4ROTA 2HW8A 4IDOA 3I73A 5DM1A 3RHSA 2DBZA 3I01M 2PD6A 4OJTA 4NBKA 3JQFA 2BD0A 2FX2A 2IS6A 1PEKE 5JXJA 4JH0A 2XTJA 4DTIA 2IZZA 5ALLA 5D6OA 2WVJA 3C3YA 1GJRA 3EW7A 1YQQA 3JR3A 2QPLA 5DHQA 1NG9A 4BB6A 3B5IA 2P4SA 4G5SA 4P7BA 2VCEA 3HEBA 1ML3A 5FUBA 3NV7A 2PUGA 1LD3A 3G7UA 2WSSD 3OQ1A 2AFIA 2LDBA 2OY0A 2GCOA 5AW9A 3W2HA 2FDRA 1V8FA 1R8JA 4MW2A 4O0LA 3PCXA 2C7PA 4BX2A 1ZIXA 3EA0A 2RHLA 3VZPA 5KYYB 3WK8A 4DVGA 3CF0A 3GJSA 4FOPA 2R65A 4MW7A 4JHXA 5HRAA 4UNSA 3SBEA 4O8CA 4OB7A 3HDYA 3BB3A 5MFPA 4OCZA 2JGJA 5CLHA 1NASA 4EYEA 2GVZC 3DKPA 4N1AA 3ZWKA 4EY8A 5C1PA 1OFUX 1UT8A 3RYCA 2C57A 3PX7A 2RSLA 2OCXA 1DSSG 1R9NA 1CUCA 1Y8RA 3JWGA 4ZQGA 3ZCSA 1TIBA 3DEZA 4QWMA 3M2PA 1NOJA 3AQ4A 5K0EA 1B0UA 1STOA 3G2KA 1KP9A 4I6GA 2OCLA 4TMZA 1JBQA 1G8HA 1OX4B 3TDKA 5IDXA 3U5ZB 2AZDA 3MF4A 4IOLA 3GJ0A 1PW5A 1XZMA 4IXTA 4KPGA 4L75A 5CIQA 1J0XO 4RMJA 3DMPA 1YR1A 4EB6B 1SBTA 2C4TA 3ZE6A 1KZ7B 3OJCA 2DFPA 3QX8A 4PU0A 2HRDA 4M53A 3QEAZ 3EZXA 2WWHA 2YHUA 4KLNA 3R4VA 4ENRA 5B12A 5K09A 3HXPA 1KI6B 5AI6A 3VR6A 2BP7B 1BG6A 2XY4A 3GEPA 4DF3A 4E32A 5DSXA 2DBVO 4TMFA 2W37A 3A3YA 2GK3A 2J6CA 3T5BA 2AJBA 1OXXK 3JQ7B 4WFKA 2I6XA 4IUDS 3AF4A 1DKUA 3H6KA 3I39X 1KDTA 2ZFUA 4KPEC 5FBVB 1E58A 2QPAA 2ZYIA 4OXXA 1WZUA 2GJ8A 3M4ZA 5TPWB 3AIOA 2NP7A 3DOHA 3VUEA 3SM9A 3VNUA 5B1DA 3AX6A 1XDGA 1QYVA 4XYLA 4D0SA 1PNQA 3GDHA 3P4UA 4OBWA 1DBWA 4Y2QA 4HDNA 2OCGA 3EDQA 5DHRA 3GNQA 4R3WA 4ZCTA 3ZUGA 1J9EA 2H8KA 2G4CA 2CXRA 2WIAA 1KEVA 2LCFA 2ZYRA 3HB9A 3KOXA 2KBFA 1GXSB 1DQYA 3OM9A 4MRSA 3HLKA 4H27A 1HDRA 2ST1A 4B3MB 3M1AA 4EM6A 4RHCA 3R6TA 1ONSA 2I2AA 3GFRA 3L41A 3PPIA 4C0LA 2AIRA 1KZ4A 5L3SA 1NVKA 3BN3A 4PHHA 1EHYA 3FVVA 5BRJA 1I4OA 1HE3A 1QUFA 2NQTA 3GQBB 3OZVA 3VVLA 3WLRA 4DLVA 1D7AA 1W4RA 2ZIEA 3ECCA 4NI5A 3BTVA 4FN5A 5REQB 5JZMA 2QL5A 2BFDB 4FMPA 3PFFA 4L50A 1C1HA 4PG5A 1EE9A 1QE5A 1YE5A 4BIMA 5A4FS 1YR9A 1HE5A 2X7XA 4XUCA 4ZHQB 4K1LA 1LK0A 2A9QA 1O95C 2F90A 2AK3A 2V3VA 4IILA 1US8A 4XGQA 1Z5VA 4X1YA 1IUOA 1SBQA 4HDSA 4ZDWA 2RK4A 4N12A 4CQLA 4DSAA 1X7XA 3STWA 4B8WA 2CNLA 4ALNA 4YUXA 1O8CA 1TC2A 1I01A 1V1RA 2VSOA 2Q3HA 3L7NA 2I87A 2MTBA 4KAXA 2JIDA 2ZB2A 4N9QA 4ZV7A 1USVA 4U8HA 2JC3A 5GGXA 1OGYA 3IPYA 4N01A 1IJBA 1GNSA 1T3GA 1ZNWA 4YCDA 1W5AA 2R0QC 1WDTA 4ZWNA 1E77A 3UJCA 4GXNA 4XX0B 4Y2JA 2IOQA 1GOTA 2I2WA 2CLIB 4PCAA 4TVBA 1T29A 1A9TA 1PK7A 2AMJA 2P35A 3QSGA 4NBLA 3MWDA 1XNQB 1VLQA 1TO1E 2AQ8A 4DWVA 2O7SA 1DQRA 2AC2A 4P38A 5CVEA 5E6UA 1GLGA 5FA8A 2XQKA 3CLRD 3WXBA 4O4JA 1LRLA 5H0IA 5IT9A 3ADBA 3C8ZA 1WKBA 4BNXA 1ANKA 1P61B 4UHKA 3T3IA 1Q57A 4D46A 3NCTA 1IWBB 2IVZA 2P9BA 3E9CA 3QVKA 