3GH3A

Structural insights into the catalytic mechanism of cd38: evidence for a conformationally flexible covalent enzyme-substrate complex.
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
241
structure length
241
Chain Sequence
YSGLNRWHGAGSTADFQKIIQERCDTYTQTIRPGSRSRNCQAIRQAFMSAFISKDPCKATKEDYNSLINLAPPTVPCGQQVFWSKTKELAHEYAKRRRLMTLEDTLLGYLADGLRWCGEPGSSDLNIWSCPDWRKDCRTNYLSVFWEVLSERFAESACNTVRVVLNGSLENAFDSMSIFGRVEAPNLRPQVELEAWLVHDTGKPPSDSCSGSSIRKLKSILDGRNVKFRCMDNLSRDQFLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the mechanism of bovine CD38/NAD+glycohydrolase from the X-ray structures of its Michaelis complex and covalently-trapped intermediates.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
molecule keywords Ecto-NAD+ glycohydrolase (CD38 molecule)
total genus 82
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature ec 3.2.2.5: NAD(+) glycohydrolase.
pdb deposition date 2009-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 3gh3A01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gh3A02
1C0LA 1KY5A 1MFPA 4YA6A 2QQ5A 1RM4A 1HKUA 3DR3A 3UF0A 4B3JA 1OZAA 4XCVA 3VH3A 1U9JA 1PQPA 1DIRA 2GUGA 2YDXA 1PJ4A 1O5IA 4NI5A 1UP7A 4BNYA 2A92A 4RDIA 4U6QA 2HSDA 4AJ4A 2YY7A 3UN1A 2DUUA 2HK7A 3JQGA 3KVOA 5IN4A 3PEFA 1H93A 3NTOA 4S1VA 5HRUA 4ZGWA 1E92A 1X7GA 1BHSA 5GMOA 2XPCA 4XYMA 1AHIA 3OMLA 3DAGA 1V3VA 3W6UA 3HNPA 2XF8A 2I3AA 2J3HA 1KEVA 4IJVA 4BGVA 3MTGA 4YVFA 5I8WA 2UUOA 2VUSA 5DP1A 3U4DA 5FWNA 5BSEA 3JQGB 3I9NA 3INGA 1IZ9A 1DAOA 1EUCA 4CQMA 3GHHA 4PG6A 4RQUA 1E1LA 3QVWA 4LRSB 3D3WB 1ZO8A 4I5DA 4CPDA 4PLTA 4FIZA 2JAPA 2X9NA 3MWEB 4GH5A 3GVXA 2BFOA 4NIMA 3JYQA 1HDOA 1R0LA 1Y9AA 1GYPA 4XDYA 3ZGYA 4GGOA 3PTZA 4CMIB 3W6ZA 2E48A 5BT9A 3DONA 3QRWA 3Q2IA 4AJIA 2OZPA 2CVZA 3PI7A 1N8KA 4XR4A 4IDBA 1E6UA 3C8MA 2BI8A 2VHVA 2EKLA 1NX6A 1BSVA 2OBYA 4W7HA 4HADA 5KOIA 4MJLA 1HYHA 5AYVA 1IULA 5DN9A 4WCDA 5DZSA 2EHDA 4CM9D 3KEQA 1JDJA 1OC2A 1PGOA 4P22A 4ZICA 3IUSA 3MJSA 4UVIA 5I7EA 4DIOA 2Q50A 5KKCA 3DBVO 1I01A 4YQYA 3K2BA 1J49A 1DB3A 2EKPA 4BS9A 1KVRA 1VJTA 1A72A 3TDKA 3FNEA 4BNHA 2WMDA 1AUPA 1V35A 4CM8A 5KWEA 4W9NA 5HS6A 1PJQA 1ARZA 3GZNA 3ZWWA 4MVJG 4N7RA 2PK3A 1U3VA 2NVUB 4YRAA 1WAMA 1CERA 4N5LA 4A2CA 4CODB 5BR7A 4D3DA 1BG6A 1I24A 1MV8A 3PFWO 4QEDA 3UCEA 1GU7A 4OIMA 2XXJA 4QECA 4KMSA 2B35A 3CSDA 4XRGA 1MXHA 3OF2A 4RLHA 4CQLA 2YQ5A 3FHLA 1FDSA 1DJNA 4XWYA 1KEUA 2Z95A 1Z6ZA 4BNGA 5L9AA 3MEQA 1DIGA 2Y05A 3PVZA 1AXEA 3PZRA 1UXGA 1DIBA 2DQ4A 1RYDA 5JXWA 1Z45A 1DBVO 1C3VA 4DLAA 1ZW1A 5IDWA 3O4RA 2GNAA 1P1RA 1YB4A 5DT9A 5TJ9A 3DBLB 1EUDA 3I9MA 4YWJA 3H9GA 4RLSA 4B7XA 4U0JA 3Q11A 4XQ9A 3F1LA 4P38A 3OJOA 1AHHA 3A4VA 5EQDA 2FPIA 1OOEA 2DAPA 4NU5A 1SZJG 3AY3A 3PJGA 1YL6A 3E5RA 2FN7A 1PTJA 2FPPA 4NHEA 4Z9XA 2O2SA 4IDCA 3E5MA 1E3JA 3OFSA 5HWSA 1JVBA 3OECA 1LRJA 2WSBA 3L4SO 1XCBA 2RAFA 3QSGA 3RJ9A 4I9NA 3WYCA 3I1JA 4BNMA 5CG2A 1KVSA 2FRDA 4MVJF 1VC2A 3AFNA 3W8FA 1H6BA 2RHRA 1NAHA 2ZQYA 3T7EA 1NWCA 1HSOA 1L1FA 1YONA 4IY1A 1PS9A 3QHAA 3LT1A 3RUEA 1PGNA 1N9GB 2Q1WA 4RZIA 3WS7A 4E4YA 5U9CA 2NTNA 1A5ZA 3EY4A 4AJNA 1VJ0A 3QWAA 4TRMA 2AEFA 1GTMA 5AOVA 1NP3A 1SO8A 4J49A 3GUYA 1IL0A 1XGKA 5BQFA 2NU7A 1YQXA 4E5MA 3DL2A 1NFFA 3KM0A 2JFFA 2V6BA 1NM5A 4OHUA 4XA8A 4CLDA 3GRPA 1M6HA 3F1KA 4BO8A 4C7JA 2OORA 4IINA 4NJOA 4NJMB 4H3VA 4CMCA 4HFJA 3NT2A 1W8DA 2A35A 3E9MA 4BO6A 3KYDA 4YJHB 3ZNPA 1U5AA 5F5LA 2X4GA 3O8QA 1BTOA 1Q7CA 2O7SA 1DSSG 3ZCXA 2G17A 4II2A 4QO8A 2WD8A 4QXMA 9LDBA 3AFMA 3GGOA 3FWNA 1E3WA 5DDIP 5CDTA 2ZTUA 4YAIA 1MFZA 4CMIA 1DC5A 1EVJA 5HS4A 4CV1A 4L76A 3GNTA 3OICA 4YJFA 2IEBA 1Q1NA 1GPDG 1OC4A 2X0RA 2NVWA 2DUWA 4CLXA 4B8WA 3WGZA 5C5IA 3SLKA 3BA1A 4DLBA 4AJ2A 4UUNA 4BB6A 3M1AA 2V6GA 3H3JA 4CQMB 5JLAA 2PZMA 4MVJI 4MO2A 1K0UA 3LC1O 5TIIA 3G0OA 3CH6A 4RPJA 2ZB8A 3MJVA 4CM1A 3HUDA 1DFIA 3RUCA 2O3SA 1PZHA 2VT2A 3IP1A 1XU7A 4RO0A 4R1SA 5JBIA 5JY6A 4L9RA 1CIVA 4JIGA 1A7KA 1ENPA 1KVQA 4B8ZA 4UUOA 1UDCA 1CDOA 1I2BA 1HWYA 1WZIA 1R4MA 1GEGA 1PGQA 1Y8QB 4JLWA 3GRKA 5K6AC 4EJMA 2B5WA 1Y8RA 4KWHA 2P68A 1EEHA 5HM8A 1C1DB 2X5KO 4AJOA 1GQQA 4PVDA 4UEOA 2H1SA 3HB5X 2ZB4A 1DAPA 4YDRA 4GSLA 3KTDA 2OFPA 3GMDA 1E3LA 4GPD1 3ABIA 5GZ1A 1TXGA 2H9IA 2BGLA 4FGSA 3PQEA 4J2HA 3I3OA 4E3ZA 4NJMA 1HDYA 3S2EA 2EGHA 4YBZA 2H63A 4WLUA 3P5SA 3D64A 1EVIA 2WE8A 5A3VA 3PXXA 1N7GA 4BNTA 2NM0A 4FCCA 5TSDA 2RHCA 2ZYAA 4J0EA 4CM5A 4KTTE 4DRYA 1V6AA 5EJ2A 3H4VA 3NJ8A 4J7XA 4YJGA 2Y1CA 3I9KA 4RPHA 5JE8A 3VVCA 4JN6B 1UZMA 2QHXA 1JKJA 1RJWA 1BGVA 1H94A 1GZ4A 5AXCA 1ENOA 1A9ZA 5IZCC 2VOJA 3H5NA 1HEUA 3GAZA 4TMFA 2O3TA 1NWHA 2UDPA 3JSAA 4ZQFA 3OJFA 3ZV5A 2A4KA 3LU1A 3ICCA 3G49A 3TZHA 3JQAD 3UGKA 3CINA 2OHXA 3M6IA 3OSUA 7MDHA 3KSDO 3GFBA 2J3KA 5FI5A 1ONOA 3UOGA 3D7LA 1DHRA 3KHUA 3WFJA 4DYVA 3CKYA 4E32A 3HDJA 4WCFA 3WGYA 4R69A 5DF1A 5T5QA 3S2GA 4I5GA 5EERA 4EUHA 2DBQA 5IFLA 2NNLD 1EDOA 3K96A 1QYVA 3G79A 3RKUA 1JAXA 3DHNA 3NKLA 3RUHA 5BSHA 4F6CA 2WTBA 2C0CA 5F1KA 1HYGA 4NK4A 4NQZA 4FOOA 4O0LA 1T2AA 3K31A 1B26A 4I9HA 3U4HA 3HQ4O 2VHZA 2EEZA 3BHIA 4LVCA 3WGHA 1F17A 4J3FA 3WG9A 1Q2XA 5JAQA 1U5CA 3D1LA 5T8KC 4DIBA 3CZMA 1ZJYA 1MC5A 4UVHA 3BAZA 3MJEA 1HDZA 1C1DA 4MVJA 1EBUA 4A5OA 4AJ1A 4RF5A 1U8FO 3I23A 5FI3A 4NPCA 1YOVB 3ON5A 3HN7A 1XWFA 3P2YA 4XQCA 4XQGA 1Z73A 3D0OA 2IODA 1QYXA 5ILOA 4R3WA 5COBA 4RVHA 3ZZNA 3ZDFA 1O89A 2AE1A 3BIOA 3JD2A 3STHA 4PLZA 4N5MA 4W99A 1D1TA 1DDOA 1GZ3A 4IJKA 5IDQA 5THQA 2AA3A 2P4HX 3NDRA 1WW8A 3HFGA 1T26A 5L4SA 1NFRA 3BZUA 3EZYA 3WXBA 3E18A 1PZFA 2VUTA 4DMLA 4XJTA 1LSUA 4OXKA 4FC7A 1SAYA 1YKFA 4ZD6A 1RM0A 3V1UA 1VSVA 4QFCA 3WGTA 2Q2WA 3RJ5A 4ILKA 1PGJA 3BTVA 3GF4A 4NBUA 2D8AA 4IMRA 4OSPA 3WQQA 3WFIA 3U4CA 3ZHXA 3LT4A 5AQ1A 2HMUA 3FI9A 3H8VA 1NPTO 5JW6A 1DLJA 4E2XA 2P5YA 1LDYA 3CMMA 4LN1A 2VNAA 1OMOA 5ICSA 3PIDA 1I32A 1QYCA 2W90A 4PVCA 4MKXA 3QV1A 2F00A 1BXGB 1B8UA 1HT0A 4E2ZA 1MGOA 1GYRA 2B5VA 2VHXA 3DHEA 3FR7A 1Y81A 3VZPA 4II3A 1NHWA 1ADCA 1JTVA 1Y8RB 1ZSVA 1YH3A 4NFHA 5CFZA 3B6ZA 1V3TA 4ZQGA 4FBGA 3EUWA 1UR5A 2X9VA 1P3DA 3DDNA 3PHGA 3PLNA 5IZCA 5KIAA 4MP6A 1XYGA 4B4UA 3C24A 4RVDA 3U5TA 2WYVA 3NYWA 4GMFA 5C7IO 3E9QA 1B7GO 4FW8A 4TWRA 1JN0A 2ZIZA 3H9UA 3W8DA 2I76A 1JU9A 2Q49A 2IDZA 5JPIA 5DULA 3VDQA 1L7EA 3ZWAA 1B2LA 1Y9EA 1YJ8A 1V9LA 2DBVO 2LDBA 4WEQA 2J5KA 3W4KA 4P4NA 3IL2A 4D0SA 3NAQA 4ND1A 1XSEA 4CMHA 4D43A 4J90A 1ZBQA 3EYWA 3JQ9A 3RROA 1U4SA 4LCJA 1NBOA 4GX5A 1YDWA 4BKQA 4Q3CA 4I8XA 1XG5A 2B0JA 4DUPA 4R01A 2X9GA 5EPOA 1U2GA 1E3WB 3TF5A 1D1SA 4F45A 4UUMA 3ASVA 4ALIA 1R4NA 2ILTA 2NSDA 4DBVO 3CUKA 1V3UA 2BD0A 4J0FA 5TLSA 4KP7A 2EGGA 5H83A 3AU9A 5JAIA 4IS2A 4Z6KA 3MCVA 4HX5A 2FR8A 2EKQA 3IIEA 4R3NA 1GPJA 3DC2A 2HRBA 1I3MA 5LC1A 4ZHSA 3GAFA 3WGGA 2GN8A 5TQVA 5IG2A 1N92A 1XQ6A 2CDCA 4E6PA 4LRTB 3OQ6A 1Y6JA 1Q0HA 1E3SA 2AQ8A 4A10A 5ER6A 1VL0A 4HY3A 1PX0A 4PLHA 4BV8A 3WSVA 4S3MA 4BO3A 3AI1A 4KUEA 4P8RA 1WWKA 2FPGA 1PEDA 1YXMA 3BMOA 3NTQA 3Q1LA 4GWGA 3X2FA 3AI2A 1ISJA 3L6DA 3PHHA 3I5MA 1YQGA 4GVXA 4CLRB 4JK3A 3LSYA 3TSCA 1Q0LA 2PFGA 3VH1A 5JFOA 4BNZA 3TNLA 3Q0EA 1QMGA 4JP2A 3PP8A 4YJFB 2UYYA 4FJ1A 1LX6A 4DYDA 3ZNQA 2UUPA 5IAAA 1XDWA 1KVUA 3RCBA 3L4BA 5T57A 3DZHA 3NT4A 3AOEC 4DREA 2Y68A 4DPLA 1LBEA 2VNSA 1HDCA 3BTUA 4H16A 1CQJA 3ADOA 4IMPA 4OM8A 4ALKA 5T8KA 3AM4A 2AEJA 4K1LA 1KVTA 4Q3BA 3ST7A 4DBZA 2CD9A 1E1NA 2D3TA 4H15A 1T25A 2CMDA 4FSHA 2O48X 2P91A 3WYEA 1WLYA 1VKOA 2IYOA 4E33A 4Y8VA 2IYPA 1X1EA 1R0SA 3TQHA 3W8EA 4GSKA 5JAZA 4R4JA 2X0IA 1OI7A 2G1UA 4EITA 3U49A 3F5QA 3HHPA 4TVBA 5CEFA 3CZRA 3M1LA 1PGPA 2QZ9A 3F3SA 4Y9DA 1I5RA 1CF2O 2AQKA 3OJEA 3AU8A 4J4HA 2YHIA 3SC6A 1IPEA 3K5PA 2PZJA 4W82A 1EBFA 2ZTMA 2G5CA 4UEJA 4M8SA 1GR0A 1GCUA 1P45A 3HDQA 3VVBA 5CEJA 3E1KA 3OA0A 1AE1A 4M86A 3GVCA 5JCJA 1TT5A 3F5SA 2ZYGA 4PZCA 2Y67A 1M67A 1O94A 2RCYA 3I6QA 2PTGA 1HDXA 3C7AA 1GD1O 3DAPA 4B4VA 2VZ9A 3PWKA 2XOXA 2HAEA 1N1EA 2WWRA 4IQ8A 4RPLA 3VPGA 1LLQA 3VDRA 4O5OA 3JQ6A 4IZIA 1P77A 4EJ6A 1R16A 1EMDA 1O9BA 4YAGA 2GN4A 4E12A 2HLPA 3RUAA 2CDAA 4YJDA 1X13A 2DLDA 2F1KA 1W4ZA 3PDUA 4DGSA 1J4AA 3JQ7B 4J91A 3BTSA 5TS3A 3R0IA 3DBLA 4I08A 5B12A 1FK8A 5G4LA 1T2CA 4OXNA 3K92A 5U4QA 2JD0A 3LQFA 4LSMA 3GEDA 4BO1A 2WYUA 4MKRA 1ADGA 2HRZA 3H3FA 4C7KA 1PL8A 3BMQA 3SBOA 4BGEA 1VLLA 2DTXA 3JQ9C 4XB1A 4FFNA 4JXKA 3GDGA 3RUIA 2JKVA 1O95A 2NQTA 2X6TA 3ZW9A 1TVEA 1P1IA 3TN7A 2NU8A 1ISMA 1DC3A 4QSMA 3GPDG 4E2WA 2WM3A 3V5NA 4CMEA 5G0TA 2POQX 2VYNA 3WNVA 1T24A 1A4UA 1BXGA 1QXSA 3KB6A 1QLJA 3N74A 3IUPA 4YAKA 2Y1DA 5AVOA 2JCVA 3H9EO 2G82A 3COSA 3TZKA 4ZJUA 4FDAA 4GX2A 3JTMA 3ZV4A 4DPMA 3TOXA 3GY0A 2Y0DA 5JCJD 1UDAA 3AWDA 1FDTA 1QV6A 2QX7A 3FBTA 3VH2A 4ZN6A 8ADHA 1C1XB 2ZCVA 4JBHA 3ITKA 4PGFA 3KYBA 3Q2KA 5KNLA 1A7AA 2D0IA 1BRMA 1BVRA 3ZI0A 4OQZA 1NXQA 2HO5A 4TZTA 5F1PA 4E2YA 1DPGA 1MB4A 2VWPA 2CNBA 2AE2A 1H6AA 3L0DA 4GGPA 2EIHA 3DMYA 1Z7BA 3SEFA 1WZEA 2BHLA 1R15A 1KETA 3WGIA 4IIVA 5FEUA 1TI7A 5C7OO 3RWBA 2A9FA 1GUZA 3FF4A 3QJ5A 2PWZA 5TC4A 1XEAA 3GFGA 1C14A 3RC9A 1E7YA 1D8AA 2G76A 3TZ6A 5KTKA 2B83A 2XXBA 5DBIA 4IJUA 4DQXA 1A71A 1EFKA 2PKQP 5CP8A 5ER9A 3OIDA 2UV8A 2VRBA 3GLQA 4J4BA 4L74A 2HCTA 3VTFA 3OM9A 2FSSA 4BHTA 3OJ0A 1P31A 2SCUA 2C54A 2ZB3A 4OOFA 4D45A 3Q3CA 3GGGA 1R4MB 3V1TC 1NQ5A 2BKAA 4PRLA 3H9JA 3ROKA 2NU9A 1HLDA 1I3NA 4J9UE 2VWGA 4J7UA 2J5RA 4JX8A 5DOVA 3LK7A 4BVAA 3CTMA 4RF4A 4C4OA 4J1QA 5G4KB 4NBVA 5A06A 2OP1A 4R16A 4L4SA 2QRKA 1KIFA 4OYRA 2Q46A 1UXHA 3FD8A 2B36A 2X7HA 1D7OA 2X23A 1NHGA 4IDEA 4WLNA 3KLMX 5KVQA 3FTPA 5BNIA 2WJPA 4J1TA 2QRLA 4UVGA 4ALLA 1WVGA 3V1YA 1ADFA 4WCFB 4D41A 1ISIA 4AJLA 2WD7A 2VZ0A 3JYLA 4AG3A 3WDSA 1JW9B 3RFXA 3NEPX 3DB2A 3N7UA 3R6DA 4RL6A 1C0KA 2PGDA 5L3ZA 1PS0A 4DWVA 4TQGA 4OGWA 1N5DA 2O23A 3WNQA 3U09A 1IHXA 3F47A 1ZEJA 4JJFA 1Y7TA 3UHAA 1YL7A 2PY6A 3MWDB 3QWBA 4OKIA 1JVSA 3OIGA 2Q4BA 3PFFA 5L4NA 1MX3A 3JQEA 1I30A 4YXFA 1DO8A 1BMDA 1CYDA 4ZU3A 2UAGA 5JMPA 3TL3A 3ZWCA 1ZEMA 4NBWA 3F4BA 4U8GA 2GR9A 2X0JA 4YT4A 1J0XO 1PSDA 2OGUA 2GASA 1UP6A 4J7CA 4R5MA 1H2HA 1LQUA 2BMAA 2HJRA 4X54A 4Z3DA 4G5HA 5LCXA 4K26A 1HE2A 5L4LA 3HDHA 4XGNA 1E7MA 1Y8QA 3JYOA 3OETA 4ZQBA 5IDYA 4BUCA 1SOVA 3RU9A 1ISHA 1IHYA 3GH3A 3FCOA 1H9BA 1U4OA 1XA0A 2GN9A 4EUFA 4NFYA 1EQUA 4HV4A 2CVOA 3DTTA 1M76A 4I1IA 2ZATA 3TFQA 4MVJP 2VCYA 3DTYA 4ZQHA 3LVFO 2GPTA 2GCGA 5A9SA 3DOOA 2HK8A 3NX4A 1VL8A 2VRCD 5COAA 1HYEA 4XDZA 4DC1A 3DEYX 4BNIA 1LSSA 3QWFA 4Q39A 