5F1PA 3G9UA 5KYKA 3TSOA 2PX4A 4G2NA 3I23A 3HVRA 2D4HA 3D3NA 3H04A 5EFOA 4HEJA 2XMSA 3C7CB 4GXTA 4K2HA 1A8SA 3OMWA 3WFJA 3B3GA 3GN2A 4UJ3A 3K9LA 4UDOA 3TPCA 1LA2A 2VOEA 2WAYA 4I4TB 5KX5B 2R6FA 3QFSA 1BRTA 4OV6B 5I5EA 3I9MA 1QJ4A 4M9UA 2IX3A 3LWBA 4TUYA 1RJ9B 1OLUA 2H6EA 3CLSD 2I4NA 3OX2A 3F7TA 3RUAA 4QTTB 1S8AA 1OY1A 1P2TA 2V6JA 5CA1F 1AKEA 3Q15C 4TVKA 3EFHA 4XTCS 1KYVA 4PNZA 1ZM3A 4YRNA 2H54A 4K6MA 4BGEA 4ZTUB 1GAXA 5L6MB 1ZIDA 1GFIA 2JFZA 4GWGA 3EEFA 3QKRA 1L1QA 1Q0ZA 3UK2A 4BWYA 1TUBB 2YXPX 4ZOAA 4KR2A 4N7BA 2IXBA 2XT6A 1GZ5A 2DP4E 4MWOA 4PR3A 4C0JA 4UXJA 2YWDA 2XT0A 3MUEA 4UHDA 2VH2A 5JLJA 4KL8S 1YI8A 1YJQA 4Q12A 3TL6A 4EHBA 3CG0A 4JLAA 2XH8A 4Q3NA 4WTOA 3H2KA 4X00A 1TTHA 3RWOA 5B6JA 2O2SA 1UPXA 1G2IA 4F1JA 3WNZA 4M8NE 5TQJA 2OBBA 5A4AA 1RLIA 3OJEA 4II2A 4AMZA 5A02A 1UBJS 2J3EA 3G3EA 2YJ5A 4I2NA 3B8EA 2HRRA 4B6JA 1PZHA 1CUEA 2GN9A 1J0EA 4E08A 4Y3UA 2PJRA 4KVAA 1PUJA 3U81A 3EJ6A 1AKUA 2EBHX 5BSRA 4IJ5A 4BX0A 3HB0A 1FDRA 1OWNA 4R1SA 4TS9A 5E3IA 3HA5A 2J0UB 1F14A 5IK2A 5HQ3B 3T7JA 2QIPA 4ZQBA 3RS3A 1OC4A 2VJMB 3MBKA 2JLQA 5B7NA 4NENA 2X4IA 4CHTA 5JD4A 1SCQA 3OPXA 1F3LA 2ZR9A 2MU1A 2QQEA 1QRRA 2WD9A 1TUEA 3EFOB 3OU6A 4MP3A 1SKYB 2BMWA 3BILA 4NBUA 5CG1A 3CVJA 4NJEA 1E61A 3UK1A 1OOEA 1K6EA 4FT2A 1N2IA 4ESEA 1XV5A 2X0KA 4Q3CA 4V0ME 3E58A 1VG9B 1SQ5A 4LWZA 4TWIA 5JS2A 4ZEVA 3T54A 1IY0A 3CKKA 2FX5A 3TQQA 2HV9A 1U3UA 5TX7A 3TIIA 3EXIA 3UN1A 3VKVA 2CNNA 2FG7C 2FU5C 4K8OA 3KQMA 4R8LA 3HWSA 1FFXB 4Y9RA 4A36A 5ADUS 2ORWA 621PA 3PJFA 1J5XA 3WDMA 4UEQA 4DV7B 1JW9B 3NHMA 4K9SA 3UAYA 3LVQE 3FYCA 5KQSA 5CW1A 1S4QA 3F3YA 3EEOA 1LXCA 5IKMA 4KFUA 2JKVA 1S5PA 1HDEA 3NGXA 4AI6A 1NF8A 4YDHB 3NHYA 5LZ4A 4QU0A 4YRCA 1Z7WA 2SNIE 1M3SA 4IMRA 4XUGB 5JAZA 3SG0A 1X8XA 3PUWA 1NYTA 1P91A 4MKRA 5TVGA 3GC6A 5KTMA 1UBOS 1XCPA 1GGJA 2I7DA 1XLTA 3DOFA 4G56A 1X8KA 1XDSA 2CDAA 1EFUA 4DLSA 5AQEA 4P8RA 5EEGA 1N1GA 2V7GA 2VF4X 3RU3A 3CF2A 4W5JA 4HXYA 4MPTA 1OWMA 3UT6A 2P8SA 1TM5E 3A9TA 2FXVA 3NYQA 1CR4A 4M60A 1XYVA 5J1TB 5K7SA 4K86A 3PV0A 4FGJA 1VL6A 4RSHA 1MVOA 2XMZA 4KH1A 5HKLA 4DR5B 4AJ9A 4I9FA 1C30A 4OQQA 4G0VA 2JLSA 5B53A 4C4RA 5FA6A 3LM8A 3OF5A 1X80B 4TXJA 1C0LA 3LAWA 1YA8A 4RAQA 3A3OA 3JQ8A 4PW0A 5K6RA 3PHBE 1CSEE 2EFYA 2YJZA 4J1SA 2JBAB 3IB6A 1HE4A 4KO2S 4LHYA 3L7BA 4E0BA 4QDUA 3DTTA 4TTJA 1VKRA 5CGQB 1XTQA 3VGPA 5A9SB 3S28A 3ZDAA 1Z0UA 2HEGA 4P4TA 3TLMA 4K9OA 4C0KA 2CLKB 3NTQA 3AFNA 1GSHA 3MJ4A 1YZ3A 4JR1A 3SMQA 2ET6A 2DOKA 3MPUA 2WJGA 1PL6A 5K3BA 3PXGA 2Y67A 2CLFB 2B35A 2D00A 3I34X 2JCYA 3BSYA 1PNOA 3NW9A 3OAAD 4WVLA 4XR9A 1NQAO 2BGRA 2F7SA 2W8ZA 2ZYAA 