4Z0TA 3TJRA 3OBBA 4WLOA 2RH4A 3AUUA 5BNTA 2Y1GA 4ND4A 2GZ1A 4A7PA 4BO4A 1ISFA 4A03A 2EG9A 1PL7A 1I2CA 5IJZA 1Y1PA 4MIOA 4Q3NA 4INAA 4MPDA 4BO5A 1PJ3A 3DAFA 5JO0A 2GDZA 1EK6A 3KYCA 4RVSA 1LLUA 3WQSB 3DBHA 2V6FA 1DHTA 4FPXA 2Q45A 1IYZA 2ZYDA 3MJCA 2W2KA 3PJEA 4BKRA 4LSWA 4K6CA 5K0ZA 4R51A 2NV6A 3TWOA 4YRDA 2I99A 4PLFA 1LLDA 3VPSA 4IBOA 2CY0A 4QO7A 1P1HA 4UREA 3BTOA 3EMKA 1B8PA 4P4LA 2YYYA 4N5NA 3PHIA 2I3GA 3QLJA 3GVIA 3SVTA 2DTDA 1W0CA 1X7HA 1O6ZA 1DFGA 1PJ2A 3O9ZA 3RIHA 1QORA 2Z1NA 4OJNA 2YV3A 4RZHA 3PYLA 1QP8A 1Z7EA 4PFJA 1L7DA 2C29D 4Z9FA 2B4RO 3X2EA 3ZH2A 3CXRA 3RKRA 3VC7A 2GZ2A 4BNFA 3C3XA 3RD5A 4CMGA 5I7FA 2IRWA 3DBRB 4TKMA 5TT1A 5EQFA 3LYLA 3F46A 3UKOA 4E0BA 3WGQA 3ASUA 1QLHA 4CM6A 1K6XA 5KVVA 2DKNA 1HETA 3NRCA 4FJ0A 1H6DA 3K6JA 1KEWA 4IXWA 4ZQEA 5KKAA 1DIHA 4Y98A 3A14A 1RPNA 3AY7A 3NT5A 4E13A 5JDCC 4Q3AA 4NZ9A 4A0SA 3EDMA 3FPLA 4ZA2A 3EHEA 5C3MA 3JQAA 3NV9A 1B0AA 1LXCA 3RU7A 3DZFA 1PJTA 5KJEA 2VTDA 3HB4X 1FDUA 3D4PA 1B14A 4LW8A 3OP4A 1SB9A 2DT5A 1PWZA 3CPSA 1R66A 4FFPA 1NYTA 1W6UA 4HKTA 1ZK1A 4CMJA 2PH3A 1P0FA 3T7CA 2R00C 3PPIA 4WUVA 3NDIA 1U3WA 1LJ8A 2NUAA 3AK4A 4GAEA 4RF3A 1E7RA 3KEOA 1D4FA 4EYEA 3AUSA 1FXSA 1VL6A 8LDHA 2ZTVA 3QA9A 1H5QA 1LSOA 5CDYA 3B70A 4PLYA 1Y5MA 3B1JA 4GQAA 5A05A 1HXHA 3SJ7A 4BNUA 4E5YA 3D3EA 4BQRA 1PJCA 2I67A 1Z82A 4BQPA 4PIVA 4AJJA 1JLLA 5TT0A 4BV9A 4J1NA 3VKUA 3WMWA 1PL6A 4E5KA 1TB4A 2G0TA 2X58A 4CMKA 1E7QA 1ML3A 4CLOA 1ZK0A 1GFSA 3QQPA 4AJPA 2C5EA 4DC0A 4J1SA 3ZU2A 1LTHR 1UZNA 4FFRA 4HFRA 4PRKA 5I7VA 3GK3A 1P33A 3P2OA 4G65A 4M49A 4PLVA 3UW3A 4KUHA 4J43A 4PN3A 5EESA 4Q3EA 2VYVD 1BDBA 4NDNE 3BXXA 4LMPA 1JA9A 2OBNA 4W7IA 5F5NA 1WDKA 2C2YA 5F3RA 2Y1OA 5DCUA 3D5TA 1R6DA 4M54A 5L53A 2CVQA 1UXKA 3R1IA 1PJSA 2PD6A 1Y5RA 5BNFA 1UDBA 3I9JA 3KLPX 5L95A 1P0CA 2JD1A 5IDXA 4WNCA 4ID9A 4NBTA 3QVTA 1RM3A 4NK5A 2O3UA 3PGJA 3DZBA 1XLTA 2WD7B 1YL5A 1Q7BA 2NVUA 1WXDA 2Q2QA 2YHUA 3FNFA 3JV7A 3LLVA 1KERA 2CZCA 2DC1A 2W98A 3RBZA 5A03A 2QYSA 2OXIA 3RFVA 3FTNA 1U7TA 2EWMA 4M55A 3GEMA 4EJ0A 3NGLA 1WDLA 1YVEI 2GD1O 1G6KA 1OBFO 3RAJA 3VPHA 2BGMA 4MOWA 3OEYA 4R1NA 4K28A 5JC1A 4RQTA 5HBRA 4AL4A 4RJTA 3ZHYA 4L0QA 4MP3A 3ZHZA 4E21A 4WKGA 1DRUA 1IB6A 3ZWNA 1MP0A 2W2KB 4YQZA 4OAQA 2PR2A 4UUPA 1I10A 1ADBA 3ZNOA 1KC3A 2R00A 3OH8A 4QTZA 1F0YA 4J2OA 1SEPA 1WP4A 3K8ZA 5I9NA 1X7DA 1HLPA 2BLLA 1TLTA 4WEOA 1EZ4A 1IE3A 3PIIA 2OO5A 3B1FA 3DQPA 5I9MA 3WBBA 4FD3A 5FF9A 1GV0A 5CHEA 3S2IA 4DMMA 3JQBA 3I52A 5GY7A 4AJHA 1LA2A 2E6UX 4N18A 4L4RA 4WECA 1MUUA 4XYLA 2HK9A 2VOEA 4YAJA 4RPGA 1NVTA 3AOEA 3D3WA 5JO9A 2WDZA 1EVZA 1YB5A 2CF6A 2JL1A 3QVXA 4OQYA 2PGJA 3O26A 3JQ8A 5B1YA 3NUGA 1NQOA 4GLOA 2NQ8A 4G81A 2D59A 3VHRA 5A04A 3DZJA 4Z0HO 1NPDA 5CAEA 1K89A 4FQ8A 4MVJD 4YB8A 3HJAA 4ONEA 4JCOA 3RBXA 3ZW8A 4L75A 4GMGA 4YPOA 1AN9A 3MOGA 5DCYA 1V8BA 3IS3A 2VYVA 4F6LA 4OXYA 5FYDA 5G0VA 1TEHA 1LDNA 5LDHA 4P4GA 3I83A 1E3IA 3WBFA 4N54A 4GX1A 3G1UA 4FB5A 2I6TA 1YOVA 1WNTA 4LCEA 3QP9A 3IAHA 3L77A 4B7UA 1XQ1A 4BKOA 1GAEO 1LUAA 2QIOA 2PLAA 4DA9A 2FSVA 4IUYA 3H2ZA 5HTOA 1XU9A 3IMFA 4R5HA 3PRJA 3IKTA 2C20A 1Q7GA 4JJIA 3PYMA 4HBGA 3K9QO 1GQ2A 1LDMA 3DBHB 4BMSA 2C07A 3TRIA 3JQCA 1ZIDA 1WMBA 1GYQA 2VT3A 1N7HA 2Y0CA 2ZJ0A 3DZIA 1NNUA 4GLLA 3UXYA 4AICA 4Y6PA 3DHYA 2AQIA 2AXQA 4MDHA 5A1TA 3NTRA 2PV7A 4YACA 1G0NA 1P44A 4A26A 4O6VA 1T2DA 1HZZA 3G3EA 2BH9A 5FFFA 1NASA 3QWIA 2EF1A 1GDHA 4R41A 4IZHA 4HXYA 4JBIA 3ZNNA 1YQDA 1SNYA 1UP4A 5EL0A 3V2HA 2W8ZA 2NWQA 4B79A 2XAAA 5L40A 2QYTA 1PJLA 1YGYA 4QQRA 4L4XA 5EINA 1E5QA 3GUCA 3S1LA 3BMQB 1X14A 1UH5A 2OMEA 3ADPA 4D42A 1LLCA 3C1TA 1EVYA 3JCZA 4QT0A 4IQGA 4XIJA 4CLHA 1CRWG 2P9GA 2VZ8A 2P9EA 3KBOA 4M87A 1HL3A 4R9RA 1A4IA 3DZKA 3IJRA 4A27A 2FZEA 3RUFA 5JDIC 1H9AA 2I5PO 4WE3A 3RC7A 2D1YA 2ZTLA 2Q1UA 4EGFA 1OAAA 2X1HA 3A06A 4FS3A 2QW8A 4MINA 4RORA 3LZ6A 4D44A 2HQ1A 4ALJA 2HU2A 2AMFA 3GR6A 3KSUA 4CUKA 1BW9B 1KYQA 1GCOA 3I4FA 4ITUA 1DC4A 3EAGA 4B4OA 4E30A 2ZQZA 4J4TA 4HP8A 4RDHA 3RASA 1PIWA 3E6AA 3KOUA 2X5OA 1VM6A 4PLGA 3L07A 3U3XA 3VTZA 3PLRA 4EI2A 1KEPA 1SPXA 5THKA 1ENYA 4XR9A 5L7WA 3ONEA 2Q1TA 3LLSA 4B4WA 1JWBB 1SMKA 3FNHA 3BMCA 1F14A 3WMXA 2YJZA 3E8XA 2NLOA 5MDHA 3QVOA 4PZDA 1YS4A 2A94A 5ILGA 4NR0A 3WWZA 4HUJA 3VZQA 3PQFA 3RFTA 1G1AA 4PG5A 1LI4A 2AG8A 1UJMA 1P9LA 1MC4A 4NG5A 3ETEA 2CUKA 4BO0A 4CM9A 3EVTA 3UCFA 2ET6A 3GT0A 3BMNB 3L9XA 1MG0A 4IIUA 1P74A 2VQ3A 1JQBA 2YV1A 2YDYA 1DRVA 4R1UA 1LC0A 4U7WA 5A9SB 3FBGA 4YT8A 1PS8A 3L9WA 2JAHA 1HDGO 1HSZA 5JYDA 3WJAA 5JCXA 2FWMX 2RBEA 3OHSX 4NH4A 3PWSA 4WASA 3QWHA 4TRNA 2FZWA 1FDWA 1ISGA 5CG1A 2X8LA 3GQVA 1A27A 2NU6A 3WSWA 2QRJA 2AEMA 3EGOA 4CV3A 5JDCA 4PG4A 1KY4A 3RC1A 3VH4A 1LQTA 1BXKA 2E37A 1PWXA 4PZEA 4ROSA 4YEDA 3U0BA 1XR3A 3IQDB 1UUFA 4E31A 1E6WA 4YAEA 1E6EA 2GYYA 3JQFC 1E5LA 1ENZA 1P1KA 4RGBA 3TOZA 3E9NA 4QUKA 1LRKA 3B1KA 3VOSA 3WTCA 4PG8A 3RC2A 1IZ0A 3A1NA 2C7VA 3ROPA 1M6WA 2AG5A 3SC4A 1KOLA 3NGXA 3OA2A 4J16A 2DU8A 1PR3A 5COQA 4TROA 4FGWA 4YYZA 5JNLA 1BDMA 1D3AA 1RKXA 6LDHA 5ICMA 3VZRA 4E5NA 2NACA 3V2UA 5G0WA 1TT7A 4EEZA 3CMCO 5ES3A 4Z0PA 5ENVA 1DXYA 1EE2A 3IDSA 3VKVA 4DIFA 4KUGA 3GVPA 2HUNA 4KOAA 1WMAA 2BF7A 3WQRA 1NAIA 3EK2A 1E7SA 4NBRA 