3M70A 4I0WB 4IUBS 1VE6A 5BW8A 2ETVA 3IPLA 4JWKA 5IJ9A 2IHVA 3UUGA 4RQBA 3OJXA 4XOUA 3ZDFA 4EABA 1QS0B 3OJ0A 4HV4A 5DI3A 2JFGA 4P3PA 4Y2UA 1M6EX 1LBEA 3BIOA 2RGCA 3L7OA 1WXEA 4QXMA 3V8PA 1P0PA 2GWRA 1NX9A 4YC7A 3CUKA 3KBBA 1Q0SA 2BRUC 3VNBA 2D8MA 4YJ3F 3C7DB 1T1RA 2HRCA 13PKA 3KB1A 4UNIA 4JP1A 4F5WA 3JS5A 3EXEB 1Z8FA 4ZO7A 1XZQA 1TK2A 1M2WA 3CT6A 2XADA 2ZPUA 2KS6A 3L8HA 1U2TA 3RRMA 4BWGA 4OLHA 1V41E 3T0IA 4ER7A 4EF6A 2O50A 4AP6A 1GADO 2VBFA 3PYLA 4Q4JA 3UMBA 4RX1A 3L3BA 3WKAA 4FEGA 4O2AB 3QUAA 1KE2A 1D4FA 1ULTA 3FMGA 1EXWA 3C3PA 5K45A 3GX1A 2R2AA 4NMHA 4DRXA 1NJ6A 5DBIA 4MGZR 4O1HA 2ECKA 1K9VF 4FEYA 4NNJA 3GLHA 3K9CA 1HFKA 1C14A 1V6AA 3VOAA 1TK3A 2HHAA 2ZDHA 3Q9NA 3BXOA 2VBCA 2YVAA 4QRHA 2OQRA 4Q3DA 3FUWA 5IN4A 2C7RA 1NBWB 1QGUB 2ID4A 2VUHB 4HDQB 1J8FA 1L4KA 4CVNA 4CIVA 2H1CA 1C8BA 2IODA 3CRNA 3DAOA 4FI3F 1QANA 4LC9A 4DS3A 2W42A 4OU4A 2X5NA 4XDGA 2MSEB 1B1CA 3ONVA 2AJ8A 3NORA 3RSCA 1MJNA 1UQTA 4I4IA 1RXYA 5JPIA 4G36A 3BCUA 5DX8A 3C39A 1YR2A 3MWYW 5CEJA 3PKJA 4ZT5A 7MHTA 1KRWA 4LE1A 4S24A 3KRTA 1QF7A 2WSYB 3MMZA 5BP7A 2FPSA 4ABTA 4CMCA 2VDWB 1OI4A 3F6CA 3FPBA 1TJNA 3I3OA 3IP6A 4HB0A 4PGGA 2JEZA 2WIBA 2J87A 3KL4A 2COKA 4D5EA 2QWXA 3S4YA 4QULA 3S6JA 1UXJA 1USKA 3G0OA 1YZVA 5JAOA 4GM0A 2AFIE 4QFBA 4G9BA 4BU0A 3DXZA 3UJ9A 3UK7A 1KI8A 1ECCA 4RVFA 4LDZA 5T4HA 1R4NB 3I62A 3BD8A 1W96A 4YMIA 3A1NA 5ELXA 3CXUA 2JJ2A 1A50B 1D5WA 1UM8A 2DUJA 2VQDA 4JXKA 5IKXA 3A06A 2R48A 4QYIA 3UFXB 3ZGXA 1X9HA 4WH0A 4BNDB 3RSOA 2XEXA 1OX4A 4OJNA 2HK9A 4JC0A 3TN7A 3WDLA 4TQ9A 3L49A 1Z2PX 4GBJA 3IBTA 4AUEA 4KDCA 4P3XA 4GRAA 1V37A 4DLRA 2VPXA 3AL2A 3MJHA 2PLNA 1D5CA 5CP8A 2VS1A 3NYWA 2VG8A 2C61A 1LNSA 3ASVA 3F97A 3R0ZA 4C1BA 4YX9A 5JY6A 5HZKA 2HWKA 3MCWA 4MUIA 1CDZA 1U3FA 2JVKA 3VZBA 4LJ8A 2BMAA 4MHTA 4L2IB 2BP7A 4JLOA 3MLEA 3P0IA 4LXTA 3EOZA 1KPIA 4K6HA 4V0QA 1GL3A 1UWVA 4A0FA 5JS6A 2PYZA 1MAVA 4P9NA 1FRVA 3VC7A 1T0JB 3FMIA 1X1RA 3I5UA 5KJ6A 4AXXA 1KVTA 1ZQ9A 1ZU5A 1NVFA 4GL2A 1O0CA 1VHDA 4B7UA 4S1PA 1MC1A 2D7JA 3IKMB 1RMYA 1TJ5A 1PR0A 1EVLA 2R1TA 5EP4A 4AK9A 3D64A 3MB5A 2VYVD 3ZXSA 1CYDA 3K9FC 3AUXA 1XTZA 3Q7SA 5ALRA 5TPWA 5AM3A 4LYAA 3WV5A 2FDCA 5KJ1A 1VSVA 2A58A 5LQKA 2ZPAA 1Y63A 1HDYA 4BLUA 1O94D 4WI1A 1FNCA 2P3OA 1KJWA 4MLCA 4D43A 2Z09A 1YQXA 2I3DA 1TJ4A 4ENPA 5CB4A 3O8NA 1QVAA 2CEKA 4NNOA 2QW0X 3FOWA 3T1TA 2ZRNA 4TTSA 1GXSA 5ALKA 2XMCA 1UJ2A 1OW3B 1BMFA 3O03A 3TXXA 5CLJA 4R2WA 1E9AA 1K5PA 1I2ZA 2ZJ7A 2FMUA 2W2TA 3O1JC 4GFDA 4PICA 5DYWA 4F3YA 4O59O 1CLEA 2H5LA 2HJHA 1BEUB 1N5RA 2R84A 3IODA 3U13A 1K7YA 1L1RA 3I64A 4FGUA 5DTRA 1R0WA 3UJ8A 2X9GA 5CB0A 3RTDA 4M9QA 1PQUA 2BFDA 2W6PA 3OZTA 1KJZA 2W90A 4D92A 3SEFA 4F06A 4YV0A 5BN5A 5BSGA 5A2QA 2Q4RA 3UOAB 1JEAA 2I6FA 4DPMA 1NBMA 4Q93A 5A3JA 1CP2A 2Y6UA 4KX3A 1MO4A 1TF7A 4LJ9A 5LMNB 3PFKA 1WBJB 4AN4A 3PEWA 3M6MD 3DFIA 4I1PA 2E5WA 1K5DA 4W63A 3KKKA 4DPKA 3FTQA 3ID6C 4PE5B 3QHQA 1PYDA 2ZRFA 1HORA 4QIHA 2WWGA 1U2SA 2ILVA 1V4VA 3SWWA 4S35A 4AJ4A 2O07A 3DWFA 3QPDA 4G4SO 2C8KA 4AUNA 5BN3B 5BSVA 2ZB8A 4REOA 3KUXA 2JI6A 4E5NA 1PRYA 2JHPA 2W6JD 2IHYA 1HE2A 1EVJA 5IUNC 5T5QA 5AI9A 3UKJA 3DBLB 4OLJA 1VJ1A 3LIPA 1NNI1 4GEGA 1RAHA 2FPRA 4NSNA 1O6GA 4FDVA 4AVYA 5B64A 4C88A 2X4LA 4UQOA 3DHYA 4XUEA 1TJ3A 4LSMA 2WU1A 2G88A 1M66A 1K8XB 5EQJB 1T3TA 4PPFA 4R9NA 1JL3A 3PQ6A 1G3RA 2KQUA 4D56A 1G8KA 1U7OA 5AVSA 1QG6A 4ZVKA 3R3SA 3ZKWB 3EVDA 4QQ8A 3SK0A 2BHSA 4BL5A 1LI4A 1QH1A 1Q2UA 1SIWA 3EIHA 4JS0A 5TV2A 3RVPA 2B20A 2PKQO 4HWPA 1G98A 3S44A 2IWHA 3QPCA 5ES4B 2QDKA 3UW1A 1BS1A 2KWIA 1D09A 3T41A 3VH4A 3ZVRA 4QAQA 1GVNB 3R9XB 4JROA 2P9HA 4F7DA 5BVHA 1O8BA 2P27A 3M89A 4TM8A 2P8JA 2X1VA 3JAMA 2C7QA 4PG8A 3L06A 3HKBA 3JX9A 1L6RA 1VL0A 4HAOA 2H17A 4QVGA 4G0XA 3RQIA 3WNBA 5I7RA 1U28A 3UCFA 4I4TA 5KX5A 4Z51A 3ZE9A 5L3QA 4B4OA 5IBPA 1Y4UA 4Y6PA 1T9KA 5B7PA 1KMHB 1DIGA 2B1IA 2E82A 4BRZA 2WTBA 3OA0A 4RH1A 3PQEA 3HA7A 2N3ZA 5D85A 3BMQB 1VP9A 2VP4A 3B82A 4GRDA 5F78A 3GRVA 5DN6D 3K5IA 3BWCA 1OBOA 2F3QA 2DQSA 2VJNA 5HE8A 3UXEA 2R97A 3OCCA 2F48A 3UW3A 4L4XA 4EGQA 4H15A 2XYVA 4LVOA 2W6OA 1ZM2A 3PB3A 4FR0A 4UKDA 3AZOA 1H4SA 3C3XA 4XR4A 3KWMA 3DKRA 4P32A 1ZK2A 5E7MA 4JMPA 4EA9A 4M0FA 4Z86A 2I1LA 4Z49A 1CJTC 4ZFNA 5EEHA 1O0SA 3M3HA 3RPEA 1AURA 2GFHA 1NBIA 4IMJB 1KS2A 4X45A 1E2QA 3W2IA 2UVQA 4EO7A 2GTIA 3B52X 4MW4A 1MRSA 1EH5A 2F6RA 3ISJA 3R2JA 1IXYA 2N1MA 2UVPB 3PF9A 2HADA 1DAMA 1UBMS 1GL6A 4QD3A 2WV9A 5CXUA 5BSEA 4NZ9A 3K70D 1GD1O 3N2KA 3D6MA 1N34B 1AN9A 2YWBA 3U44B 5PGMA 3O7WA 4R4JA 5FX2A 2OCIA 4NAUA 1W87A 5TQ0B 1XXLA 1YQTA 1QV6A 4XH9B 3EIXA 5CTAA 2JFUA 5IJAA 3KZOA 3OG9A 2GDZA 1K89A 1UJMA 1SD1A 3FYTA 1DUVG 2QM3A 3NBZC 1GQFA 1M1NB 4LDPA 3TTTA 4RH3A 3H84A 3IV9A 1V4BA 4UXHA 4Z4EA 3WWZA 4IQ8A 1A69A 1BAPA 3O8BA 1A4XA 4JNCA 4MARA 1J07A 3C74A 4XIFA 4CUKA 2NVOA 2WHPB 5SICE 2YS6A 1HNNA 1R5BA 3EFOA 4Q37A 5HKAA 3H9EO 3LX4A 3OHMA 4Q05A 4B7CA 1ZUNA 3K8QA 2PMCA 5JT1A 4KXLA 1XA4A 5AOCA 1Y6JA 2GYWA 2YFHA 4IGKA 1SVSA 2CE7A 2Y9MB 3ETHA 3KXLA 4PIPA 1ONOA 2B7LA 3R24A 1Z45A 4PAWA 4QU8A 3WGHA 4EMSA 5IHXA 4OFXA 3ZV3A 2O7NA 2PEZA 2Q07A 2Q1UA 1BXRB 3LT5A 1VSQA 2PXHA 3GQVA 1D6SA 3IP9A 4FOLA 4PTYA 2BFMA 1FFXA 4H3VA 2J3HA 5A5DA 1M75A 1PWYE 3HCWA 1AKNA 4J7XA 3UK6A 2NO0A 3ZQKA 1QLHA 4GMDA 4RV5A 7GPBA 1NN0A 