2O3JA 3K2EA 5IF3A 2CF5A 3L6EA 4Y6RA 4GKVA 5EN4A 2HMTA 1ZH8A 3AUTA 4CJXA 2IE0A 3BMCB 4R54A 1JAYA 4L73A 4OMUA 2P9CA 4EBFA 3JD4A 1N2SA 5ITWA 3E82A 1MXFA 4GBJA 4ND3A 2FR0A 3IC5A 5L7TA 1LNQA 3O03A 1U3TA 2EV9A 5A3JA 1B15A 4CM4A 1F12A 1U7HA 4OOEA 5BSFA 3FSRA 1E7WA 1Z75A 3FRJA 1R37A 3LDHA 4I5FA 4XYBA 3MJ4A 3PWZA 3DOCA 4HFMA 3U62A 5G4KA 2W4QA 3QW2A 2Y0EA 2J3IA 1AXGA 4XRRA 2DBRA 3KO8A 3RSHA 1EK5A 4OKNA 4D0RA 2Y66A 1R12A 4W6ZA 4WNIA 3RQSA 3IOYA 4IGFA 3UCXA 1JKFA 3N58A 2O3QA 4B3HA 3ZWVA 4IJWA 1ID1A 4WLVA 5L51A 5C37A 2EP7A 4IDDA 3SLGA 3WIDA 3GZNB 3W4IA 4AJEA 1PZGA 4GI2A 2D5AA 3NJ4A 1SCUA 4QFDA 3TL2A 1ONPA 1VJ1A 1AGNA 1ZZEA 4WJZA 3WTBA 1ZMTA 3JD3A 1GEEA 1PU2A 4BO2A 4PLCA 4IM7A 2FHSA 4XEHA 3R3JA 3QIVA 1NTOA 2WE7A 3ZWYA 2YUTA 2NTVA 2C5AA 2VUUA 1VRWA 1EUZA 4FR5A 5BSGA 1YRLA 2V6MA 1F06A 1VPDA 4DXHA 1ZVMA 1HDRA 2JCXA 4CL8A 3OQBA 4UULA 5HA5A 2D4AA 2VHWA 1IPFA 3ZWOA 2FY8A 5A4DA 5KJCA 1TA4A 5ADHA 2Q99A 2TMGA 2IXAA 2Z1MA 4CV2A 1ZKMA 2EW2A 1U28A 4MVJM 2JFGA 3PYXA 4R9SA 4RF2A 4JQCA 2IZZA 1BXZA 1DJQA 3GA0A 3NDJA 4CM4B 5JSFA 3HFSA 4WLFA 1UXJA 2GRAA 4XGKA 1GUYA 5CEEA 2GLXA 2HMSA 2UVDA 2JD2A 1HE5A 3M2PA 3AM5A 2NTJA 5TJHA 2BFPA 2C82A 5GZ3A 4CUJA 3ZWXA 3GDFA 3L6OO 2X22A 4JROA 2H6EA 2QG4A 3ETDA 3D4OA 5IN5A 5T6BA 4UEKA 2P2SA 3WIEA 6ADHA 2BI7A 3JQ7A 4XYGA 2VTEA 1QR6A 4BNKA 4DL9A 4WCFC 3S2FA 5TF4A 3TPCA 2JHGA 1ZJZA 2ZK7A 3I4CA 4AVYA 3CIFA 3SX2A 1ZMOA 2NADA 4OSOA 4EW6A 1EDZA 1IY8A 3T4EA 4ND2A 5EMHA 2JJYA 1XIVA 1YO6A 5CDGA 3AW9A 3K73O 4BIIA 1TT5B 4YRBA 1E1MA 3B20A 1C1XA 3HDYA 4O1MA 3I9OA 5IZ4A 4XQEA 3GG2A 4WK6A 3GNSA 1I3LA 3TZQA 1HE4A 2GO1A 5JS6A 3C1OA 4CMAA 1GY8A 3DWFA 2DFVA 3GMSA 2R2GA 2YHIB 2CSUA 1QRRA 3IKVA 2PNFA 4OL9A 5T67A 3KZVA 1ZNQO 1GADO 3ZWBA 2AHRA 2B37A 5A9TA 5A5FA 4D3FA 2O4CA 3ONDA 4R68A 4Q9NA 2DVMA 1K6IA 3KYCB 5JDIA 1ORRA 3VPFA 4ALNA 4CV0A 4KZPA 2HKIA 4ALMA 4DVJA 4XJSA 3I6IA 1SBYA 1HRDA 4PLPA 1FJHA 3SXPA 1VI2A 3UVEA 5K9ZA 4BOYA 1CWUA 5T64A 4R1TA 4JGBA 3O8QB 3OEWA 3WWYA 2HMWA 3ROMA 3TZCA 1LSJA 4BO7A 4BNLA 2EXXA 3F6YA 4DPKA 3UFXA 3PZBA 1QV7A 4BNVA 1N1GA 2JHFA 4ZRNA 4MIEA 4PLWA 4IDFA 2RH8A 1ZK3A 4U6SA 5G0UA 4ESOA 3H2SA 4CQLB 3ANLA 2HMVA 3HWRA 2I65A 3KXDA 2AQHA 4F46A 4MVJE 3ICPA 1K2WA 1QSGA 3AUAA 1T4DA 1J5PA 4J6FA 4FJ2A 4OH1A 1HF3A 1ONNA 4YJGB 5H82A 3ETGA 2IEDA 1YDEA 3H9QA 3PGXA 4FOSA 3GEGA 4CLRA 1B3RA 3WB9A 1F8FA 5I9LA 1B16A 1BVUA 5DCWA 4MVJH 1IOLA 4E5PA 4U5QA 4RVFA 1QYDA 5DNAA 1NFQA 4RVUA 3Q9NA 4IPTA 2X0NA 1SOWA 2IZ1A 3P19A 1K5HA 1RYEA 4YT2A 1RM5A 4CR6A 2B69A 2BFAA 4CM3A 4Z9YA 3P7MA 2AW5A 2B4TO 2PZKA 4LGVA 5CPFA 5AXBA 4DQVA 1M66A 3RBVA 3AJRA 4Q3DA 3H6KA 1HZJA 3C7CB 2Y1EA 4WLEA 2FP4A 4UAGA 4GKBA 2YQ4A 1O8CA 2ZCUA 3UICA 5DOZA 1E1KA 1ZFNA 2EP5A 3JYPA 4KWIA 3WICA 4YR9A 3W1VA 5IXYA 5K6AA 2DM6A 3U9LA 4XZ3A 4BKPA 3PJDA 3EZLA 1A9YA 5TRTA 4GL4A 3JQFA 3TFOA 3SJUA 3DOJA 5JC8A 1DLIA 1JKIA 5F1OA 5CDSA 2GZ3A 1X1TA 4FFMA 2Y93A 1YJQA 5B4UA 1T1RA 4BKUA 1B3BA 2HJSA 4L8VA 3I9LA 3DXFA 4PG7A 3FNGA 1YE3A 5JYEA 5KVSA 1M2WA 3UAGA 1KC1A 4UVEA 3ZWPA 3JQBC 1MG5A 2FOIA 3DFUA 5ENDA 1PQWA 2TMDA 1P1JA 5KJFA 1I3KA 1H2BA 4O59O 1G0OA 4CUZA 1H6CA 2NVBA 1CEQA 5TGDA 3ANNA 4JJGA 1ZK4A 4HNHA 3T4XA 5EIOA 1XHLA 1I33A 1UAGA 1SEVA 1X0VA 1LU9A 1E0DA 3ORFA 4I9UA 7ADHA 3HADA 1EE9A 4XGIA 2PZLA 4BB5A 2HDHA 3RVDA 3ONFA 4TRJA 3S55A 4BMNA 2D5CA 1ZCJA 1K3TA 3KV3O 5B37A 4ND5A 3ITDA 2VN8A 4KTVE 2JFHA 3WLFA 4H7PA 2GSDA 5F21A 3BYZA 3ZV6A 3FR8A 3EVNA 3WLEA 4TVOA 3O38A 3RI3A 4D3SA 5GZ6A 3ULKA 3PHJA 2PD4A 3GHYA 5KJ6A 1FDVA 4EEXA 1T4BA 3QE3A 4IGEA 1F8GA 5AXAA 4W4TA 4Y67A 1WDMA 2I9PA 3INTA 3F4LA 1FMCA 4FC6A 4CMEC 1HE3A 1R0KA 3LF1A 1N9GA 1ZXBA 3PHLA 4YTEA 3A28A 5KCZA 1DIAA 4MKZA 1O0SA 1YWGO 3GOHA 3INRA 1S6YA 4XIYA 1SB8A 3RUDA 4B3IA 5KJ1A 4CLEA 3ZU3A 3PJFA 5JMWA 2X86A 2Q1SA 3IJPA 1YBAA 4FFLA 3UUWA 1ZUD1 4U0KA 2PGLA 4DTIA 1MLDA 2C7GA 2E49A 4OO3A 3ENKA 1OFGA 4DQUA 2EJWA 4TZKA 1SC6A 4W9NC 1VE9A 2ZB7A 1LDBA 2E4AA 2ZJ1A 4WOKA 1LDGA 1NQAO 3GVHA 2O50A 3H7AA 3K30A 3ZU4A 3DMTA 2GF2A 2YW9A 4BNWA 1P1FA 4BGIA 1ULUA 5LDGA 2QZZA 3AY6A 1UZLA 4RCVA 1C0IA 2P4QA 5KVCA 4CMBA 1JWAB 3E48A 2PKQO 4YT5A 2V65A 3ENNA 3D4NA 3GGPA 3F9IA 1Z74A 4NFSA 2WYWA 2I66A 4G2NA 1ZSNA 3OQ1A 2W2LA 1T1SA 1PR9A 1CETA 4NU6A 4CM8B 1ZK2A 3HSKA 4ZRMA 2J5QA 5CDUA 1R4NB 4BO9A 3JD1A 1EFLA 5G0SA 3WX0A 4Y6SA 3BMNA 1NVMB 2V7PA 3LT2A 4AFNA 4TKLA 4GVLA 1LC3A 2R6JA 2BRUA 3FN4A 3C85A 1KBZA 4BNNA 3JQAB 3FWZA 3LT0A 4MP8A 1M75A 1GZ6A 2OUIA 3FPCA 3JD0A 4KQXA 3WYBA 3CE6A 3L4BC 2FR1A 1U3UA 5G2OA 4IDGA 5JAMA 9LDTA 3OJLA 4NNJA 3MOIA 4CLOB 3V8BA 3IP3A 2YZ7A 5B4TA 1GUFA 4J9VA 2W2LD 4IS3A 2EJVA 1HTBA 2O4UX 2VYND 2CFCA 3MZ0A 1S7CA 3EW7A 4XX0A 3ZWMA 4O63O 5DP2A 3HN2A 4LK3A 3ANMA 1CQIA 2Q2VA 3U4IA 4DLLA 4WGGA 4CM7A 4LVUA 3LC7O 2C59A 2X5JO 3JYNA 4K9DA 2GN6A 2Q3EA 1C0PA 3LF2A 3AM3A 2DFDA 3DO5A 5H81A 2Q4EA 3Q6IA 2VWHA 3C1AA 3ZV3A 1DFHA 1GQYA 1DOHA 3WGOA 1DRWA 4CR7A 4JNKA 4IDAA 1I0ZA 2J8ZA 1DEHA 4D46A 4I5EA 3DFZA 4M89A 4CR8A 2VHYA 1Q0QA 3DBRA 4XD2A 3MJTA 3A9WA 3QVSA 3G17A 4JP3A 3VPXA 3ROQA 4M1QA 2O2YA 1UXIA 4TSKA 3HZZA 3AOGA 1XELA 1I36A 2PD3A 1T2EA 2CDBA 4GWKA 2OL4A 4BGUA 2VRCA 2DBZA 4RPKA 3W4JA 5DBFA 1B8VA 3KUXA 3G1TA 1ULSA 4QX6A 5AXDA 3WJ7A 1E77A 