2ATCA 2QE7A 5GP1A 3OLCX 4ZAWA 4BVAA 1RHMA 4F9EA 4EYOA 3A6GA 1H0HA 2QGZA 4JJGA 5TQ2B 1XEWX 5K0CA 3V97A 5BNZA 3R0IA 5DM70 4ZRNA 5H68A 3U09A 2JHFA 2Q3LA 1JEQB 2J6BA 4PFQA 5HJ5A 1KI7A 5JU6A 4MQ4A 4TLMB 4ZJUA 1E2IA 2VLIA 1PS8A 4Q19A 5JSYA 4EEKA 1VIYA 1XLUA 3KYIB 4B9EA 1HH4A 1KO5A 5A1JA 1ZAYA 2BWJA 4GUDA 2GZHA 4L8GA 2OFXA 1OCEA 3AOGA 1P4HA 3DZDA 3HMKA 1OXMA 3W1WA 3UWMA 5KNCH 1Z08A 3GDFA 1V16A 4GMGA 2GBLA 2R9VA 4AZTA 1XZLA 4RPLA 3E7FA 4KNYA 2WQ7A 4RVGA 1EZ1A 3AT1A 1NY6A 1UZAA 4RC9A 2HTEA 4JQSA 1RQPA 2GBIA 1L5SA 4WLEA 4B80A 3U1TA 2R1ZA 1BJRE 4DMUB 4CF6A 1S1CA 1FF9A 1FP4B 3EGXA 1PNRA 5EGNA 4R2IA 3A70A 4F2GA 3RREA 2A88A 3BD7A 2EW8A 4NCIA 4RHYA 2V9ZA 2YWHA 3DE1X 3ZDDA 1QHHA 1V43A 1FE8A 2EIHA 1OFGA 3LVRE 3PUZA 3QVUA 3VPFA 3ZW8A 4EEZA 2QBYA 5F1YA 2IXTA 4BKMA 2I1VB 3RRYA 3DWIA 1NYLA 4ISBA 1OBVA 1TI7A 3ZD6A 5GOTA 3F5DA 3JAKB 3EQ8A 1NVDA 4C76A 1QV9A 1FBTA 2OV1A 2H7CA 2J30A 1SXJD 2XOKD 1QPZA 1B1AA 1DXQA 4OU5A 4F0JA 2PJUA 5EHIA 3F6PA 3CV3A 1N3LA 5G3YA 1L6IA 1I30A 4CM1A 5LB2A 2ZKIA 3ABSB 3MB8A 2II6A 1MXFA 1GDDA 1JJFA 3BK7A 2ZCUA 3DT6A 2C4HA 3EGOA 2AQIA 3IMEA 4MQUA 3LUHA 4WACA 4ACBA 5JAMA 4DA7A 1GL9B 4YRAA 4CDMA 3QX3A 3C6QA 4XM2A 1I6WA 2PH7A 5L51A 5ALPA 1G7RA 3WKCA 2R8RA 5SZIA 1O5TA 3A36A 2V8OA 3ES9A 2HMYB 4A9AA 5IT0A 4D1YA 1IZYA 2W2LA 4Q3EA 5JPCA 2PX8A 4MUKA 1L5HB 4RELA 3E18A 3HO6A 2C5BA 2VTVA 4URZR 2OQ2A 1H0RA 3BM5A 5ALEA 2ZR8A 1EX7A 1U2EA 3VO9A 2WNIA 3CF6R 3ZWOA 3T7AA 4HQNA 1SQSA 3AY3A 2B9EA 4RK4A 4W9NC 5G0SA 4TVSA 1IRIA 1MZVA 4KZKA 4YYEA 4P86A 5E2IA 1KJJA 2DLCX 3T5MA 2OHJA 3USCS 1V47A 5B3LA 5A06A 1Q3TA 2Q3FA 5EHQA 2QUZA 1R6UA 4NYMQ 3S40A 3NNNA 2ZUSA 4EZBA 5ECWA 4AYXA 1ZYUA 3FYUB 4Y30A 3KETA 1AKVA 2IYXA 1TEHA 4LF7B 3V2UA 3G5LA 4MW9A 3NG1A 3U7HB 3MT9A 4HGOA 4TLBA 1NLFA 3GL9A 2AW3A 3GLHE 521PA 3SZMA 2QTMA 3AR2A 4BMCA 1CZKA 1TMOA 2I76A 1N5IA 3H2BA 5I7UA 2IZ5A 3PGMA 2QU7A 3NJ4A 1VCIA 3AB7A 3C1AA 3KE8A 1EU1A 3HM9A 5HZHA 4RMHA 3SKVA 1RC1A 1ZRMA 4JI8B 1BXZA 3OM0A 4A91A 2RH9B 3J7AC 3WWCA 3COSA 3T6KA 4ARVA 4OXKA 4RYDA 2J85A 3UKDA 5CFOA 1DEOA 3TD2A 3PTAA 1VKOA 2VDWA 4XUDA 4K05A 1CUYA 3KOZA 3VBEA 3THYA 2RGUA 4LMBA 5FQOA 2NTJA 2XVYA 1XZAA 1BOOA 2R8OA 3GELA 4BO6A 3CLTC 1BH2A 1P39A 4UBIA 2IP1A 1DGQA 1SEVA 2OWDA 3JQRA 4A7PA 1R4NA 1T3HA 1UKZA 1X8LA 5KYUA 3X1MA 1KC3A 2V5AA 1U80A 2H2HA 3NAZA 3ZIDA 1CV2A 1JXMA 5EMLA 3VJLA 3V7UA 4F4JA 5C81A 1RDFA 3CF4A 1WTCA 4CODB 2X0JA 1JT2A 1H23A 1IOLA 4EG0A 4OK5A 4BEJA 3UB2A 2IYQA 3RUPA 2Z04A 2PNJA 1BU8A 1Q74A 2WABA 4EKGA 4HS9A 4E88A 3EZ9A 5JNWA 3A4LA 1JZTA 1Z7YA 2OM6A 2AN9A 2I67A 2VCHA 1HY3A 1TD9A 2AC7A 1QFXA 3GMDA 5JY1A 1DX6A 