1U1IA 4UVDA 3GC6A 3H5RA 1IUKA 4XYEA 4YCAA 4EUEA 2ZKLA 4D7AA 1U2DA 1VKNA 1YB1A 2PA3A 2B4QA 2EW8A 1PZEA 4AJKA 1LRLA 3JQDA 3KSZO 3GPIA 4LMRA 4WPGA 1I2ZA 2PKRA 2D2IA 4D79A 3DZGA 2OP0A 2DPGA 3PDJA 4ZVVA 5JY1A 4FFOA 1MA0A 1NR1A 4JBGA 1KS9A 4CQMD 1H0KA 3GN1A 3HE3A 3BHMA 4BMVA 5L45A 2VWQA 1GL3A 4F3YA 5J23A 2EERA 3WOHA 2H5LA 1BW9A 3KRTA 2OOSA 3Q9UA 1PQUA 4KQWA 4HFNA 3ZU5A 5MGBA 2J6IA 3GN2A 3C7DB 2Y1FA 3D5QA 1UAYA 3LC2O 1LEHA 3MTJA 3AI3A 3OIFA 5A5EA 4K6FA 2YFHA 2YV2A 5U1PA 3GZ4A 3HG7A 4EDFA 1X0XA 5L7YA 4NMHA 4LISA 3H5AA 4EZBA 2FMUA 1PJBA 3S8MA 4RVGA 3UH1A 2YFQA 4BNXA 2O7QA 3H65A 3KYDB 4YJHA 3EC7A 1QG6A 3E03A 5B4VA 4MIYA 5A02A 2Z5LA 4HWKA 5DBGA 2JCYA 4B7CA 1NQTA 5I8ZA 3PQDA 1FF9A 3ZN2A 1NVGA 1ZSYA 1ZXLA 5A9RA 4XKJA 3JQ8B 2P5UA 1VSUA 5I7SA 4IXTA 5CPBA 1LDEA 2IZ0A 4URFA 3WR5A 1DC6A 2PH5A 5TNXA 3KETA 5IXSA 5ITVA 2BFMA 1RWBA 1EQ2A 3BHJA 2Y99A 4RV9A 2C2XA 4TRRA 5C7LO 2RIRA 3CEAA 1YBVA 4A73A 3R3SA 4IQ0A 1NR7A 3BMOB 3GDOA 2O3RA 3GNQA 5TX7A 1V0JA 2BELA 3GG9A 4FN4A 1QKIA 2DTEA 1NPYA 2BGKA 3VZSA 3DMTC 1T2FA 4KDFA 4PCVA 2DPHA 1QYWA 2E82A 1E3EA 1XKQA 1YBMA 4BL5A 4CL3A 2LDXA 3QY9A 3VAZA 1W73A 4KDEA 1J6UA 1I8TA 2J3JA 2WEKA 2GGSA 3M2TA 4Z3KA 2IXBA 1GV1A 1X15A 4WOJA 1BWSA 1U8XX 4BNJA 1K6JA 1CJCA 4GX0A 1WPQA 3PK0A 4XB2A 4HNGA 2GERA 3ZHBA 3V2GA
chains in the Genus database with same CATH superfamily
1MRSA 5KTRA 2RGXA 1DAKA 5FH9A 5IDVA 4L5JA 1M6VA 2D5LA 1HKUA 4MJ3A 4V0SA 1HFKA 3OPMA 4KE6A 1CZKA 3HLKA 4ZU1X 3R7AA 4F60A 3R5XA 4IO0A 4X62B 1RAHA 5F9MA 3TK1A 2EU8A 2IIVA 4Z1MD 2YVLA 2IS4A 2CMFA 3LWZA 1ND6A 1O5IA 3A4MA 3VR6D 1EP3B 1U9ZA 4C6HA 3OQMA 3VSDA 2QNRA 4D8YA 4EY7A 4IIJA 4AJ4A 4K8OA 3THYA 2ZRIA 4OFZA 1X1DA 2DUUA 3SC2A 2XCTB 4KQJA 3JQGA 3V80A 4I50A 4AO7A 2R6AA 3PFHA 1E2JA 3QI7A 1H93A 3NTOA 4S1VA 5D8DA 4YPFA 1E92A 5HRUA 2HV8A 3HRHA 2YINC 1YRAA 3NDBB 3KE9A 2NZVG 4XYMA 1VSTA 4UFOA 5AHOA 4OBWA 2JIPA 1V3VA 4FDLA 4RHYA 4PPQA 2AL7A 3W6UA 3WL6A 3TX6A 2PX6A 3ZH9B 3FF1A 2J3HA 4BGVA 1ZM4A 2VUSA 1CR6A 3KAJA 4RIIA 3G2PA 1CB7A 3FXAA 3JQGB 3I9NA 2W43A 1MJGA 4M9CA 1EUCA 3GHHA 3GT3A 4RQUA 3LRTA 1R18A 2BKLA 2G08A 2FI1A 1CY7A 4CPDA 4KSCA 4H17A 4QTUB 2I3ZA 2JAPA 1AV6A 3QKSB 1NP7A 2X8BA 2JK0A 2PM8A 4K6GA 4PYLA 3TLJA 5HQ3B 2BFOA 2H4HA 3ENWA 3IDAA 3HKEA 4WADA 3JYQA 4FEYA 4MHSA 3PLAE 2QPAA 3FFTA 3FKJA 3HP1A 4PGMA 4TV8A 8AT1A 5KWSA 4MS1A 2DZDA 1WVMA 1H22A 1UINA 4UBLA 4ENRA 3PTZA 4CMIB 1P8JA 3DONA 3QRWA 2BN4A 3Q2IA 4AJIA 1E99A 3K6SA 4A15A 3PQ6A 5HRAA 5FOTA 1FYVA 1VZ2A 4XR4A 4XPIA 5EFZA 2VTBB 3WLTA 4AMVA 1E6UA 2VF2A 2BI8A 2VHVA 3PV0A 4PBRA 4EJFA 5HCNA 4P58A 4LRXA 1AIPA 1BROA 1Z5OA 4JGGA 5KOHA 2YS6A 4HPJB 4FKZA 3AP2A 5AYVA 2HADA 1IULA 1MQSA 2W2XA 2ZIEA 5IKOA 1P72A 5DZSA 1PNRA 2G8LA 1BEZA 4JLMA 2H8KA 4AU1A 1X9IA 2C0QA 3BA6A 1XEFA 3EW9A 3OLWA 3KEQA 5HFNA 1KFBB 2AFIE 3IUSA 4BX8A 5LJIA 3JSXA 3QEBZ 3ZJVA 5HJEA 4TYNA 1N5JA 2AK3A 3FJYA 4PWYA 521PA 5HFAA 2GYVA 1J49A 3OY2A 4CW7A 4XX0B 3ZCVA 1G41A 1L4GA 2Z0MA 1KVRA 3PNBA 3WHPA 4BNHA 1ABFA 1AUPA 1SOUA 1V35A 1VCMA 1LI7A 2GEKA 2ZRMA 4KQ9A 5KWEA 4W9NA 4PX5A 4LXQA 3BF8A 3IKJA 2GAFA 5HS6A 1ARZA 1HOTA 2C84A 2G07A 4O3MA 1ECPA 4M36A 4YJ3F 5ADVA 3U5ZB 1SKYE 2BC9A 2QDXA 1WAMA 3J81k 4CODB 2K87A 4D3DA 1FUIA 1VSBA 2WT4A 3IR7A 4OHKA 3GFFA 5LBTA 4CKEA 4KXUA 3LQ2A 3NJRA 3OPYI 1M0EA 1NONA 4A5SA 2PWYA 2R751 4XUCA 5T3YA 1Q1QA 1T6BY 1D6NA 4PX2A 5D5QA 3K8YA 1VHLA 2VRNA 2DJIA 2NSLA 3HACA 1Z25A 5E2BA 2P9FA 4AXBA 3C70A 5KYUB 1GGKA 4KPEC 5IJ0A 4XWYA 1BX0A 4FEEA 4GU5A 2FW0A 2XX3A 3MWJA 4DYHA 3BE6A 4H4DA 2BMJA 1JEDA 3I04A 2OTCA 5FPQA 3RREA 1TYCA 4EEKA 8OHMA 4BMZA 5L6MB 1H5NA 3FLBA 4PNEA 5C81A 3P1JA 3HYTA 1DIBA 2DQ4A 2L42A 3A6DA 3LA6A 4JUDX 4Q18A 3VR4A 3OZAA 1QCCA 4FOLA 1DBVO 2GM5A 5F98A 3M5CA 2GNAA 1P1RA 5HF9A 3QFFA 1YB4A 4JJ7A 3QOXA 4Y2QA 3RYFA 5IEJA 2WK1A 1EUDA 5DYYA 1L3IA 3TUZC 4O4HA 3LXRA 1M8GA 3Q11A 1XJWA 3F1LA 4BPBA 1U90A 2XXAB 1AHHA 2XSZD 2H57A 1NVKA 1SZJG 3WB0A 2FPMA 1V47A 4EATA 2FPRA 4QXOA 2IOYA 1OAOC 1Q0PA 4KE9A 1RTTA 2CE2X 4IVQA 4E03A 2I2DA 5I9IA 2H1WA 2E9SA 2IHUA 3JAWA 1TF5A 1M6YA 3OZDA 1SBHA 1ZQ9A 2WVGA 3PC3A 3DFIA 4IDPA 2R6FA 3DUFA 2UKDA 2RAPA 1N78A 1DTEA 5CW2A 2C5LA 1JHUA 5LYJF 4XSGA 5JYEA 1C4OA 4QM6A 1P19A 4I9NA 3RVJA 3WYCA 4BNMA 2C31A 5CG2A 3KZCA 6Q21A 1S1CA 1VC2A 1MIHA 4IHJB 2FMTA 1DI0A 2Y27A 3LUHA 1NAHA 2ZQYA 2A14A 1HE8B 2B0CA 2IHTA 4HYYA 1YONA 2XNJA 1L1FA 1DAGA 3RUEA 5KX5B 2HHCA 2R0QC 1E62A 4D5EA 3DMPA 3ILVA 3SM3A 1A5ZA 1GGEA 1WXGA 2V7QD 2SKDA 2GI4A 3CA8A 3EY4A 3KQQA 3QWAA 3BK1A 3R76A 5A4MS 5FOSA 3H4MA 1GJRA 1NP3A 3PBKA 1XMVA 3KUCA 4JASB 4ZYUA 3ZS9A 3AR8A 3U3RA 2ZJAA 4OQLA 4YP7A 2IW1A 2HA4A 3BB3A 2BKXA 1JDTA 3GRPA 1M6HA 3IBFA 2QGZA 3F1KA 4HNQA 4ZU6X 4BO8A 1WD5A 3RFUA 3NUZA 4NJMB 1KI9A 3AB8A 4PX3A 2H4ZA 4HFJA 4CMCA 2A35A 3E9MA 4I8DA 3QLVA 2XVZA 3KYDA 3PRHA 3ZNPA 1U5AA 4OHCA 4B74A 2VQFB 2IZ6A 3FOAA 1OWMA 4H1TA 1MR3F 2WHPA 3P0EA 1QYIA 4WXEA 1E1CB 1P9RA 4AYTA 2PUBA 4KYTA 4UM7A 4II2A 4W5TA 1QIEA 1FSZA 3M6UA 3MTBA 3OZBA 2DKOA 3GGOA 4JQZA 2WU4A 1VGVA 3FWNA 5DDIP 2H4XA 4WUTA 4I4TA 2VJMB 4CMIA 4LKOA 1NQVA 3QXHA 3ZEIA 4AD8A 1G2OA 1C7FA 1M7HA 4LBZA 5HS4A 3HJFA 3QFCA 4S0ZA 3GNTA 3OICA 3T4UA 2NYAA 1TFRA 2JFVA 2X3UA 4DA8A 