4CQJA 3K2IA 3LZCA 1GPLA 1OIXA 1F4VA 3RG8A 4Z5XA 5KYTA 4FJ0A 1XPRA 4L2IA 1QBKC 2JDID 2VSFA 4YMSA 3WGYA 2IX9A 4Q1DA 4JJZA 1K08A 2GHRA 4ZEOA 1KZ9A 4XE5A 1CTQA 1RPZA 2AI1A 1SHTX 4C4ZA 3PD1A 2HZ7A 1AUOA 2HDWA 3NBUA 3R6LA 1JR3A 1ULSA 4LXGA 5IZ4A 2BEVB 3C16C 1GNPA 2O5VA 2W00A 5BY2A 4G0WA 4NYJQ 2BKLA 3UOGA 3P71T 4V3CA 1HRKA 2QN2A 5JIBA 2QLJA 4U2EA 2JFXA 2CDNA 4JK3A 2CDCA 1T2FA 2HF9A 3UEOA 1WUYA 2GZSA 1O97C 2GBPA 1TAGA 3P9SA 3PXAA 1XAHA 4NR0A 4WCFB 1Z6QA 1UP6A 2PMFA 4GEKA 3ZIAA 4V0OA 4EHHA 3WGIA 4OM8A 4RL6A 2IYSA 2J3IA 4B09A 3S1AB 4MJLA 3TKYA 2G1AA 3QWHA 3V3TA 2D5CA 3E05A 4G0MA 1WP4A 4IFTA 4Y6SA 4AMVA 4F3KA 3LSTA 5IP5A 2R66A 1Y1QA 4MKHA 4YMHA 2PVSA 1Y6GA 1ZHFA 4C08A 1ZINA 1NOIA 2NADA 5JOQA 3PITA 2W22A 3A1TA 2VJAA 5KNCA 1X42A 1BKYA 5T64A 4X1IA 4KR9A 1S8OA 4R1PA 3UMFA 2ZETA 3ENWA 5ESRA 5ALNA 3JYPA 3CN9A 2VFAA 3H5AA 3RFUA 4CKWA 3UPDA 3WL5A 2GT1A 3KJHA 4WFJA 3K5HA 4CFYA 2F43B 2EP8A 4MUBA 4MAFA 1Q1NA 3MJEA 1UPUA 2VHCA 3IT0A 4K9PA 4RBNA 4MGYR 3C41J 5CJ2A 3KR1A 3G5UA 4NLLA 1QF9A 2EQ5A 4J07A 2QL6A 1DJMA 2QVXX 3U3XA 3SJUA 5KQPA 3TLYA 1FCJA 2I5PO 4LDNA 1I3KA 4EVRA 2Q9BA 5DW0A 2AKAB 1T5BA 2NYUA 1I8TA 3INGA 4Z8XA 3IAM6 3EGDB 4MR8B 4OTZA 4EGAA 2MYNA 2C3UA 5KSPA 3TNDA 2AOVA 2ZWIA 3I30X 1HNWB 1PX2A 2OAEA 1IOVA 1XRLA 2DG2A 3HU3A 4HEQA 4G89A 4C0BA 5B1YA 3R8FA 4XD2A 1WDKA 1M6WA 1S2NA 5H9VA 4E21A 1TTPB 1ZL2A 3TLGB 1HDGO 3DBOB 3MK31 1WMEA 4Q9LA 2WJPA 1JR2A 3R5XA 1PGQA 3ZCPA 4MDFA 1CEYA 1DKRA 3ZK7A 1HDCA 4D4GA 1KP2A 1PVDA 2GTHA 4MROA 1XMPA 4XA8A 2OE2A 4XDHA 4DCUA 1JQDA 2I2BA 4Z1MD 5HKKA 5JTTA 2ZDQA 4ZAVA 4BUJA 2YCBA 3L8YA 3ZKWA 3BA1A 3VDRA 4D6YA 1IVSA 3B13B 2NLOA 1XCGB 3TLCA 2R7NA 2ZPTX 3V8NA 3WRYC 2YN4A 3MWJA 4LK3A 3LQFA 3LU1A 4QOIA 3C45A 2ZTMA 1H0KA 2ZXUA 4DZTA 5LWQA 4GLOA 2YW9A 3LPNA 2CHGA 2B9VA 5D1HA 3U4QA 3TR5A 3FVQA 4JT9A 2Q28A 4P2GA 2C9YA 1PUIA 4R7GA 1GDTA 3C3EA 1L7QA 3L8ZA 3EUFA 2MMGA 3PL1A 3KEQA 4I6EA 4KIFA 5AM4A 2IE8A 5BURA 2Q21A 3FNIA 4D8UA 4YMGA 1KMHA 4GIBA 2WWVD 2AG5A 1LGYA 2QR5A 2NZYA 1KFEB 1UBSB 4FKZA 4LXQA 1FQOA 2NQ2C 3BMQA 3RF7A 4DM7A 5KSWB 2XWSA 2QSUA 1VCMA 5BORA 1TDJA 2WSMA 4L95C 1SKAA 1B14A 1J8YF 2QTGA 4XKJA 3B2QA 4ZHQF 1Y8AA 4H17A 1JR6A 4AICA 3T5GA 3WLFA 2XT9A 4NYMR 3VPAA 5BSTA 3VTFA 1H66A 2J1LA 3SC6A 1ODJA 3MINA 4H6PA 3W8EA 4LRTB 1PTJC 4X93A 3TB6A 5KQRA 3EZYA 2AE1A 3QPWA 4UVGA 1E0JA 4IDAA 2EERA 5D6NA 5EIBD 1MHPA 1RM0A 3WK6A 5D2CA 1AM4D 1N1MA 1SPBS 4JUIA 3S29A 3CUUA 4MVJH 1KO4A 2PZAA 2QHXA 1W7AA 5J5VA 4FC6A 3L7MA 3ANMA 2OFWA 4KQKA 4B6GA 1GPJA 3TVTA 4FFDA 1FXSA 4C0SA 3SDZA 5KJCA 2VOJA 4BLVA 2UVPA 2CLLB 5A6VA 4EY4A 1OT5A 3UB4A 5DNEA 