2Y4OA 1WU7A 3OZCA 2JLCA 4RY9A 4G0VA 2PQ0A 1POXA 1XL0A 2K2QB 3ED1A 2HXGA 3E7PA 3WGZA 5C5IA 3EDYA 4RVNA 2VDLB 4UUNA 1RWNA 2DFLA 1K86A 1F2TB 3WAJA 2P40A 2W6NA 3A6PC 3H3JA 3LUJA 3SDSA 1EP2B 2PZMA 1LPMA 4MVJI 5KREA 1T29A 1JLLB 1TECE 2IYUA 3LNCA 4RGVA 2ORIA 4WAUA 4CM1A 3AP1A 2UXBB 4XFDA 1T0JB 1PZHA 2RHJA 2VT2A 3DTNA 3IP1A 3RRZA 3SE0A 4LC0A 5A5DA 1R8JA 3NBYC 4V0ME 5FPYA 5GJCA 4RO0A 4PV7A 4R1SA 3G5MA 5EYPB 4L9RA 5JY6A 5KDDA 1G8PA 4KK4A 2HWXA 4O2BF 1GRRA 1N7IA 5LZ2A 5SZJA 2MSDB 5A4IS 1JHZA 2ZVPX 4FYYA 1EFRA 3EEOA 1INLA 1M10A 4EHBA 1W5SA 3R0JA 4O29A 2A0UA 2PL5A 1Y8QB 3I01M 1KJQA 2I7DA 4WNAB 2ZT5A 1KSGA 2NO4A 5JZOA 3TYXA 3HWWA 1L5RA 2DCUA 2YXBA 2P68A 4LE1A 1C1DB 1CVIA 5FAKA 2CL5A 1R0BA 2WV9A 3EG5A 3M3PA 3NATA 2BEVB 4UEOA 4JL6A 2N1BA 3HFJA 4LQCA 1C0EA 2QN9A 5AUNB 3LKDA 4M37A 2O1EA 1XTZA 1CUIA 1E61A 2IUTA 1CQJB 3SKVA 2D1FA 4DJEC 1NW4A 4B7CA 4BATA 5GZ1A 1TXGA 4HWRA 2C2GA 2I1LA 2M6LA 4E3ZA 2H7CA 3EX7C 4NJMA 4MDFA 2F3SA 3F3KA 1MQAA 1XKLA 4U7GA 3GGSA 5A3VA 2POCA 1QDEA 1NXPA 2XQIA 4FXOA 2OXEA 2ZULA 4JLKA 2WJVA 5EIWA 1CT9A 1P4SA 2JW5A 5JVDB 1A2BA 1EP9A 3KJEA 4FCCA 2QTZA 2RHCA 3E0XA 4J0EA 4OFWA 1YZVA 1NRWA 4KTTE 4ZGGA 2BFBA 1W8IA 2OFOA 2W48A 4HATA 1H65A 3I4LA 4BEWA 1XTKA 2QMYA 3FOBA 4C30A 4YJGA 5AVXA 1FW8A 4RTKA 3OX2A 4NCBA 4RPHA 5JE8A 4JN6B 1TM4E 3SSMA 4LOAA 3TI9A 3HWSA 1RJWA 1BGVA 2PMKA 5M29A 4X97A 1A9ZA 3C39A 5IZCC 1NOJA 3JZDA 3GAZA 1OXUA 3I2GA 4J16C 2HM7A 1LBIA 3BFKA 3RYIA 4C0HA 3USCS 2JLZA 3BGVA 1NUUA 4D9FA 4L8LA 4KRXA 3W7AA 4HN9A 3UGKA 1FNMA 5JD6A 2JARA 5HQJA 1XNHA 3DP9A 2H7YA 1U31A 2C8JA 5FI5A 3WFJA 4DYVA 5IUJC 1QDUA 1W6RA 4WJLA 5DF1A 4B4KA 1JHXA 4EUHA 1WUHS 2IHJA 5IFLA 3R77A 3TR0A 4V1CB 7MHTA 3K96A 1KE1A 3CV3A 4TLLB 1JAXA 2RDMA 1U0RA 3RKUA 3VR4D 3ZXXA 4F6CA 2IK8A 1V8PA 4RK1A 3L7AA 2J9FA 1VRVA 1IRIA 1G7TA 1QX3A 5F1KA 2AFHB 2C0CA 2WTBA 3PSHA 4JLVA 4EF5A 1T2AA 4LF7B 4I9HA 3QE0A 3U4HA 3SXJA 4CU2A 3BHIA 3WGHA 1F17A 1FFBA 1OFTA 3IT0A 2CLIB 3BT7A 4XVUA 3D1LA 1VKJA 4DIBA 1ZJYA 1IJEA 3SS8A 3CPHA 2V7QA 1CR2A 2XZLA 4QDJA 1LX7A 5AJUA 1TIPA 4EB6B 3PS9A 5KB3A 1UJ6A 4TSRA 3HSYA 1RQXA 1YOVB 5ADUS 2JFBA 3OZRA 4XQGA 1Z73A 2JLYA 1T9KA 2UZAA 2FETA 2P69A 3QKIA 5KTNA 4TTVA 1Y4SA 2IYLD 2YOFA 3ZZNA 4R71A 5C8YB 1XZLA 1JLHA 3W5CA 4DIMA 3GRRA 2QNBA 4E5UA 2H92A 5BMOA 3TE7A 3I2JA 3CUYA 3GT4A 4PLZA 2DMRA 2FPOA 3BUSA 4RZSA 1IWOA 1TM5E 4V1CI 5JZMA 4KH1A 5KKCA 5LJLA 1FB5A 3DVAA 1WULS 2JJMA 2AA3A 4M7PA 3NDRA 1KI7A 1G17A 3HFGA 1T4CB 2OC9A 4JH0A 4WA7A 1L5KA 1ADJA 1VSQA 2RBKA 3KYIB 3OWOA 2NO5A 3PUZA 2QLFA 1TFUA 3D6UA 3WXBA 4N0MA 3L0OA 1PVOA 2ZE7A 3E9YA 2XE4A 2GN2A 1IHDA 1FRZA 1ESZA 1SJ9A 3FPSA 1N5RA 4ZD6A 3RF6A 1RM0A 3ZK7A 1X7WA 2HFJA 2A0YA 1ILEA 5HQTA 3C5VA 1DV1A 3OQVA 2EWWA 3SBXA 2P4EA 4IMRA 3O3OB 3ZWQA 3HBLA 3MFYA 3ZCUA 1K1EA 3EFOB 3RB8A 3OZTA 3ZHXA 4EX7A 3LT4A 4YROA 4FBLA 1P6XA 2HMUA 3B78A 4QC2A 2J0VA 1TVKA 5GM2A 4E2XA 4BXOB 3TAXA 3H83A 1COWD 2VNAA 4LN1A 1OMOA 4Y2GA 2ZYVX 4X6UA 1GHTA 4TL9A 1BD3A 1N2XA 1L5MA 2Q7OE 1PVDA 2DR3A 2F00A 2FZGA 3UJBA 3VOTA 1MGOA 3HJUA 1ZONA 1ORHA 1IAVA 3WL7A 2ES4A 3SHQA 4B45A 2Q1YA 2HNKA 3IV9A 3PD0A 1U28C 4GRDA 4JJAA 5FWYA 5HQ3A 1Y81A 3MN1A 1G5IA 3C74A 4PZ9A 5AIAA 3VZPA 4HRAA 4US1R 3IQZA 1X92A 1DKQA 4NFHA 4Z7QB 5CFZA 2VJKA 4H3HB 2VP0A 4ARAA 5IC6A 4ENQA 5M3BA 3U2QA 4BVJA 5CCEA 4B31A 3T5GA 1UR5A 2LE0A 4LWQA 1KDZA 1P3DA 3PHGA 2YRWA 3HB9A 3NNNA 3PLNA 4O2BA 5CM8B 5EJIA 4D8TA 4PANA 4Q21A 5IZCA 2NAPA 4G9GA 1V2HE 1TA0A 3VDXA 1U0TA 3EOAI 3C24A 4RVDA 1OTYA 3B85A 3GUVA 3W5SA 4CF6A 2NTYC 1KU0A 5C7IO 1SXGA 3DA8A 4R8MA 4PTYA 2Z5VA 1J33A 3EVAA 4FW8A 1U98A 5IH7A 5EIBD 3V7UA 2OBBA 2QTGA 5HX7A 3V7WA 5KOJA 3EAQA 4TXHA 1D5WA 4TMTA 3PPWA 4U2KA 5L3QA 3V8NA 4NHOA 3UJAA 1IPHA 3NZEA 1V45E 2LPMA 3PEEA 2LXNA 3ZJ5A 3SC2B 2CWWA 3O2SB 1XZMA 1P2DA 3V8QA 3W4KA 2ZM6B 3P0RA 4R6XA 3IL2A 3F6PA 3HM9A 4CMHA 4K6OA 4J90A 1WEHA 2PQMA 3AEZA 1U4SA 4ZEXA 1CUSA 1EK1A 1YDWA 3O90A 3O8DA 4M0UA 1QP4A 2B0JA 4R01A 1GXSA 2H8GA 5AW7A 2Q5OA 4H7DA 1JP7A 1U2GA 4RSHA 5LQDA 2N47A 4UUMA 3CR3C 3QLEA 1O5TA 4TL7A 2P79A 3HBAA 4UD2A 3KZOA 1N0HA 2BD0A 1GCAA 4V0RA 2QP4A 2XADA 2HWYA 3C7KA 4Z6KA 3FM9A 5JI3E 1GUBA 1GXSB 1RZ3A 2FR8A 1LPPA 2EKQA 4JSTA 4ETWA 2HHJA 3HCOA 4JLOA 1HX7A 1W0JD 3MIZA 1MAHA 1JNYA 5DKFA 2W6JA 2J4DA 1XQ6A 2P2CA 4J0KA 4AX8A 4V24A 4KXQA 4Q4CA 2VL7A 5ER6A 5K20A 1KTVA 2BTQB 3LYUA 5IUKC 2JPDA 1Q20A 2RH5A 3AZOA 3AI1A 3DD1A 4WVFA 2WYOA 3R9IA 4YUZA 3RYHA 3OCJA 4NZOA 1USUA 1YXMA 1MDBA 3BMOA 3Q1LA 4NATA 1MA3A 2JEOA 3D7MA 4PEVA 3AI2A 1KZ1A 3PHHA 3AVXA 2J46A 1UMCA 1EWKA 3GBPA 5DPMA 2OZEA 2ZE8A 1RWOA 2QTVA 3UJPA 3CVWA 2PBFA 3EQ9A 3HM2A 4H6WA 2JZOA 1NJSA 3MILA 3VH1A 1XZNA 4PSCA 3Q0EA 4OATA 1QMGA 3ADDA 3MWDA 1PNTA 2FW1A 1F6BA 1YC5A 2E4YA 2UYYA 3BXOA 1LX6A 3H17A 1A8HA 1UJNA 4PAOA 4DYDA 1G20B 2J0EA 2JS7A 2PTHA 2W00A 3ZNQA 4MJXA 1KVUA 2N46A 5JISA 1EFUA 4B7AA 1H3FA 3ZE8A 3DDSA 4LHZA 4XASA 3O84A 5H68A 4FMDB 2VPYA 2CHFA 1A76A 2BRUC 4INJA 4A6XA 4F06A 2DQSA 3UHPA 3QEMB 1EHCA 2XGMA 4H16A 1QK3A 3ADOA 3BH6A 4K9KA 5J2TF 3U3ZA 5T8KA 5HYVA 4K1LA 3ST7A 1G5FA 2X9QA 4IO1A 4Q3BA 5F7ZA 2CD9A 4A8HA 5I51A 1H2YA 2JFYA 2CMDA 2O48X 1XA4A 5HKAA 1GL6A 1ZGJA 2XA9A 3TO5A 4E33A 4LZZA 4KBYA 