2M1XA 1J39A 4IIJF 4F4UA 1JA0A 1YR3A 2GPBA 5JZOA 3M1YA 4IHKA 1NLYA 2V8BA 3LRPA 4A8JB 4Q7QA 5BVGB 5TQ0A 1YI1A 3D8BA 3F5FA 1GN9A 2OG1A 2RCNA 1AU9A 1OI7A 1YRWA 1Z7EA 2LD4A 4K6KA 4WKOA 1B16A 2RKBA 2Y93A 3GY0A 1AZWA 3KQQA 4EI7A 3LT0A 5FWXB 3OIFA 4QVIA 3I5YA 1M1NA 3A6ZA 3MTIA 5TY0A 3TIVA 1UDAA 1MO2A 3Q85A 4UBNA 5DNDA 4ZT2A 4LXIA 4LFCB 3AO0B 3KB2A 1YIOA 3U4QB 3NHPA 4S12A 5FYDA 4OPMA 3JSXA 4FHDA 2QOEA 4IINA 3TTSA 4NQRA 1KNXA 2FPGA 1EWVA 2FZVA 1ZGJA 1ADCA 2WVHA 3OI7A 3A32A 1N25A 1O9HA 3UAOA 1I3MA 4JA2A 5CNKA 1XD8A 1EP3B 1G6KA 1KZGB 1UWKA 1X77A 1ZMOA 2JJYA 3IEXA 5B2FA 1U8CB 1VMEA 2VZ0A 3W5IA 2PZLA 3VI4B 1TECE 3QF7A 2IUUA 3NYIA 4JWTA 1ZH2A 1YCHA 2EU8A 3HG7A 4P34A 1N6KA 3LWDA 3BIWA 2QD1A 1E3WB 3DAFA 4C01A 4W5OA 1CJCA 2XDYA 3U4IA 4WBNA 3D6FA 2FFAA 3AI3A 4UUPA 1QOQB 2WC1A 4RCYA 2ZI5A 2PZBA 4Z0PA 1EK0A 1U1EA 2MSKA 1PLKA 1M7HA 1UBLS 1E99A 2FVYA 2FWNA 1A88A 3HGMA 2YMQA 5ALGA 3PXEA 4WT7A 4BNLA 5HUQA 2G0NA 4J0CA 5B2EA 1I9GA 2NUPB 3S2GA 3AEKA 4H2DA 2NNLD 4EUHA 1G8JA 5K3AA 4LDAA 3RC2A 4POOA 4NYJR 5M2QA 3U7FB 4JQYA 1YBMA 4ZQCB 4B3HA 2AEFA 5AKIA 3FCAA 1OPRA 4X85A 1XJWA 4EA6A 3KD3A 5A3RA 5K6TA 3IVGA 4OHWA 5E95A 4YRKA 2C83A 3M49A 2W70A 3TPZA 5FJIA 1C3JA 5I3CA 3T3PB 3L92A 5HVNA 3BDIA 1HLGA 1X1EA 4EG5A 4Y2RA 5BT9A 1I1OA 1SHZA 4X20A 4H7IA 3TMAA 1TLTA 3FR8A 2ZUTA 3OOEA 2CUKA 3GNTA 1OKKD 2UZAA 3QEOA 2VP0A 3BA6A 2QJWA 1SRRA 1JPNA 2A59A 3TEFA 5HX7A 5B36A 2NPFA 3A7EA 3C7AA 3X2EA 1FP4A 1N2HA 3H17A 2C4MA 4HZUB 4MW5A 3ZBTA 5J2UA 5F9MA 4XWYA 1BO6A 4UNNA 3ZY6A 1CR2A 2GM4A 3BK2A 5DO9A 3UJBA 4A10A 1ZUD1 2ZSEA 1Z88A 4R0MA 3R3VA 4R8MA 1OA0A 1XD2A 2AHRA 2VYCA 2ZRKA 3BXHA 3GRPA 1U2GC 1NP6A 3OEWA 5E8RA 5AUQA 4MP8A 1W0CA 1V8ZA 2ROQA 2HCJB 1L5QA 4PV7A 3TWOA 3FSRA 1DEAA 2QT1A 2QV7A 4QU9A 1RCFA 3MQ2A 4DCJA 1W4CA 2C31A 5AMXA 4YN3A 2X7JA 2H9IA 3QA3E 3FFTA 3GRUA 1JTEA 721PA 4I9NA 5FF9A 1VIAA 2BELA 3AU9A 3BB4A 2E4XA 3IBGA 1TM7E 3OZXA 4Q4AA 4E5PA 2A57A 4ZCIA 1Z4IA 4E13A 1QRUA 4BHTA 4BDSA 1BWRA 2WP8J 4XWWA 3R8XA 5BOVA 3SY8A 3A9UA 1RBZA 4JVMA 1PNVA 1W94A 1T4GA 5ALYA 3E53A 4OHKA 3NDBB 2P5YA 4TYPA 3UG7A 1A1VA 1KSGA 2OGSA 1COWD 1SKBA 4BO9A 2OXCA 2EW2A 3WQBA 1LS1A 4PQRA 2GPTA 3DMNA 1HYBA 3MSCA 3JW8A 3WLPA 3JRNA 3BUSA 5LP6B 1FTSA 3QTTA 5SZHB 2GJ9A 1N9GA 2H9YA 1KVQA 2BFCA 5B4TA 3QVTA 2UYGA 2XZDA 2Z98A 4GMXA 4UMFA 1GTG1 3BIJA 4X90A 5BMVA 3FOBA 3PL5A 3CX3A 2BHLA 3WLLA 3C5EA 3R44A 1SUPA 4EY6A 5IWCA 1PE0A 1K5GA 1WTAA 2X40A 2QP4A 4I46A 1O4VA 3FYUA 4IGEA 3FUTA 4ZO8A 1FMTA 1K7XB 1W73A 2B4YA 4NFHA 2H1RA 2CT8A 2B34A 1H65A 1JI0A 3UICA 3OZUA 5JAPA 3W5AA 1UANA 3HRKA 4IYRA 2FFQA 4RD2A 1VBMA 5AVRA 1ZM4A 2B4RO 2ZAOA 5FTJA 4E6PA 1IBKB 4YRMA 5AXBA 1KTVA 1E1CB 4BV9A 1DXOA 1ADBA 2DHRA 4PX2A 1TCAA 2C2WA 1PV2A 4HLNA 3F49S 1JSZA 2C2GA 3EPRA 3KJIA 4HFRA 5FOTA 4BB5A 4ZCSA 2VYQA 4MVJA 3H1EA 3IURA 1W52X 1NPYA 2PRIA 1S9HA 2PK3A 1KFKB 1V7ZA 3L9XA 3GZJA 4JKIA 3JRWA 3VDXA 2CBXA 1E5VA 4EAQA 4F5EA 2V54A 3FDZB 3EEBA 3O2JA 4XDZA 1RPTA 1PQYA 1VI2A 3PUJA 4PHTA 5F35A 4R0VA 3O8CA 2J33A 3WJ2A 2VQEB 1HETA 2VHUA 2PAAA 1UWCA 1RJEA 3KQYA 2C4KA 4P7FA 2ZS9A 5CBPA 4GYJA 1RHRA 1R0XA 5H16A 4WZBE 4BMZA 4PN7A 3GLIA 3CY6A 3RUEA 4GSLA 4LMAA 4LF6B 4B8YA 4DJJA 2HJGA 3L7JA 1JDVA 3IKTA 2XAUA 3DBHB 4TLCA 4TTAA 3W05A 3TS1A 2N9UA 4LECA 4TYMA 4BBAA 5JD6A 2DBQA 4LKRA 1G63A 4XIIA 3V5NA 3K6KA 4YJGB 2RHOA 2G28A 3WSTA 3BB1A 4O2AF 3WB0A 1SN7A 2WBLC 4Z7QB 5DLYA 3F71A 3EARA 3B1KA 1Y1LA 3NNSA 2ZSDA 1LC3A 2VNKA 3L5OA 2PXXA 2WYIA 3VU1A 4G0YA 4D0RA 5CVCA 3OQBA 3W8FA 1LJ8A 4YH1A 1R66A 3SF8B 2G40A 5JDIA 1VG1A 4IFIA 2QTNA 3F90A 1CQJB 2N1BA 4HQLA 3TDNA 2QPOA 2VAVA 1KRHA 1CK4A 2WHRA 2R00C 3FHCB 1ORVA 1XAGA 1Y4SA 4HH0A 2XODA 4B46A 4EKNB 2BEVA 3CWQA 4RF5A 3RRFA 1NMYA 4HXGA 3HZOA 2FTKE 1MTOA 2RGNA 3FY4A 2OTCA 3SZUA 4QNNA 4B7ZA 1O2DA 3ZWVA 2BZ0A 3JQBA 2V55B 3L93A 4D6PA 1ETUA 5KHAA 1XFDA 2O05A 1JR3E 3CBQA 3NEYA 4CM6A 1KERA 4Y6RA 5WRFA 2I66A 3G02A 4BVJA 3SFZA 2FWRA 1UMBB 2Q7XA 3JARA 1L7DA 1BA3A 1XTJA 1MTZA 3AZPA 4CLXA 3LCMA 2UKDA 5C5IA 4KWEA 3UJAA 1SK8A 2Q2VA 1YS1X 4KR3A 4AY3A 1LK7A 1A8PA 5FBHA 3QMPA 1QQ6A 2H4HA 3G7NA 1KI3A 1NBAA 1W8IA 1KE1A 2D5LA 3N0WA 5EHZA 1BNCA 4CEHB 3UQZA 3WVNA 2ICAA 4BN5A 2JD1A 2RG1A 2D5IA 1YQ9A 2GTPA 2UZIR 4F60A 1NXOA 5ALJA 3HUUA 2ZAYA 3ACBA 3ZVLA 3MOSA 2W58A 4JP5A 4RH0A 4DR1B 1C4WA 2F43A 4BRWA 1IXKA 2AX3A 5L7WA 5IDQA 5J1SB 4AF8A 3WMEA 1GPAA 2LZ0A 4WXHA 3W0LB 3PCRB 4RPKA 3OD1A 5TXGA 3N7UA 2I80A 1ACJA 5KOHB 4YGYA 1TL7C 1CYEA 1H1LA 2JA1A 5KC8A 1CWUA 1BFDA 4XPZA 4BFVA 3SIPA 5BSKA 1P33A 1WBBA 3PQCA 3ZE2B 1XP8A 2GGSA 3EGDA 4HVCA 3QFHA 1GQYA 2IYLD 3BL6A 3GWGA 3GD7A 3SX0A 4FYWA 1DWQA 3DEKA 1JHYA 5E1DA 4DL9A 1B8VA 1YVRA 3ZZTA 3T7TA 2VQSA 3RM3A 2JJMA 2YVLA 1R27A 4KTTE 1E7SA 1KXZA 4L5AA 3V7WA 1ULAA 3DKKA 3DHEA 3ZBQA 3OIYA 3FHOA 2XB8A 1NQWA 4TKVB 5FHRA 5H02A 1ZGZA 4G8CA 3PGLA 1T10A 2UZ1A 3DLAA 3P0JA 1ZBDA 4CDGA 3ZS8A 4BN0A 2EWWA 1JIIA 3DD1A 3WYFA 4REQB 5EHGA 4EK9A 2G67A 2HH9A 2P6OA 2G1KA 4MJXA 4KRXA 1TW3A 3R7FA 1VTKA 4GSKA 2R6DA 3IEPA 4F2PA 4UM9D 1F5NA 1N5DA 2BFAA 4GX5A 3OT1B 2AN4A 2DWUA 4HZGA 3HJGA 4I14A 3SKYA 1TZCA 4PO3X 1N2CB 3PEUA 2IZOA 1VRWA 4MEBA 4P53A 4ND7A 4NFLA 1JLLB 5ECDA 4O4LA 5K0BA 3U9TA 1AF4A 3D4IA 1ISFA 1WSDA 3LLSA 1OV6A 1QYDA 1XQ9A 1VKNA 3RKUA 1SC9A 1KMQA 3GMIA 4DUPA