4Z4FA 1Y1RA 3W8EA 1O57A 2HCJB 4GSKA 1NTRA 1C9KA 1G7RA 2Z2XA 4O2AF 3RVQA 4TTTS 2ZUUA 3UOAB 1OI7A 2G1UA 2B9EA 4NECA 3ND5A 3RRFA 3WB2A 3HA7A 3T41A 3U49A 2JGRA 1BQEA 5DM4A 3M1LA 3FMPB 2QZ9A 4Y9DA 1CF2O 2ZRQA 2YHIA 4QRIA 2YX1A 3OTWA 4W82A 5A3SA 1Y1SA 3M6LA 3AUYA 2ECPA 1A8SA 4XVQA 1WSAA 1P7WA 3HDQA 2IJGX 4Y2RA 2R85A 5LOVB 3A0RB 3A10A 1AE1A 4TV8F 3KK0A 2R7MA 1QONA 5LUAA 4AO6A 1J21A 1COWA 1K4YA 2XUKA 3I6MA 4PSUA 4V0QA 3Q41A 5JCJA 2IW3A 3O92A 5CXQA 5LQKA 1REQA 4L4UA 2J45A 4M8KA 1M67A 1O94A 2XYRA 4N3GA 5KNDD 1RWKA 1PNVA 4HH1A 3GRVA 4DR6B 3DH0A 1I7QB 3LGSA 3TSAA 2PCLA 4N0EA 4G0XA 2HTEA 3WO0A 3OPQA 3NU1A 3ASYA 3BWEA 3NALA 4IQ8A 3VPGA 3LBIA 4A92A 5IKXA 4B6EA 2X40A 1WNFA 2FZLA 3MJRA 4EJ6A 2BOVA 3EARA 4LYYA 4YAGA 2RGBA 4E12A 2ZIVB 3DZ8A 4ARZA 2IEZA 3UPUA 5FL7D 5A62A 5MFZA 1J4AA 1E64A 3JQ7B 4J91A 3KZ1E 1X3LA 3R0IA 2GPAA 1DWQA 2WU8A 1A5AB 1FK8A 1Z35A 2XBUA 3LGXA 4YX9A 1YJAA 5U4QA 2V4UA 1JZQA 2IYVA 3EXHA 4KODA 4WDQA 1JJIA 1UMDA 3OJWA 4NSNA 1W35A 4CG1A 4JJEA 4WK4B 1C9YA 2AHOA 3ILHA 1PL8A 1IXKA 1T9AA 3NS7A 4JENA 5CLFA 4EA6A 2P9ZA 3R8CA 3BXEA 2DTXA 3JQ9C 5JALA 2Q6IA 3AVPA 5KHAA 2P30A 1D6MA 3M33A 4FFNA 2ZUEA 3GCZA 2XQKA 3PNLA 2FFRA 2JKVA 3CBGA 1HK7A 1E0JA 1SQFA 3JVIA 3P45A 3GYGA 3KKMA 3ZW9A 3KT0A 1DX4A 1IK4A 3NM6B 3NONA 3WB1A 1AD2A 3JASB 3GCXA 1DC3A 4G8JA 3GPDG 4QSMA 1IK6A 1TJ4A 3HR7A 1XUOA 3D6TB 4X8HA 1B23P 2RJOA 1HEIA 1DAEA 1N9KA 1BXGA 1V8ZA 2WKPA 1T6NA 2HIHA 1WSDA 3N74A 3OQPA 4MUNA 4FSXA 5I4CA 5HKKA 1VLHA 1JBKA 2H18A 1O94C 3GD7A 1QM5A 1V1RB 4B6PA 5EE1A 2I2WA 4GX2A 4JBWA 2ZJ7A 1IG3A 4H35A 3JTMA 3HLYA 3ZV4A 3OE4A 1ETUA 4DPMA 1UJCA 2INGX 3UPDA 5JCJD 5ALIA 1XZGA 4ZN6A 4QDUA 2ZCVA 3IALA 3W9BA 2O2GA 3BRWA 2CE7A 4IV5A 4HNAB 3KYBA 2LNDA 4WXPA 1S96A 2XUFA 3SGLA 5FA8A 4NARA 4URHA 2H1OA 5H8WA 4ISCA 1E4VA 3FBWA 3HGQA 5LZ5A 4JP5A 4OQZA 4UFNA 2WJYA 4H6XA 4BE7B 4LIPD 4EB8A 4UUQA 1DPGA 1VMKA 5JTTA 2IZ5A 1GPLA 3ZOZA 2AE2A 4N7JA 3KKQA 3GRYA 5EWLB 1XLUA 1WZEA 2BHLA 1H1LA 1WD7A 1LW6E 5GONA 3S1SA 5C7OO 3RTAA 3ZLTA 3P8ZA 4QT4A 3QJ5A 2PWZA 5TC4A 1AKUA 5JXIA 1C14A 3RC9A 2FMIA 1BE8A 3VNAA 3F6EX 3O4FA 1DJMA 1CRZA 3LHFA 1NSYA 2YY6A 1EFKA 3E35A 4NCKA 4DQXA 3D2BA 2PKQP 1WL8A 5K3DA 3WMFA 4AK9A 1UM8A 2PT7A 2UV8A 2G1AA 3B7GA 4J4BA 4YO8A 3OM9A 2QTAA 2FSSA 1AS3A 3BDIA 4MYRA 1J0CA 3TRJA 2ZJBA 2JLBA 2PLRA 5JH7A 2ZB3A 1P2TA 3OF5A 1ODTC 4PR0A 3R7NA 1RBYA 2HCBA 3AHJA 3GGGA 4RGYA 4D3XA 2ODEA 2BKAA 3LAWA 2GBLA 4PRLA 4W8GA 2NXEA 4UU1A 4LYAA 1I3NA 4MB2A 3ZIUA 2VWGA 4J7UA 2J5RA 4PGAA 5EUQB 4U02A 3CTMA 4RF4A 3WBKA 5AMXA 1YFZA 3ICWA 3NIDB 3X44A 1VP9A 4BTVA 2PSFA 1YA4A 2WMNB 5E9QA 1KYVA 3ICOA 4HDSB 1WUYA 1MABB 1UXHA 1U0HC 3AF6A 3ZBQA 2JHPA 3FD8A 4UMDA 5FXMA 1SCBA 2B36A 2P9YA 2ST1A 1XDDA 3L8FA 3I05A 3FLEA 4PIPA 1OXMA 4QATA 3L7BA 3UK0A 3TPFA 1NHGA 1L5HB 2H29A 5ITZA 4CKYA 4REMA 1IUOA 2WJPA 1JHRA 4Q3KA 2QRLA 4ALLA 2XB4A 1P2BA 1XHFA 2EKZA 2VT7A 3W5IA 3VGJA 1XEXB 3DC7A 1ISIA 4EECA 2ZIAA 4MCAA 2ETXA 2OZVA 5F7OA 1P4AA 3WDSA 2JAQA 4JI7B 1U0NA 3CLHA 3DB2A 3KKLA 2PGDA 2HF7A 3GLSA 1VE6A 3A1FA 1FJXA 1W5TA 3PNVA 3EC1A 3SY8A 1GZ7A 1PV2A 3ZZTA 3F47A 1ZEJA 1AGXA 4YP0A 5CXUA 4JJFA 4Q48A 1CC1S 3T06B 2VPXA 2EF0A 4PSVA 2ZYUX 4Q4JA 1YT5A 1YL7A 2NT3A 2RJ3A 5EHQA 3UHAA 3EBOA 4CEJB 5JQGB 4ZO6A 1WHTB 4DT1A 5IC5A 2HR1A 3MLAA 3PUYA 2XRMA 5D2CA 3T7IA 5EKSA 4RJJA 4OUDA 4A36A 4GM4A 4M0KA 3W3AA 3LO8A 4FD2A 3F4BA 4JOQA 3TXYA 2GR9A 3FB1A 3RUPA 4G36A 1BMFD 1J0XO 1JU4A 1PSDA 3L0PA 4G01B 2OGUA 1BRTA 2KPOA 3N53A 1H2HA 2B78A 2H5EA 5AICA 5G41A 3T0IA 4G5HA 2N75A 5CD9A 5EJAA 1E7MA 2C2WA 1Y6QA 4NS1A 4DEYA 3EIUA 4IICA 1GNPA 3WXMA 4L8YA 3O82A 5ABPA 4XB6B 1U4OA 5TDHA 1Y7PA 2GN9A 3SHTA 4X71A 3T9BA 1KJZA 4QGAA 1G42A 1KHTA 3IPLA 3P97A 4KVGA 1TO2E 2CVOA 2N42A 5D3QA 4EH1A 2WM2A 4AKEA 4EVSA 4MVJP 1C7RA 1PI3A 3NKFA 4D0NA 5AW5A 1G5PA 3U39A 2GPTA 4GRIA 3OLCX 2GCGA 3QV2A 5C4MA 2CBZA 1O3YA 2XDQB 3H8SA 1U0EA 5EXTA 2HK8A 5ALFA 5CA1A 4PYIA 1CFZA 1VL8A 1SM4A 4PBTA 4TS3A 5IJAA 1WXIA 4CF4A 4WZBA 2IH5A 2HOQA 1B0UA 5ECDA 4BKRA 2AX4A 4OI1A 2AYZA 4X8LA 4H59A 3QWFA 2QM7A 3OKCA 3RFFA 2VR1A 4D4LA 5K6RA 3RF7A 3BWYA 4EEZA 1FNDA 1RWXA 3VU9B 3WIUA 2NTEA 4FB4A 3A4NA 1IN8A 5K8VA 5IVPA 5H9VA 1QO7A 1CCWA 5FPSA 1E66A 1M1UA 2VJOA 5IJZA 1TU4A 3R9XB 1EA7A 1QIFA 4INAA 4Q3NA 4MW5A 4MPDA 1PJ3A 2JDID 4DLNA 4WGFA 1EK6A 1DTWB 1OBOA 1LLUA 1S8NA 2O0KA 2C2MA 4OGGA 4AKIA 3W6NA 1KZ9A 2COEA 2QPTA 3ACDA 4FPXA 3MJCA 1WJGA 5ERXA 1ZRHA 3ABRB 1T0PA 1J97A 4U2BA 4FNGA 1PG0A 4R51A 2WQ7A 4YRDA 2I99A 1Z2EA 1C7EA 3VPSA 1CR4A 4DOMA 5CVJA 4QO7A 1P1HA 1HG1A 1YK1A 1O6CA 1JTFA 3AO0B 3EMKA 3P9IA 4E88A 2I3GA 4ZHQB 1OFVA 5A7FA 3ZLBA 3C3BA 3PVCA 4ZTUB 5KNDH 3PFCA 2DETA 2NPOA 2ZYSA 1ZC3A 2VDMB 1KNXA 2I7TA 1R4ZA 1WMDA 3A3OA 1UDRA 1G9TA 2V7VA 4RZHA 1KBQA 3TVTA 1QP8A 4DJJA 1L7DA 1Z28A 5HUQA 4BLQA 3KKPA 1BGXT 3O95A 3ZS8A 4DMGA 4C05A 3CXRA 3M5PA 4JT2A 3VC7A 2X6RA 1T8TA 2WTNA 4P5EA 5I7FA 5HZKA 5DNDA 3W8RA 4WKNA 1OQAA 1VHWA 3OE7A 2C4VA 5JZVA 3PFKA 3UK7A 4BY9E 2O05A 4AURA 1EGHA 1ODSA 4HAWA 5ALSA 1FS4A 2YXDA 2HBYA 2IL1A 3Q7TA 5LLTA 1OXSC 3K9HA 3Q8KA 5F23A 1K6XA 4D9CA 5KVVA 2DKNA 4KO1S 2G1PA 1JHQA 1J2UA 4FJ0A 4IXWA 1KEWA 3VPAA 4C4YA 2V6IA 2Q3LA 3WE7A 2YOHA 5IT9A 4ZQEA 4N76A 3IP6A 5BSMA 2JGDA 5JWRA 5DSXA 5BSWA 2YWRA 3IAEA 3U4MA 4KDCA 4HNVA 2QLJA 3RLFA 5C3MA 5C34B 4KIGA 3SVZA 1GSIA 1L3BA 3DZFA 1PJTA 1SBCA 1YRBA 1TD1A 2ISSD 3G2OA 5KJEA 4AZSA 2C2OA 1QGZA 3WNZA 3D4PA 1P61B 3DNMA 1A9SA 1FLNA 5HK8A 1WB5A 5DB4A 3OP4A 1W93A 1NU6A 2Y0PA 4OA8A 4WWHA 5CJJA 2VCHA 4P32A 5IAJA 2O8VA 1JRLA 3MUOA 3NHJA 4Z4HA 4W5QA 3EEBA 4HKTA 1VJDA 3F7OA 4IYJA 4AMUA 1ZK1A 3V32A 1KR2A 4XPIB 3T7KA 1P0FA 3MT7A 3T7CA 3PPIA 3PICA 4HL6A 1RKVA 3VNRA 5A7HA 3FX2A 4EAAA 4RLFA 3AK4A 1OYYA 1UJBA 1A5BB 2VDWA 1WDWB 3PTLA 4V3BA 4EYEA 1QOZA 2GKSA 1MC1A 3AUSA 1H69A 4JKYA 8LDHA 3OEEA 2WIKA 2ZTVA 2O7VA 1ITZA 2ESRA 4CT5A 5CDYA 1OBCA 4MIKA 3L4JA 1KMNA 4LXIA 1M8KA 1H4TA 4UCQA 5EVJA 3LWNA 3D3EA 3N6VA 4BQPA 1XF1A 1EFTA 3C5EA 1XXHA 4OUKX 1G5QA 5AUPB 1PL6A 1TB4A 1L8QA 1NVXQ 3M3DA 1M8FA 1TIKA 4EF4A 1JQKA 2VJQA 1WCYA 1XZHA 1O97C 2D2VA 2OXRA 1S7GA 2C5EA 1WF6A 2GNOA 1IDOA 3A11A 1F1BA 1UZNA 3B8HA 3EXIB 3G89A 4PRKA 5FR1A 3G2QA 4B5KA 3T9FA 3T3MB 2WVAA 4G65A 4WX2B 5C8ZA 3VHXA 1UT6A 2ZSFA 4JVMA 4BLPA 3MM4A 1PD0A 2W5UA 5EXXA 4L8FA 3BXXA 5MF6A 2CMKA 4W7IA 5LLSA 1IB0A 4M54A 1I9GA 4E08A 4N48A 2CVQA 5KSYA 2H0AA 4BNDA 6ABPA 2RE8A 3PC2A 4UUBA 3FCSB 3I9JA 3BDAA 3D1VA 3IBTA 3GLGE 5J5CA 4F5WA 4W1SA 3CLKA 1JIQA 1N4DA 4ID9A 3MUNA 1Q7TA 2BMDA 2Z98A 2ZJ8A 5DU2A 1PHRA 3O6VA 3GLGA 2WD7B 4F5YA 5AI4A 2NYVA 4EI8A 2GRJA 5ULLA 4E2FA 4NICA 4Q1VA 4B2YA 4DNQA 3QX3A 4XEUA 3F9RA 4ZVSA 4YRMA 3A1WA 4KITB 3PJRA 1ISRA 1X2EA 3EZ2A 1C8BA 3NVAA 3C3DA 1FYEA 4EYSA 2D74A 3FDXA 2XDWA 3LBYA 3O8BA 4EJ0A 5EP1A 5K0SA 4DM3A 2YHBA 1WDLA 4YRZA 4IKPA 4IIFA 4FFWA 2WJIA 3HR8A 3PXAA 4TX1A 4HNTA 2JFZA 4C22A 1FCJA 1KZ6A 5L3RA 4JQYA 2PX8A 1OI4A 1ND5A 3NHYA 4RH0A 4FOTA 4P0TA 2CNLA 1A8QA 4RJTA 4L0QA 5DNEA 1J8YF 1CYEA 4RDXA 4GZ6A 2IU6A 4WKGA 5G40A 5BMVA 2AZMA 1RYYA 2GKGA 5LOVF 3RTCA 4YQZA 3W7BA 2G70A 3CF0A 2BGJA 3AZQA 5CGQB 4TTQA 3E4DA 4QTZA 3V6LA 3H75A 4IIYA 3DBIA 3ONWA 1F0YA 3OQIB 4KW7A 2XD4A 5CIWA 4CRWB 1NSTA 1X7DA 1FVFA 1TLTA 1U7ZA 4P9NA 2OO5A 1CF4A 4FD3A 3WZMA 5FF9A 3M83A 1GV0A 5CHEA 3S2IA 4DMMA 2CXUA 1RE1A 3EGIA 3I8SA 1CS4C 2E3JA 2IT1A 1KH1A 1KI2A 2QD3A 1MUUA 4P5PA 4XYLA 4DJFC 2W2NA 3CF2A 3G6WA 2DHQA 3HC7A 3BCHA 2BFNA 1K4KA 1NVTA 4IIHA 3PUHA 1ORDA 3ORHA 4UHBA 5A4KA 2WDZA 4AZ3A 4D98A 2PGJA 3JQ8A 3B6MA 1O4WA 1SCUB 3GJYA 2IV2X 4GLOA 2NQ8A 5A04A 1FX0B 2IU0A 2AOVA 3CW8X 5CAEA 1K89A 3PG5A 1GTZA 3T5CA 5GVSA 1QKKA 4NU8X 4MKGA 3AGQA 3LX4A 5J3JA 1Y3DE 1WUJS 4MB6A 3ZW8A 4GMGA 4YPOA 3K0SA 1V8BA 2IYEA 2VYVA 5HDBB 4YRTA 5FYDA 1IJKA 5G0VA 5BSRA 4COOA 4F6LA 5L6LB 5E3JA 1TM1E 4HDMB 5J2UF 2IIQA 2JHCA 2XB9A 3OCVA 4QGFA 5LDHA 1LY1A 2PX2A 4P7JA 3WBFA 4EY8A 1YHYA 5TPZA 2GTHA 3EULA 4GX1A 5HKBA 3G1UA 3X1DA 1CHNA 1V71A 5KDOA 5EWJB 4KLZA 2NOAA 1M1ZA 3DULA 3L46A 3IAHA 3L77A 3QP9A 4BFYA 1EIWA 3TCXB 2VAVA 2WYHA 1A9OA 1HLGA 2ZUVA 3CO5A 2L17A 2QIOA 3F5DA 2GPWA 6REQA 2PLAA 1FU8A 4LJRA 5CA1F 1EDBA 4BMOB 1E58A 1TZJA 4HUQA 3MB8A 1AQ6A 1TJ3A 3QQ5A 2QUBA 4C06A 3MAGA 4DLTA 4FGUA 4R5HA 1Y5NA 2H4JA 2C20A 3C3JA 3PRJA 1K4MA 4JJIA 4R1OA 3FPGA 2KLBA 2FUEA 3NORA 3HKBB 1GSAA 4IJQA 5K3CA 4X0EA 4AG5A 4H9GA 1CRLA 1GPYA 4BZQA 3JQCA 5JATA 1PT6A 1DRKA 4P2GA 4M0PA 1GYQA 1JVNA 2ZAYA 3EQ7A 4MDYA 2WUEA 4AMGA 4DV4B 2FJ0A 3DTVA 4MICA 3KJXA 3DZIA 4X7MA 5AKLA 5A71A 4GLLA 3ZVRA 4C21A 3E8MA 3IYLW 1F20A 3NOQA 4F71A 3B5IA 3EXFA 1E98A 4Z51A 5KTMA 1F0KA 4MDHA 3NTRA 4DTCA 4E22A 4ZMBA 3VPCA 5C5CA 1G0NA 1GKKA 4OCZA 3WLSA 4O6VA 1MZVA 3CEMA 1T2DA 2CYCA 2E4VA 3SS9X 3QGMA 4UZFA 2WWXA 2ZU0C 2CXXA 4MRRA 3DPIA 5EGNA 3OM8A 4IZHA 1J8QA 4JBIA 1O96B 4N9WA 3E5NA 1TJPB 1UP4A 1XZKA 2Q2OA 2EW1A 2QN7A 2Y76A 4JWTA 5EL0A 2NWQA 5LZ7A 5LMNB 3NTUA 1XTTA 1XZCA 2REQB 2VG8A 2D6FA 1HA3A 3NH9A 3WLLA 4RMHA 3WOVA 1W4CA 4ZI7A 3BMQB 1QRAA 2ZG6A 3EGDA 3LPAA 1QP7A 1CHDA 2ZSIA 1UFVA 1ZM3A 1E59A 3JCZA 5EZQA 4XIJA 1OASA 1XDZA 3GPCA 1QHEA 2F3TA 2P9EA 4DR1B 3V97A 1HL3A 3LLCA 3IJRA 5JROA 1GKYA 5TPZD 4PYRA 3AI7A 2P65A 1SCAA 2VPTA 3AHDA 2KBFA 3IHWA 5GQSA 3BWDD 3UTCA 5GJBA 1IM2A 2G7ZA 1QZZA 2VSNA 3KXLA 2VDNB 4ALJA 2AMFA 3GR6A 4ZT2A 3OAAA 2PSDA 2RGWA 1YTLA 2EATA 3N05A 3UK1A 5DLQC 4B4OA 3I4FA 3OKFA 1DC4A 5JZSA 1K98A 4MUXA 4S2UA 4N40A 4DM4A 3G0HA 1YDHA 4HP8A 5EQJB 1M2GA 4U2FA 2J3QA 2QYHA 3AEQA 3U3XA 3KOUA 1VM6A 4B84A 2R79A 3H1EA 4LYGA 4PQEA 4RZUA 2ZBVA 3UA4A 3UT6A 5AM2A 1N3LA 1EQAA 3IQWA 2CFIA 1ENYA 1QGOA 4RDCA 5THKA 4UEWA 2Q1TA 1OYWA 5L7WA 3DKVA 1D9XA 4V0OA 3JY6A 2QBYA 1RVV1 4HX2A 2H48A 5K3FB 2C99A 3LE8A 3R0ZA 4HNUA 2AJBA 1FRQA 3QVOA 4PZDA 2A94A 5ILGA 1W34A 4NR0A 1G6OA 3UAZA 3BQNB 3DE6X 1LI4A 4JJ4A 4AXXA 4B81A 1GRCA 2LWIA 4NBSA 1WCV1 4Q4HA 5FPHA 1XRPA 4PF1A 4FEAA 1UC4B 3CNEA 3UCFA 4EI7A 1IQ0A 1KYXA 3BMNB 3FJ1A 1MG0A 1VYHA 1BGWA 4K87A 5FL7A 1EB9A 3PQ4A 1KY2A 2V0CA 3DW1X 4K9SA 4KAXA 1JQBA 4L3VA 4ON9A 2CHGA 1DRVA 1GZDA 1I4OA 1LC0A 1T4MA 2PDAA 5AHWA 4JI3B 1N2JA 4WTOA 2ZRAA 1ZL0A 3L9WA 2JAHA 1HDGO 5JYDA 2VT6A 3FLAA 4ISBA 4P08A 5KOYA 3VVMA 2VJNA 3L4EA 3QWHA 2FZWA 4KIWA 3S27A 5IK2D 4JJ8A 2A5FA 1KMIY 3C3KA 3GQVA 3TMKA 2PZAA 5CG1A 5JRZA 4WN9A 3WSWA 2QRJA 3NBZC 2H54A 4ZMRA 5JASA 1G66A 3IJEB 3ZZ0A 3O9VA 2YR0A 1H1DA 1ZA1A 5EHGA 4I14A 1LQTA 3ZC3A 1PWXA 3Q7PA 4PZEA 3ZKWB 5LLDA 5E8RA 2CT8A